1CF8H

Convergence of catalytic antibody and terpene cyclase mechanisms: polyene cyclization directed by carbocation-pi interactions
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
218
Chain Sequence
DVQLQESGPGLVKPSQSLSLTCTVTGYSITSGYAWNWIRQFPGNKLEWMGYIRYSGDTRYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAIGYGNSDYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHAFPALLQSDLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPKDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CATALYTIC ANTIBODY 19A4 (LIGHT CHAIN))
publication title Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
pubmed doi rcsb
molecule tags Catalytic antibody
total genus 43
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cf8H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cf8H01
1DQDL 2WK2A 1MIEL 4DUXA 4XCEB 1A5FH 3DXAB 1AKJA 3MRMB 4Y1AE 4KZDH 2VLLA 3CVIL 1YMMB 2VQUA 5IF0A 2GJ6D 4TSAL 4DVBA 1RVFL 2P43B 3VI4F 1CGXA 1GRWA 4MNHB 4KXZI 1BJMA 4YQXH 4MMXC 4P2RD 4QHNA 4JFED 2OTWB 4UTAL 2R9HD 3X3GH 4HSQA 1KLUB 2XQBL 1U8HA 2EZ0D 4HK3N 1NCUA 3WHE0 3WXWH 2NZIA 4ETYA 4I18B 2GUOB 4F8TA 2A6IB 4OZIE 2C4FT 3AS0A 1KB5H 3O2DA 3WFDH 4OZ4B 1DBBL 2CIIB 3HZKA 3QWOA 4IOSD 2QHRL 3TIEB 4OV5A 2Y72A 3Q1SH 5C07B 4CN4A 2B1HH 3WXVL 1P4LA 1J0ZA 3DI3B 2DTML 4XZUB 1MLBA 2XZCL 4DOHE 5EOCL 4HK0A 3BP4B 4FQQB 3QUZB 3PWJB 4IDJH 4O51B 2H2SD 2FYYB 1LO0H 1IC7H 3QIUB 1KEML 2R2CA 5HI5C 4OI8A 3IGAB 3FTGB 3QEQA 4R0LA 1S9XB 1PAMA 4NHCH 2NXYD 5ESAB 1DANT 3ULUH 1NMBH 3FB6B 3VRJB 3DO7B 1I8LC 5KTEH 1LMKA 2EC9T 3MLVL 4M6OL 1ETZB 2WBJB 5B38A 1NPUA 4XP4L 2J12B 3G6JB 4WFFE 1JN6B 1FYTE 2A38A 1J05B 3KXFE 3VFGL 4MA7L 2WUBL 2AQ1A 3O4OB 1QRNA 3RDTC 5F3HB 3VXOB 3FO9B 4MQ7A 1JZ6A 1KIRA 4K2UL 5DFVD 2NY4D 3RA7H 5DYOB 5SWSE 2OLDA 4G6KL 2W65A 4I3RH 1T21B 1XF3A 2EYTA 3QXVA 1JHLL 3GMLA 4J6RL 4MA1B 3U2SA 1KGCE 3PQYA 3R1GL 3NABL 4NQCA 1TCMA 4OFDA 4HWUA 1UJ3C 2R4SH 3S36L 3CFBA 4DJMA 2FATH 2X4QB 5F7DA 3GNML 2YPLA 3CXHK 4PJ7A 1AQDA 3NN8B 4XVTL 3TN0B 3UZQA 3TJEL 4S1QH 1MCIA 4HS3B 5BMFL 1P5VA 4HMDA 4R4BA 4OV6F 4LARL 3JV4B 5CCKL 2DBLH 3LKRB 4YGVB 3LS4L 3RU8L 1JUFB 2BMKB 4XNZC 5EG6C 5D1ZD 4OFYD 1TJIL 3ROOB 4F7MB 3HRZA 5GRJH 4PJ5D 3JVGA 1DBKL 4Q6IA 1S7XB 5IFJB 4ZUTB 2ZKHL 5TPWL 2HVKB 3O6MH 2BJML 3UTZB 2AGJH 4BSWA 1URLA 4JFDE 2IBBA 1AR1C 2AV1B 5D1XD 5E8OB 1GH7A 2X42A 4O58L 3OGCB 1HHJA 2J8UF 4X99B 2Y1VA 4HPYH 4OCWL 5D2LF 4OJFL 4QYOA 5T5FL 5F96H 2CGRL 2Q8AH 4AEIH 3RX8A 4YX2H 1E4WL 1Q72H 5E00B 3MRBB 1PFCA 1A64A 2YZ8A 3DRTA 1N5AA 1UACL 3LD8B 3RVTD 4AL8H 4IRJA 4H1LG 3WKMH 4KK9D 1FNSL 1P53A 1VFOA 2L0DA 1GAFL 2A83B 3LKOB 4UU9A 3IFNH 5J11B 2X9WA 4MX7A 4PRHD 1A47A 4K94L 4XVUD 3MRLB 3EJZC 3ES6B 5KSAC 4LSUH 1EHXA 4JFQB 1H5BA 1YNLH 3MCKB 5DRNB 5EN2B 3O81A 1FNEB 4WFGE 3T4YA 4DFIA 3LEXB 1IAKA 3P2TA 3BIKB 3F58L 4K3DL 2GY7B 4OLVL 5ID1A 1E6JL 2NXYB 5GGRB 5CAYB 4AG4H 4OAWA 1OD9A 4G80B 1PX4A 4HKZA 2NY7L 1INQA 2YSSA 2VWEE 1MFDL 4NNYB 5MHSE 3BGFC 1BFVL 4PGCB 1OB1B 1QLEL 3UYOD 1WT5A 3OKYA 2HT4C 1QA9A 2QQNL 1T2XA 3QO1B 4MDJA 3L3KA 2NY4B 3GGWB 1FNAA 1LP9A 3F62A 1V7NL 2DI7A 3MNWA 4NRXB 1EFQA 4FQJL 5E8DH 2EDLA 2QQLL 4M48H 1DBMH 4D8PB 5BVJB 4TUOA 1MCPL 4DWHA 4ONGL 1JI1A 1NCBH 3CDGB 5CINH 3SCMA 4L9LB 2VR9A 1NFDA 5CJOH 4BUHA 2DQJL 3QWRD 1GGBL 3G9AB 5J13C 2NY0D 1ZHLA 2E9BA 3CK0L 4Z7VE 1QO3A 3TIDB 1I3VA 1C5CL 5EZOH 1DQML 1VKXA 3IXAA 3VFUB 5E2WH 1BBDL 1W72L 4NUGL 4PB9L 1OGAA 1CGVA 4Y4KC 2ORBH 2P5WB 4OLZL 1D6VH 3WFHA 4NQDD 1CLOL 4WDIA 1UCBL 35C8H 3LQZA 1NEUA 5FHBL 1H0DA 4LKXA 1YZZA 4XC3H 5D1XB 4AEFA 1XF1A 3GB7A 4CADA 4JG1L 4NZUH 3SOBL 2VN4A 5EOQH 1FV1B 3L3DB 1ORSB 3FQTA 1RK1B 2ICEB 3OJVC 4L3ED 4RWYH 3V6OC 4BH7A 3MLRH 5GISL 3ZE1E 1UM5L 3FRPA 1DJSA 3E1F1 4AT6B 3WL9A 3PWPA 3CJJA 4WO4D 2A9MH 4NYLB 2ZJSL 4NRZA 2CO7B 1XF5B 4PJ9C 3RWIB 2MKWA 5IFAL 3AUVA 2H45A 2Y4SA 4AIZB 4LCUB 3OXRB 1U36A 4WCYL 4JJ5A 2P5EA 4M6AA 3PP4H 3ZTNL 1S9KC 4I4WB 4ZO7A 4HGKC 1LEKB 5T3ZE 2J8UB 1UADC 4IMLA 1A6VH 1J0IA 5D2LB 3JWOL 5J57B 2E27L 2ZOKB 5FKAA 1SJHA 1CFVH 2HP4A 5I1IH 4JG0H 2QLVB 4EBQL 1CE6A 1FYHB 3PIQB 5D2NA 5EO9A 1UXWA 1NL0H 3C6SB 3B2VH 4PP2A 1AIFA 2HVJB 4I3SL 3REWA 3WFCL 4OD3L 4HEME 1WZ1L 1OT2A 4ZTOH 1DBJH 3CZJA 4X4ME 3ARBD 3VFNB 2J6EA 4I2XE 3HMWH 2GJZA 2VLKD 4ZUSB 4KDTC 2IALA 3LN5B 4R90H 1IC1A 4PJXE 4QHMB 4RGMC 2D7QA 3FQXB 4PJEF 3T0XA 4CJ1A 1T5WA 2Z92A 2H3NB 4NN5B 2PKDA 4WWKC 3IDYB 5ECJE 4X5XB 3QDGB 4G8GB 1WWAX 4HJJL 3BRGC 4IM8A 3RBSA 4P4KA 1RIVH 2DJSA 3DVNA 1JNNL 3PWLB 3ZO0A 4BSVB 5H35B 5JHLH 2APVA 2QSQA 4FQPA 1CGSH 3MBEC 2NY0B 2NTFB 3VFSB 4Q97A 5IVXA 1UWGH 1PGRB 5FGBA 4DVRH 1L7TL 1KIUA 2R56L 2HT3C 2CRIA 3BD3A 3V4VH 3IXTB 4XTRD 4KVNH 3CVHB 1ED3B 2B0SH 1MVUA 5KS9F 1U6AL 4O02H 3S36X 3RTQB 3D18B 3N85L 3O3DA 4NQDB 3EYUL 1L7IH 1JF6A 2GTWB 4M00A 2VL4A 4E41B 6FABL 5J12B 3FOLA 5IVOA 3RVVC 3NCFB 3VJ6A 3MCG1 1N7MH 2YUXA 5CEYB 1WEJH 1YUHA 2D0GA 3MREA 4L3EB 4GAYB 1TENA 1KTRL 2YPKB 3UTTE 5L7XH 3DV4B 4WO4B 4Z18A 5I1DB 4YUEL 3L3JA 4I1NB 4PR5B 4L8BA 3U1SL 4PTUA 1SYSB 4NO3A 3MOAH 3FB7B 3U83A 5DSCB 5J6HB 3KDMB 4QTIH 2WWMC 3B2UC 4MCYA 3VXRD 5GSVA 2QEJA 2BXYA 5K59F 5HHNA 4R4ND 3HAEA 2QSCL 2VLRD 5D6CB 3U4AA 1BEYL 4OF8A 5L88H 5B8CC 2VH5L 4OF5A 5DJ6A 5T1KA 3S88L 2PO6A 1NBZB 1S9YB 5GGUA 2F74B 4ISVA 2W9LA 2H8PB 3CFEA 2I60H 4G43A 3NFPB 4N8CH 3MUHL 1CXEA 5DS8A 3PDOA 3M1BB 1IEAA 2J4WH 5IJVA 1XGYL 3V0VB 1J1PH 3E2HC 4F7TB 1FNLA 3WN5A 5ANMA 2QBWA 3LDBC 4X6BA 2XWBB 2Q1EA 1MFNA 2FIKB 5J1AB 1RJYA 3ARBB 3STLB 1P2CA 1EAJA 4KRMB 1QEWB 2VLKB 4LLDA 1FPTL 4QOKA 4N9OB 4RX4A 3D0VA 2AK1L 3S5LG 2YXFA 3DRQA 3GMOA 4XI5D 4LGSB 1XGTB 5BJTA 3CFCL 1VFAA 3HNVH 3U36B 3MCLL 1KULA 3C2AH 2FD6L 1LEGB 2OQJB 3EBAA 4FXKA 3VXQA 3QRFM 3T1WA 4YDIL 1T3FB 3ZDYE 2Q8BL 2PNDA 1RHFA 4FTVD 5I73B 4Q6YA 4DZ8A 2FX8L 3BSZL 4JHAL 2MCG1 1T04B 3QXWA 4XP6L 4MAUH 2BRQA 1KJMB 4IOFD 1Q1JH 5TDOB 4AENA 3D85A 4M7ZC 4PJEB 5TH2A 2H32B 3CD4A 3ZYIA 5KSVB 5CMAB 2XY2A 3QFDA 1AE6L 2YMXH 4NPYB 2PW2B 4DGYH 5FGCE 2E7CA 5GGSA 4L8DB 5FDYA 3MRKA 5JOFB 1XEDA 1DQJA 4LCYA 3GIZL 3JXAA 1DQDH 3P3YA 1MIEH 5EBLA 5KN5B 3OQ3B 1KG0B 3WNNA 3MUGA 4APQA 3DYMA 1VEPA 3CVIH 5IVNA 1CR9L 1QNZL 2EKSA 4GW5B 1RVFH 4TSAH 2J2ZA 5KS9B 5IBUB 1HQ4A 3VWJC 3JSSA 3S3JA 4LBEA 1QLRB 5M7QA 4F7EA 3C60A 1K8IB 2ERJC 3QZWB 1TZHA 5E2UL 3BEWA 3SY0A 3VXRB 3VMPA 3IFLL 5F88A 4QRUA 4RFOL 3C9NA 4UTAH 3ARFA 6CGTA 3NIFF 2XQBH 2D9QB 1CD9B 2N7BA 2QKIA 3OKNB 2A6DB 2NLJB 1YECL 4HEPG 4YEEA 4LFHG 1Q9KA 3OHXB 4MJ4A 4YWGL 4ZS6C 1DBBH 1MI5D 4HWEL 2QHRH 1MFAL 1DUZB 1OSZB 1FCGA 3WXVH 1G7LA 3R06A 5EZJA 4ENEC 5H2BA 1O7VA 2DTMH 2XZCH 5CSGA 4WUUD 1K4DB 5EOCH 5DJZA 1CD1A 3TBVA 3RVWC 4GLRI 1N3NA 3ZKQD 5ETUA 1R3LA 5TE7L 4N0UB 1KEMH 3ALWA 4ZXBA 5CGYD 2QV2A 4NKDA 4PV8A 5JLZB 3O8XA 4J3VA 2L4OA 5JHDE 3MLVH 1JWSB 4M6OH 3K2UL 4JO3L 1JVKA 1RZIA 4XP4H 4UTBL 3QEQD 3PL6B 5MEOA 3VFGH 4MA7H 2WUBH 3WJLA 3CSBA 4PBWD 5ABDE 4ZD3L 1CG9A 2ZUVA 1YPZE 4CKVX 1AGEA 1GPOL 3MR9A 4ZFGL 2F53B 4K2UH 1T0MA 3W11D 5ICXB 4PJ7F 4HUUB 3CDCA 1G6RL 3Q3GA 5DUML 4M03A 3FT2B 4G6KH 5GGRY 2VIRB 4EN3D 1JHLH 4J6RH 4DQOL 3WD5L 4M9PA 4N0FB 3R1GH 2NY3B 3NABH 2H9GB 4ZAKD 1EERB 4LLQB 3S36H 4JM2F 4S11A 3CMGA 2MHAB 2AEPL 3P4NB 4Z0BL 4KZEL 1J0KA 3HI5L 3L3OA 3GNMH 2OTUB 4JZNA 4XVTH 4MQXD 2W1NA 4JRXD 3TJEH 3I75A 1ZHBA 5BMFH 3QFJB 4X4YA 5IW3A 4OFVA 2ATPA 2D3VA 4LARH 4P9ML 5H94B 5CCKH 2ADGB 1QOKA 3LS4H 25C8L 4OD1L 4LU5L 3RU8H 5I2IB 2YPLD 4XRCA 3RWJB 1MREL 2R8SL 1TJIH 4H26A 3RIFK 1DBKH 3HI1B 3D3VA 3QNXA 3UP1A 5FO7B 5LGJA 4DEPC 2ZKHH 5TPWH 1MNUL 5ALCL 2F8OA 2BJMH 3MLZL 4XC1L 2HLAA 1T0NB 3ARGC 4JM2D 4KV5E 1PKQA 1RURL 2OBGA 4O58H 1AKJB 4PJ8A 5GS2H 1A1NA 4I13B 4OCWH 4KI5D 2AERT 4OJFH 5IF0B 3SEPA 3QQNA 4DVBB 5T5FH 4U1KA 2RCSL 2UV3A 4I18C 5FGSA 2CGRH 4Y0GA 5C7XL 3VFRA 1Z0NA 3BPOB 4N9GA 5HYSG 2HTLC 1E4WH 2APTA 4DCQA 5HVWA 2E8ZA 4IIQC 3JUYA 1ZEAL 4H5SB 4J3TA 2F19L 2WWKT 1UACH 4QHNB 3IDNB 1KXVC 1RZFL 1FNSH 1WTGT 1OF2A 3PHQB 1GAFH 1PG7W 1MI5B 4K94H 3C6LD 3BDXA 4K7FB 2X1PA 5E0QA 3VDAA 5IW6B 4XCFH 1GGIL 4WUUB 5GRUL 2IPKB 1K3ZA 3HZKB 3QWOB 4HIIA 3PE9A 5L2KE 2HKFL 3BUYA 3MRNA 1WVZA 1YJDL 2H2PC 3F58H 4K3DH 3WDHA 5FDWA 1P4LB 4OLVH 1E6JH 1MLBB 4JRYD 4HK0B 2DQFA 1GGTA 2NY7H 1MFDH 4MXVF 3AS3A 3HR5A 2L7UA 3N0PB 1RIHL 5ILTL 1BFVH 2ATKA 3QEQB 4R0LB 4WI2A 1NFDF 1QLEH 5J56B 2JIXD 4R2GB 2QQNH 3V5DA 4MA1C 4JKMA 2OZ4A 3EJYC 2R0WL 2X70A 3ZZ1A 4LEXL 1FZOA 1V7NH 2AABL 4WEUD 4FQJH 4EI5A 5B38B 2QQLH 4JDVA 4X8JB 3QI9C 1MCPH 2RR3A 5SWQA 3DYOA 4ONGH 1HQRA 3SE3C 3JV0A 5HSFA 5IQ7L 1G6RA 3SGDH 2X2YA 4MQ7B 5KSBE 3C5ZD 4ZAKB 2PW1A 2DQJH 1U3YA 3DJ9A 1I1RA 2NY6D 5KVGL 1GGBH 3GBNL 3CK0H 2W65B 1XF3B 2EYTB 1CICA 3GMLB 4TSBL 2NX5A 4YC2C 1MWAA 3PQYB 2PXYA 1C5CH 5C0BD 4CRPA 3U2SB 4NQCB 4LCIH 1QSFE 1BBDH 1W72H 3CFBB 3DGCR 4NUGH 4PB9H 2ZUSA 5B3JF 2DKSA 4X6DA 2YPLB 2EKJA 2DKUA 2ENSA 4PJ7B 1AQDB 2IJ0C 3JTSA 4KUCF 3KHQA 4OLZH 2WAHA 4ONFL 4WGWB 1OTSC 4R4BB 1UCBH 1GZPA 3P73A 2NXZC 3VXUA 4MNQE 5E4EC 2IFGA 5FHBH 4JM2B 3CPLA 1IE5A 1T7WA 1T7XA 4JG1H 3SOBH 3HRZB 5GSRA 3FN0L 1S9WB 3IJSA 4Q6IB 2OYPA 2DYPA 2NTSP 5GISH 1UM5H 1OAXL 2PYEE 5A2LH 1WITA 3ZE2F 1QSEA 1RHHA 3RGVA 2IAMA 3RWCB 1RZKL 2R23A 2ZJSH 1B4JL 1FC2D 1CDCA 1HHJB 5J11C 2WBWB 4R96A 1N6UA 2MCPL 4KUCD 5IFAH 1HYSC 5CWSA 3HAEH 4CU6A 2JCCF 4IMKC 5JXEA 4WCYH 3GK8L 2WANA 1A6TB 2FNBA 3PWPD 4FHBD 5F7YC 3ARPA 3ZTNH 1QACA 2NY2B 3DRTB 1N5AB 4G6ML 1P9MC 4ODVL 5I18L 4IRJB 1B88A 3JWOH 2NY1C 2K3TA 1TCRA 5IB3A 1LK2A 2GAZA 4UU9B 5BZWB 5KVMC 1TZGL 4EBQH 1J7VR 5HHOE 1H5BB 3QG6A 4R8WL 4JRYB 2VZ3A 4LVEA 4I3SH 4KKLC 3T4YB 3GMQA 3WFCH 3W9EA 4OD3H 2R0ZL 3TESA 1WZ1H 1IAKB 5E6ZA 5LGHL 1OP9A 3GKZA 1N6QL 2X4TA 5ID1B 5I6XC 4KROD 2BK8A 5E6ID 4OAWB 2NYYC 3TCXA 2DM4A 5KOMC 1INQB 5IVXF 1IEHA 1MRDL 2DICA 3C08L 4HJJH 2QQKL 1WZLA 4MDJB 1RV6X 1JNNH 3I85A 2CR6A 3L3KB 4W81A 2IBZX 5FYJD 3MNWB 2JB5L 1AP2A 4LLWA 1X4XA 2G5BA 4M4RA 4LAQL 4TUOB 5JR1L 4XMLL 5T33L 3P40A 2APBA 1V3LA 1L7TH 4P4KD 2R56H 5C0BB 1NFDB 3GSNA 3QHZL 2YZ1A 1U6AH 5DMKA 1ZHLB 1OT1A 3UAJD 1QO3B 4E0RA 3WLWC 1CXKA 3K81A 3PXJA 4F37F 3N1MC 3N85H 4JFHE 1BZ7A 2YA0A 2VUYA 2J88L 3EYUH 1ZWIA 4WFHD 1VKXB 2QTEA 3ZSSA 4Z7QF 6FABH 3QUXC 5H8DA 4PRID 5E56A 2ZCKL 1OGAB 1NGQL 1J11A 1UKTA 4WDIB 4P5TA 3UC0L 2X4OA 1H0DB 4LKXB 1YN7A 5IHUL 3N06B 4YUEH 3GB7B 3TJHD 4CADB 3U1SH 2JELL 3FQTB 1ACZA 3VD5A 1CDYA 4BH7B 4Q0XL 4MWFA 4PLOB 5A16A 4LVHC 3BP7A 3MLPA 3HZYA 1BLNA 3BW9A 3RWDA 1R24A 3WL9B 3PWPB 3NCBB 3ISWA 4NRZB 4YEFA 2QSCH 5CS7A 1T5XB 5HDQL 3VXSA 4FZ8L 1BEYH 1EHNA 1M4KA 4HKXA 3LZFL 2OXGA 2VH5H 1ADQA 3S88H 5DMJB 4JJ5B 4GSDL 3OZ9L 3HRPA 1KXQE 3D0LB 4XCCL 3UBXI 4N1EA 1MJ8L 1LQSR 2NZ9D 4IMLB 5C2BL 3X13B 1U3HC 5FKAB 3UPRA 1SEBA 4YPGA 1XGYH 2JCCB 1CVSC 5C08E 1SJHB 2EYSA 5D7IE 3B9KA 1CE6B 4P2OC 3HPLA 4JPIB 3IDYC 3ULUC 5EO9B 1UXWB 1MFEL 4PP2B 3VGFA 4KROB 1AIFB 43C9A 1FPTH 2N7AA 1UCTA 4YR6A 4PGDA 2AK1H 4JAMA 4Q9CA 3REWB 2APXA 1JNLH 2CKBA 2QADB 3CFCH 4WY7L 5IIEA 1K3IA 4YIQA 1UZ6F 4U6HA 2GJZB 2FD6H 4KKCC 3OAYK 4RMSA 1KCVL 3LSOB 3NOIA 3AB0B 5GGTL 4YHML 3UJIL 4YDIH 5TJWK 4HIJA 1G0YR 1T5WB 3F12A 3RWEA 2Z92B 2Q8BH 5HGGS 4WW2B 5H37G 1VGKA 2WIIA 2FX8H 3BSZH 4JHAH 1SY6L 4P4KB 3RTQC 4XP6H 3KPRA 3VRIB 4NC2B 4QRRD 2A6JA 5CEZL 4JB9L 5IVXB 4J4PA 3DMMC 3D69A 1JZ4A 1AE6H 1BIIA 1MVUB 4KWUA 4H0IA 3T0ED 3K4ZA 3KPMA 3CAFA 3GSVA 4JHWL 2VQ1B 3GIZH 1HEZA 3O3DB 2FSEA 1MFBL 4IBLT 2E7LA 3FOLB 3V4PL 1NDGA 4V2BA 4GW4B 5E8PA 3VJ6B 1NGWA 1CR9H 1QNZH 4P2QA 4OSUL 1YUHB 3MREB 1I1YA 4K07A 3O9WA 3L5JA 5E2UH 1KTDA 2YHGA 4ZPVA 5AYUL 3IFLH 4L8BB 3UTSD 4BK4A 1Z9SA 4NOBA 1UEYA 4RFOH 4NO3B 3DROA 4X9BA 3KLAA 1HWHB 4MCYB 4MS8D 1MHHA 4OZFH 5GSVB 1JYXA 1IT9L 5I71B 5HHNB 1YECH 3WLBA 3FQNA 2Z8SA 4FNLH 5FXCH 3ARFD 4YWGH 1Z9LA 3MTRA 2WMPA 5DFTA 2OR7A 2UUDK 4XPFL 4G6AC 5T1KB 4HWEH 5BV7B 2PO6B 1T7ZA 1MFAH 4N0CC 1L0YA 3ZYOA 1QKZL 5GGUB 3GI8L 4ELKB 3MRQA 4Y8DC 3CFEB 4G43B 3EYQD 3SGJC 3MV7E 3MC0A 5DS8B 1NGZA 4NO2A 3PDOB 5GRXG 2OR8A 2P8LB 1IEAB 3TZVD 2APWA 5TE7H 3I02A 1I1AD 5IBLD 4OLXH 3KPSA 2HT2D 1N0XL 3WN5B 5ANMB 3EAKA 2X4NA 4BQBA 4X6BB 3P11L 4H0HB 3NIGF 5HHME 4CVWA 1RJYB 5FB8A 3BQUD 1P2CB 5I73C 2D7NA 4LLDB 1FVCA 5GRVK 4HCRA 4QOKB 5I15L 3SBWC 3D0VB 3K2UH 4JO3H 4YNYA 5C92A 5MENA 3C09C 4ZXBD 3F5WB 4UTBH 3GMOB 5BJTB 3MV11 3QDAA 5I74B 1VFAB 4ZD3H 4CW1B 5BXFB 1GPOH 4ZFGH 1NMAL 2WLYA 2YUVA 4FOMA 4F57L 4FXKB 3VXQB 1G6RH 1F2QA 4HWBL 4K9EL 4TNWK 5DUMH 1JZ3A 4DKFL 5FK9A 4GS7B 1A0QL 4HDIA 3IRPX 5GRVL 4N0RA 5M94B 4DQOH 5FGRA 4NGHL 4DZ8B 4YAQA 3D39A 3WIIL 2AEPH 3O6FC 4Z0BH 1YMME 5JA8B 4WV1A 3HI5H 4KZEH 3KS0H 1T83A 3L7FA 3E6HB 5DFWH 4X6FA 3D85B 4AENB 5EUOE 4JY5L 5TH2B 4DGVL 5JDJA 2WBKA 4YPJA 4KK6C 3HCVA 4U1SA 4P9MH 25C8H 4OD1H 4LU5H 3QFDB 2R8SH 1MREH 5F7KC 1A7RL 4UOW0 1UA6L 3T4AA 1NJ9A 5C0EA 5GGSB 3MRKB 1MNUH 5ALCH 5F6HI 3MLZH 4XC1H 1DQJB 4LCYB 3S4SA 5EBLB 4PJFA 5CJXA 1BPVA 3CLFL 2FDBP 3FHQA 1U8LA 1CTOA 3MUGB 4Z7UA 3F6LA 4APQB 1W8OA 2Z35A 5J3HD 1DLFL 1I1CA 2G5RA 1L4IA 2EKSB 3QEUA 3UTSB 1G9ML 2RCSH 5CGTA 1HQ4B 5C07E 4RDQF 4LBEB 4WHYH 1P6AB 3VXMA 4F7EB 3C60B 4PJ8D 1ZEAH 5IBUG 1TZHB 2F19H 3BEWB 3P9WB 3ARED 5SWZA 5JA9A 3FQRA 4ZFOL 4OM1L 4QRUB 3QZWG 3VD3A 2X1QA 3C9NB 5T1LA 2BXZA 5BS0E 2NPLX 3ARFB 5BQ7A 1YDPB 3QNZA 2ZSWA 1MF2L 2QKIB 4MAYC 1B9ZA 1QYGL 3PJSB 5DI8A 1MCJA 1UM6L 2F15A 4GG8A 1Y6NR 1Q9KB 1JZ8A 1GGIH 2ARWA 1YEFL 1HXMA 5GRUH 1EFXA 2NY5L 4M4PA 4ZOEA 4OUOA 3C87A 4U6VL 1CFNA 3TZVB 1VCAA 4GKZB 1YJDH 4GBXC 1G7LB 3VRLF 4POUB 5EZJB 2VABA 5H2BB 3PL6C 1PKOA 4Y5YA 5C09E 4NC1C 4POYA 3AS1A 4K8RD 1EO7A 5DJZB 1CD1B 2VQTA 3TBVB 1N3NB 3WS6C 2W9EL 5ETUB 4R97B 1R3LB 4TUJA 4Z7WA 4ELMA 3WV0A 2F8XC 4XHJC 5ILTH 4ZXBB 1RIHH 4G42A 5HXMA 5E95B 5DJCA 1NAML 1D6EA 4NKDB 4PV8B 4OBSA 4KAQL 3O8XB 1S7WA 4D9RD 3PHOA 1UENA 1GGYA 2NY3C 3OXSA 2IPUK 2R0WH 4LEXH 4X7EC 5MERA 4WNQA 2AABH 2VXTL 3HS0A 1RZIB 3TPKA 3BYYA 1TVDA 5IKCB 4YZFE 1CDGA 1TPXC 4BJLA 1CG9B 1MHEA 5IQ7H 4L3AA 4HWBA 4XPAL 2PN5A 1AGEB 1Y6KR 1JYNA 4X6DF 4AQOA 3Q3GB 4EI5D 3MOBL 4R9HA 5KVGH 1ZLVK 3GBNH 1YEGL 1FO0A 5HGBA 2Q87A 3CC5A 4TSBH 1C08A 2HN7B 2UY7A 4NOFA 3O3AA 3WUZA 3RIAF 3RPIA 1F3JA 3GO1L 4MSWA 3O6LL 1IBGL 2QR0A 4PJHA 3VXTA 4JFEE 2FECL 4JZNB 1DL7L 1SMOA 2GKIA 1LNUB 1KJ2A 3G5XA 3OAUL 3I75B 3SQOL 1ZHBB 5CZKA 3OTTA 4ONFH 4PG9A 1QLFA 1CFSA 5KW9L 2ATPB 1ZT4A 4UT9L 3GRWA 4XRCB 1CL7I 1LD9A 3RIFF 2A6KA 4O2FA 4H26B 4MQTB 3SKMA 4J1UA 1VADA 3FN0H 3RQ3A 1OWRM 4S1SL 3D3VB 3QNXB 3VI4E 4CVZA 5LGJB 1H3PH 1I8LA 4XB7A 1TQCC 1OAXH 2HLAB 4B50A 5F6IB 1DP0A 4MHHG 1PKQB 3IDMA 4PJ8B 1RZKH 2XKSA 1ZT1A 1B4JH 1S7QA 1A1NB 3AREB 2DN7A 4L1HA 2E6PA 4POZD 4EIZC 3PV6A 1RFDL 2MCPH 3KGRA 3VGDA 4U1KB 4YFDB 3VFRB 3QR2A 3GK8H 1F8TL 3QB7C 4DCQB 3DX8A 1SQ2N 1CXIA 4AZ8A 3BGAA 1ADQH 4G6MH 1JF1A 3QEHA 4FQ2L 4NZRL 4OBRA 4ODVH 5I18H 1UJ3A 4ZUUA 4LQFL 1JPST 2GJJA 4XXCC 4X7CC 4OIBA 3HLAA 1OF2B 1YNKL 4LSPL 3F8UB 1J8KA 3FO2A 4LPVA 3P77A 1TZGH 3SDCD 5CZXD 4GUPA 4Z95L 4R8WH 4HAFA 4NRYA 1XFPA 1JPSL 3MRRA 4HIIB 4PJGE 4NHUA 3GJFA 1JYWA 3BUYB 3MRNB 2XA3A 1T1XB 1AI1L 2R0ZH 1NCTA 5LGHH 5FDWB 1N6QH 4DUVA 3TVMC 1T03L 1HSBA 4OCLC 4C57C 5EIQA 3EDEA 2DQFB 2O93L 4PLNC 3EDDA 3IAQA 1BFOB 3UBXA 4XWOC 3VGAB 3H2WA 3HR5B 5E1HB 1L9NA 1JHTA 4LRNL 2ATKB 1MRDH 3K74B 4BFEA 3C08H 3WJJC 4HJGA 2QQKH 1UZ8A 4B41A 3V5DB 5CD3A 1LE5A 3W0WA 4P0DA 4KTEL 3BKJL 2P5WE 2X70B 2YN3A 3HE7C 1FZOB 4TVPD 4GLRH 4JFDD 4EI5B 1QUNA 4M6NL 4JDVB 3FAXA 2FEDD 3TCLA 4LAQH 3NMEA 5JR1H 4XMLH 5SWQB 5T33H 3CUPB 3ARDD 1BQHA 5B38G 3EOBB 2F54D 4N8VA 4XH2A 3QISA 3QHZH 1HHHA 4O4YL 5KSAA 4X8XA 3QPQD 1XF4A 1LDPL 4PRNB 4GW1A 1UG9A 4OFPA 4N1CA 4WI8A 1CICB 3GSWA 5D5MB 4BM7A 1NH6A 1MWAB 2PXYB 5DEFA 2J88H 1J18A 3IDXL 4RGNB 1ITBB 5DF0A 1JZ5A 4X6DB 1QBML 1MUJA 1NGQH 5JW4Q 3JTSB 1NUFA 1NKRA 3UC0H 4PRHE 1GZPB 3CXDL 5JIPA 2O5XL 4MXWL 1U41A 5IHUH 3CPLB 1WF5A 2DLTA 1KC5L 4YDJA 1ZA3A 1B2WL 4HH9A 1ZHKB 2JELH 4D0DA 5GSRB 3IVKA 3OPZL 3IJSB 1IVLA 2NY2C 2DYPB 1I8MA 4EUPA 4JDTL 4LHJB 2VXVL 3B3IA 4Q0XH 4PYGA 4LVOB 3GM0A 5F89A 5BRZD 4LSSL 2B20A 2HRLA 2NW2B 5L0QC 1U91B 2R23B 4XVSL 4R96B 5HDQH 1F11B 4FZ8H 5EB9A 1G7QA 3LZFH 4HIXL 3A6CL 5CWSB 4PTTA 1H5BC 1FN4A 4GSDH 3OZ9H 4OQTL 2DQTL 4XCCH 2OMBA 2D0HA 1UEMA 3FL7A 1MJ8H 5C2BH 2XTJC 1EV2E 3DX6A 2I9TA 4Y4HD 1T6VN 4DTGL 2MOVA 2H41A 4U1HB 1TCRB 3QDJD 1EX0A 1SHMA 5IB3B 4Y4KA 4ONOA 4FG6D 3W2DL 1Z3GL 3MJ9L 3K4DA 3H3KA 3BP5B 1XIWD 5I1GL 4GQ9H 3QG6B 1MFEH 1F4XL 4M93B 2OL3L 3M17A 2B4CL 1K8DA 3EDFA 2MQ3A 5J9PB 3HE6A 3D2UA 3GMQB 3H3PL 3W9EB 2AJXL 5TF0A 4WY7H 3HPJA 1VHPA 5KANI 4K23L 4OCYL 1IKNC 2EDOA 3GEWB 4I0PD 1S5HA 2X4TB 1KCVH 3JZ7A 4FABL 1UGNA 4Z9KB 2A1WL 4YHMH 5GGTH 3SCMC 3UJIH 4OGXL 5JZ7D 3ULVD 4O2EA 4PJ9A 3ORJA 4Y2DA 4XCNA 1WIOA 1JZ7A 4NQDE 4ODBD 4E41E 4S0TD 3IS1X 3QA3A 1SY6H 5FHAL 3ARDB 2F54B 4JHBA 1IQDA 1Q94A 3NCYP 4L3EE 2IFFL 1AP2B 3OAYH 5CEZH 3UJTL 2QJDA 3B9DA 4LLWB 2G5BB 5EU6A 3WDIA 4JB9H 5HDLA 2D0FA 1ZGLP 2ZUXA 5EC1A 3RVXD 3KPRD 3KPQA 3GSNB 4YXKL 1HKLL 2CPCA 5DMKB 4KK8D 4PJBA 4U2YA 1U95A 4RRPA 1JPFA 4E0RB 3RZCC 3U82B 4JHWH 4NCC1 3INUL 3L95B 1JWMA 1BZ7B 5JOEA 4PP1D 5T3ZD 4M43L 2K9UA 1WZMA 1H15A 1MFBH 1VEMA 1ZWIB 4NN6B 4X6CA 4LSVL 5HVFB 3V4PH 3T08A 3FO0L 4XPBL 5EBGA 4K8RL 3V79C 1VPOL 3QAZB 4KDTA 4OSUH 3SKNB 5C0NC 3UCRA 2X4OB 2LFGA 5BRZB 2X9XA 4TULL 5CJ8A 5IEKA 1CGWA 5AYUH 4P2QD 4UI2A 5F7UA 4D3CL 3UTQA 3MJ8A 3MOQA 3GMNA 4KK5D 4MWFB 5A16B 4RAVA 3QQ3A 3BP7B 4PY7A 3HZYB 1BLNB 3BW9B 5GGSY 2J5LB 4K94C 1R24B 1IT9H 1OCWL 5B21A 2VLKE 2WP3T 3VG9B 4PRBA 1Z9MA 2G75A 2DI9A 4HKXB 2C4XA 4XPFH 5D2NC 2HTKC 1QKZH 4X4ZA 3GI8H 4U3CA 1M6OB 4LLMA 5CSBA 1EMTL 4EOWL 3VI3F 2JJWA 1MCBA 4PFEA 4ODUA 5I8OL 1LO4L 4UB0L 3UPRB 3B8SA 4Y8AA 1SEBB 4QRSA 4YPGB 3BFOA 2EYSB 4CJ0A 1N0XH 3W39A 5DLML 4KJYA 3P11H 1CFBA 3B9KB 4OGAD 5ICYA 5MP6L 2VLJA 4Y5XA 3HPLB 2P48B 3BKCL 4U1IA 4QNPF 3H9SD 4YDVA 4PJEE 4NKQB 5I15H 1TVBA 4YR6B 4V1DD 5JIHA 4PGDB 1II4E 2ED7A 2VXUL 4JAMB 1O7SA 3SO3C 3DECA 5HI3C 1DQQA 2CKBB 5IIEB 5JMRA 4YIQB 3OF6A 4JQVC 4U6HB 3DI2B 1JHKL 1U58B 4F57H 2Z9TA 4HWBH 4K9EH 4DKFH 4Z8FL 1A0QH 3F12B 1A9BA 3RWEB 1FL6B 3DETD 2Z4QB 3RX5A 1OAUL 2DLEA 3GBLA 4NGHH 2WIIB 3RNQA 1YY8A 5KBNC 4PJCA 5KS9E 3KPRB 2G60L 5JNYA 1FBIL 3PV7A 3ARXA 2A6JB 4KRPC 4NJAL 4P5MA 4GRWH 5DRZA 3TT1L 2XWTA 4JY5H 3BPNC 4DGVH 1D3CA 1U8KB 4DGIL 4JKWA 3D39D 3D69B 2G2RA 5DT1L 3VXRE 5HTSA 3MGAA 3D87B 3OKDA 4Z7UF 1I3RA 1BFSA 4XAKD 3G5YA 1A7RH 1BIIB 2H26A 3EO0A 1UA6H 4RA0C 5I8CA 3KPMB 4Q9BA 1VDGA 4LVNB 4CDGC 1A4KA 2EDWA 5C0AA 1DEDA 1HEZB 3QWQB 2FSEB 4B7LA 3SDDD 4EKXA 2X4RA 3CLFH 1Q9LA 3GMRA 1NDGB 2X40A 5D7JC 4TSCL 1DLFH 2YBRA 2EICA 1NBVL 4P2QB 3QDMA 3LPWA 1G9MH 1N59A 2VAJA 3SE8L 1I1YB 2ADJA 4U6YA 4Q74A 5IG7B 3CDYA 5K59E 4F3FA 5BV7C 1TJHL 2PO6C 3LPGA 4WW1A 1F4WL 4ZPVB 3EYVA 2E5EA 1OGTA 4OM1H 4W6XB 1A14L 3JWOC 3Q6FA 1CXLA 5HY9A 4Y1AA 2B8OT 3DROB 4P3DA 5FA4B 4N0UE 3VXMD 3KLAB 4Y88A 3OBAA 1TXKA 2GITA 1MF2H 2VTFA 1QYGH 1MHHB 3FN3A 2EXWD 5SWZD 4DUWA 4QWWD 3U30B 1UM6H 4ZFFA 3EZJB 5JORA 4PJAA 3FQNB 3WLBB 5MI0C 1A3LL 1YY9C 1YEFH 2NY5H 1DVFC 4ELMF 4Z7WF 4XPGL 4U6VH 1TNNA 4FTVE 3RX7A 2JTDA 3MRQB 3G9VA 5CP3A 1HHIA 3FQUA 4NWTL 1K4CA 4DAGL 4PLKD 1NGZB 1VFMA 1SM3L 2YD3A 3VFVA 1REIA 3NTCL 2LAAA 3CH1A 5INCA 2W9EH 2I07A 5EULV 3I02B 5DHXB 5FUCC 3OWEA 4JN2A 2X4NB 1C12A 1U8IA 3VWJA 4KMLB 3QBTB 5D4QA 1NAMH 3ZDXF 32C2A 1S7TA 2HG5B 2ZG2A 4KAQH 5FB8B 1FFNA 1CU4L 4KPHH 1FVCB 3RHWK 1BQSA 1IGCL 3Q6GL 1FFPA 2GSGA 3WNPA 2IEPA 4YNYB 2VXTH 5MENB 2EZ0C 3UDWA 4HWNA 5JQHC 3L5XL 4XPAH 4QKXB 4PJHF 1SJXA 3EYFA 5ADOL 3WKNA 1S7VA 4HULB 3MOBH 1M05A 3B43A 5FK9B 1NUDA 1YEGH 1W0YT 4HDIB 4OF0A 2BY0A 1WAAF 3NFNB 3UZVB 4YAQB 5DEZA 1F02I 3D39B 2IBGA 2Q7YA 3GO1H 3O6LH 1G7HA 4WV1B 4YK4B 5DR5L 1IBGH 1T4KB 1DL7H 3MRDA 2AP2A 3L7FB 3AU1A 3OAUH 3SQOH 3H9HA 4X6FB 2XXCB 5SWSA 5K9JL 1ZLVH 5KW9H 3TA3D 1FDLL 4WEBH 1V7ML 3QIBA 3HCVB 3HMXL 4U1SB 4JFXA 3UYRL 3HG1A 5D1QA 1EJ6A 4UT9H 2UYLA 1UXSA 3DVGA 3KNBA 4XP5L 1I7TA 3C60C 3W82A 5C1MB 1MVFA 3T4AB 4S1SH 1MI5E 2I26N 4LSQL 1FZMB 1X7QB 4UIKL 5DVLA 5HI5D 2ZG1A 4NQEA 3VE0A 2W91A 3V0AC 1U8LB 3P0GB 4Z7UB 5JXAH 2Z35B 4WUUE 4HUMB 3C5JA 3PWVA 3ULVL 1RFDH 3NIFE 3QEUB 5I1LA 1CD8A 1F8TH 3TNMA 3VXMB 4BZYA 2EIEA 5E94A 1ZVSA 5AWNL 1UQSB 4FQ2H 4NZRH 3RDTD 5SWZB 5I76A 1U0QA 3FQRB 1HSAA 4LQFH 1N8ZA 3U7WL 4OD2A 5T1LB 1G7JB 4OF7A 1FAKT 1AGFA 1YNKH 4Z5RA 2DQDL 2EDTA 2IMMA 4LSPH 3MBXL 2MSPA 3QEQE 2ZSWB 3QNZB 1X4YA 5DI8B 1SBSL 5GGQL 2BY3A 1HCVA 2GFBB 1WBXA 4R97C 2FH8A 4GG8B 5D1ZC 4Z95H 1LGVA 5T3XD 2BSSA 1JPSH 3OJMB 1HXMB 1IM9A 1EFXB 3VCLA 3QQ9C 5FAAA 5IWLC 1QPPA 1CFNB 5T3ZL 1AI1H 3T2PA 4MLIA 3S97C 5HYQA 2VABB 3ARGA 4U0RC 1T03H 3WJLC 2O26U 3E3QE 3G5VB 2YUWA 2GTZB 4TUJB 4ELMB 4Z7WB 1NEZA 2BC4A 3KYMB 4G42B 1J87A 4LRNH 1AR1D 5TFSL 3RVTC 2MQ0A 3HB3D 1D6EB 2DLHA 1OY3B 4IIQA 1HI6A 2YPLE 1S7WB 4HX1B 1FGVL 2W92A 4KTEH 3PGFH 3BKJH 3OXSB 3C2SA 4BFIB 4KK9C 4O2CA 1YEDA 5MERB 4WNQB 4P23C 2CK0L 3HS0B 4M6NH 3ZTJG 4PJIB 4XVUC 3ZKMC 4HH8A 2OTPA 2XG5A 1ZLWK 2DMBA 2Y6SC 4O4YH 1UYWL 4KI5E 2BHYA 1LDPH 1TETL 1PD6A 1FO0B 5HGBB 5KVDL 3CC5B 1FZKA 4P2YA 1C08B 2YWYA 5C9JA 1TQBC 1HHGA 3ELAT 3AMLA 2CR3A 3O3AB 3QIWD 2YRPA 3IDXH 3O41A 1F3JB 4JANB 4MSWB 5KSAD 4C54A 2CUIA 2QR0B 4PJHB 3VXTB 5DK3A 1QBMH 1KJ2B 1NCCL 3G5XB 1HK6A 3TLRA 1WV7T 5FM5O 4JKLA 5F1IA 4PG9B 1QLFB 2NR6C 1ZGLA 1EZVX 1U8NA 3CXDH 4B53A 4Z7VA 4FS0A 2E6JA 5HHVL 2O5XH 1ZT4B 4MXWH 5F7EL 2YD1A 4ETQB 1KC5H 1LD9B 4QO1A 1ERNA 1B2WH 2NNAB 3SKMB 4J1UB 1VADB 3OPZH 4QRPD 3O4LA 5D93B 2KQNA 3WIHA 4CVZB 4JDTH 2VXVH 4NZTL 4WI4A 1JMZA 3P0VL 4LSSH 3VFWA 4C55A 2QSVA 4OCNC 1ZE3C 1ZT1B 1S7QB 4XVSH 4JRYE 2HT4D 5DURD 3K4AA 3RDTB 3PV6B 5DUPL 2AK4A 4HIXH 3A6CH 4BZ2L 3FOMA 2XZQH 3BMVA 4ODHL 4OQTH 3DX8B 5E03A 2M1KA 1NUNB 2DQTH 4I0CC 1MH5A 4ODTL 1XGUA 1JF1B 4LCCA 5E1AA 5SX5K 3WUWA 2W0PA 5ACLA 1UJ3B 4ZUUB 5J4MA 3EO1A 5ITFA 4DTGH 4WTWA 1NMCC 1XMWA 3HLAB 4HLJA 4B5EA 4M61A 1NGPL 1XAUA 5DQJA 3FO2B 3W2DH 1Z3GH 3ILPA 3P77B 5C70A 1Y0LA 4RDQG 2BFVL 2C3HA 4GUPB 3MGTA 5I1GH 2YN5A 2QL1A 5LAXB 4NRYB 5JDSA 4NCDA 1F4XH 3MRRB 2OL3H 4XNZB 1OAYL 2B4CH 4MXVE 4NHUB 3GJFB 4M1CC 3EOYG 3H3PH 1AO7A 5DK2A 1JK8A 1H8SA 3AC0A 5C0BE 2V2TA 5DC4B 4K23H 4OCYH 2EECA 1BECA 1HSBB 1BJ1J 2KPNA 1F4AA 1SJEA 3NA9L 4FABH 2A1WH 4OGXH 1XCQA 4JPKL 3D2UD 3K1KC 3UBXB 1F2XK 4X0KA 1MELA 1S7UA 1B4RA 4YFEA 2C3GA 1EJOL 5FA3A 4RGOL 1JHTB 3BWAA 4HC1L 4IMKA 4HBQA 1MCRA 4U1GC 4HJGB 5FHAH 2HJKB 1UZ8B 1DR9A 1OGAE 1CICC 2E9IA 5CD3B 3W0WB 5IT2L 1LE5B 3UTOA 4X4MA 3MODL 4PJ9D 2X05A 2A0LC 1P9MA 5FYKD 4RGNC 2IFFH 4GMSL 4LK4A 3RY5A 3UJTH 5DJAA 5I1CL 4PJXA 3TCLB 1R3KA 2VZ1A 1BQHB 1KOAA 4X6CF 4N8VB 4XH2B 2O5ZL 4R7NA 5B3JE 4YXKH 1HHHB 1HKLH 1HKFA 2LQRA 5KSAB 4G9DA 4QHKI 5EU6D 4A2LA 5CBAA 2UWEE 4Z76A 5L6YL 3INUH 4KMTL 3PWPE 1ORQA 1GL4B 4M43H 1MCCA 3IETA 4LSVH 1T1YA 4UDTB 2L7JA 4XCYA 3FO0H 4XPBH 4K8RH 3RGVC 2IAMC 1MUJB 4X83A 5DQ9A 4GRWE 3DUSA 3T0VA 4KJQC 4XBPA 1LO3L 5JXEC 4TULH 3BGFB 5AG8A 1ZA3B 2Z8RA 4HH9B 4D0DB 3IVKB 4D3CH 5DURB 1I8MB 2JCCE 4EUPB 3B3IB 4ZPTA 1B6DA 2V2XA 1BJ8A 1XF2A 5F89B 1Q9WA 1S78C 4WWKD 5D70L 2IWGA 4DN4L 1OCWH 3LAFA 3QUMA 2XT1B 1FLTX 2R1WA 3G5ZA 1MAJA 1G7QB 1KBGL 4A6YL 1CN4A 1FN4B 5J13B 1BFTA 3MBED 4IRSC 2Z31A 5FV2A 1O5DT 5I8KL 1OTUC 1EMTH 1YJDC 4J3SA 3VFPA 4EOWH 4HV8A 2X4UA 2HT3D 4N68A 1IL1A 2I9TB 1I9RL 5I8OH 1LO4H 1CLZL 1T2QL 4UB0H 5FYJE 4HGWA 1LILA 1ZOXA 3LKQA 4D0CA 4Y4KB 3GHBL 1X5GA 4RMRA 3JUZA 5DLMH 5MP6H 3ZKNC 4PY8I 3BKCH 4OZGE 3RVVD 3MRIB 3M17B 4LLAA 5DMGC 1KENL 2A73A 2P7TA 2VXUH 3D2UB 5D7LD 5L8JB 1WJ3A 1WC7B 1FZJA 1CCZA 2VLJD 3HPJB 4WFHE 1S5HB 4PJCF 3U7YL 4MLSA 4LNVA 4PRIE 3MMEA 1C1EL 1JHKH 5TGBA 5DMIH 4O2EB 1CGYA 4Z8FH 4PJ9B 1KB5A 1SYVA 3QUYD 4XCNB 2R1XB 1OAUH 1DANU 3JTTA 2XN9A 3B2UD 3EJJX 3QA3B 1U42A 2WLZA 4BKLA 4AEHL 3FT4A 3TBTA 3MUY1 2G60H 4ODWA 1IQDB 1FBIH 1Q94B 3B5TA 1P4BL 5DWUL 3TT1H 5EU6B 2YD8A 4DGIH 4L4VD 1RUAL 3QAZC 1U3HA 5DT1H 3BKYL 5I75C 2K7PA 5EC1B 3SE9H 3KPQB 4P5TC 1A6UL 5J6GA 5EH1A 3AGVA 1J1XH 4KKNA 3DUUB 1U95B 2ZNXA 1JPFB 3QCVL 4MCZA 1ES0B 4DKDC 4MXQD 2Q3ZA 1V5JA 3NPSC 4LPCA 1H15B 4UV7L 1HIML 4X6CB 2ICWI 2AJSL 3NGBC 1RZKC 3MRJA 1RUKL 2XY1A 4TSCH 5IHZB 4HGMA 5C08D 1QRKA 5JPNA 1NBVH 1K6QL 5I1HL 1AHWA 1AD0A 3SE8H 3R0MA 4RGMB 4WWKB 4XVJL 4PJAF 1TJHH 5IEKB 5J1TC 1F4WH 1S8DB 4A2MA 3I84A 3UTQB 1A14H 3GMNB 3OKOA 1EHLL 2X4PA 3PHSA 4ZUVB 3U0WL 2C3VA 4PY7B 4HF5H 4MVBD 3F7VA 5E08L 3DMMA 4PRBB 1A3LH 4A6YA 5E9DA 5I17A 4PRPA 3B9KC 5JW4M 1NDMA 4XPGH 5E2VL 4MZ3A 3L5HA 1ACYL 4RISL 3FFCD 4LLMB 1WFNA 3QJHA 5HPOA 1M71A 5JIIA 2RIKA 4NWTH 4DAGH 3SDYL 4ODUB 1QFWI 1SM3H 1IFHL 4QRRE 1PZ5A 5D9SA 3RZWA 3NTCH 4QRSB 2HAZA 5GS1C 2VKXA 1A7NL 1UZ6E 3GI9L 3W39B 5D7LB 4CAGA 1IC5L 3CFKB 4KJYB 4RMVA 5ICYB 3KYKL 4OI7A 2VLJB 5TDNA 2WZPD 5B39G 5DVOA 5IB2A 2A9NL 1CU4H 4U1IB 3X12A 3HC3L 4FMKA 4J23A 4LPWA 4YDVB 1IGCH 3Q6GH 1MJJA 4HS8L 5FYJU 2EEAA 5CIPH 2YRZA 3FHAA 5ADOH 4J4PC 2ESVD 4XPTL 4C4KO 1OM3L 1A9BB 3F7RA 5DD3L 5JHDA 4Y5VA 3UPAA 4YHOH 1AGDA 3RNQB 1YY8B 2DIAA 4PJCB 4KJPC 3T65A 1UT9A 1YPZA 5FF6A 2JB6A 5JNYB 3UTSE 5GJTL 3MJ6A 3SGJA 4ZS6D 3RI5K 4Y16A 4NNPL 5DRZB 2XWTB 4NQUA 5K9JH 1FDLH 2G2RB 1V7MH 3HMXH 2VERN 3UYRH 1CGTA 3ARQA 3OKDB 3E2HB 1I3RB 4ENED 3LDBB 3HNSL 4XP5H 2H26B 1Y18A 3EO0B 3O9WC 4Y7MA 4P57A 5I8CB 2OSLA 1AC6A 3HUJE 4XX1G 3IFPB 5DJXB 2AJZA 3RVWD 4UIKH 4LSQH 4HMCA 2HH0L 5C0AB 3SBWA 3HG1D 4OF3A 1Q0XL 3MV7D 4X7TA 1NGXB 2AJUL 4FFZL 4KKBD 1Q9LB 2GCYA 3VGEA 1NBQA 2HMID 2YBRB 4EDXB 3ULVH 4WHTA 2X6MA 1EAPA 1UM4L 5LGKA 4N8PA 1JV5A 4L29A 2ADJB 2IQ9H 4U6YB 4NUJA 4AIOA 3BN9C 4F3FB 5AWNH 5F44A 4WW1B 1EH9A 4S10A 2RFXA 3EYVB 4CVXB 1ZMYA 1OGTB 5F9WC 3U7WH 3Q6FB 4DK3A 1EGJL 3O6FA 5HY9B 4Y1AB 4P3DB 5IBTL 4E5XB 3MNZB 1P7QD 4S2SB 4U1NA 2BVYA 2DQDH 2E9WA 3MBXH 2GITB 1SBSH 5GGQH 1A3QA 4M7ZB 1J0HA 2YD9A 3FFCB 5JORB 4PJAB 5DO2C 3DXAD 1BD2A 4JFYA 4EIGB 4HIHA 5T3ZH 3BHBA 3G6DL 3NIGE 2PTUA 1JPGA 1HHIB 5F9JA 3FQUB 5GHWL 3T0BA 1D5XA 1JTPA 3KPPA 1K4CB 2KDGA 4GG6A 3QRGL 1SVZA 2IC2A 4JHZA 5F7LB 5INCB 3CH1B 1HNGA 4QXUL 4NQVA 1X9QA 1C12B 1U8IB 3VWJB 5L2KA 5TFSH 32C2B 1RZ7L 5TE6L 1S7TB 1FFNB 1FGVH 1FFRA 3FQWB 3NZHH 2R2HA 2GSGB 3SJVA 2ESVB 2CK0H 4DOHB 1JGLH 3T3MF 2HTLD 5AZEL 1T83C 4XXDA 4MAYA 1ZHNA 2D7PA 1OL0A 1S7VB 1UYWH 2CMRH 4G9FA 4NP4L 3LMJL 2XZAL 1M05B 1D5MA 1TETH 4JVUA 3F6IA 1MJ7L 5KVDH 3ZL4L 3SGDI 4Z7VF 1PKQE 1U8PA 3I6KA 4JR9L 1HINL 4XGZB 1NCAL 2XZZA 2EO9A 3QUZD 2NCMA 4XB8A 2Q7YB 3TH3T 1G7HB 5FFLA 1MQ8A 4GBXA 2UVEA 3MRDB 1ZLWH 3P9LB 3DURA 1NCCH 3AU1B 3H9HB 4JN1L 4J7RA 5SWSB 4X9IA 5KZCD 2MFNA 3QIBB 3WS6A 5HHVH 4JFXB 3HG1B 2H2PD 5D1QB 5GGVY 2UYLB 2WBJD 4XNUL 5F7EH 1UXSB 2ADFH 3DVGB 3KNBB 4JFOB 5T1MA 1I7TB 1IMHC 5EU4A 1T7YA 3V5KA 5K9QI 4NZTH 5ITBL 1TLKA 3DV6B 4LGPB 1CI5A 5TE4L 3P0VH 4EXKA 3ZHDA 3ZT6A 4HZAA 4NQEB 3VE0B 3V52L 3C5ZC 2DQHL 3OB0K 4LSTL 2CUHA 1NLDL 5DUPH 2NY6C 3MJGX 3EJYD 4TNVF 5I1LB 5IOPB 3PF2A 4BZ2H 3W9DA 4ODHH 4UMGA 3TNMB 4UZGA 3QI9D 4ODTH 4NC0B 3TN0D 1ZVSB 2PYEA 2AK4D 4D9RE 1HSAB 4RFEA 2ZCLL 1N8ZB 4OD2B 4YHPA 5KSUA 4OZHA 2A77L 1AGFB 1BZ9A 4Y5YC 5JPMA 2F9BT 1MAKA 1NGPH 2ZWLT 5EA0L 5LBSL 3VRLE 1FIEA 1WBXB 1QBAA 1E27B 4JLRA 2BFVH 2D7TL 4D94A 5SX5H 3VU2A 1L0XA 2BSSB 1IM9B 1OAYH 3BDYL 3UJJL 3VCLB 3OR6A 4OFIA 5F72S 1JGDA 3SHSA 4DEPB 3MNVA 2NXZD 2YEZA 3ARGB 1PY4A 5F71A 4K3HA 3NA9H 2DDQL 4JPKH 5D5ME 1BVZA 1AO7D 4PJXF 3ALXA 1NEZB 5EBMA 1MHCA 1EJOH 2BC4B 2N1KA 4RGOH 5IB1A 1G7MA 5EU3A 4LDEB 3P9MA 1CXFA 1ZK9A 4IIQB 5IT2H 1HI6B 4X6DE 1EEZA 4HLZH 5A3IC 3MODH 3JWDC 4RA3A 4NJ9L 1QFWL 2IADA 3ZKXC 4O2CB 3SE4C 1YEDB 1WFUA 5JW4N 2IQAA 2DIJA 4GMSH 1HYSD 5I1CH 4XXCA 1BVLA 1MCWW 2IF7A 1T22A 2LTQC 4NKOA 2O5ZH 4IHOA 3TV3L 2CSPA 2N56A 3TO4A 5DC9B 1FVEA 3PABA 2NY1D 5IQ9A 1FZKB 5L6YH 1PEZA 3LQMA 1FCCA 4KMTH 3RUGA 4TOYH 5C9JB 1HHGB 1FHGA 5D93C 2PETA 3D6GA 5KZCB 3QEGL 4XP1L 2CQVA 3O41B 3TBYB 3KJ4C 1OQXA 4FFYL 1DN2A 4JGUA 4M5ZL 1PJ9A 5FEBA 4F8QA 3TVMA 1G9MC 1I4FA 2NW3A 1LE9A 5F1IB 4KKLD 1VGEL 1ZGLB 3STBA 1U8NB 1S7RA 4Z7VB 3CFDA 3O0RL 2RQ8A 1WCBA 1F58L 2WV3A 3NBNA 1A6AA 4OLUL 3WJJA 4M8QA 2SEBA 4WI9A 3O4LB 1JPTL 2NYYD 2AJVL 5ERWA 3HE7A 3VFWB 2V5SA 4YBHA 2BY1A 4NQXA 4DN4H 1W2KT 3K46A 1H8OA 3QI9B 4O9HL 2FHFA 1KSRA 1BREA 5DUBA 2AK4B 2IH3A 2NY5C 1GYAA 3UAJC 1KPVA 1W0WA 3WBDA 1PLGL 3FOMB 1KBGH 4A6YH 4F7PA 5I1AA 3MV9D 3OKLA 2ICWA 5IUSA 5C0CA 1AXTL 4QRQA 3KYNA 4IOIA 4EXPX 5I8KH 1MH5B 4LCCB 2P5WD 4YC2B 5E1AB 3WUWB 4WI7A 4X6EA 3EO1B 3NFSL 4GAJL 5ITFB 1KIPA 1I9RH 1CLZH 1T2QH 2D9CA 2IMNA 4TVPE 1EEQA 4I9WD 3VDBA 1DDHA 1BOYA 3B6SA 5FM4A 4M61B 3WLWD 1FAIL 3GHBH 4RZCA 1I85A 3BI9X 5DQJB 2FJGA 3ILPB 4F9LC 1DTUA 1Y0LB 2F54E 2GT9A 4RNRA 1DLHA 3MGTB 2NXZB 5E4EB 5DVMA 3QUXD 3EFDL 5JDSB 5HDOA 4UIMA 1KENH 1PYWB 1K5NA 1AO7B 1X5ZA 1JK8B 3H7LA 2EH7H 2V2TB 1MCDA 2UZIL 1KF9B 2BVPB 1BQLL 3U7YH 1B0GA 3EO9L 3WFZA 2RGSA 1C1EH 1SJEB 3MV8A 1XCQB 4AM0B 1VFUA 1TTGA 1XR9B 1FVDB 2VN7A 2XPGA 5EDXA 1S7UB 5E6YA 1RSFA 3BZFA 3ZDYF 3BWAB 3EIFA 4KUZL 1KUMA 2VMFA 3RL1A 3UBXG 4LPTA 3L3GA 4AEHH 5EBWA 1P4BH 5DWUH 3ULUF 3BKMH 5A2KH 1H3UA 2I9LA 5DJAB 2NY1B 5BRZE 3MV01 4UQ2A 3WNOA 2GSIA 1RUAH 1R3KB 1H3TA 3BKYH 2EDYA 3V4UH 2EE2A 1JRHI 4YHLL 5AAMA 3E0GA 1A6UH 4YH6A 2JF1A 1WFOA 1BQHG 2YA1A 4N8VG 1RJCA 1IC4H 2CRYA 2X1XR 5CBAB 2CH8A 4Z76B 3QCVH 1U3HD 1N4XL 1CIDA 3S96A 1AGBB 1F4HA 2Y25A 2XKNA 4L9DA 3LRGA 4UV7H 1HIMH 3IETB 2AJSH 5EU7E 1T1YB 4WIQA 4XCYB 5AG9A 4P2OD 2HFEA 1RUKH 3U0PA 1IKNA 3ULUD 4KTDL 4H1LH 43CAA 1K6QH 3QDGD 3C8KA 3QXUA 4G8GD 4K71B 3IFOB 5I1HH 5I6XB 3QDJE 5DQ9B 4GAGL 5MEQA 4QGTA 1UC6A 1FQ9C 4NKMA 3DUSB 4XBPB 1BJ1H 4XVJH 3I2CL 2ZUYA 3DOSA 5BW7C 1JBJA 3MXVL 1EHLH 1V3KA 4ZPTB 2V2XB 2VE6A 2R4RL 4C58B 1XF2B 3U0WH 5E2JA 4D2NA 1T89A 2EE3A 3MV9B 4M7LL 5GRYA 4EUPG 2CXGA 4PS4L 3QUMB 2R1WB 5E08H 3G5ZB 1EEUA 3SPVA 3RTQD 4H20L 3T0EC 3CCHA 3ULVE 2BOCA 3LIZL 4E41D 2OXHA 2KZ1B 2CK2A 1LEIB 5E2VH 1ROWA 4YHKL 1ACYH 5I0ZA 4RISH 3GBML 3RZCA 3DMMD 2Y9RT 3VFPB 4GFTB 4HV8B 2X4UB 5E9DD 3HE6C 4PRPD 5F7WC 5EO0A 4YE4L 3SDYH 5E5MA 2P44B 3QUXB 1IFHH 4M1DL 3LKQB 3GJEB 4D0CB 2Y7QA 4B0MM 4H8WL 1R5VB 1A7NH 3GI9H 4Y2DC 5E24E 3KYKH 1HXYA 3KPRE 1GXEA 4MB5A 3FO1A 2A9NH 2YD4A 3HC3H 3BH8A 2W38A 2P7TB 4FA8A 1QSVA 4HS8H 4L5FL 1IAOA 1FZJB 1RUQL 3I6LD 4XX1E 2X89A 1INEL 3ZYJA 4LVHB 4BELD 1YPZF 3MMEB 1A4JB 5TGBB 2JE8A 1CLYL 3LN4B 4I8DA 3RFZC 3B5HA 4XPTH 5SX4H 1OM3H 2EO1A 1KB5B 1SYVB 2V7NB 5DD3H 2NMSA 5ADPL 4G7VL 4UQ3B 3JTTB 2XN9B 1ZAGA 4G5ZL 4CVUA 2FJFA 3FT4B 3TBTB 4P2QE 2VNCA 1DEEA 1C5BL 5GJTH 3WO3B 3KR3L 5DMYA 1OAQL 3E6FA 4NNPH 1ZLUK 4G6AD 1I1AC 4BSJA 2HT2C 1U3HB 1ZT7B 4ZO6A 4XCEA 4MNGA 2CUMA 3UROR 5J6GB 3UTPD 3BQUC 3N9GL 3HNSH 1UWXK 3OR7A 5IMOA 3V9FA 5C0RL 4P2OB 5HYSA 4UNUA 2WIMA 4MCZB 2HH0H 5TDPB 5HGDA 2ZG3A 3I3BA 5EUOA 1Q0XH 2AJUH 3MRJB 4FFZH 4KV5F 5C0IB 1MHPL 5C71A 2JLLA 4JQVA 1YNTA 2Q20A 4WUKL 4EZMA 2OTWA 1AD0B 1UM4H 2VZTA 2VDRL 2AJYL 4QF1B 4HUWA 3AM8C 2BNUA 5C3TA 4MJ6A 2P42B 4JE4B 3D48R 3MA9L 2GUOA 2A6IA 3PUCA 3H9ZA 3VXPB 3H9SE 1V8HA 1EGJH 1W72A 3OKOB 2FIRT 2X4PB 4V1DE 4XBEL 4L4JA 2C3VB 5DVNA 2W60A 3VI3E 2P46B 1X5XA 3F7VB 3DMMB 4UAOC 4HT1L 3G6AA 4GG6F 2KBGA 1P1ZA 3IJYA 5E9DB 2Z0BA 5AZ2L 3WE6A 4PRPB 5D72L 5I17B 3WO4C 2DQCH 2B4CC 4Y5XC 5BS0A 4D9LL 3QIUA 4G8FB 3IGAA 3QJHB 3IU4L 5JUEL 4ZYKB 5GHWH 1M71B 3NAAL 3VRJA 3QRGH 5B4MC 4GRMA 3DO7A 1PZ5B 5D9SB 1V05A 5D7JA 2OR9L 3H0TA 2ZUQC 3Q5YA 4QXUH 2DL2A 2VUOA 3D39E 1E4KA 2BNQA 3DSFL 5TDNB 1RZ7H 5F3HA 5TE6H 4RMUA 4IJ3C 4WU5A 4XAKE 3ZE0E 2ZSVA 1CS6A 2A74A 5C09A 1MJJB 4NZJA 3CH8A 5K9OA 5I1KL 5AZEH 1I7RA 1NCDH 4RAUA 2DD8L 1OP3K 3SDAC 3SJVD 4NP4H 3LMJH 2XZAH 4W4OA 3NH7L 1MJ7H 5JHDB 3ZL4H 3T0WA 4Y5VB 1I8IA 4I0KA 2QHLA 3GSQB 2Q6WA 1TMCB 1DVFA 4JR9H 1HINH 4MAYD 1AGDB 4OLEA 3U6RA 4KJWC 1NCAH 5EU5B 3JV4A 4CDHA 4G9FD 3T65B 1YPZB 5FF6B 4X9GA 2JB6B 4K8RC 4XNQA 4PJDE 4Y16B 4PIRF 4JN1H 5T1DL 3VXME 2GJ6A 5F1KC 4QHUA 3QXTA 5SWZE 3UX9B 4GBXD 3IDUA 4XNUH 3OGCA 2CLZA 4P2RA 3JV5A 3MQIA 3X14A 3PL6D 2E3VA 1Y18B 1U2CA 5TF1L 4P57B 2OSLB 2Y5TA 4JFEA 5ITBH 4CMMA 2AJZB 1X5FA 5TE4H 1J10A 4PD4J 4N90D 1E6OL 2F53D 4N0YL 4YQXL 1MEXL 3OAZK 2EIZA 4XHJD 3WCYA 3C09B 2JJUA 4HWZA 2VO5A 1JRHL 3WMSA 3T77A 2DQHH 2GCYB 2ITDA 1KJVA 4LSTH 1JF5A 1MCWM 1NLDH 4WHTB 2NY3D 4OZHF 1EAPB 3MLXL 2EEDA 1KCSH 2A83A 1JV5B 4L29B 4W68A 1ZTXL 4NUJB 1QBLL 3MRLA 2J7LA 3SDXA 2Q86A 2RFXB 2YD7A 3QFJD 3U9UA 3VW3L 2ZCLH 3O6FB 4ZDHA 4HG4J 3OB0H 5CUSL 2A77H 4U1NB 5IMLA 4ZG1A 1V3JA 5I19L 5DXWA 3MRCA 5LBSH 3BZEA 4LASL 2X4SA 2YK1L 2AEWA 2HLFD 4NCC2 2CO6B 2CIKA 2D7TH 4LF3A 4ZOAA 2CRMA 3BDYH 4JFYB 1BD2B 1AKJD 4P9HL 4PJIE 3UJJH 1OWWA 3QJFA 2LVEA 3IU3A 5GXBB 5IFHL 4NO5A 1N5YL 1LO0L 4NFDA 3ZDXE 3GDBA 5EZLA 1JPGB 3UDWC 5F9JB 3VGBA 1D5XB 2OS7A 3KPPB 4PLJC 2DL9A 5JW3L 4GG6B 2DDQH 3K1DA 2DKMA 4NQVB 3S6CA 3W5MA 1IQWL 4PJGA 5L2KB 4MHHI 2IGFL 4YBQC 1TTUA 4L9LA 3O3UN 1HHKA 3EUUA 5ACZA 2WQRA 4NJ9H 3I50L 1QFWH 2R2HB 4S0SD 3SJVB 1WAAE 5FUZL 3RUGF 3SKJL 4I3RL 3CVHL 4XXDB 5L9DL 4MAYB 5CZXC 2FWOB 2X09A 1ZHNB 3TV3H 5L8KB 4KQ4L 3QIBC 3BJLA 4G9FB 4U1MA 1D5MB 5D1QC 5D1ZA 4OFYA 4F15C 3W5NA 3T09A 4PJ5A 3IKCA 3ETBF 1U8PB 3I6KB 4JZJC 1A2YA 4K3GA 4BQCA 3QEGH 5IWLA 4XP1H 3V7MA 4XHQA 1HILA 4FFYH 4GBXB 4M5ZH 1EXUA 5LJYH 2NQCA 3DURB 1X44A 1FV1A 5A2IH 4R2GD 1C5DA 3STZA 1VGEH 3R4DA 1P69B 5FCSH 4D9QD 3O0RH 5JMOC 1F58H 1D9KC 1NCNA 4PUBL 5KG9A 5DDHA 5BCAA 2XOTA 2ICCA 4OLUH 1KEGL 5T3XE 5EU4B 3V5KB 1QRND 3RWIA 1JPTH 2R39A 4KHTL 2AJVH 5DC0A 3V7AG 3BWUC 4XWOD 4P23A 4FFVC 2DMCA 2D2OA 5ISZA 4AH2A 3U46A 4PRHA 3MRHA 4ZSOA 1MCOL 1OAZL 5FCUL 4O9HH 1TPXB 1JI2A 3PQYD 4NQCD 4X4XB 1YQVL 3LB6C 3HE7D 1PLGH 4K7PY 3IDIA 3UO1L 2C1PA 3W9DB 1KELL 1AXTH 2PYEB 4C59B 2R69L 4RFEB 1CD0A 4OCSL 3NFSH 3Q2CA 4YHPB 4GAJH 5KSUB 4OZHB 5C0CD 2HVJA 1Q9OA 1BZ9B 5JPMB 4P99A 1FAIH 3F7YA 4GKNA 4JGMA 2BVUA 3W0WE 2VLLB 4YXLL 3BD5A 4JLRB 4PD4K 5EZIL 1LVEA 2HRPL 2FH6A 3KLHC 3U48A 4WFED 2P47B 2RHEA 1TVHA 3FQXA 3OR6B 3BRFA 3M8OL 5BZDA 1JGDB 3OB8A 3KPOA 1RZJL 2UZIH 3MLSL 1TQCB 2OI9C 1SMAA 2YEZB 1X5AA 5HHXL 1BQLH 2OP4L 4OZFA 3EO9H 1ULVA 2AAVA 1U8HB 2VWEC 2D31A 1GGCL 1X5JA 2NY2D 4J3XA 3QWRA 1MHCB 1YMHA 4KGJA 3VFSA 4IRJD 2AJ3A 5IB1B 1EUTA 1G7MB 2B5IC 4KUZH 4LCWA 5EU3B 3P9MB 4HG4K 5CINL 4F33A 5EU7C 1A7BA 5IW1A 4NQSA 4ZNEE 1NEZG 5ID0A 1EEZB 3MV8D 4Y4HC 4ESKA 4OV5B 1EUUA 4QRPE 2IADB 4I77L 2IQAB 3FB5A 1BVLB 4FG6C 1N0LA 5J7CC 5D7SL 4NKOB 1LP9F 1U8JA 4IHOB 4YHLH 4ZQKA 4WHDA 3ZT5A 1C7TA 4QHLA 3TO4B 2XTJD 1IGTA 1FVEB 1Z5LA 1T6WA 3NCCB 3RUGB 2GW5A 1B90A 3QPXL 4GAYA 3BISA 3QCUL 5KANG 4I0PC 1NLBL 4CBPA 1F6AA 4OCXL 4X7SL 4KTDH 5I66A 3OSKA 3D25A 3TVMB 1I4FB 2NW3B 1LE9B 1KN4L 4GAGH 1QRNB 1ODAA 2FGZA 1QFWM 3DARA 1S7RB 2AV7A 4BYHA 3CFDB 1KIRB 1WCBB 5GRZA 3BGMA 1HDMA 3I2CH 3WEXA 3M07A 1A6AB 5JTWA 5LQBL 3LKPA 4CUCA 4M8QB 2SEBB 3MXVH 4LCCC 3SCMD 5ERWB 2R4RH 1DQMH 1X3DA 3HE7B 3P4MA 5IP4A 5F7DB 4NQXB 4P4RA 4OI9A 2F74A 4PS4H 2EXYC 2VDQL 4TTGA 1IILE 1LHZA 1G84A 4U05A 4PRDA 5LXGL 5DUBB 1CLOH 4KK8C 5HVGB 2IH3B 1KPVB 3LIZH 4F7PB 4X9HA 5I1AB 3V6OE 2HJFA 4QXGL 2ICWB 5C0CB 4QRQB 4YHKH 1OGAD 2V9RA 4IOIB 4F7TA 3GBMH 1QBBA 1SBBA 1MFCL 4IEFB 1B3JA 3ALPA 1H3GA 2EH8L 4GQPH 1WICA 3HN3A 4FN0A 3NACL 4X6EB 3ARBA 5KOVC 2LU3A 3BZ4A 3BO8A 1KIPB 1P84J 1QEWA 4BSWB 2BX5A 5FYKE 3WUWG 1DDHB 4M1DH 3B6SB 3RZCD 4MB3A 4H8WH 2FJGB 3Q48A 1KTKE 2GT9B 4QYOB 1DLHB 3R8BB 2UZXB 1LEGA 2OQJA 4LIQE 2HWZL 3B5GA 5EU6E 4UIMB 5HYFA 1D7FA 3D9AL 4KK5C 1QHOA 1KTLA 4L5FH 5C0ND 1RUQH 3MO1A 1INEH 4AMKL 2E27H 1B0GB 3QH3A 5L0QB 2P5ED 5AYQA 1CLYH 3MV8B 4MX7B 3O6KL 4LKCA 2XPGB 3EOAA 5TDOA 5ADPH 4G7VH 4X6CE 3RL1B 4JPVL 1QQDA 5KSVA 4G5ZH 4IRSA 2IG2L 4UBDD 3L3GB 2VXSL 3BT2L 5E2TL 5EBWB 3WYRA 2VZSA 2PW2A 3KR3H 1OAQH 1WQVT 2XTJB 2I9LB 2FX9L 4LSDA 5DD5L 4UQ2B 3IYLW 2GSIB 3EYOA 2HTKD 5EUOF 4K71C 4LDOB 5JW5A 4OGAC 3T2NL 3R0NA 3U4EA 5FO8A 5KN5A 3AMKA 3N9GH 3FB8A 5C0RH 4HKZB 2YSSB 3SO5A 2QADD 4Y4FC 1T0PB 4GW5A 5KS9A 3S96B 1QR1A 2P1YA 1QA9B 2XKNB 1U8OA 1EIBA 4G6JL 5EPMA 2VRAA 1LP9B 2EIDA 1MHPH 5F7HA 3LCYA 3U0PB 1YEHL 1MOEA 4WUKH 3NCJL 43CAB 1A7QL 2VLRA 4X5WA 5MEQB 2VDRH 2AJYH 3DETC 3SCMB 4NKMB 5HI3D 3P4LA 2C3XA 4JY4A 2XXMB 1PDKA 2XV6B 4JZOA 1CXHA 3FFDA 3MA9H 3BZDA 2Z31C 5GZNC 2ICES 1CE1L 3HFML 2E6QA 3L5WA 2VE6B 1HE7A 4QXTA 4XBEH 3O2DL 3IXAB 5D7LE 3H9YA 4RBPK 3RKDD 2DMKA 1J8HA 4L3CA 2VLJE 2E7MA 4KY1L 4HT1H 3SPVB 4ODXA 4HMEA 3WFHB 3KPTA 3CCHB 5AZ2H 5D72H 4K55A 4OTXL 2BOCB 3LQZB 2X44D 4FFWC 1J0JA 1WIUA 3BESR 3S9DB 3ILQD 3MLTA 4D9LH 1WBZA 4N0UA 3RZCB 5IB5A 3SDDC 3IU4H 5JUEH 1HNFA 2IANA 3NAAH 5EO0B 5JLZA 3V8OA 1FP5A 1P7KA 5E5MB 2BNRA 5C2UB 3TGXA 1X4ZA 2Y7QB 4L4VE 3KPNA 4LQ1A 3BUTA 2FL5A 4RWHA 4PJCE 3ROLA 4FTVA 1HXYB 3DSFH 3KHOA 1A1MA 4DKEL 3FO1B 5D7JD 3VXNA 3BH8B 4JDZA 2P5EB 2EYRA 1UVQA 5FECA 4EQ2A 1GVIA 3QDHA 5FYKU 5I1KH 1A6ZA 3RNKA 4N0FA 2EXWC 2GK0A 4YZFF 5INDA 3WIFA 1JNJA 5T1KD 1MCKA 2PO6D 2DD8H 3P4NA 1CFQA 4G3YL 5LG1A 2F5BL 3C8DA 5HYJA 2YC1A 4TRPL 3NH7H 3GM8A 5C0AE 4F2MA 5AUMA 1P84K 5D2NB 3B83A 5H94A 3MLYL 3RVUC 5CD5D 2FJFB 3V0WL 1DEEB 1KFAL 1YY9D 4KI1A 1I9IL 1QFUL 3E6FB 3S34L 1DVFD 5FO7A 5T1DH 3MCLH 1CDHA 2W07A 3MRGA 5DK0A 1AHWC 1T0NA 2IALB 4OQ1A 4QOKD 2FECI 4MNGB 5GS1A 4RX4D 4ZTPL 5IMOB 3OR7B 4U0QB 3ZHLA 5SV3A 3O45A 3H3BC 15C8L 5TF1H 5HYSB 3OGOE 5HYEA 1E6OH 5JOPD 5HGDB 4N0YH 4WI6A 1MEXH 3FFCE 5EUOB 1TITA 5AD0A 3DVNB 4PJAE 2GI7A 4H5SA 3SO3B 4JO4L 3SDXF 3CIQA 3ESUF 1A02N 1JRHH 3S7GA 7CGTA 3LPFA 3IDNA 1YNTB 2ARJQ 4F7CA 3MLXH 4R4FL 3P0YL 4LPUA 3PHQA 5AEAA 1ZTXH 2XFXA 4HUWB 1MI5A 1AC0A 1QBLH 1MJUL 2BNUB 4GKSA 4MJ6B 4K7FA 1CQYA 3D85D 3OAZH 3HC4L 4W70A 1IGML 3VW3H 1I75A 1CLCA 5IW6A 1W72B 4PG2A 4WUUA 5CUSH 3HR6A 2IPKA 5I19H 3TA3C 4KRPB 4MD0A 4LASH 2W60B 3BPNB 2YK1H 4GRLC 1UJTA 5FOBA 1XGRA 3G6AB 1P1ZB 3IJYB 3WE6B 2ESVE 4HS6A 3IRZA 4S1DD 2D7MA 1IGFL 4P9HH 4WGVB 4HUXA 5BS0B 4APQD 5IFHH 4QT5A 3VGHA 1N5YH 4PJGF 3FZUD 4MJIA 1XGQA 3L3JB 1OTTC 5H37H 4PTUB 2XRAL 1IKFL 4BQ9A 5JW3H 4GRMB 3C60D 1GOHA 2M2DA 2BDNL 2AVGA 5D7JB 3H0TB 1WTLA 3GHEL 3WFBL 1IQWH 3HAEB 4X8JA 2IGFH 4MJ2A 4EN3A 2BNQB 1IGYA 4Y5VC 4WU5B 4P59L 4ZAKA 5JO5A 5DJ6B 1P4IL 3FCTA 3FAWA 3I50H 2ZSVB 4X98A 2A74B 5C09B 3TF7C 2FX7L 4ISVB 1T1WA 5FUZH 3SKJH 5K9OB 3CVHH 4JRXA 3HG1E 1I7RB 5L9DH 3GSXA 4Y16C 5I1EL 4RAUB 4PBVC 3V7AE 1M7XA 4KQ4H 5IJVB 4XMKL 2GHWB 4LP4A 5MI0B 2F5AL 4U7MA 4C56A 2O5YL 4HJ0D 1I8IB 2Q6WB 3NIDE 3KWWA 1DVFB 4AK1A 4NQEE 3U6RB 5F21B 4KFZC 4L8SA 4JM2A 4QLRA 5HDBF 4XNQB 1KJ3L 3DRQB 2F58L 1S9WA 2ZP0T 4NKIL 2UZYB 3JV6A 4PGJA 2GJ6B 3MACL 5GGTA 1A7OL 3O8XD 3QQ9D 3RRQA 4QHUB 2E8YA 3HB3C 3RWCA 4PUBH 2CLZB 4P2RB 3I3DA 3X14B 1KEGH 1FL5A 1SY6A 1RK0A 2Y5TB 2X41A 3WD5H 5FM8A 3DXAE 4JFEB 4CMMB 1OP5K 3P4OA 4KHTH 1IEBA 1CIUA 2J3SA 5I0DA 4B7IA 4OFKA 4U6TA 1A6TA 2EIZB 1JGEA 4EJ1C 3VWKC 4HWZB 3T77B 1MCOH 1OAZH 2ITDB 5FCUH 1KJVB 3C6LA 3GZKA 2VSDA 2AXFA 1YQVH 4TUKL 3UO1H 4P23D 1KELH 5ISZD 2VXQL 1HYRC 4LPYA 1PX3A 5KVEL 3K3QA 5BZWA 1UKSA 3QIWC 4N5EC 8CGTA 3SDXB 3ZKMD 2Q86B 4NN7C 4P5KA 3U9UB 2R69H 1J88A 1CGUA 4OCSH 5CHNA 2Y6SD 4XCFL 3UEZA 4JRYA 4ZDHB 4NIKB 5F8RC 5IMLB 1CDIA 1RURH 5BOZG 1RAMA 3F7PC 3VG0L 3MRCB 3BZEB 2X4SB 4LP5A 2MNUA 3D3VD 4YXLH 2VYRE 5EZIH 2CIKB 2HRPH 4LF3B 5DJYA 5C7XH 2JIXA 5C0JA 3BDBA 2J6EL 3QJFB 3IU3B 3M8OH 4NO5B 4YLQT 3SY0B 5LCVL 2NR6D 5F88B 1RZJH 1RZFH 3MLSH 2FEEL 4WWID 5EZLB 5HBBA 3UMTA 5HHXH 2BVTA 1G1YA 5FYJL 2OP4H 2XWJA 5DD1L 3TBSA 3C5ZA 1GGCH 3U0TA 1EVTC 3T3ME 4M6ML 4GXUN 3DIFA 3HHRB 4AY0A 4PJGB 4TPRL 5DHVA 2V5MA 3SGEH 1BBJA 5C0BA 1HHKB 4E42A 3G6JE 4G8IA 1A9EA 2H32H 2R2BA 2VDNL 4ZFZA 2EDKA 5ACZB 2HKFH 4NM4L 4I77H 2X1OA 1FNGA 3EYSL 2BERA 1AR2A 4LCWD 1H3WM 3R06B 2J8OA 3OKMA 3TP4A 1GC1L 4P49A 5D7SH 1VESA 1JGVL 4F37K 4LCIL 3IKKA 3O4LE 2YUZA 4U1MB 3VFOA 5D1ZB 3M45A 4W4NA 4PJ5B 4HFWA 1OPGL 3IKCB 1A8JH 3ABZA 1A2YB 3KLSA 2VDOL 3QPXH 1EO5A 3QCUH 3CGTA 4HHAA 5CZVL 1NLBH 4BH8A 4OCXH 3PNWA 3QG7L 1HILB 4X7SH 2AK4E 2DJUA 1EXUB 1HOCA 2JJTC 5GS0D 3KPLA 5MEOB 1M1SA 1M7IA 1VB9A 3N1FC 4I5BA 4U0RB 1KN4H 1C5DB 3STZB 12E8L 1BP3B 4M1CD 3X11A 3TYGL 3MR9B 2UWEA 1T0MB 2LV4A 4F58L 3B8YA 5KG9B 1PY9A 5DDHB 5LQBH 2IH1A 1T5XA 4R6UA 2ARJA 4P46C 4QRTA 4YDLC 4CU7A 3SE4A 4P23B 3L3OB 4ORGA 5ISZB 4AH2B 4LEOA 3U46B 3D0LA 3MRHB 4PRHB 2VDQH 5BV7L 4ZSOB 3ZKSD 1CICD 2NX5D 2PXYD 4BA8A 5LXGH 4X4YB 3X13A 2A0LD 1Z2KA 2HFFA 2BCKA 1AO7E 1RULL 3EHBC 3IDIB 4RGND 2C9AA 2C1PB 2VSCA 4QXGH 2JCCA 1G7IA 1U3ZA 2EDBA 1F97A 1MFCH 2WNGA 3TO2A 4XNYL 1F6FB 4EDWL 4LRIC 1U93A 1TQBB 3TPUA 2EH8H 4CN1A 1CWVA 3NACH 1P6FA 4JPIA 4XMPL 3VXUD 1Q9OB 2VR5A 1R3JA 5E6IA 2XACC 3F7YB 4KHXL 4GKNB 1PEWA 3PGCA 2DYPD 5F7NC 4NM8L 3UZEA 4N9GB 4RQQA 3BEVA 1QSED 3LSOA 1TVHB 2HWZH 3MFGB 2IAMD 3RGVD 4R7DA 5I1JL 1KNOA 2JJSC 3D9AH 4ZFOA 5BZDB 4WW2A 3KPOB 3KG5A 5IGXL 2W0FA 4KJQD 3ZMRA 4AMKH 3V2AR 1KPUA 1XT5A 1YA5A 5JXED 4OZFB 1A7PL 5HHQA 4Y19A 3Q5TA 1MQKL 1T66D 1YC8A 4TN9A 2D31B 3VRIA 4AYFA 1QSZA 3O6KH 3QCTL 4GKOA 4OZGA 3MGOA 4RCAA 4L1DA 1YMHB 3TO4C 2AJ3B 1S78D 4LCWB 5KAQF 1QG3A 4JPVH 1IJ9A 2XI9A 4F33B 2IG2H 5IW1B 4NQSB 5ID0B 2VXSH 3BT2H 5E2TH 1WK0A 4TVSa 4PRIA 1FRGL 4CNIA 3S98A 2FX9H 5DD5H 3FB5B 5C0DA 4QTHA 1MCLA 2VQ1A 1NMCB 2Z91A 3CFIC 4IRSD 5DJ2A 1BWWA 3HA0A 4FQ1L 3T2NH 1OTUD 1U8JB 4ZQKB 1RIUL 4F9LA 4QHLB 1TIUA 5GZOC 1NAMA 1IGTB 1Z5LB 4GW4A 1E4XI 5HD8C 2G9HA 3MV9E 4EQ3A 4EI6A 2DQGL 2OK0L 1R0AL 3N1GC 4OLWL 1HH6A 1I8KA 1F6AB 2LU7A 4G6JH 3ZKND 4YFLI 2JB5H 5HI4C 1YEHH 2VLMD 2Z8WC 3U79A 5I66B 3NCJH 3D25B 1A7QH 3TH4T 2EDNA 1VACA 4I9WE 3QULA 3QUYC 1J1OL 1HQRB 5DMGD 3QUKA 2W9DL 5AAWA 1G6RB 1DE4A 2AV7B 2BVOA 3HTLX 2ED8A 2PW1B 1I7ZA 2H1PL 3BGMB 1HDMB 1RQ5A 3WEXB 4ZO8A 5C0FA 4HXBL 4U1GB 3LKPB 1CE1H 2NX5B