1CF8H

Convergence of catalytic antibody and terpene cyclase mechanisms: polyene cyclization directed by carbocation-pi interactions
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
218
Chain Sequence
b'DVQLQESGPGLVKPSQSLSLTCTVTGYSITSGYAWNWIRQFPGNKLEWMGYIRYSGDTRYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAIGYGNSDYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHAFPALLQSDLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPKDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CATALYTIC ANTIBODY 19A4 (LIGHT CHAIN))
molecule tags Catalytic antibody
publication title Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
pubmed doi rcsb
total genus 43
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cf8H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cf8H01
2OSLB 4U3HA 5JW3H 3DVGA 5F8RC 5ACZB 4ZUTA 4WO4A 4JFZH 1J0YA 2ID5A 1CBVH 1KIPA 1CT8A 1Q9KA 2ATPB 5JIIA 4NC2B 1JGVH 1T21A 4L8BA 5IK3A 3VG9B 2DTSA 4YBQD 3HNVL 1PYWA 1T7XA 4N0UA 1Z2KA 4XX1E 5I19H 4PD4K 5DI8A 1NLDL 1CIDA 2COQA 3U9UB 3BGAA 3O6LH 3TVMB 3V4UL 3IFPB 2UWEE 2P5WD 3PWNB 4JZNA 4UU9B 5CEXB 2E7HA 1A8JH 3QO1A 5DJDA 5D7KE 1A6PA 4JFHD 4ZYKB 3WFHA 3NZ8B 2VXTL 5TF1L 1GRWA 1I8IA 2Y5EA 2ITDB 3CFCL 3MGAA 4JFQB 3BDXA 4NQEA 2VZ1A 2GHWB 1EZVX 3G6DL 4UV7H 3TNNA 2GTWB 3OX8B 3MLTA 4JO3L 3U9UA 3C8KA 4JY4B 5FUOL 5DJ6B 2YPLB 1R3JB 4WFHD 5I1IL 2CH8A 2GKIA 4R4NC 1AD0B 1AGCB 2X1PA 3QUYD 3U46A 4G6KL 1KEMH 4BFGA 2DF3A 1AQKL 3C8KB 4JY4A 3PG2A 1Q9KB 2ATPA 1IBGL 3NN8B 3GI8H 5AD0A 1NEZB 1HNFA 1EDQA 1IGTA 4RNRB 1TQCB 4PJDA 4L4TB 2R1XB 5J9PA 4JKWA 5D1ZA 1J1OH 5JW4R 2DBJA 4IIQB 4FNLL 3D6GA 3TYFB 1WLHA 3HE6A 4OF3A 1FNGB 3L3HA 2YK1L 4X99B 1EIBA 3F7VB 3IU3B 4KJPD 2GUOB 1A4JB 3MBED 3T4AB 5MEND 1NCBL 1LEIA 5GGRY 2ZCLH 1UWGL 2Z9TA 1OGAD 3BN3B 5TF0A 4P2OA 1YY9D 3D2UB 3HNTL 4GMTL 4FTVB 1BEYL 5CBAB 1UM5H 1GHFH 1RZJH 4WW2A 1OPGL 4TSBL 5BS0A 3HPJB 4BK4A 3U1SL 4PJXA 4UIMB 2XA8H 4W68A 1NC4A 4HWEH 1U8IB 3GBML 1NDMA 5CD5D 5DTFA 1T1ZB 3BP5B 5GXBB 1XIWB 4S1QL 4LIQH 1WC7A 5L8JB 1CXHA 4K7FA 1UQSA 1ZA3A 1IAOB 4K23L 2CUMA 1T20A 3S97C 1WSST 3ULSB 2XTJD 3C5ZD 4K07A 1NUDA 3F7PC 2VR4A 3OXRB 1TZIB 2AQ1A 4OM1L 5E8PB 1AY1H 1ZE3C 1XGRB 5FYKU 5FECA 3WDHA 1FRGL 3O2DA 4I3RL 3WNKA 1PLGL 4ZUVB 2NY5C 5MENB 3BKCL 3S6CA 4ENEC 4XVSH 7FABH 3FHAA 1OAKH 3CVHB 3O4OC 1MFDL 3MJ9H 4W4OC 2W9EH 3TN0C 5IROA 4XNYH 3I75A 4D0DB 5C9JA 5JPNA 1M1SA 3TN0B 1JFQL 2NY1D 3WMSA 4TSBH 3H0TB 5MEQB 4XNUH 4RX4A 3RUGE 2YD6A 3MRNA 1HQ4A 4YE4L 2XN9A 4NHUB 5T3XE 4M7JL 5FGCB 2KPNA 4ZPTB 2FATH 2G5BB 4WW2B 4JFDB 1IAKA 2NY7H 3MXVL 4R97C 4MSWB 5BXFA 3FJTA 3QDJE 4I48A 1FFRA 4P23A 2D0FA 5IP4A 2BY3A 4HGMA 5KVMC 4QRPE 1HDMA 1VFBB 5JHLL 5JO5A 1U91A 3DX9A 1QA9A 2Y6SC 5CILL 5D7JC 5T3XD 2VLLB 3JTTB 1X6LA 2GUOA 1T7YA 1LNUB 3MNVB 4KRMB 5IJVB 5IIEA 1ZVSB 4NN6B 2G75B 4NJAL 3VXTB 2R4RH 2JJSC 4XPAL 5FYKH 3I3DA 1X5XA 1KJMB 2QQNH 4QY8B 3IDMB 3K74B 2XFXB 4JPVL 1FCGA 2X1WL 2Z8SA 2P4AB 2J6EA 4CU6A 2J6EH 4JM4L 2APBA 2NY2C 3MRRB 1TQBC 4XBPA 1DP0A 3VXMB 1OQOA 4TRPL 1TMCB 4M1CD 3ZE2F 5DRWA 1CGUA 1R3KB 1KIRB 1LP9E 2APWA 2G2RA 2NX5A 3GMRA 1MVFA 2DMCA 2X4UA 1L9NA 4P3CH 5SWZB 4NQTA 4Y5YA 1BF8A 3GKWH 5A40E 3QUKB 4F7EA 2L7UA 5J7CC 4NO5A 3NAAH 4X5WA 2WWMC 3GIVA 4Y4HB 1I8MA 1JHTA 3E8UL 1WT5C 1XGYL 3KG5A 1ITBB 2CIKB 5FO7B 3MRLB 1JGEB 4FRWA 2K7QA 3SJVB 1OWWA 4ZODA 3VH8A 1KB5L 3O4LB 1S78D 5HI4D 3RWGB 2WIIA 2DD8H 2GITA 3FZUD 4HJJL 2FX9H 3ZKNC 1RHHA 5I15L 2WUBH 1BGXL 5LBSH 3WS3B 1J1PL 1GAFH 2HWZH 1N59A 4PJGE 4G6AD 4S1RH 3T77A 4LKXA 3W9DB 4ACPA 2AKRB 4DVRH 2DS4A 2AI0L 3RUGF 1UEMA 4BQ9A 9CGTA 3RY4A 5CGYD 1G7MA 5TH2A 2DL9A 4U1SA 1ED3A 3EDKA 4KRPB 4DUXA 2VH5L 3NN8A 5DD5H 1QR1B 1UGNA 4AK1A 1RZJL 1DTUA 3QIWB 4D9RE 1UG9A 4NKIL 5FXCH 3HC0B 5C08D 1L7IL 1RHHB 3DVIA 2XWTA 5D6CB 3WIIL 5CEXA 3PDGA 4P46A 5JNYA 2FIRT 5JO5B 3QA3A 3D39A 5C0BB 4HV8A 3V95A 1NCBH 1TITA 4F58L 3QH3A 4NWUH 1V7NH 4ODSH 5E24E 2VL5A 2PXYA 2WWKO 4QNPE 2NY6D 4OZHF 3V6FB 4K9EH 1I8IB 1ZHNB 5C08E 4EUPB 4QXTA 2LTQC 2E9JA 2DKMA 3B9EA 5GSRB 2DKSA 1QRNB 4Y1AA 3MCKB 5I1GL 5BZWB 2BXYA 3HI5H 2HLAA 4YWGL 1XH3A 1ZHNA 5AZ2H 3MLUH 3UTSD 1EBAA 1A47A 5LGJA 4TUKL 3CH8A 3TYGL 2ADFH 2UVFA 1ERNA 4DW2L 1IM3B 1CFQB 4PJIB 3TT3L 4HKJB 4WFED 3G08B 5J56B 4RGOL 3QBTB 3OKEA 3SE3C 4YGAB 3OPZH 5B3NA 4ZUUA 5HI3C 2GJ6A 3IVKB 3UTSE 3GMLB 4JCMA 1WFNA 1AR1D 4TUJB 2FEEI 1XR8A 2C26A 4I18B 4P2CG 1X5JA 1CD9B 2W92A 4Y4FC 1PFCA 2W91A 4OF8A 1QUNA 5HI3D 1Q9OB 3RWGA 5I30H 5E70A 5F96L 3DUSB 5HGHA 4D9LH 3RGVC 3HUJF 4TTDD 5GZOD 2DLHA 1KXVC 1JYWA 1RUQH 3UZQA 5IOPB 1RI8A 3OTTA 1CXKA 3RKPA 3KVQA 3VFNA 4DZ8B 4PJFE 4L4JA 2PW2A 4KVCL 3RGVD 3IT8D 5HPOA 5GGRA 1JWMB 1I7ZB 1HYRC 5I1GH 4PJHA 3Q6FB 4P46C 1CU4H 3VI3F 2X2YA 1JRHI 1C5DB 4FXGB 2OL3A 3TV3H 3DROA 1HH9A 4YIQA 3GMQB 1KELL 3EYOA 5F88B 2VXQL 4U6YA 1D5BB 4YPGB 4LSQL 1B9ZA 5GS2H 5B3JE 3DSFH 1I3GL 1LNUA 5JW5B 4M02A 4PIRF 3MUGA 3SPVB 1F4XH 1AO7B 4N0UE 3BSZL 2X89A 3CNKA 4JFEB 1C16B 1SJEB 1QKZL 3FAXA 2IALB 3E3QE 1TQBB 2D03H 3OG4B 2R9HD 1CDHA 3WLBA 4RA0C 2J3SA 2DBLL 3AREC 3ARRA 4K71C 4DKEH 4DTGL 4LSSH 1K3IA 1OPGH 4TNVF 2N56A 3HB3D 1KCLA 1QD0A 4L3EE 2AI0H 3LKOB 2X42A 4YDVB 4N0RA 1FVCA 2E6QA 5JW5A 3L3KA 2F8XC 1Q1JH 2XZZA 5DJYB 4MSWA 3IFOB 3QG6B 5IR1A 3DJ9A 4UINH 2EE9A 5TDNA 1FVEA 1RFDL 4GKZB 4J3OC 2GY5A 4KDTA 4O51A 3H3BC 1KTLA 4QHLA 3T0ED 3CFIC 3GMPA 4NFCA 3WCYA 1AH1A 2GK0A 2L4OA 5CZVH 3MFGB 1GSMA 2FLRT 3E8UH 2EXYD 3DETD 4K8RH 4ZPVB 3C09B 4YBLB 4WGVB 4CN1A 4GRLA 4LLYA 4JM2B 4G8GE 4ODUB 2E7LC 2OM5A 5IW6A 5IMLB 5HHPA 5D2LA 3CVIH 4RWYL 5C2BL 2EH7L 4QXWA 3IDJA 4YGVA 4D0CA 3H9YA 4BZ1H 2QHLA 4EI5D 2GAZB 4IOIA 3HPLA 3MREB 4NKMB 2HKHL 5J6HA 1KPUA 3ME0A 1MHEB 3G6DH 3MXWH 5DK0B 1NGWB 5F72S 3GMNA 4MAYD 3FB6A 4OZFA 4PTUB 3ZDZF 1J87A 4KKBD 4KUZH 4CJ1A 5L88H 1DBAL 1V7MH 4QHUA 4RIRB 1ES0B 1U3HD 3D3VB 3MOBL 5JHLH 4R26L 2VQ1B 5CCKL 4NYLA 2WAHA 3KNBB 4BELD 2APTA 4D94A 4LF3A 1F4YL 4R4ND 1PBYA 4ERSH 3VXQB 3BIKB 1EGJL 3LV3B 2ZOLA 1QPPA 2BVOA 2UZXB 4Z7OF 3Q5YA 2KZWA 4TULH 4P57A 4Q6IB 1MF2H 2I07B 5D7SH 3P77A 3LN4A 4ZO8A 1D6EB 1YJDL 1CICB 5FV1L 5CJ5A 4EIGB 4XP1L 3ZE1E 1KIPB 1WFUA 3MGTA 1R3LB 4LVHB 5E5RB 5MEOA 1MLCA 4FQ2H 5C07D 5ITBL 5F1OB 1NMAH 3MJGX 1YN7A 1H8SA 4X5WB 1B4JH 1U0QA 4WWKD 5DJZB 4Z7OE 5E2WL 4LL9A 4LCWB 25C8L 1R3IH 2F53D 1DBJL 1KLGB 1GGBH 5DVMA 2X4SB 4R90H 3OR7B 2A83B 4QOKA 4XMLL 3O11A 3I3EA 5EU7E 3EO9H 2AJYH 2IBBA 2AK4A 1EFXD 1DE4A 3TM6A 1I1AD 1JWUA 4FXKA 1MRDH 1BWWA 3L5JA 1D5ZA 3SKUD 4XNQB 1TCMA 3GFUA 4HDIB 1UM4L 1I9RL 1CXLA 3OKKA 2GJ6E 3QI9D 5IMOB 3NA4A 4L8CA 3CX5K 5T3XL 4XH2B 4ORGA 1PDKA 2HFGL 3D48R 2H6PB 2XICA 4JPIB 1UWGH 4NO0A 4NO0D 1NFIA 4H1LH 1PQZB 4GMSL 2R0KH 3T65B 3ZKMD 3IKCA 1HI6A 1ZT4B 3MLZL 3U2SA 3D2UD 5D7IB 4NRYA 4WI6A 3WFBH 4WI9A 5FHAL 5J0BA 1G6RB 5C0DA 1G7IB 4LSQH 2QJDA 4XMKL 3NCJL 3QEQA 4H8WC 1ZKAA 3FRUA 1U8MA 2YK1H 2AGJL 1OHQA 1NJ9B 3SDDD 5HGHB 1T04B 2IADA 2H2PD 3QUMA 5C8JB 3LH2L 3OJMB 4P3DB 4QOKD 1CQYA 4KV5E 4G8IA 3CLFH 5HYQA 3HC4L 1RUMH 2KBGA 1XF2B 3FO0H 4JKPL 2X4UB 5HBBA 5AUMA 3V4PL 4Z7UF 3QXAB 4XC3H 4X0KB 1SJHB 4M62L 1DUYA 1NUGA 4IDLA 4JVWA 2MFNA 2NY5L 1D6VH 2DM3A 4KFZC 3X17A 3L1OL 3BUTA 3WIFA 1KN4H 4NQCB 4OZIA 1CFSB 1CGXA 1FIEA 3DGGA 4D9QE 1E4KA 2X7LA 4PGEB 5GSVA 4XBGB 1AE6H 2VDRL 5IJVA 4PJBF 2HVJB 1CR9L 1MAKA 4GS7B 2DN7A 2PYED 1K4CB 3N9GH 2G5RA 2MJWA 4F7CB 1WBXA 2C3GA 3QCUL 4OCXH 4AG4L 1NBQA 2F19H 3WEXB 3BVNA 3RKDC 4DJMA 3I50L 5D7IF 2EE6A 5C09A 5HXMA 1G7LB 4PGJA 3EOAA 4YHYB 2R8SL 4F58H 5I19L 1FO0L 1XF4B 5EU7C 3U6RA 5KTEL 4QCIA 1NANH 3WEXA 1QLFB 1U3HA 2QHRH 5HVGB 2DQCH 2RBLA 1F3DH 3NTCL 4I9WE 3NPZB 4Z7UE 4P5TC 2XZCH 4GKSA 1G0YR 1KCUH 1S5IH 4MAYA 3MLRL 4PR5A 4QT5A 3OAZK 3GIZL 1IAMA 3GSNB 1SY6A 1OTSC 3KXFB 4CU7A 4IIQA 1F3JA 2XQYK 3H3KA 3RBGA 2XN9B 1T2QL 1T03L 5I9QC 5DVLA 3TBVA 1CFSA 5IHZB 3K1KC 1J5OH 2XNAB 3OKOB 4MXVE 3V6ZB 5EG6C 3S3PA 4MDIB 1TZIA 2GSIB 1OP3K 3SGKA 1N5AB 2R56H 4H5SA 4TVPL 1FFQA 4GRLD 3LRHA 3TBSA 32C2B 1XH3B 1R5IB 2EIZA 1QQDA 4BYHA 3EO1A 2A83A 4DK6A 1I3GH 5IM7A 3TT1H 4NKIH 3VXSA 2DQJH 5KBNC 2WBJC 2QSVA 3D39E 2EYSB 4HC1L 2WIIB 3M17A 1HILB 3FT2A 5IEKB 4R9HA 3L3IB 4WJ5A 3V6FA 1MLBA 1MCWM 1E28B 4KGJA 4M03A 5IB4A 4S0TD 1T0MA 3CDFA 3ULVC 4Y2OA 1CFNA 3QIBB 1NSNL 2ED9A 3U4AA 6FABH 3W11D 1R3LA 1DQDL 4P46B 1S5IL 3MRFB 2NQCA 3JUZA 1FG2B 1A7PH 3MACL 3F7YA 5DGRA 5FK9A 3GSRB 4NQDB 1MF2L 1S7XB 2DQCL 3I85A 3K3QA 3GMRB 4RISH 4ZS6C 1Q0XH 2MQCA 4M6AA 4CVXB 4PY7B 4FQJH 4BH7A 4K94H 5HVFB 4FP8H 5DWUL 4RZCA 4ZUSA 1DR9A 3VE0A 4Z7VF 1UH2A 3WJLA 4U6HA 3VFWA 4TTGA 2BNRA 3W0WE 5BJTA 4NYLB 1RV6X 1CG9B 3OR7A 2J8UF 2XQBH 1FCCA 3X3GL 1RIVL 4U6VH 4OI9A 4PJEB 4Y4FB 3VGAB 1I7ZA 4JEGB 5HVHC 2B0SH 1DZBA 3NPSC 3DX7A 3LD8C 4PG2A 1XMWA 3QUZC 5GRWA 5C86A 4ZOBA 2W9LA 1WJ3A 1AQDB 3GBNL 5D6DC 3S88L 1J0JA 4LPXA 3V4PH 3VE0B 5TE7L 3S96B 3IFLL 5SWQB 4XXCA 5F7YC 2R4RL 1Q9OA 1SJVA 4KKCD 4FFVC 4KTYA 1SM3H 3SE8L 3MRPA 1KN2H 3OKLA 1AXSA 4ZAKC 3VA2C 4ZAKA 1A2YA 4MD0A 3NH7H 1QFHA 4Q97A 3BAEL 3RGVA 5HYJE 2E27L 3BEWA 2A38A 2BY1A 4OCRH 3K8LA 4EDWH 4ZQKA 4PRPB 3DMMD 5GS0C 5J8OA 4E0RA 2NY4C 1I9JL 3G08A 2JB6A 3HG1D 3C6LD 4TPRH 2BVOB 1OVZA 3VXUD 1JCKA 2BRQA 2HTKD 4YHYC 3NIDF 2NTFB 4K23H 3TC9A 5H37G 1KJ2H 4KXZH 2VXSH 2B1HL 3QXTA 2NR6C 5FV2A 3PHOB 2WANA 3VXPB 2V9QA 3CFDB 2VE6A 4H25A 1NGYA 4QTIL 5T3XH 2YUWA 4ZFFB 1JV5A 5ILTH 2DLEA 1OQXA 5KVGL 3BGMA 5E8EA 1BZ7A 4BQ6A 7FABL 4JDVA 5CIPB 4OFYD 4B7LA 2P8LA 1J9CT 2UYLB 2W65B 2JIXD 4NCDA 3MV7E 3HE7A 2ZG3A 2Q7NA 2Z93A 1P7KA 3M8OL 3NCBB 5EBWB 3IETA 4F7CA 3WDIA 2VOTA 4IOSD 2W9DL 3MLYH 5I0DA 4X4XA 1OCWH 2FJFB 1BJ1H 4LLYB 4UTBH 2JCCB 3PL6C 4NKDA 2H41A 5ESQB 2IEPA 5E99L 1IGIH 5LQBL 1T83C 3LZFL 1ACZA 5I8CB 5HYQB 2JE8A 5L8KB 3MLPA 2GK2A 3I84A 1YNTA 3FQWA 1DSFL 5CMAA 4KI5C 4S10A 2VWEE 4U1IA 1P4BH 4POZD 3N1PC 1B2WL 2H8PA 3IDYC 4TQEH 1EX0A 5IHBA 1F90H 4GOSA 3U0PA 2BSSA 2P5ED 3SY0B 2R29H 4MCYB 2NW2A 2AXFB 3V5KB 1L7TH 3JV0A 3U7YL 4NNXB 5HHME 4NJAH 3TNNB 1G7IA 4HIHB 4HZAA 1I1YB 3R8BB 3LKRA 4YBQC 5BO1L 3OAYK 2Y06H 1OTUD 3WKNA 5IGXL 2HT4D 2VRAA 3VXMD 1IBGH 4WEMB 4KUZL 2OXGA 1W0VA 1PKQB 4JO4H 2IQ9H 3EGSA 1EEYA 4M7ZC 5E2TL 2A73A 4LSVH 3Q6GH 4ETQB 4MAYC 1I3UA 4UBDC 3UPAA 3BP7B 5I8CA 4IMKA 3TBYA 2VYRE 3FO9A 3CZJA 3ZMRA 5CWSA 1DQJA 2AQ3A 5A16A 3UDWA 2D0HA 2F8VA 1KCSH 1FYTE 3QA3B 5BRZD 1D5MB 3GGWA 1GZPB 2H2SC 2YSSB 1N6QL 2NX5D 3IDNB 3OJDB 4X6DE 1I1AC 2OMBA 3VGBA 1DBKH 3FQRB 2VLME 4M00A 5DSCB 3RX8A 1XR9B 4GUPA 3F58H 2UV3A 3ZT6A 1R3JA 2GT9B 2YEZA 2P48B 4KK6D 3BHBB 4XRCA 3PHQA 2PYFA 1OGTA 4XPBL 4LIQE 1OCWL 5A3IC 2A74B 2APFA 5IVOA 4RAVA 5D1QD 3RNKA 1OAXL 1N2RB 4AM0A 4MJ5B 3X11B 1R0AL 1MJ7L 1AGEB 1ZWIB 4DOHE 3PHOA 4NQUA 4B7IA 4MA1C 1XF3B 4OGXH 3ZYZA 3Q3GB 5B8CB 4PUBH 4M6MH 4Y16D 1PG7W 1I7RA 2AEQL 3O8XA 3SE9H 3NCYP 2A6IB 3MRFA 4P3WA 5JHDE 3BKJL 5IEHA 1HCFX 3GMLA 4F7MB 3MRJA 4XBEL 1XGRA 1KULA 4EBQH 2M26A 3S5LB 1WTGT 1YDPB 1ZT1A 2Y7QA 1RZFL 3VXQA 2GFBB 4UQ3B 2ZCLL 3KLSA 4M4RA 4HIEA 1AHWA 4JHZA 4WI8A 4YHZH 3MROA 5GS0L 4UI2A 3HZYA 4ZNEA 4I8DA 5KSUA 4PJAB 2AJSH 3FQUA 1TENA 1DBKL 2ENYA 1RQ5A 3LQAH 1U8IA 3ILQD 5F71A 2WV3A 1W0WB 3VW3L 1BOYA 4HIEB 1JHLH 4JJHA 4KQ4L 3C09C 4YBLC 4ZPVA 2ZUWA 3O3UN 3RUGA 5K9QI 5ISZB 4X7FC 1BX2B 3FOLA 5CS7A 1EFXB 2ICWJ 1OP3H 1QLEH 2DQEH 1MFCH 4R0LC 1IZKA 1WGOA 2VLJB 3P4NB 5DRNA 5F70A 3BP4B 4WW1A 2FX7L 3SBWA 3ARSA 5CEYB 4ZG1A 3L5WA 1F00I 5C07E 4PJGF 3D5OF 2HRPH 3UJJL 3JTTA 4IMKC 4NQDA 4F15C 1MCPL 1VERA 5I1KL 1FYTB 4Y8DC 4YK4B 5EDXA 2A9NH 2EDQA 3T3MF 4AYFA 4RZCB 5I18L 4XMPL 3KYOB 2Y72A 4R8WH 1TNMA 3IDMA 3RY6C 1FYTA 2JCCE 4DGVL 1OL0A 3FRPG 1X5HA 4JB9H 4OKVB 2J5LB 2QLVB 4OFKA 3J8F7 3U7YH 1KNOB 1CT8B 3N1MC 1OWRM 4GKSB 4Q0XH 2YKLL 3BH8B 4JN2A 2QSCH 5B38G 4H88H 4ZSOE 2DQGL 3DBXB 4PRIB 5IB2A 4LVNC 4JFXA 4X7TB 5GSVB 3TBYB 5J6HB 5HHQB 3UCRA 4P5TD 2EO9A 4XCEB 1AFVH 3OL2A 5GGUB 1KXQE 5EIIB 2BRRL 1QFWM 4Y89A 4Y4KD 4AT6B 1NCNA 2MKLC 5EU4A 5DRXB 2VR9A 1R3KA 2NX5B 4DAGH 4P49A 5ANMA 3HI5L 5F97E 3QUYA 5BV7L 2HFFA 3B2VH 4EVNB 1G0DA 5JW3L 2D31B 3G5ZB 4OZGF 2GK0B 4F33B 3U6RB 1F3JB 2O93L 12E8L 5CBEA 2BNQE 5GS1A 2HG5A 4MS8C 3TBVB 2DIAA 5DT1H 5IHUH 5E00A 4CN6A 2Y5TA 1UXSB 5L0QB 2QSTA 4MMXC 5MERA 2ZCKH 5FYJL 2MCG1 3PABB 2IF7A 2X6MA 3L7EA 4J4PC 1T6WA 5DQDL 4F7TB 3K1DA 4OLVL 4LCCC 3QZWG 1CDYA 3D0LA 3JWNC 5CINL 1XF4A 4NO3A 3VXPA 3BO8A 5CD5C 1A7RH 4U7MA 2N4IA 1EXUB 2EIEA 4YHNB 5I2IB 5ANME 5JLZB 2HG5B 4OZIB 1XIWD 2BMKB 3QXWA 4RBPK 5FM4A 1HNGA 4M7ZB 1EEUA 2FX9L 4LAQL 2WW8A 4ONGL 3EJJX 1IKFH 3DVNB 4XBGA 1Y6MR 1K8DB 4Z9KB 3RPIA 4N1HB 3S36L 3DYMA 4QXUH 4P3DA 4DK3A 3E0GA 4CW1A 2WINA 1AGBB 5EA0H 2XG5A 1G9EA 3ZDYE 5C0IB 5HHXH 2NR6D 2X40A 1SEQL 3ZT5A 5F3BB 4MJ2A 5SWQA 5IG7B 1KJ3H 5CJOL 4AENB 2F53B 3MV01 5MEPB 5I1EL 4LCWD 5T1MB 4WIQA 4P3CL 3RVXC 1WC7B 4L4TA 1A0QH 4HV8B 3WIHA 2DQIL 3DARA 1ZA3B 4XCNB 4NC1C 3KPOA 4X9HA 5GRUH 4QWWD 5DA0B 5IFJA 5CUSH 3RWCB 4K3DL 5DRXA 2V2XA 5F7DA 1MRCH 3PWUB 2FJGA 5F1SA 3IDGA 5L2JB 5ITFA 1Q72H 1YY8A 4YK4C 4J3VA 4OFIA 5EFIB 4JAMA 5F6IB 2V7NA 4S0SD 2YPLD 1WEJL 1QRKA 4MJIA 3DV6A 5ECJE 1MOEA 4XNXH 4X6EA 2DIJA 3GNML 1BJ8A 3W2DH 2R29L 3SDAB 2NLJA 4UOW0 1GPOH 5CGMA 5JXEA 1VFOA 3PQYB 2JELL 4W6YB 2XACC 5HSFA 1HQRA 4ZOEA 2WWKT 3MV9E 4KKCC 4G80B 3NOIA 3IKKA 1AGDA 1ZEAL 1CYGA 2EE2A 5F9WC 2PTTB 2F54B 3T0BA 3HNVH 1JFQH 1OLZA 5FEBA 4JG1H 5ESAA 1GGTA 2VITB 4UAOB 4XP4L 1EFQA 2ERJB 4Y4HC 1ZV5A 5D1XB 5E95B 4JZJC 5EZOH 3BXNB 1I3VA 5D96B 2F5AL 4PS4L 1CD1B 1JL8A 3QIWA 4HC1H 4U7KA 5F89B 4CL7A 3K2UL 4XVSL 5D1XA 4LGRB 3H2WA 4L9LB 3QH3B 1OT2A 1BZ9B 5ESVA 3L95A 3FMGH 3GJEA 3B43A 4LDEB 2P8MA 3FB7A 5FUZL 1NCUA 3L3JB 2WMPA 3OV6A 3ZL4H 3MYZA 4TOYH 3HRPA 1YEJL 2BVQB 1IC4L 5E1HB 5IR1B 4NQEE 4M8QA 1OW0A 3SN6N 4XPFH 2K1MA 2R0ZH 3LN5B 5GS3A 2VLKA 3RWEA 3QRFM 1UACL 4QRQA 1CE6A 1S7TA 5EB9A 3MRDB 3VXSE 4CMMA 1LEKA 3HI1B 5C0GA 3GIVB 4PJHE 5IB5B 4P9MH 4OT1H 3S5LA 2EDJA 3MR9A 2V2XB 4XPBH 1U3HC 3BZDA 4PY7A 3L7FA 2D2OA 5EZIL 4N1EA 5I17B 3IDGB 2VABB 5L2JA 3PDOA 5IMKA 4PRNA 1QFUH 4O5LH 1KV3A 4XWOC 4LEXL 2CLVA 5KSAB 1IE5A 3BAEH 4WI5A 5KSBF 1RD6A 3TESA 2WSKA 2GW5A 3VFOB 1YMHB 4JZJB 1S5HB 3T8XA 1KN2L 2D0GA 3VFMB 2HMID 1OARH 1IGFH 3V4VH 4NQVA 4ZOAA 4S2SA 3H42H 1WZ1L 1QPXA 4IOFC 4Q9BA 1CXIA 2X4NB 3SGKC 5BVPH 5SX5K 5FFLA 3LEXA 5EN2A 4Y5YB 5LXGL 5F7FA 4IS6A 3HKFA 5FUOH 2CLRA 1KT2A 1REIA 4XVJH 4FQLL 5TE6H 4CAGA 2DQGH 1KUMA 2J6EL 3MBXH 4D8PB 8FABB 4OZIF 4NPYB 5IJKA 1TNNA 5F8QC 3UPCA 3PL6B 1PSKL 5M95B 1E4XH 4Y4HD 3CLEL 5CWSB 1HSBA 5DJ8A 5EFIA 4ELKA 1AXTL 4HMEA 3CMGA 1FZKB 4PBWD 1LDPH 1J1XL 3QEQB 3RTQD 1HZHH 5C0RH 4OLXL 1D9KD 3BMVA 1JNLL 1TTFA 3C6LB 5F7KC 3OG6B 3U30B 4XPTH 4F3FB 3QFJE 3HNSL 2R69L 2OP4L 2IBZX 4S11A 4MZ2A 1MVUB 1QFUL 4O5LL 1EEQA 3O41B 4JRYD 4J7RA 5IHLB 1TJHH 4M1GL 5KAQG 4QRTA 1K6QH 3BH8A 5F9OH 2HFEA 5IESL 5GQBA 1WTLA 4I3SH 3EDEA 3ALPA 3DV4B 3EHBD 2X05A 4NSKA 1FFOB 3S34L 1JYXA 3ARVA 1DSFH 3OGCB 2CDFB 2V6HA 2IGFL 3KPOB 4HWNA 1UT9A 2R0ZL 5CJXA 5HHXL 3B9DA 5B22A 3T0WA 5FF6B 4ZFZB 3FB8A 5C6WH 4HGWB 1Z9MA 1A7QH 2HVJA 2W9EL 5HHMD 1KT2B 2EDOA 3EZJB 1NDGB 4EJ1C 3O11B 1TQCC 3EO9L 2RQ8A 4TTDC 3GKZA 1MHCB 2YPVH 4X4ZA 5HYSG 3B2UC 2VUOA 3PGFH 3PWPD 3FHQA 4E41D 4NWUL 4OCYH 3MV8A 2OBGA 3O9WA 4Y5XB 3HI6H 5EBLA 3O3EA 1UCBL 2XYCA 3RU8H 3QUZB 4FQHA 4XXCC 2CRYA 4ZXBC 2AEIT 5GRVL 2YN3A 3ARBD 3WXVH 5DQ9B 3EOTL 5HYFA 4LHUD 1SBBA 2HJFB 5KSVB 2OJEA 4ELMB 4YFDB 1J05B 5DFVC 4RNRA 5HDQH 1SYSA 2EYTB 4BKLA 1GGCH 5ACMA 3S35H 2FYYB 4HLZG 5KANG 5KVGH 1ZT7A 5E5MB 1NGYB 4H25B 2CIIA 3IXTB 3LKNA 2HJLA 3PGCA 5DC9B 3G04A 5JIHA 4ISVB 4R7NB 3TA3A 1I3RB 3T4YB 2P8LB 4G8GB 1JPFB 2IH1B 3PL6A 1JN6B 2JK5A 3QIBD 3QUXD 3UZVB 3WO3B 3BEWB 4F7MA 1UH3A 1KTDA 5ITFB 4F2MA 1OSZB 3WXWL 5DJDB 4UB0H 5BQ7B 1FH5L 2VQUA 3G5XA 3F58L 3ZKMC 3KYMB 1XF3A 3F7VA 5EZOL 3L9RB 5CHNB 3MRHA 4OIBA 3CVHH 3IXAA 3NFPA 4U49A 5DRNB 3WIFB 4UILH 1PX4A 1J0KA 1OAZL 1KB5A 3ETBF 1BLNA 1E6JH 3O4LD 5SWZE 3U9PH 2BC4B 4JY6A 3HCVB 1EJOL 1MEXL 2XZAL 3QDJA 1DCLA 1BPVA 4F37K 3QXDB 1IC5L 3RHWK 1UJTA 4MXQC 2V17L 2SEBA 5DUBA 2BC4A 3S3JA 5DTFB 3IRZA 3WXVL 5EU3A 3OX8A 4OKVA 5HHQA 2B4CL 5I1HH 2Z4QA 5C0JA 2GYSA 3GBLA 3IXAB 3NFPB 1S7UB 2YRPA 1E4JA 5CIPH 1JPSL 1MREL 3QEGL 3K81A 1CLOL 3BJ91 1AO7E 3C60B 4OD3L 2FSEB 4YHLH 5E6IB 4JN2B 1B3JA 3CPLB 2OS7A 4HX1B 5SX4H 4Z7WE 4Y5VC 3EYSL 4YNYA 3WNOA 5IWLA 2JJTC 1GZQB 2OQJA 1NLBH 5A2LH 1BD2D 2YC1A 5I1KH 2AS5M 5SV3A 5F9AC 3WFZA 1O7VA 4DKFH 1NFKA 4K3EL 1F90L 1NC2D 3DTXA 3MFFB 4K3JH 1MCNA 1A3LL 3ARFB 5I16A 1NGQL 4NKMA 4MDJB 3D85D 5DD0L 3PIQB 3OZ9H 1VADB 4MXWH 4TSCL 2XOTA 4Y2DC 2ZSWA 1BX2A 1QLEL 5FIEA 3QFJB 3SCMB 3FTGB 1JHKH 3MV9B 4GS7C 4G43B 1ODAA 2I5YH 4NT6B 5F7HA 2EXYC 3DETC 5TDPB 1CI5A 4XHJD 3GGWB 3CXHK 4CVZB 1UCTA 5CEYA 5IM7B 5E2JA 2ZPKH 3LZFH 2FRGP 3FQRA 1IM9D 1DVFC 3V5HB 3QT2A 4NNPL 5JA9A 4NRXB 4OCWL 4G9FD 3CK0H 3O3EB 1JI2A 4DOHB 2CIKA 5FO7A 4G42B 2OL3H 4EI5B 4U1KA 3DSFL 4NJ9H 4MVBC 3GJFH 5T5FL 1KGCD 1PKQA 4F33A 4EBQL 1J8HD 3FONA 1H3GA 3QQ3A 5HDOA 4XHJC 3OF6A 4I3GA 5CSZA 2Z8VC 4L8DB 3PWNA 2DMKA 5D5ME 3AS2A 1J8HE 1T66C 5ID0B 5KSBB 2FLBT 3OKDB 4MXQD 4XCCH 2UYLA 5D7IE 3ILPB 2EIBA 4QHUB 2I9LA 2IC2A 4NRYB 1H5BC 5T1DL 5I8EA 2ED8A 2W60B 2C5DC 5DMJB 2V9RA 5J1AB 2NZIA 2A1WL 1LDPL 1MHPL 2I60L 1YC7A 4JHWL 1H3PL 5CSZB 1NMBH 3LB6D 4Y19D 3OWEA 5BXFB 3UAJD 4P2RD 3QCTH 3T08A 3DNKA 1CFTA 2VZSA 1FGVH 4DCQA 3MUHL 4KK9D 3UXFA 2PKDA 2WUCL 3WBDA 4NQCA 2IAMC 3NA9H 4NUJB 2F5BH 4Y19E 4C83B 2V7HB 4OFDA 4WTWA 4K7FB 1IGCL 2A77L 3VFVB 2WZPD 2VDML 4L8SC 4ONHA 5MHSD 5DQJB 1RK1A 4ZUWA 3PWPB 3HMXH 3W5MA 4NRXA 5K9KA 2I60H 5EIVA 1EGJA 4PJCE 5ADPL 3VMPA 4TSAH 3RVXD 3BRDA 3NCYS 1INEH 2EXWD 4LSUH 5ICXA 3PABA 1EEZA 3T0DA 2PW1B 3RI5K 2QQQA 3NPSB 4PJEA 4Y4FA 3BP5A 4KUCF 4E0RB 5HYSB 1X4YA 1VADA 4M1CC 4XBEH 1DQDH 3TBWB 1AGFB 1ZHLB 4XI5C 5TH2B 2LU3A 1JF1B 4XNYL 3BPCA 1A1MA 3MUJA 1T0NA 4GRWE 1MY7A 2P5WB 4G80A 3T65A 2EDLA 2R2HB 4O00A 3MCLL 5JOFA 2J2ZA 1EO8H 4OZ4B 4IRJD 4HH9B 3AGVA 1UM5L 3GB7A 3RAJH 4OTXH 4K2UH 1T7WA 3BYYA 2FSEA 3FRUB 4LP5A 1OT1A 5KAQF 4L9DA 3VGEA 2EDEA 3KWWA 5CJBA 3E6HA 4KKNA 1SY6H 3VFGH 1JP5A 3H9ZA 2NPLX 5HYJD 4NKQB 1BQHB 1LWRA 1QSFD 3GHEL 3ET9F 3WJLC 5JNYB 4KK8C 3SDXA 2Q86B 2C1PB 2NLJB 1Y0LA 2JLLA 3WFDL 3KPNA 2V2WB 2O5YH 3LHPH 4U6XB 3O3DA 1HHHB 5E94A 2O61B 4G6FD 4ZTOH 4U1LA 4OFPA 4PGBA 4F9PA 4JM4H 2F54A 1I1YA 3D25B 5I1IH 4YHMH 1JUFA 4DZBB 4TULL 1AD9A 5D93B 1T89C 4PJDF 3U82B 1S9XA 3ARXA 5E8OB 1ZHKB 4TUJA 4PV8B 5JW4Q 3IFOA 3QG6A 2V5TA 2Z31C 1A2YB 4MD0B 4MJIB 1D9KC 3WNMA 4PJ9A 1AKJD 1B0GB 1CLYL 4KI5D 5C9KA 2RHEA 2X4TA 1BIIB 4R4BB 5EIQA 5HYIA 4J23A 3L3IA 4K8RC 4QRUA 3FO1B 5JQHC 3VFRB 3QNXA 3NCCB 3JWDH 4FFWD 4BQCA 4BSWA 1INDH 4WUUA 4LGPB 4L29B 1ZVHA 4X6BA 2Y07L 4HMDA 3DMMC 4GQ9H 1U58A 32C2A 3WO4B 2BNUA 2VB5A 4ONFL 2HTKC 4XVTL 5FYKE 3GHBL 1EJOH 4N1CA 4M8VA 3HMWH 5HHPB 3DURB 1NGPL 4Z76B 1MCQA 4RMTA 2BY0A 1PZ5B 1BFOB 4UDTB 5ADOH 2ZUTA 3OJ2C 3SGJC 4U1MA 4UV4L 4WHYG 2HT3C 2QKIA 4JFZL 1JRHL 2HJKA 1RZ8B 1NAMB 3UEZA 2FEDD 2PCPA 5GISH 3S35X 4I5BA 3B8YA 4L3CA 3DPBA 4N9GB 4HFWA 1F4WL 3P4MA 4K71B 4G6JL 3MJ8B 3CZFB 3IJYA 4UUJA 1U8LA 1P9MC 2RJMA 4WHCA 1YEHL 3MRMB 4ELMF 3O6KH 3QUYC 5BCAA 3T4YA 1GOGA 2NY3D 4O9HL 1RZGB 1ZS8B 5CZXC 1MUJA 3VDBA 1N7ML 5E8DL 4FQXB 5D2LB 5FGSA 4IJ3C 3SDAD 4XP6L 4YUEL 2EZ0C 3IYLW 1MIML 2XZCL 4FTVE 1HXYA 3ZL4L 1W72A 2FEEL 2R23B 5BV7B 3EHBC 1T1XA 1S9XB 4PLJC 1Q94B 2P49B 4GKOA 3VWJA 1IEBB 5CBEB 2VXQH 4HK0A 5CSGA 3UYOD 4EN3C 3LSOA 4GKZA 1FNGA 3L3HB 4XP5H 1NCAH 5K59E 4EQ3A 4Y16C 4RRPG 4YQXL 1U8PB 4PP1C 2VISB 3DOSA 4BQ8A 2NY6B 4PJ8D 2H32B 3HLAB 4PRHE 5EUOE 5BV7H 3W82A 3C6SB 2R2EB 1NFDA 3QPQC 3WUWG 3QIUC 2DQTL 5EN2B 2ORBL 4UIKH 5KSAD 4Q58C 3ZZ1A 3LN9A 4FQCH 4KROC 5C7XH 3HPJA 1NGXA 1KEGH 5CIPA 5KTEH 3GMQA 5K9JH 1JZ3A 5I1JL 4HHAA 1UENA 3KYKL 4LCYA 3JBG7 4TVSa 2OP4H 4WGWB 4JPIA 3RY5A 4E41E 1RK0A 2ZUYA 3X14B 1RJCA 2IMNA 1N8ZA 4HQQH 2VE6B 1IL1B 35C8H 4HZLA 1BREA 4PJ7B 4JO2L 4P4KC 3VGFA 3UYPA 3WE6B 4C58B 5T3ZL 5B4MC 5HY9B 4X5XB 4PRHB 4YIQB 3UROR 4F37F 2OI9C 4UU9A 2CQVA 5D9SA 3SKJL 1U8LB 3ARTA 1WIPA 3IFNH 3O4OB 4DN3L 4P2OB 2YS4A 4H0HB 3V0VB 3UBXI 4XCCL 4PJIF 3LN5A 1SMAA 2AK4B 1ZLWK 5HYSA 5DI8B 1FIGL 3A67H 3ESUF 3UTPE 1GGUA 1RZKH 1AD0A 1X5AA 1YMMA 1QHOA 3OXSA 1XIWC 4X8XA 5DR5H 2I9TB 5H35A 1KEGL 2H26A 1N0XL 5D2NB 4HEPG 2D7OA 2HFTA 4F15B 1Z6JT 4CN4A 3CH1A 4ODVL 2ZSWB 2JF1A 4U1KB 5EIIA 1MLCB 1WUNT 5D72L 2ZNXA 1DEDA 1R6VA 1T20B 2C3VA 4YHZL 1MHHB 1Q0YH 3D39B 4A2MA 4KK5C 3ARZA 1BIIA 4PLJD 5KOVC 3MYJA 1UXWA 1MFBL 1IT9L 4HKXA 2RFXA 1U8NB 2WBKA 1RFDH 3M8OH 1U8MB 2ADIB 3WFEH 5H35B 4PJGA 3P0VL 3DXAD 3BZ4B 2Q6WB 1AI1H 4QTHA 3QULA 5BVJA 5CBAA 1JZ7A 1F6FB 4PG2C 1J7VR 1K4DB 5IQ9A 4Q6YA 4DEPB 3A6OA 4BZ2H 4MNHA 1ZGLA 5JQ6L 5LCVL 3O6KL 4PTTA 3ARGC 2Q3ZA 4MNQA 4XP1H 3BVNB 5E56A 3H6JA 2J8UB 2FHBA 1KTRL 5IK3B 3UJTH 1RIHH 3KYNB 4RQQA 1CE1L 2ICWB 1P7QD 3QDGE 1WIUA 2PYFB 1N5YH 3I2CL 4WO4B 3THML 5T33L 1DQJB 5T3ZE 12E8H 3CMOH 2OJEB 4ELMA 3JV4A 5GISL 4JM2A 1T21B 4LPTA 3DRTB 4P4KA 2OI9B 3X13B 3VWKA 4LLUB 1D5MA 4Z0BL 4LCUA 1QQDB 2VL4A 3NCEB 3QDGD 2R2EA 3STZA 4MA8L 2NXYB 5DSCA 2RFXB 4WENB 4EOWL 1O7SA 3BRFA 2IH3A 3RWCA 5F7UA 1KIQA 4RDQF 4LPUA 1FNHA 5I1CL 3OKOA 1I1AB 4KRNA 2BRRH 2AVGA 4NQEB 5DRWB 4PGZA 4LEOB 1MCFA 4OF5A 4PRBA 4AIZB 2NTSP 1EO7A 1HHKB 1H8NA 3OQ3B 5C8JA 5MEPA 4MD5B 4ZSOB 2XIDA 4MA1B 1C1EH 5D7LD 3W2DL 4GLRI 1Q94A 3Q3GA 2VLRA 3JSSA 3AAZB 3H42L 5H8DA 4BSJA 3BN9C 5GPRA 3UC0L 1LO3L 2AJUL 1CD8A 4J6RH 4BFEA 5L2KA 5BW7C 2IFFL 1A6UL 2Y06L 1AE6L 2B39A 4DGVH 1OGAB 1T6VN 1BAFL 2CSPA 5FGBC 5J1AA 4W6WB 1I1FB 1OD9A 4L1HA 1YY8B 5J1TC 5DDHA 4PJXB 4UIMA 4IBLT 5C09B 5C0NC 1S7QB 4HS6A 3QP3A 1L7TL 3OKDA 1GVIA 4XVUC 3TP4A 4AEIL 1T2JA 1I1FA 4X9FA 2HJLB 3EUUA 2V2TA 6CGTA 4JO1H 1RMFL 5LAXB 3VG0H 1NMCC 2X4QA 1F13A 5HD8C 4HF5L 3L3OB 3F7RA 2EEBA 4PBXA 1IM9B 5JIPA 4D8PA 3I6LE 8FABA 3AU1A 1EVTC 5IVZA 1IGFL 3WFDH 4X99A 4KMQA 3A6BH 4O02L 3WKML 1TVHB 1D5ZB 2EKJA 2IQAA 2D03L 1PG7X 1HSBB 3C60A 5E6IA 1HHKA 3R1GH 3MNVA 4ZD3L 1I8KB 2Y23A 5GS0H 4HD9A 3O3BB 3BKYL 2CKBB 5DZLA 4PG9B 2BZDA 5DUMH 4QCIB 1U8PA 1Q9LB 4OQTL 4LCUB 4BH8B 2NY3B 2YZ8A 5CP7A 1UZ6E 4XCEA 3V52L 2AXJA 2XA8L 5IOPA 2B5IB 1L6ZA 3EYQD 4LCIH 1MCSA 2WP3O 4GLRH 3OAYH 4X80L 2G9HB 2ILLA 3O2VH 4NFDA 1HXMA 3TVMD 5F1KC 5I8OH 1H15A 2HT3D 4V1DB 3BSZH 2BCKB 1UWEH 4LPVA 1A5FL 2Q8BL 3HC0A 5J11B 5F1NA 3K2MC 2C3WA 4G6JH 3MUY1 1NGZA 4BSVB 2YMXL 1J12A 4OKDA 1CF8L 4X6CB 4R4FH 3GSUA 4UNUA 1A6WH 3F6LA 4LARL 4X0KA 2AJ3B 5DFTA 1WEJH 3EYVA 5A2FA 5ANMB 2Q3AA 1EMTL 5KSAA 4CVXA 1HHHA 2JCCA 3BZEB 5ADOL 2IH3B 1CU4L 3WL9A 3BESR 1TZGH 2V5RA 4KTDH 5IBLD 1LK3L 2HLAB 2VN7A 3VCLA 3K4AA 3WNLA 3TJEL 3BKML 3JWOH 3P30H 1P7KB 3MV9A 4DFHA 1OD7A 3Q5TA 1FE8H 5DHXB 3QUML 1FGVL 2D9CA 3Q6GL 4TNWF 3B9VA 1JGUH 1QBLH 1RU9L 1XCQB 3FB5B 5IB1A 4Z5RB 3EDJA 1GOHA 1MFEH 3O6FA 3QPXH 4MB4A 1OAYH 3IJHB 4UIKL 3I6KB 3AAZA 3C87A 1YYML 3ULUD 1N4XH 4LP4A 3DX6A 4JFED 2O5XL 3IU3A 5CJ8A 3GB7B 4X6EB 2AERT 2FWOB 5E7BA 3RJQB 4PJBE 1DANU 1Z9SA 3SDAA 4JG0H 3RZCA 1MI5D 4HUVB 2IAMD 4L9LA 3V0WH 3U7WH 5GZOC 3GO1L 15C8H 4L4TE 3TWCL 3WJJC 2NY4B 4PJ7F 2NW2B 1YEDA 3KHOA 3IJHA 1KJ3L 5CJOH 3QXDA 3QZWA 4GXUN 5IVXE 5AEAA 4JFYB 5HHMB 2QTEA 5JHDA 1XF5B 5TFSH 1S78C 1U6AH 4WJ5B 5ABDE 2E9WA 3FCTB 5CINH 3TPUB 2CD0A 4KQ4H 5F3BA 3KPRD 3EYUL 4F7EB 1ZXQA 1CLZH 5D6DA 4CVUA 4K9EL 1HHGB 4LPWA 4GRWH 4U6YB 1JVKA 2Q7YA 2MOVA 4GBXD 3RWJA 1IGYA 4OCMC 4GRMB 1JGDA 1NCWH 2EYSA 4KPHL 5DK2A 5GSRA 3MRMA 5K9OA 3WSQH 2PR4L 5EC1B 2CKBA 2WINB 1A7BA 1V8HA 3C6LC 5F9DC 1H9VA 1OF2B 2BNQA 4NKDB 2VZTA 2E7MA 5FAAA 3G9AB 1JWMA 3NIGE 4JN1H 4DKEL 4DTGH 3MRBB 1JPFA 2IH1A 5BVJB 1Y18B 4Z78B 1AGFA 1ZHLA 4HWZA 5DJCA 5ICYA 4PLOB 4F9LA 1FL3B 4OLVH 3H7BB 3BUYA 4FFWC 3BMWA 1MWAH 3PWLB 3TH4T 1A6VH 3V7AG 4TNVK 2X09A 1BEYH 1H0DB 2RGSA 1A3RH 1L0QA 3HAEB 1RJZB 4GSDL 4I48B 4EN3A 1YQVH 1JTPA 3O2WH 1P4IL 1U3ZA 2PO6B 4JRXD 4K3EH 5H2BA 3SOBL 4DN3H 1HDMB 4DUVA 5EBGA 4TPRL 3WD5L 4HHAB 4NRZB 4WV1B 3MLVH 1DEEA 4RAUB 4HIHA 5A2IH 1AXTH 4XTRD 1BQUA 1DANT 4QRUB 1E6OL 2FIKA 4NP4L 1JZ2A 2I9TA 4BJLA 1URLA 4Q9RH 3O41A 2DMBA 4U1IB 1QSFA 5EUKA 2VISA 2YPKB 5CEZH 2GJ6B 1T89A 2F74B 5HYJA 3IVKA 3EOBB 1K5NA 5FYJU 4Q2ZB 1T83A 3WLWD 1HH9B 3B8SA 1KACB 2ARJQ 2YHGA 3VMOA 2MPAH 4KKAD 4DW2H 3GSXB 1Z5LA 2ZCHL 3KXFE 1MFCL 1A4KA 4ODBD 2ATKA 1UH4A 3MOQA 4HXBL 2XKUA 3SJVD 1IAOA 2DDQH 4R4FL 2NXZB 3LKRB 3GHEH 2P7TB 4I0PB 4QRRB 4L4VA 3KPMA 3MMEA 4PJ5A 1JGDB 3MLVL 2E3VA 2FL5B 3SGDI 3W39A 5C0DB 3IAQA 4N0FB 4NBYB 4DZ8A 2YD2A 2CMRH 3ALXA 4YHML 3VXUB 1AY1L 5ENWA 5KJRL 1CFBA 4HH8A 1JIBA 1IGMH 1RIHL 2BSRB 1KCVH 4FFYL 3BIBX 4EUPG 1WIOA 2J8UA 2BNRE 1U92A 2RCSH 2W0FA 2DWEA 3QEQE 2CJUL 4YR6A 4HDIA 5L9DL 5DFVD 5CJQH 3ZE0E 3BP4A 3LMJL 3O4LE 5SWZD 1U95B 1YJDC 3WUWB 4RRPA 4G9FB 2GJZA 5L2KE 1X5GA 4OGXL 3T0VA 1NCAL 2QKIB 3UZEA 2YA1A 4MNHB 2YRLA 3S5LG 3QJHB 3GK8H 3SKOA 3E3QC 2ADIA 3QCVH 4LF3B 3GSQA 4ESKA 1DUZB 5FYLD 2FWOA 4Z0XB 4JZJA 3PGFL 3STZB 1IGTB 3DRQA 4Y5YC 1UCBH 2DD8L 3DI3B 2NY0D 3N1FC 1I8LC 1X5YA 1HINL 3HS0A 1JTTA 2EDXA 3L5IA 3PQYD 1DFBH 4H8WH 4PJAA 1CICA 4NQCD 5DJZA 5F6IC 2YXMA 3KLAB 4X6BB 4HKXB 3MGOA 3GZKA 2VC2L 3TZVD 3TO4C 1UKQA 2DTMH 1A9EB 1MHEA 1KCSL 3GIZH 4P2RA 1HYSC 3C5SA 3CXDL 4OSUH 4OLZL 4M5ZL 3FQNA 3BWAB 3QDME 1AQDA 1BQSA 4U2ZA 5I16B 2DYPA 4G6ML 1KLUB 1Q38A 4Q9QL 1AQKH 1C5BH 1KCVL 3VJ6B 2F8OA 1X7QA 4TRPH 4H26A 5ICZB 2HKFL 3SGEH 3AC0A 4UDUB 4LLWA 4LSVL 1JZ4A 4K9EC 3WHE1 4G43A 3KS0H 5TDOB 3QUXC 3FN9A 4YXHL 4NFBA 4X9BA 4JO4L 2R8SH 4ZFOA 2AW2A 5HYEA 2ZUVA 3KPLA 4HCRA 3H7LA 1BJ1J 4DCQB 4HUNB 4NN6C 4ENED 1S7WB 1J1OL 1C8PA 4ZFOB 2OTWB 4HS3B 4YAQA 1NGPH 3BQUA 5CILH 2NY1C 2R1WB 4EI6A 4XAKE 4Z7VB 2OK0L 4H26B 4KK5D 5ICZA 5DJ0B 2I25N 1E4WH 3B9AA 1EHXA 4LNRA 1ND0A 1XGUB 1VKXB 1KGCE 5D1ZB 2W60A 2B2XL 2YXFA 3HC3H 4XAWL 5DQ9A 1ZT1B 2BXZA 2Y7QB 1QBBA 3CVHA 1QFWI 4GAJH 4HIJA 3GMMA 4UT6L 2AJVL 2EDRA 3QYCA 5KSVA 4WFFE 4BZYA 3JV6B 1F3RB 1WICA 1ONQA 3VWKC 4Z8FL 4G9FA 1T1YA 1LK3H 1J18A 5MEQA 3FN0H 4J1UA 4FQIH 5C92A 2CKBH 5C0AB 3VXRE 1EMTH 1JHLL 2J5LC 4WNQB 5ETUB 1ZLVH 3CFKB 1ZLSL 2H2PC 2LQRA 4LBEB 1N5YL 4CU8A 4XGZA 5D9SB 4YXHH 1DN2A 4YHKL 1NUFA 3MBEB 4QRPA 1G6RH 3VD4A 4K7PY 1NDMB 4OT1L 5FCSH 4PJFA 5E8NB 5KN5B 1A6ZA 3RVUC 3MC0A 4GRLC 1W72L 2CDGB 4KQ3L 1AGBA 1NC2A 4WEBH 2PN5A 4WFEE 5KVDL 1U92B 4C4KT 5J12B 1SBSL 3K46A 2BCKA 4LPCA 4YUEH 5I8OL 1F42A 4YR6B 3TO4A 4NC1E 3OHXA 2CXKA 3FFCE 2WQ8A 2AJZA 3ARGD 2A0LD 3PDDA 5D8JL 1DVFB 2G60L 3E6HB 4BZ2L 3VFUB 3SDXE 3WFEL 1U8KB 3D18B 4GAFB 3QRGH 4PB0H 4FFZH 5DDHB 1BQHG 1SEBA 1T4KB 5DO2C 3RQ3A 2P8PB 3VRLE 5GS1B 4AMKL 4LSUL 4GG6B 4HJJH 4R90L 3QEHB 5MHSE 4DGIL 2OR9H 4L3CB 4Z7QE 3ISWA 2C4XA 3QXAA 1LEIB 2AK4E 5GRJL 2P8PA 3BPOC 4OI7A 3AREA 1U8OB 1CLZL 3K2UH 2B8OT 4LCWE 2Y36H 4IEFB 2CKNA 3N50A 1DL7L 3GJFB 3RL1B 4CUCA 4WCYH 4WW1B 4KJYB 5TFSL 2JB5H 3UMTA 2QQKH 5L9DH 4PYHA 1I7TB 4ODWA 2YZ1A 1WAAA 4L1DA 3CDGA 1Q9WB 4D2NA 1NGQH 1XF2A 4Y2DA 1VGKA 2PO6C 3D9AH 3Q6FA 5ERWA 4H88L 1IGML 5C0AD 3QEHA 3V7MA 1LO2H 5AWNH 1YJDH 4GG8A 4G7VH 4O4YL 2IQ9L 3TO4B 4NO0B 1FAKT 2QQNL 4M7KH 4QWWC 1ROWA 3TO2A 4QRRD 3QO1B 2G5BA 4JG0L 1WCQA 3PL6D 4XI5D 3QI9B 1DVFA 1AC0A 2EYRA 4MGXA 2PXYB 1T2XA 2DM2A 5TPWH 3RWEB 4ZXBA 5E9DB 4PRIA 5IB2B 4PJCF 3IDXH 3MRDA 1AO7A 4LKCA 3RVWC 2HFFB 3CAFA 4X9IA 3MLXH 1B0GA 4U1NB 1BM3L 2ITCA 4PJAF 5C0CD 5AYQA 2VIRA 3TT3H 1I75A 4PJEE 2WUCH 2YR3A 1C5BL 3MZTA 4PJIA 4MJ6B 2DYPB 4RA3A 3ZHKA 5KZCB 5MP6H 4GW1B 3MLUL 2HJKB 4BZ1L 5D2NE 5INCA 5CZKA 4M5ZH 1NFDF 5IVZB 4WWKB 1YEEH 4PJDB 1JV5B 4TVPD 1QEWA 1F45A 1PVHA 4E41A 4RQQB 1B0RB 1UADC 5B8CC 3K0WA 3N1QC 5LGJB 1CDIA 1V5JA 5AZ2L 1RUAH 4M7LH 1S9WA 4N8VB 1ZA6A 2AGJH 2NXZD 2B7DT 4GBXC 1TJIL 3ZKXB 5GJTL 1YYLL 1INQA 5F89A 2NW3A 1XT5A 4WUUB 1UZ8A 4N8CH 1U58B 1NL0L 4NNYA 2OL3L 4HS3A 3ARDD 1P4LB 5I6XB 1TZHA 2ZP0T 1JGEA 1AHWC 4HGKC 4KJWD 1S5HA 3T8XB 1S7SB 3GSOA 5C3LD 3UP1A 3ZDXF 1JK8B 1MIMH 1G7QA 2Z31D 3MO1B 1PG7L 2ZUSA 3HRZB 1YNLL 1S7XA 4JM2F 4NM4L 3GRWA 3TPKA 1U8JB 2AV7B 4PREB 3SGDH 5FGRA 1GCFA 3OKKB 1TTUA 1KIRA 4LSSL 4DVRL 4WFHE 3VFPA 4PRPD 4HLJA 4NM8L 4F57L 1LQSR 1FLRL 2AKRA 2FR4B 3ALWA 2ZCKL 1JMXA 3RTQA 5L8LB 1HSAA 2O61A 2BNRB 5HHOD 3TGXA 3RL2B 5DK0A 3TT1L 1X4XA 3S34H 1EHLL 1PAMA 4KK9C 2DQUL 2WUBL 2B1AL 4I0KA 3MTRA 4C56D 1L4IA 1IFHL 3VRJB 4XCNA 4UOW1 4NZTL 2GTZA 3QSKB 4JDTH 3VGDA 1FVDA 2EH8H 1X5IA 1RUAL 4M7LL 3O2DL 1LGVA 3BPLB 1JNLH 2VTFA 3RDTA 4ETYA 3WS6C 3T2NL 2FEDC 1I7TA 4ODWB 1HSAB 2VITA 1TZHB 3ZE0F 1HILA 3FT2B 3CC5A 4CVWA 1SVCP 1WBYB 1OSPH 2VXVH 4P2QB 4KZDL 3G5VA 3B9KD 2Q87A 4DKFL 4ONHB 1CD1A 1IEBA 1LO4H 5FYJD 3I02B 2YKLH 4U1GC 1FG2A 3VGAC 3VD5A 5HVHB 2FBOJ 3K4DA 3T2QA 1IAIH 3LKSB 5EC2B 2R1YA 2Z92A 2A6DB 3FB8B 4G8GA 4HBQA 3VXNA 1YEGH 4NHCH 4YFLI 5FYJE 2VERN 3DGCR 2DM7A 1OAQH 2YEZB 1G7LA 5FKPA 5ISZE 5DJAA 2UUDH 2DWEB 1FVEB 5HHNA 4KY1L 1YPZA 1MVUA 4G3YL 5JR1H 5JXEC 2YMXH 3G6JE 4KKAC 2A9NL 3JVGA 3L7EB 3SQBA 1SYSB 4BKLB 3CDGB 1MCPH 1FZJB 1RAMA 1NC4B 2AABH 3MRCA 4N5EC 2YUZA 3ARYA 3REVA 3FO0L 2IAMB 3BP6A 2YPKA 2DTML 4WCYL 3PP3H 1RJYB 5INDB 5EZLA 3EGSB 1YMMB 4LHQB 4GKNB 5EA0L 1PLGH 2FZ3A 3VFGL 1YEJH 4H0GA 3EW3B 4UTAH 3ULUF 2EDTA 2GSIA 2BVUA 5EORH 4I5BB 2OZ4A 3RVTD 1U3JA 5D1XC 3HN3A 3JTSA 3MLYL 1NAMH 4OGZA 2AJSL 3WS6A 1OB1A 2FCBA 1OY3B 3DROB 1SY6L 5HJ3A 4OCWH 4JZOB 3T2PA 4N68A 1GC1L 1N6UA 2R56L 4RMWA 1TDQA 4W81A 4N5ED 4AMKH 3MRCB 1MCIA 3DV4A 1K9TA 5LWYL 2GI7A 5JORB 4YHPB 2Y1VA 3SE9L 1MQKL 5HGDB 5AUMB 5FKPB 3AMKA 2YD5A 4F7PB 5C6PB 3RZCC 1SBSH 5E8DH 2B1HH 4HMCA 3UPRA 1FNFA 2YPLA 2EDFA 2QHRL 4BSWB 4YDIH 4N0FA 5BV7C 1NBZB 3KPRB 5DD1L 5L7XL 4MNGA 4JZOA 5DUML 2A6DA 4KHTH 3NCMA 4MB3A 2C1OA 3LEVH 4RMUA 5KSBE 3F5WA 1SVZA 2X4TB 3R4DA 1EA9C 4R4BA 3MLWH 4C57C 1QNZL 2B4CC 3JWOC 3KYNA 2X4SA 1J0HA 4UBDD 1M7IB 2FJFA 4YHLL 4PV9A 4HX1A 5CMAB 1S3KL 3MYJB 3ZTNH 4LCWA 4G42A 1VACA 5E00B 2Y25A 5CKAA 1OAYL 4G6KH 8CGTA 1BLNB 4ALAL 5TE4H 1JGUL 3L6FA 5DR5L 5J9PB 5ID1A 4V2BA 3RDTD 3BD4A 3EFDH 2CRIA 5IESH 5D70L 3SDDB 4P4RA 3EFDL 4M62H 3HNSH 3IS1X 1VGEL 4PTTB 3MRPB 1OAZH 3CFCH 3DRTA 3K4ZA 4XTRC 1ZS8A 4OV6F 4YO0B 4U0RC 3HZVA 1G6RA 2XNAA 4WU5B 5HHOA 4POZC 4Z0BH 35C8L 1MIEH 4LGSB 3CZFA 4UUJB 1UA6H 2VAAA 4L3AA 4K94L 4W4NA 2EH8L 5EO0A 4IRZH 1X3DA 4U1JB 4M7KL 2X70B 4OIAA 3AUVA 3RRQA 4EIZC 3BEVB 4LCCB 2DLIA 1NPUA 4E5XA 5IROC 4JHBA 3MXVH 2FHCA 3PWVA 5DYOB 5I9QB 1AJ7H 3QDMD 4NKOA 4RGNC 1TVDA 5TE4L 2W38A 3V4UH 1T0MB 3WN5B 5EO1A 4EXKA 2HJFA 1JN6A 5D1QC 2ZZUT 3MREA 2HT2C 5SV4A 3ARDA 1WWWX 1FLRH 2Z4QB 3T2NH 1KJVB 2ICEB 4HWBH 3ORJA 3LS5H 4CADA 2IPUK 1W2KT 5IFJB 5HDQL 4PJ7A 3IXTA 4LSTH 4P9HC 1Q9LA 3WHE0 3K80A 1ZA6B 3KPPA 1SHMA 4WHTA 3EOTH 4Z0XA 3RVVD 3IDNA 1P7QB 3OJDA 5EOCH 5IBUB 3QHZL 4Q6IA 1A6TB 3CK0L 3CDCA 1YDPA 2ADJB 3FOLB 1NCCL 3TIEA 4Z7UA 1LDSA 1Q1JL 4M61A 4Y8AA 3RWFB 2FJHB 3MGOB 4CW1B 5E2WH 4OLWL 1WISA 4MQSB 3VU2A 5DJXA 1IL1A 4OGAD 3G5XB 5ALBL 3DHJA 4J3SA 5F1NB 1KCUL 2PYEB 1MCOH 2H1PL 1DN0B 4O9HH 4QY8A 3E6FA 3VFSB 2B5IC 2X4QB 1R3HA 5BW7A 1MCDA 2AABL 3TBWA 2RR3A 2OYPA 3VDAA 3P73B 4LQFH 1KJ2L 4IHOB 1DVFD 4FFYH 1VPOH 4HZLB 1J1PH 1NAML 1U36A 3I6LD 3ZSTA 4L8BB 3MRIB 4ZDHB 1V3JA 1XZ0A 1YN6A 3SKJH 2GQHA 4YXKH 4Q0XL 5IV2B 3VGGA 4RMVA 4Y2DD 4J6RL 1XFPA 2E8YA 3S4SA 2ZOKB 1EAPB 4F3FA 2FDBP 1EVUA 1R24A 4OD3H 5IUSA 2VLKE 3QFDA 5DJ2A 5E08H 4HXBH 4MA3B 5M7QA 3BW9A 4IHOA 3OB8A 4BH8A 1RUPH 3EO1B 4YHOL 4M1DH 1F8TH 3MRQB 1HKLH 3W0WA 3FFDB 5I1DB 4O2FB 3CSYB 4YHOH 5IBLC 3VD7A 1A0QL 1CVSC 3BIAX 2V7HA 5GGSB 3H0TA 3I02A 1G9NC 5DD3L 1IQWH 3FAWA 5LG1A 2VUYA 1T0NB 5A16B 4GKNA 1T04A 3CVHL 5DD6A 1C5CL 2I26N 5F88A 1R24B 2VLJD 2QQKL 3HMXA 3EDFA 4Q7DA 3JV4B 3FTGA 1FHGA 2CDEA 2HMIC 2XQBL 4KVNH 1FZMB 3C5JB 1C12A 5D71L 1MHPH 3MLZH 3MRIA 4ZDHA 3ARFA 5FOJA 2WK2A 5BOPA 1YA5A 3O0RH 2HTLC 2XTJC 3C5ZC 1IFHH 4D0BA 1I85A 4JGUA 4JQXC 5IV2A 2ZG2A 4KTEL 2V2TB 4YHPA 5GGSY 5I1AB 5J12C 3SOBH 3D69B 4M7JH 2BOCA 4L3EB 1CZ8H 5D1QA 4AIZA 3BISA 1A3RL 2Y5TB 4LQ1A 1CDBA 4G6MH 1HQ4B 1RVFL 1UKTA 3SDDC 1JK8A 1NFDE 4G8GD 4U3CA 2DQFB 2MHAB 4QRQB 5DUPL 2VDKH 1JGVL 1R3HB 3EYQC 1MH5A 5IB3A 4I77H 3U7AA 3G5ZA 3HI1A 3ZE2E 2UWEA 1QR4A 3RPIB 4PREA 3S36H 2OR7A 2K9UA 3AROA 1A9BB 3RP1A 1NCDH 1MWAB 5FYJH 2OMNA 2JCCF 4XCFL 1RJLB 4XXDB 1KLGA 4K7PX 1DBMH 2PO6D 2X4RB 5DT1L 3VWKB 5IHUL 2UZIH 5J3HC 4GAYB 3P9MB 4K2UL 5JA8B 1FL5A 4IDJH 4ZTPH 5K9QG 3GUTB 1HIML 5DJ0A 3QUZD 1UQSB 1AGDB 1NMAL 3DIFB 3QNYB 2GJJA 4WY7L 2E8ZA 4N9OB 3S7GA 3FFCB 5IT2L 1VKXA 5CP3A 1ADQA 5IF0B 3HAEA 1OF2A 2BNQB 5HI5D 2IGFH 1MI5E 3VG9C 3QEUA 5I76A 1LE9A 4F7TA 4FQIL 4RGMB 4QTIH 4TNWK 1KJ2B 3HA0A 3F6IA 3U1SH 3EJYD 3GJFK 3ILPA 4ORGB 3TIDB 3RWJB 3VG0L 4DEPC 1UB6B 4P2OC 1BQLL 5MP6L 4GMTH 4MQXD 4A6YH 3GHBH 1BZ7B 5DC4B 1FIGH 1GAFL 3BGFC 4G3YH 5JR1L 5L2KB 2YA0A 4PRPA 1N3NA 4G8FB 3CFKA 2FHFA 2CMRL 2P5EA 3GNMH 1K6QL 5F9OL 3OBAA 3T77B 2EICA 5E5UB 3C2AH 1A6UH 3KPRE 1CQKA 4YNYB 5D1ZC 3DX6B 2Z31A 4XB7A 5BO1H 3P3YA 3RJDA 3NH7L 4YX2L 1AIFB 1F2QA 5HI4C 3VRLF 5A43C 1P4LA 5KW9H 3OB0H 1B4RA 3DUHA 5EWIH 3TZVA 2OX5A 2HKHH 1E28A 5E94B 3V8CA 5FOBA 4R6UA 2NY7L 1NKRA 4AH2A 3WIHL 1OAUL 4IJ3B 1SJEA 1BBJB 1ZT7B 4MQTB 1R5WB 4GG8B 5IF0A 1INDL 3QUMH 5HHOE 1RZ7H 3KPMB 3MMEB 4HSQA 4G6AC 4M1DL 4GG6E 3IDXL 1U8QB 1WF5A 4U31A 4QXTB 4EDXA 3MUGB 4KRLB 1RURL 3MA9H 3WFCH 4OZFG 2XFXA 4C56E 2P47B 4JKPH 2GFBA 2VDNH 1ZSDA 1T22B 1ZTXL 4DUWA 4OFYA 2V5MA 3V6BR 4MD4B 2OTUB 2CK0L 4J8RA 3DX8A 2QR0A 1U8OA 2OLDA 5SWZA 4B0MM 3BH9B 4F9LC 2NNAA 1H3UA 2DWDB 4FP8L 1IKFL 5DWUH 5EO0B 2BSTB 4BFBD 1AO7D 3D9AL 2HFGH 4MXVF 3MRRA 2WQRA 3GRWL 3IGAB 4ZXBD 4Q9QH 3MRLA 2A6KA 3VXUA 1LK2A 2E7LA 4X6CA 2LU4A 5I66B 3C6LA 5CLWA 3DUUB 5F6HI 1KG0A 2DQFA 2MHAA 1DLHA 4XWGH 3TIDA 1G9NL 1X6NA 4QRRA 5E7FA 4NM4H 1G9NH 3Q2CA 4Q9CA 3OR6A 4XMLH 1CDCA 1DFBL 4H8WL 1RSFA 3MV7B 4X7SH 5HHNB 4HUWA 4M43L 4NQXA 3FQXA 3KXFD 4U3XA 5EU6E 4YXLH 2ENSA 3LY6A 2WLYA 3FMGL 3HUJA 3WSQL 1JYNA 3HI6L 1D5BA 4YPGA 2DB8A 3L3GB 5IMLA 4NN5B 3WKMH 3HR6A 1OB1B 1KFAH 2R9HC 1U95A 3DRQB 3ROOA 3SO3C 1E4XI 3HUJB 1MJUH 2CKBL 5J1SC 5EZLB 3LMJH 5J6GB 1TCRA 4PPTA 5A2KH 1FORL 5ITBH 4FZ8H 3DURA 5DUPH 4CNIB 3MRQA 5FF6A 4YEEA 43C9A 5BS0E 3RI5F 5F9WB 3QISA 5K93A 4EUPH 4WDIA 5DEFA 5GGUA 3ROLB 1HEZA 1LO0H 3OAUL 2R0LH 5IVNA 2BNRD 3D0VB 4X6FB 1RMFH 4L29A 5E2TH 1DQLH 1LEGB 5CZXD 3VXRB 3REWA 1GOFA 3MR9B 5E5MA 2AXHA 4AEIH 4JY5L 1PY9A 3KLDA 3BPNC 3LKQB 4N9GA 2R69H 4LHUG 4EN3D 1HHIB 1RK0B 4EI6B 1YN6B 3TO4D 4JFYA 4WUKH 4JO2H 4E5XB 1ZTXH 2VQTA 3C9NB 4G5ZH 3U79A 3JUYA 1L0XA 4JRWA 3HE6B 4XMPH 5GRZA 3SE8H 1G7PA 3HHRB 1SM3L 1RZGA 3EKCA 1KLUA 2P1YA 4QRPD 2EZ0D 3FN3A 4NZRH 3ROLA 1MI5B 2ZSVB 4PGCB 3HC3L 3MNZB 2A6KB 3STLB 5DVNA 4XWOD 4NQCE 1IAIL 4P2RE 4BM7A 4C54A 1F8TL 2X4OB 4JDZB 4AEFA 3INUL 1JZ5A 1IRAY 5INDA 2DKUA 5E08L 1BECA 4KTDL 5LKNA 3QG7H 3TIEB 3EO0A 3MJ7A 3P4NA 5ELIA 1NMBL 2J8OA 1NBYB 2ZWLT 3TBTA 3V5HA 4M3JA 2Z35B 2XWJA 1TETL 2KUTA 3FQXB 1CTNA 4M6NH 1CDJA 1WBZA 1CF8H 2Z31B 1K8IA 4KZEH 4PB9L 4LSRL 2F54E 4O58H 3ESVF 3BQUD 2OTWA 4LLUA 1A5FH 1ITCA 2L7JA 4JR9L 1A6VL 1EH9A 5L7XH 1EO8L 3CPLA 4D9RD 4LSPH 5KVFH 1MNUH 3UX9B 4N0YL 4RAVB 3RNKB 5C09D 4U6XA 1MI5A 4WU5A 3RZCD 3AMLA 3ES6A 3LRGA 4M6OL 3IFPA 4LCIL 5T5NG 5LQBH 4GFTB 4OLWH 1H5BA 1QSED 1YEHH 2WBJB 4QO1A 5FO8A 4IRJB 4HS8H 4V1DD 2CIIB 4GO6B 3VJ6A 3SQOH 4F80A 2ZKHL 5T3ZD 1S9WB 3KPQA 1AI1L 1TXKA 3IETB 5DJ6A 2DYPD 2XRAH 4QYOB 4LHJB 5H94A 3QDHA 3QCVL 4H1LA 1ZGLB 3LCYA 5ENWB 3B2VL 4XRCB 4JFQA 2FECL 3IDIA 3FQTA 1BVLA 4AY0A 4UNVA 3KLAA 3KJ4C 1FL5B 1HK6A 3MV9D 2IANA 3U4EB 3U83A 4Y4KB 1CICD 2VZ3A 1G7JB 5MEOB 3PQYA 1WBXB 3HAEG 1K5NB 3I3BA 3NZHL 5BQ7A 3FQUB 4MQ7B 4OD2A 4ODVH 3PV7A 3VXUE 4M93B 3MUZ1 3SDDA 4M7LT 4CMHB 3PGDB 1VB9A 3QJHA 5CEZL 4MLIA 1FL6B 5IBTL 4AL8L 3V0WL 1M05A 4OZGA 4JO3H 4XZUB 5D96C 2G75A 5DC0A 1KSRA 3TJEH 1EGJH 3MRHB 4JREC 2VNCA 1OP9A 4U0QB 5TPWL 4LVNB 3X3GH 1MCJA 4CBPA 4WW2F 2C4FT 4PJBA 1WFOA 3QI9C 3C2AL 3QI9A 5DZOA 3QQ4A 5HPMB 3GMNB 5FGBA 3PNWB 3G6JB 3RVVC 3WD5H 2VDOL 5E0QA 3D85B 2AK4D 5CP7B 4RIRA 5ID0A 5KSBA 4PJ5D 3NABH 4P4RB 4QHMB 4FQQB 4GG6F 2ARJB 2NY0B 3SJVA 2VDLL 4KROB 5I1CH 2EDKA 5CLTA 2W0KA 1FZMA 2F53A 2AJ3A 3C5JA 2Y6SD 3JV5A 3VW3H 1GL4B 4DQOL 1KCKA 3C60D 4OZHE 5E6ID 3HE7B 1QRNE 2JJTA 5T5FH 1NANI 5C07A 4KJQD 3WXWH 1YEIH 4S1DD 5CEZD 4HK0B 3MRGA 5CD3B 3WIIH 1IEHA 1CL7H 5HDBE 5BZDB 1VPOL 1DDHA 1T66D 5IBUG 5C9JB 1C12B 2LABA 5E9DA 3CFBB 3W9EB 5DZNA 4GW4B 1KB9J 2VZVA 4ODTH 4WTXA 1FZJA 1RULL 3BRGC 3UYRL 3JV6A 4X80H 3OHXB 4RSVA 4YPJA 4F57H 1KG0B 2YWYA 1YPZF 3CFBA 4U0RB 5IWLC 2AJZB 2L0DA 5SWSB 3V52H 1PKQE 5HGBB 2P24B 4JRXA 1A14H 5JXAL 3RZCB 1CVRA 5KG9B 4WNQA 4O2FA 5DQDH 5ERWB 1CIUA 4NZUH 2A6JA 3T3PE 1Z9OA 5JUEL 3MOAL 3BT2H 3QFJD 4PRBB 1T1ZA 3MO1A 4MHHG 4OCRL 5A2JH 3EJZD 1F6LL 5ALCH 4ZD3H 1OLLA 3EYSH 4ERSL 5ESVB 1G7HB 1JNHB 2FJHA 1S9YB 4KVNL 1EAPA 4EI5A 1KIQB 1EZVY 1HZHL 3K8MA 3RGVB 4R26H 3S3SA 4LNRB 2D7MA 3CU7A 5HGGS 1OTTC 4DN4L 3WDJA 3DI2B 1LP9F 2X41A 3B9KC 5EOTB 4X9GA 2E5EA 2VN4A 2AV1B 1SMOA 3TWCH 1AXSB 2V17H 1UM6H 3L3JA 3G5YB 1G1CA 1QSVA 1E4WL 4C59B 1R5VB 1MFNA 3EJZC 5GGVL 1GYAA 3BD5A 4IRZL 5KW9L 5INCB 3TNMA 4Q9RL 4WO4C 1PZ5A 2XZQH 4NGHH 5JHDD 5FHBH 1P7QA 4BK5A 3VCLB 2VLKB 3PWJA 3TH2T 4H1LB 2HH0L 5J06A 3LH2H 2CLVB 5I30L 1V7ML 5EBMA 1DBAH 2AEPH 4JHAL 1JE6A 1QBML 4MNQD 1AR2A 2PCPB 3T3PF 2P5EB 2X7LB 4P99A 4LKCB 5J89A 3D25A 3VFWB 3P9LA 3PNWA 1P9MA 1T7ZA 3ZYOA 3RX7A 4HUVA 1M71B 2NY4D 3OAUH 3P9WB 4PJGB 4TQEL 5DMIH 1RUKL 5K33A 1JZ6A 3I9GH 4CMMB 4ZS6D 1WITA 4FMKA 1CE1H 2DWDA 2CUIA 4MNGE 3S9DB 5DD1H 5ICXB 4FFVD 5FGCE 1GXEA 5F9JB 2HYMA 4FQPA 1XAUA 5AAMA 1AKJB 4UAOC 4QXGH 2W07A 3LS4H 3TPUA 3O8XC 3OAZH 4UTBL 3SGEI 2E7BA 3PV6B 3CX2A 3PXHA 2YD9A 1T3FB 3RU8L 4ZNCD 4QHKJ 2XWBA 5C71A 5AG8A 3MODL 3KHQA 4NUGL 1FG9C 4APQD 2KH2B 4P9ML 3GEWB 4FS0A 5JDSB 3EYUH 1NEUA 3CUPA 4GW1A 4MDIA 3A6BL 4O02H 1MCBA 2C1OB 3GSNH 3BFOA 4J2XA 2O26U 3SEPA 4N0YH 2VDLH 4P5MA 4JR9H 1A64A 2XWBB 1MWAA 2W59A 4YFLF 3P0YL 5JOFB 3VH8B 2APXA 5TQ2L 3GRWH 3TVMA 4TSAL 3ZO0A 1GGYA 5IB4B 4QOKE 5JORA 4IRSC 4LFHD 2GJ6D 4XP9H 5BMFL 4X6FA 4HPOH 4CDGC 5ACLA 2A9ML 2X4PA 4JGMA 4JFPA 5ADPH 1CLOH 1CDGA 4D0CB 1RZIA 1ZLUH 4DVBA 1QBMH 3M17B 3QQ4B 5HPMA 1W8NA 4PJ8B 1U8NA 5HJ3B 4AEEA 4WDIB 3BDYL 4NOFA 3GSWA 4APQA 1Y6KR 3QPQD 3B6SB 4PJ8C 3U36B 4WFGD 4HG4K 1YEEL 5TJWK 3UTTE 5DD3H 3INUH 5GS0D 5AZEH 2XXCB 5IB3B 1NCTA 1AC6A 2VWEC 4X6DA 3EOBA 3RHWF 2UY6A 2PYEE 5EWIL 2CLZA 3GI9L 5AZEL 1QLRA 3T2OA 2PXYD 1LO4L 5LVEA 2F5BL 3OMZA 3QCTL 3KNBA 3BI9X 4KH2A 1CL7I 3ULVH 1A9BA 4OF6A 3C9NA 3O6FC 2PTUA 1FO0B 1TVHA 3B9KB 4JJ5B 1VENA 5F6HJ 2XTJE 3HZMB 3V6OE 4DKAA 5DS8A 5C08A 4EVNA 4X98A 1Z0NA 4HK3J 4LRNH 1WZLA 2Q1EA 3DVFA 2A1WH 4U6VL 4AM0B 3FRPA 4KAQL 3F5WB 3V9FA 3KR3L 3BGFB 3V79C 3P4LA 1H3PH 3VH8G 2R2BA 4ELKB 1G9ML 5L0QC 1P4IH 4OV5A 5CUSL 2O5ZL 3ARDB 1S7WA 4P9HH 2JJUA 5DMKA 4PRDB 1I9IH 2BHZA 1EUTA 3H9SB 2BSSB 2FD6H 4GJTB 4PJCA 4C56B 2XRAL 1CLCA 1XF5A 1LILA 1XEDA 3ZTJH 5L2KD 4RFNC 5TGBA 4RFOL 1VEPA 3MJ8A 3SHSA 4Z7NF 2H8PB 1G1YA 2VLRD 1P4BL 3LOWA 5D5MF 1TVBA 4OLZH 1RZ8A 2DBLH 5D7LA 3WHXB 3T1FB 2XTJB 3C5ZB 5FYLE 4FQHB 1IC4H 4PP2A 4L8CB 1T22A 2D4FA 3A6CH 4QXUL 1MFDH 3MJ9L 5ICYB 4UDTA 5KZCD 2CGRH 4UNTA 1KFAL 4FA8A 2LAAA 3SDAC 1CXEA 3OJVC 4L5FH 3RWDB 2Y4SA 4XC1L 2FO4A 5FKAA 5JTWA 5KSAC 3CFDA 4FQXC 2VZOA 2PTVA 2F15A 4JGJA 4X4MA 5I73B 2PETA 4L8SA 5C0EA 3QDGA 2D7NA 5F7EL 4OTXL 1ONQB 3VWKD 4P4KD 1QSZA 4OGAC 5JQ6H 1HE7A 4WUUD 1EV2E 3PIQA 1KLFA 5EOQH 4RFOH 1W72B 2R23A 2I5YL 3QFJA 4IIQC 1I1RA 4NKOB 5C0GB 4GXVL 4JQIH 2CJUH 5B4MD 5EU6B 1AKJA 1YPZB 2ZUQC 2YOCA 4HPYL 3UBXA 5C6TL 1JUFB 1MY5A 1WV7T 2X4OA 5SX4I 2VABA 1JTOA 2I07A 4OUUA 15C8L 1BM3H 1GPOL 4P23D 2VXUH 4R3SB 4R0LB 2HLFD 1X5FA 2ADGA 2F54D 1KELH 4EDWL 1VCAA 1I7UA 4XPAH 1BVKA 3X12B 1SYVA 1A7OL 4U4BA 3BZ4A 2Q6WA 2F19L 3T0EC 3R0NA 3P9LB 5E9DD 1OP5K 4KROD 5JDSA 1ZLVK 2BOBA 3X3FL 1NGXB 2SEBB 3BPOB 4LLAA 5KSUB 2DICA 5FHBL 1RU9H 2E9IA 1FFPB 4PJ5B 3LEXB 3ZLQC 2UVEA 3L1OH 3A67L 1CGYA 1C08B 2PF6A 2ESVB 4PGDA 5A1AA 1IQWL 3G6JA 2ATKB 3UJJH 4RWHA 4R2GD 4ZUTB 4EKXA 1YNKH 2G9HA 4I13B 4B50A 4R0LA 4KZDH 4FQCL 4CMHC 3MLXL 5F9JA 3OKNA 4D9LL 1C08A 1LE5B 4Z7VA 5DK3A 3N85L 4PJXF 1GGIH 4RDQG 1EEYB 1J88A 2YC1B 3MBEC 4NP4H 2BOBB 4IRJA 4OF0A 1OSZA 3JXAA 5SWSE 4ZFGH 1P53A 1O0VA 2LFGA 4O2EB 1OAKL 1CGTA 4NO2A 3O45B 3VDCA 1FV1A 1T80A 4JZNB 3MOAH 3KLHD 5CKGA 5EZIH 3SKOB 4KJQC 1UB5A 1PYWB 1CFTB 3P0GB 4GAGL 4NO2B 3UTTB 4O2CB 3GSNA 4NZUL 1QFPA 4N0UB 2Q8AH 3WFHB 3VXSB 2R0KL 4P2OD 5GGTL 2J88H 1YEKL 4NWTL 3UPRB 2Q8BH 2VQ1A 5JXAH 4D0BB 3O2VL 2DQEL 1HCVA 3FOMB 4G7YL 4XP6H 4HULB 3BOVA 3MV8E 2C3VB 1QBAA 3TCLB 4N90D 2H1PH 4PGBB 1UM4H 4M6ML 4XNMA 4YO0A 3T04D 1P84K 1PG7H 3NIDE 3CH1B 3Q48A 2OJZL 1P6FA 5D1ZD 4WVRA 4QRSA 4U33A 2HWZL 3BHBA 3VFVA 3QB7C 1QFOA 4Y7MA 3HR5B 4A2LA 4RMRA 3QHZH 2W9DH 3AU1B 3UTOA 1LE9B 4OJFL 3S37L 3MQIA 4PG9A 2OZ4L 2BSTA 3I75B 3LIZL 4QNPF 3MA7A 4XC1H 2HT2D 1Q8MA 2IAND 2FIKB 3F65A 1BBDL 4FOMA 2IPTH 3TJHC 4KHXL 1F4AA 1U41A 1AP2A 4GG6A 1F02I 5C0AE 3EJYC 1YPZE 3FN0L 2P5EE 4BH7B 5DMGD 2VIRB 4K7PH 3P11L 3F7QA 3NMEA 5D1QB 2VXSL 4LHUB 5HI5C 3AREB 2PW1A 1R0AH 3D0LB 3SKMA 1UYWL 3UBXB 2R2HA 5JMOC 1KENL 2J88L 1PGRB 3S36X 4ONFH 4FQQA 4MS8D 5GGTA 4V1DA 4LDLB 3DX9B 3DV6B 1QSEA 3FOMA 1OM3H 1MH5B 1FO0A 2OCFD 4XPTL 5HDBF 4J12A 4AQOA 2WLZA 1HH6A 4M6NL 4M1GH 5CEZE 4DWHA 3UJIL 5IFHH 1CICC 4P5TB 3TZVB 2E27H 4FNLH 4PJBB 1T7VA 1LVEA 3HMXL 5C0CE 1HH6B 4H0IA 5T1KB 5TF1H 3Q1SH 2R2CA 2VLRB 1PQZA 4LRNL 2HA1A 3P4MB 5CD3A 1CK0H 4S1SL 5FYLL 3V5DB 3OF6D 4ZO9A 4UT6H 2EXWC 2M2DA 3V6ZA 4XH2A 3EFFB 4WO4D 5GS2D 3HRZA 4ZUWB 4G8FA<