1CF8L

Convergence of catalytic antibody and terpene cyclase mechanisms: polyene cyclization directed by carbocation-pi interactions
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
215
structure length
215
Chain Sequence
b'DIVLTQSPTIMSVSPGEKVTLTCSASSSVSSNYVYWYQQKPGSSPKVWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCLQWSSFPYTFGGGTKLELKRADVAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CATALYTIC ANTIBODY 19A4 (LIGHT CHAIN))
molecule tags Catalytic antibody
publication title Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
pubmed doi rcsb
total genus 51
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cf8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cf8L01
2WNGA 2J6EH 2YC1B 2N7BA 3BPOB 3C2SA 4JM4L 4K07A 3ARFC 1FLRL 2JIXA 2A38A 4NO0B 3BN9D 1P84K 2APWA 1SQ2N 3DUUA 4ELKB 3QEQA 3IETA 5MERB 3EO9L 3O8XC 3HG1B 2DOCA 2BHUA 1U8IA 3RWIA 3B4NA 3QDGA 2FGZA 2GUOA 5EUOA 1G7IB 5GS3A 5TDOA 1KB5L 3H3BC 3JXAA 5FCUH 1MFDL 2OR7A 1F6FB 1G7IA 2CO7B 4UINL 4DKEH 5E24E 5T1DL 1LEGA 1BQUA 1M4KA 3I3DA 2E8YA 1VB9A 1CDYA 4Y1AD 3LKRB 3RRQA 3QQNA 2E7BA 1WFNA 4PV9A 3ZT5A 2WBWB 5E2UH 4IS6A 5BJTA 5F7KC 2ZPKH 3IU3A 3WV0A 2MMXA 3PHQA 4HXAH 3V4UH 3R1GH 5HYJE 3RHWF 1Q0XH 3GMRA 3GUTB 2AAVA 4LSVL 4YBLB 2F5BL 4IOIB 1JPST 3BZ4B 3I9GH 4KY1L 1H8SA 4EI5A 1IGTA 2ERJC 1BM3L 2P1YA 4LPUA 3MLZL 1AIFB 5I18H 4MB3A 1DQLL 4LRIA 3PWVA 1JPFA 2EH7L 3G08A 1LP9B 3AS2A 3NCMA 2B4CL 3RVVD 1MRFH 2LFGA 2NXZD 2P8MB 3LVEA 4Q9CA 5KSAD 2VQUA 3CVHL 5CKGA 1DUYB 2YXFA 1R3HA 1Z9OA 1T3FB 5HYJD 1KIUA 1FFOB 3WSQH 4UDUB 4XWGH 3NACH 3BKJH 5GGVH 1S7RA 1NAMA 4YFEA 1ZT7A 4X7CC 5HDBE 1P4IL 4FFYH 1LE9B 2CXGA 2XI9A 2HWZL 4H20L 3QFDB 5ADOL 3FQXA 4BYHA 5D1XB 5C8JA 3FB7B 2FEDC 4Z0BH 3S36X 5ACZA 1CBVL 5IG7B 5INDB 5I6XC 5HHXL 1OSPH 5TE7H 3TH4T 4ZFFB 2DQGH 4H1LA 5IHUL 2X4NB 5FOBB 1T2QH 2IG2L 4XI5C 1NJ9B 2Z31A 1TFHA 2CLZA 5EZOH 3MV9A 3OKOA 4Q58C 1IM9A 4RA0C 4NM4H 5IWLA 1UM4H 1A6VH 4G7YL 3VRLE 2NY3C 3PWPD 3DX7B 4Y4HB 5E8EB 1M6OB 3T65B 1IEBA 4BELD 1T0MA 3GB7A 1ZEAL 3VXNA 5IWLC 3FJTA 2FYYA 4PJ7F 2W0FB 1TITA 1SBSH 1EEYA 4NUJA 3H9HB 4M43H 1OM3L 5EOQL 4LHJB 1KPVA 3NH7H 5KS9E 3L3KA 3ZL4L 1QSED 1FDLL 4KVCH 2VZ1A 1IGYA 5HHME 1MFDH 2W0PA 2XQYK 3IVKB 3JTSA 3IF1B 2BC4A 4YK4B 5D72L 2ZOKA 2XZZA 1FGNL 1ZVHA 1F4YL 1E28B 4V2BA 2WZPD 3EHBD 4Y2DA 4KJQD 1B90A 3JWDC 4FQ2L 3VFWA 4OCWL 1MCWM 4IHOA 4P23A 5DHYA 1F6AB 2EDQA 5FKPB 1A6AA 4I1NB 5GGTA 4QY8B 3MROA 5IVOA 2XNAA 5HVWA 3RWDB 5JIHA 1NCUA 1WBYB 4WEUD 3SDDA 3LZFL 2WAHA 1RZIA 4MZ2A 3KPPA 4PJCF 1KPRA 3BGAA 5CZXD 2CLRB 3BPNB 4I18B 4ONFL 5GGRA 2X4TB 3VXUE 1MQ8A 4LMQI 2FD6H 2XTJC 3MREB 1LO5A 1S9YB 3BKYH 1AR1D 4ZO9A 3VXRE 1IGCL 4Z6AT 4WFHE 2HG5B 3MRNA 4L9LA 3RU8L 4EN3C 1CVRA 1GZPA 4IMKC 4M7ZB 2ADIA 4YPJA 5HGDB 3DIFA 5HSFA 4R90H 5B38B 5KAQF 1W8OA 4KMQA 2X44D 2ORBH 3BIAX 3BAEL 4OCSH 3QO1A 1JK8B 4C54A 4Y5YB 3GBML 3MLRL 5EG6C 2O5ZL 5K9JH 1J5OH 1ZVSB 5HHPA 2DQHL 3QNYA 4NKIH 3ARDA 3IFNL 4O4YL 5GRYA 5HI4C 2VLKE 5D7IB 1N7MH 2AK4D 1UA6H 3FO9A 1ZAGA 1RHFA 4L8SB 5DDHA 2DQDH 1I9IL 1KTRL 5B39A 1ZTXL 2DLFL 1YQ2A 3U30C 3TBWA 2H41A 1XFPA 4M5ZH 4O2CB 4H8WL 5D93C 3FTGB 5E8OA 5ITBL 2N4IA 4Q9BA 2CSPA 2JCCA 4FFVD 3O4OC 4R2GB 1B0RA 3SE3A 2MKLC 5D7IF 3KR3H 4G9FA 4FQXA 4TUOB 4MNGB 4RMRA 4UNUA 1ZLVH 4H88H 1AFVL 5C09B 4FQIH 1MY5A 2R2CA 2WK2A 3HRZA 3MGOB 4U0RB 3NZHL 5DO2C 1CFQB 4LDEB 4NPYA 3SGKC 3HE6C 4K3JH 1IKNC 3PNWB 3ALWA 4IRSB 3G5XA 1MSPA 1OTTD 4KQ4H 1L9MA 2IH3B 5FYKU 5I1LB 4P2QA 3WXVH 4BK4A 2EDBA 1QRND 3NA9H 3U0TB 3CFIC 1VCAA 1R24B 2YKLH 3V95A 4OQTH 2FLBT 1KJ2H 3F6IA 4RRPG 1XR9B 3W0WA 3QUYD 1JGDB 3KJ4B 1NMAH 4LLYA 4Q7DA 4S0SD 4XWOC 4YHNA 4E5XA 2C4FU 3VXMD 3JWOL 4BFBD 4I48B 1RZKH 4FXLA 4JKWA 3MOBH 1VDGA 4EN3D 3SN6N 1MCDA 3SJVE 4L8CB 2UZYB 2ADJB 4NRZA 3BEWB 2DTML 3HC4H 1MCBA 1OP5K 3VXRD 2YK1H 5C0GB 1CWVA 2HJFB 5EPMB 4FQXD 2AEWA 4MQXC 4R26L 5C92A 2AK1L 4K23H 4QXGL 1VPOH 1FIGL 5L7XH 5MERA 3NIGF 1U8LB 3O6LL 2J3SA 3QPQD 4NC0B 3F7VB 3GMQB 3KLHC 1VADA 3CK0H 2FLRT 2MTPA 1UWXK 4P46D 4U49A 3GMQA 1A7QL 3U2SA 3GJEA 4M7LH 1GJIA 5IFJA 3AFLA 3QDJB 4P5KB 4GW1B 1N6VA 3U9UB 1P69B 4NQDD 2DMCA 3I6LD 5ICXA 4OV6F 1AO7D 1ZHKB 4J3UA 3WN5B 3TNNB 5F97E 3MYJA 3S96A 4LPWA 1F11A 2DQJH 5HVFB 5I1DA 4QHMB 3WNOA 3MOAH 2OTUB 3GSQA 2EDFA 4H0GA 5IESL 4OZIB 3QEGH 3OV6A 5IOPB 1L6ZA 4JCMA 1BFVH 2NYYC 2HRPH 1K4CB 4NQVB 4HZLA 3EYUH 4U1SA 4K71C 3QB7C 3W39B 4XRCB 2WQ8A 4IEFB 5K9KA 4ZPTB 1DBAL 1WBXA 4ETYA 4G8GE 4PG9A 4EBQL 2EDDA 2F54B 4ALAL 5D71L 1FO0B 1OD9A 1XEDA 1NGYB 3HI5H 3HC0A 2F53E 2DWEA 5T1LD 5EZLB 3QXAB 5EORH 1I85A 1UB5A 3PWNB 1U92B 3B9KA 4OLYH 1Q9LB 5TH2A 2P5WE 4E41B 2A6IA 1RD6A 5ILTH 1NCNA 4N1EA 1UQSA 1U8QB 4OLXH 1QVOA 3RL1A 3WUWA 1AIFA 3MPCA 3JTTB 1CGTA 2XTJE 4U6YA 2ICWI 4L5FL 2CXKA 2NY2B 4MNQE 5HTSA 5BQ7A 1IAIL 3ET9F 2VZ3A 4X5LA 3RKPA 1GC1C 1DQQB 4NQDB 1F00I 3K1KC 3PWUA 4EIZC 1W0VB 3QUZC 2NY0B 4GO6B 1IT9L 3TYFB 2ZCLH 3D25A 1MHEA 1XF4A 3L5WA 3T2OA 4X6CB 1ZHBA 3LQAC 3D48R 1JZ7A 1DBML 4HWZB 3I6LE 4XH2A 3ARED 1MCIA 3NVQA 5DD0L 2DTMH 3HC4L 1YEJH 5CBEB 5FDYA 4M61B 1U3JA 4U6XA 2DLTA 5F8RC 3O2DL 3DNKA 4F9PC 4HUMB 3GK8L 5EIIB 4PJ5A 2NY5C 2J8UA 2WIIB 4M9PA 4YGVA 4FQXB 1H9VA 4NNXB 1N5YH 1FZJB 1H3PL 4CBPA 1FCCA 1Q0YH 1SJHA 3HA0A 2IG2H 1QLEL 4GG8B 4JRYE 2ZJSL 4PGBB 3BPCB 4P57B 3LHPL 2J88H 2VLRD 5T33L 5DR5L 5I1LA 3GMOB 1IEHA 5ILTL 5GJSL 3D85D 2M26A 5B22A 4KQ3L 2NYYD 4TUKH 5E6IB 3ARXA 1V7MH 2BRRH 4H8WC 2DYPD 4YUEH 5A2IH 1HXYB 1VACB 1QSVA 3QI9B 5BVJA 3OR7A 3GBNH 4JO1L 3VFPB 1MUJB 1GZPB 1RAMA 4CMMA 1KT2B 5F93C 4JFEE 2WBJD 2BVUA 4KRLB 2Q86B 4HF5L 4HS6B 4NO5B 3E6FB 4CJ0A 1YNTA 2NMSA 3DUSB 4LASH 3H7LA 4M7KH 5BZWB 2EH7H 4QGTA 3JV4A 1RHHB 5F7HA 3AU1B 3OB8A 4DGYH 2AEIT 4ODWA 3MR9B 4JDVA 1EH9A 1XGRB 1ZOXA 3EZ8A 4LOUC 4U4BA 4ZTPL 1DBJL 1QLFB 4HC1H 5ANME 3KLHD 4ODHL 3MV8D 1HI6A 2H32A 1GYAA 4IRJB 5EBLB 1UVQA 2VL5A 4J3SA 4OBRA 5C0JA 3MGAA 2PCPB 4HMEA 5KN5B 2NX5D 4OCSL 3O6KL 5GPRA 3LQMA 4LCIL 5K93A 1YNKH 2B39A 2ZCKH 1QO3A 2YPVL 5E1HB 5C70A 1JF1A 5M95B 3P11H 3JUYA 4Y4KB 5DSCB 4TVPL 2NY6C 5ERWB 2FCBA 3IKCA 2Z31C 1IZJA 4KVNH 4OZHF 1MFEH 4Y2DD 2YA1A 3DVFA 3OF6A 1D9KD 4BUHA 2AGJL 3HZKB 3O3BA 4QXGH 4LSPH 4R8WL 5BVPH 4HD9A 2HYMA 4FG6D 5L8KB 4U1SB 1EV2E 4OI7A 1JF1B 3CVHB 1T03H 1MY7A 1ZLSL 1NQBA 4OLYL 4JFYA 5T1LA 5HDLA 2APVA 4X0KA 1DTUA 4S1SH 4Y5XA 4IOFC 3M1BA 3S3JA 4UDUA 2CGRH 4OM1L 2RJMA 3EIFA 3SKMB 2B5IC 2D2OA 1DE4B 1KN2H 1ND0A 1UJ3B 3OPZL 1RIHH 2BHZA 3C5ZD 3RI5K 1GGTA 4M8QB 5T1MA 4N0UE 4J7RA 4XP5H 4JKPL 3FQTB 5CSGA 2Y5EA 4LCCB 5ISZA 5IW6B 3RVWC 3EO1A 1D9KC 5A43C 3N1QC 4MQTB 4KROC 1XCQB 3OF6D 1Q9WB 5CEZH 1S9KC 2DQIH 5DUPH 2VDLH 3VXRB 4EDWH 4EQ2A 5LKNA 3QUKB 1CD1B 1HE7A 3MJ9H 5I0DA 1N4XH 3ZTJG 2D9QB 3LIZH 1Y0LA 2YRZA 3TZVB 4PR5B 5ADPL 1MJUH 3EDKA 2FX7L 2OYPA 4X9FA 3PDGA 1GPOH 1MQKL 1ZSDB 2CIIB 4ORGA 5GGTL 2DLFH 4TPRL 3KYAA 5I73B 1JJUA 3LRHA 4YFDB 1OAKL 1WLHA 2VXVH 3HNSH 2YD2A 3MLSL 4QXWA 1TZGH 4ZODA 5GRUH 4DWHA 3N9GH 5ESAA 5BXFA 4MJIE 4LEXH 4PJCA 4R4NC 4E41E 4KAQL 5EU6B 1C12A 2AJXH 1G7JB 3E3QC 4J3TA 1QBLL 5FA3B 2BVOB 2OSLA 4HIHB 3ABZA 5I74B 3U7AA 4PLJD 1KEGL 1RIVL 4X5XB 4MXVF 4DK6A 3IDNB 5I30L 2XXCB 1P7HL 2F53B 2WINA 4U7MA 2QHLA 1VACA 3QI9A 3ZTNH 5C0GA 3S3PA 5FAAA 4PLKD 3BD4A 4FZEL 2I9TB 1CGSL 1ONQB 1Z9LA 5GXBB 3K1DA 2A1WL 1I75A 3GMNB 4GKSA 5C6PB 1JZ2A 5AUMA 4R9HA 3UYOD 2CRYA 3ZDZF 4DZ8B 2V6HA 4OUOA 3LKQB 3BPLC 1T21B 3ZE2F 1CK0H 1VEPA 3TN0C 3HE6A 3WKMH 1OTSC 3IYLW 3SKUD 2EE9A 3K7UA 2O61A 2AVGA 2CJUH 3OAZK 1BJ1H 4G6MH 4I3GA 3JWNC 4UV4H 4JKLA 5E1AA 1LEKB 1SJEB 2HLAA 4ZS6C 2Y7QA 4JY5H 3HCVA 4OTXH 3UEZA 4I4WB 4YX2H 5DUML 1UCTA 4Z78A 1BMGA 3QIUC 5TH2B 3HZMA 3V0WL 5JHLL 1ORQB 4JPVH 3T2QA 4JRXD 2R39A 4QRSA 5I9QB 3Q3GB 5BS0B 2PF6A 2XZQH 3OQ3B 3ARSA 1QNZL 2W65A 3NCCB 3QUYC 2EYSA 3EBAA 5J1SC 3MA7B 4ZS6D 4F7EA 2VDKL 1I9JL 3VXQB 3IJSB 5CJQH 3W0WD 5LBSH 1QFWL 1I8IA 3QUYA 2ED8A 3NABH 4FQJL 4MLSA 3ZKXB 4JFYB 3MACL 5MENB 5ALBL 1A9EA 3B9AA 4GG6F 4R3SA 2VDML 4OCRL 4GRMA 3I02A 1U8MB 4WENB 1F6LL 1RZ7L 3ZYZA 4HT1L 3LPFA 2EYTB 1YECH 4Z7WE 1I7TA 4HT1H 4PJEA 4ODTH 4YBQC 2WWMC 2Y9RT 3IJSA 1E28A 2P46B 3P11L 2J12B 1UJ3C 4F57H 4M48L 4N5EC 4K7PX 1KXVC 5TF0A 1ZHLA 3QRGH 2D7PA 3CJJA 5J6GB 4KUZH 1XGQA 4NKDA 4PGZA 2CDGA 3O3AB 4JPIB 3TNMB 4LU5L 3DV6B 4LLVB 4TTDD 4PGCA 3IDIB 25C8H 1KIRA 2R4RH 4OKVA 1DBJH 5D9SA 4AYFA 1OF2A 1KPRB 1NFDE 3WKNA 5FYLL 1HI6B 4POZC 5EH1A 5GS0D 2ZSVA 5DFVC 3RIAF 5F3HB 3MRHB 2EE3A 1E4XI 3W11D 5J6GA 3GMLA 3MCLH 3N85L 3TBSB 4PBWD 2CO6B 2IQ9L 1ACYL 5DFTA 2NY6B 3WJJC 1WC7A 5D5MF 4FN0A 3OPZH 1IC4H 4PV9B 3O3UN 4LPVA 4U05A 3GGWA 4NZUL 4JG1L 2NXZC 4NRYB 2JB5L 5SV3A 1OD7A 4MAUH 1OOAA 4BQ6A 1XGRA 1MJ7L 1VERA 3RWJB 2WUBH 3L6FB 3DTXA 3QWRD 3SGEH 1F8TH 2OXHA 4HWEL 4CMHB 2YMXL 2RHEA 4YEFA 5E5MA 3G5YB 3D85A 4H26A 2BNRB 4L9LC 3R06B 4KK9D 3DX6B 3HMWL 3HUJF 1T4KB 1XT5A 1A1MA 1QRNB 5DJ0B 5DI8B 4QOKA 4UT6L 5F21B 3HS0B 3GJFA 4MWFB 1QQDB 3T0EB 3QG6A 3DX8B 3VXME 2R69H 2DD8H 1KN4H 3RUGF 1NL0L 2F58H 4ZFGL 1K8DA 1SM3H 3KG5A 2AJXL 3RY6A 3MJ6A 4JO4H 3L7EA 3O3DB 2D7QA 4U1LB 4BQBA 1GVIA 5MEND 4XPAL 3T4YA 4QNPF 4NM8L 4X4XA 5DMYA 5JR1L 2MQ3A 1AGEA 4LVNC 2BOBA 5E95B 1Y0LB 4PJDF 5MP6H 2AK4B 1OAYL 4JQVC 2EDWA 3OKNB 5E9DB 3NGBC 1T3FA 3X13B 1U2HA 3P77A 2ARWA 3A6BH 3DXAD 4FQXC 4JZNB 1CZ8L 2SEBB 2IAMB 5ESQA 4LU5H 1F4AA 3OX8B 3UTOA 4PTTB 3V9FA 3FQRA 2AXGB 3KYOA 3D25B 4F3FB 2DKSA 5ICZB 2F54E 4C57C 5E8PB 1OAQL 3SQOH 4JFOA 3BGMA 4HS8H 3HR5A 3WDJA 4M1DL 4QRRB 4X8JA 1NGPL 1M71A 2YRPA 2OI9C 2BY2A 3B2VH 1FL3B 2A77H 3BP4B 1ZHBB 2BVPB 4ERSL 3WFHA 1H8NA 2VQ1A 3LN4B 2H8PB 5FYKH 3UTPD 3MRPB 1VPOL 3T08A 2F54D 4CMHC 4I2XE 3BXNB 3EOAA 2H1PH 3V2AR 2KDGA 2N7AA 1H3UA 2HKFL 3MMEB 3NIDF 1YYML 3ARTA 4XH2B 3IDMA 1V5JA 5BO1H 1PFCA 3UROR 3KPQB 4UAOB 4XPHH 4YDJA 1M6OA 3T65A 4AEEA 4KROD 3MV8A 3TZVA 3VFGH 3IVKA 4M7LL 3WS6A 1UM5H 4HUNB 3VXUD 1G84A 3MV9B 3GSOA 3NMEA 2PN5A 1B4JL 5EU5A 1OPGH 1WJ3A 4NYLA 4E9LA 1FLTX 2ZSVB 4JN1L 5IK3A 4NO0A 5DEGB 3PWLA 3WO3B 3TBSA 2HVJA 3GSRA 4L4TA 2ADFL 1HZHL 4H88L 1AD0B 1N64H 3GKZA 3MSPA 5ENWB 4MB4A 1RHHA 1RZ8A 4WEBL 2ADGA 4TOYL 1IM9D 4DW2L 3VWJD 1E6JL 4HJJH 3DYPA 1TVBB 3HZVB 4XP4L 4C4KO 4FXGB 3GRWH 4RBPH 2DBLL 1IVLA 5IVXE 4JJHA 4KJWC 1Q9KA 3PP3H 2W65B 4JFZH 4FXGA 3HI5L 4RFOH 5ACLA 5EU7E 4YQXH 2H45A 4RZCA 3BDXA 4X9IA 4ENEC 4XCYA 2ZG1A 3TZVD 2YKLL 1I9IH 3QJHA 5I19H 3EO0B 4OD1H 2W60A 4PB0H 5B8CA 4XC1H 1GGBH 5CJ5A 4TULL 1WQVT 5F3BB 1BFVL 3QAZC 5M7QA 4IS6B 3WNLA 1F3DJ 5C09E 1C1EH 3ZKXC 5J7CC 2CKBL 3B83A 4R97B 1I3RA 1GH7A 1WGOA 4TUOA 3Q3GA 4MHHG 5BS0A 3EOBB 5E4EB 3HI6L 4NN7B 1FNEB 4RGNC 4MAYB 1KJ3L 2JKXA 3VH8G 5A3IC 4YXLL 2ENYA 3WJLA 3MRKA 3PWVB 5F96L 1DUZB 3HPJA 4P3WA 3BT2L 1LEKA 3U0TA 3PQYB 5IHZB 1XCTA 3QIUB 1T1YA 1PYWA 5DJAA 3D87B 4BA8A 1BOYA 1A6UL 1XR9A 1U8NA 1GGCH 2CMRL 2GJ6B 3BO8B 2C5DC 3PG2A 3TCXA 1OARH 1RULH 3QHFH 4G5ZH 5DD5H 5CLTA 3BO8A 3QUZA 3ARWA 1JTPA 4XPHL 4Z76A 3VRJB 3S88L 4DN3H 4JZNA 5E8OB 2DD8L 4JRXE 5HI3C 5JTWA 5TQ2L 3IS0X 2MCPH 4TTDC 4G43B 2NLJA 1NMAL 1D5ZB 4JRXA 4MHHI 4YAQB 3V6ZB 3FTGA 2KH2B 4Z7QE 2HT2D 2XWJA 1R5IB 2V2XB 5A2KH 1Z5LB 4PRPB 4NCC2 3HMXH 4WNQB 3FFCA 3ARDD 4KVNL 2IH3A 4URTB 2JE8A 3FCTA 1BJ8A 5DQJA 4D9QE 5FYJD 3CCHB 5E5MB 4DCQA 4JZJA 5ANMA 3MBED 5DA0B 5EZIH 1B4RA 3BN9C 3IAPA 2BCKB 1D5IL 5CJXA 4M3KB 1INDL 2GIYA 4PUBL 3W9EB 1X5GA 3ARBD 3SDXF 3BRFA 2WBJB 4GKZB 3DX9A 3NAAH 4PRPE 4XNZB 4XVTH 4U0QB 5I15H 2DIJA 1QRNE 3CC5B 3VJ6B 5D7JA 5ESAB 5IMLB 4WU7B 3TPUA 5LAXB 5DZLA 3WD5L 4P2QD 4AL8L 4IM8A 3WFEH 4WFFE 3WUZA 3PHOB 3STLA 1IGML 2KQMA 5FGCB 3LH2L 1PEWA 2NY6D 3U36A 4EOWH 1KCRH 4IHOB 4DZBB 3PWLB 4XPGH 4QXTA 2DLEA 2CUHA 4JO4L 1KGCD 3EYOA 4BQ8A 4OFKA 1JPSL 2VAAB 1SM3L 1MWAB 2NTSP 4QOKD 1JHTA 5H94A 3EHBC 5HI5D 4PGEB 4EEEA 1EGJH 2H3NB 3TYGL 5DUBA 4D9RE 5F7DB 2YD4A 4PLNC 4WV1A 4PRHB 5L7XL 3FQWA 2LABA 4HPOH 4ENED 4XNXH 3NAAL 3L5WB 3KYKH 5E2VL 1KJ2B 1U8PA 1WWCA 4PRID 2W60B 4IRZL 2MNUA 1MNUH 1WBYA 1MCLA 3C8KB 3UJTL 1AQDB 5HXMA 3UYPA 2A83A 5KG9A 2DMBA 5IIEB 3H0TB 2OZ4H 5E8NA 4IOSD 3O2DH 2QSVA 2R0LL 1XIWA 1BVKB 2OL3L 1EUTA 2LTQB 2CLZB 4JO3L 4WI8A 1TDQA 3O11A 1KJ2L 2ZCLL 4N90E 1KEMH 4MJIA 4RGOL 1P4BL 4YDIH 5FYKD 3V5HB 1I3VA 3D2UB 4HK0B 4PJBA 4Z78B 4L4VB 1NFIA 4GRWB 4HH9A 3O41A 2W9EH 2XA8H 1A8JH 3T0WA 2HN7A 5IJKA 3CFKB 1OY3B 1R3JA 4OGZA 5EU5B 1MCEA 2UYLB 1HHJA 4G8FB 4WFGD 1NEZG 4KTYA 1MFAL 4NC2B 3P9MB 3FMGL 3G6DL 4OT1L 1HWGB 1A0QH 2EDLA 4MNGE 1JHLH 2ZOLA 4X6DB 3E6FA 2VLMD 1UB6A 3NZ8B 4PJ5B 3X14A 5C0RL 3QQ9C 3ULUH 2EYTA 1CIUA 4PBVC 5DJ8A 1QG3A 2Q87A 1S7UB 3ZYIA 2OBGA 5F96H 3ZT7A 3DUHA 1MEXL 3QHZL 1NCAH 4LLMB 1Y18B 4NWUL 5TQ0L 3AMLA 4Y5VA 3G6JF 3P40A 2EO1A 2CD0A 2YD5A 4JEGB 1WSST 1DCLA 5I66B 4P46B 3HNTH 3G5XB 3QI9C 3PWPE 1EHAA 4DCQB 3I75B 3BKCL 3S36L 2YEZB 3VD5A 2OM5A 1FHGA 1OTSD 2PO6A 3RI5F 2YXMA 4YHKL 3QXUA 2P4AB 4M4PA 2R2BB 2B2XH 3L3GA 1WBZA 1JWMB 5F70A 3C2AL 3SDDB 4KZDL 2VLRB 3KPSA 2LU4A 3ZDYE 1U41A 2A6JA 2LU3A 1XAUA 1KLGA 1BEYL 4POYA 4RGNB 1DUZA 2NX5E 3H3PL 5E4EC 3TN0A 4LKCB 1IM3A 3FO1B 4WW1A 2OR9H 2DBLH 4TYUA 2R0ZL 1FRGL 1CU4H 1BBJB 2KZWA 4UTAH 4OCNC 2D03L 1LILA 4H0HB 4MQXD 1B0GB 4P2QE 5MEOB 1T4KA 1EBAA 4JRWA 1PG7W 3K74B 3ARFB 4OLZL 4OZFA 3DUUB 5LQBL 1X5IA 1EXUB 2Z4QA 4LCCA 3DX8A 4G6FB 1R5VB 4S1QL 4BSWB 5L8LB 4LRIC 1B6UA 3FT3B 4CVWA 5GS0H 1YY8A 1QEWB 1XGTA 3HAEA 2IALB 4YHLL 3QIUA 1XCTB 1FIEA 5KVEL 4QF1B 2BY0A 2E9IA 4JJ5A 4TRPH 1YEKH 4FFWD 4MD5B 4XXDB 5FOBA 3WS6C 4D2NA 5FYJE 5AYUH 4F8TA 4DJMA 4QO1A 1KTLB 3OG6B 5FFLA 4POZD 1OTTC 4OZIF 3SKNA 4AMKL 4K71B 2XACC 2VWEE 1KENH 5A16B 4OFPA 5HYSA 3LKNA 5IHUH 4GS7B 4N0RA 3U7WL 3C6SA 3MLWL 1PGRB 4TNWK 5E2TL 4X6FB 4D0BB 5AWNL 4LHUG 1Q9WA 4UTBL 2PXYD 1TZHB 4GAYA 2X4RA 2BVQB 3O0RH 4XVSL 4YDKL 5B4MC 1D6VL 1ZANH 2CUIA 2DN7A 2AEPH 4OAWB 2DQHH 4A6YL 5I71C 2MQ0A 3INUL 1C5CL 1UJ3A 3LQZB 2ATKA 4LLDA 3Q48A 4P3DA 4B41A 3OR6A 4JFDB 3BKCH 3TT3H 1C5DA 1TETH 1XH3B 4P5MB 3R4DA 1B0WA 5L88H 4U33A 3HAEG 3TP4A 4M93B 1NSNH 4YZFE 2OK0H 3K4DA 4ZG1A 5AAMA 3DARA 3KWWB 3U9UA 3LDBB 4WEMB 4WRLA 5ITFA 5IEHA 1W0YT 4JHWH 1G9NL 1GRWA 1DLFL 2XV6B 3QJFA 5CEYB 1NUFA 3E1F1 2GTWB 5F9WC 4PGEA 2X70A 5IB4A 4WO4D 4ONFH 3DXAB 3W81A 3O45B 4XAWL 1JYXA 4M1CD 2Z91A 2BDNH 2IAMC 4XT1C 2R23B 1HIML 1X44A 4HX1B 1UXSA 4PB9L 1N4XL 4S2SA 3C6LB 4DQOH 1BZQK 3WJLC 4EUPG 4HIEB 3KXFE 3C9NB 1WT5A 1JV5A 4P23C 3D0VB 4RFEA 3G6JE 1LK3H 4CVXB 2XXMB 4HPOL 4YDLB 3OKNA 5E9DA 1LO0H 3MRDB 1JK8A 3BZFB 3KPSD 4L8DA 4ODWB 5CJOL 5F7EH 2XN9A 3PABB 3UBXA 2AJ3A 5E6ID 2AI0H 3HE6B 3EW3B 5HGAB 3V0VB 1S7SA 2OTWB 3QNYB 1FE8H 3GK8H 5JPMA 3C09C 2DWDA 5DTFA 5ESQB 3U4BL 1CGXA 1P9MA 4NJ9L 4NP4L 2WQRA 2Q86A 1BREA 3ARUA 3L3OA 3CXDL 3BJ91 5CLWA 2JB5H 3KGRA 3MRDA 4NN5C 1AI1L 4X6CE 1MPAH 3H9SA 3R0MA 1UKSA 1AHWB 3WHE0 2EH8L 2V7HA 3MUGA 3AU1A 4A6YA 1GHFH 1S7SB 3U30B 1XGYH 4MS8D 1A7NL 4PJFF 2F74A 3NCYP 3HHRB 4L9LB 3UAJC 4HW6A 4RGMC 2H9GA 3DMMA 5B3JF 4GMTL 4WDIA 1BQLH 3CSGA 1AXTL 4I0CC 4AEIH 4XNMB 4JDZB 3ULVF 1A6ZA 1F3JB 4LBEB 2VIRA 3MCKB 1OSZB 1DEEA 3BW9A 2P43B 2VLLB 3MBEC 4X6DE 2G5BA 5TE4H 3AXLB 4PJ5D 1AP2B 5C0BB 1I4FB 3MBEA 3QA3A 5GQBA 5GIRA 3MXVH 1DE4A 4LMQE 5EBWA 4P46A 4MJ5B 3RVTC 3PE9A 3QDHA 5F7WC 1HYSD 4OD1L 1DDHB 2P49B 3BP5A 4XGZB 5DHVB 3T1WA 4OLUL 3TO4C 4KXZI 1U3YA 4ZFOB 3U46A 3I2CH 3GO1H 3DETD 1N8ZA 4QRQA 3UP1A 3QR2A 2GEEA 4MZ3A 5D2LB 3T0EE 2I26N 1QR1A 3H7BA 1NDGB 3LD8B 4ZD3H 1G9EA 4M6NH 5FDWB 1IQWL 5HJ3B 3UYRL 1FAIH 5KVEH 3HUJE 1TVHA 5EA0H 1CL7L 2F8OA 5D2NE 4OF5A 2VLJD 1FNHA 4KMTH 3TFKC 3FN0H 5I1GH 2JF1A 3PL6A 2VDNH 1A1NB 4TVPD 1NAMH 3VRIB 4WWKB 3E2HC 3F7VA 1BFOA 5I1DB 2OMNA 3MUY1 4LSTL 5D9SB 2GSGB 1EFXB 4WO4A 1NGXA 4X5WB 3M07A 3NZHH 5IKCB 5C0DB 4NJAH 3SJVB 4BFGA 2YZ1A 2KBGA 4RAHA 1XZ0A 1U8HA 1CU4L 4UIKH 4GW1A 4NZRL 3QDJA 4P5KA 1I7RB 2JTDA 3NCJH 4KGJA 1YY9C 4KKLD 1YMMD 4RQQB 4G3YH 3O3EA 1NBZA 3WXWH 3RUGE 1HILA 2OJEA 1W2KT 5HHOE 1CE6B 4BFEA 3WNKA 5J06A 5KSBA 4YZFF 1G9NH 1QD0A 3MCLL 2YUWA 3RTQD 3GSQB 3MLPA 2XQYG 3WNMA 5C0JB 2XN9D 5D1XC 3DWTA 5A16A 5HYSB 3TN0B 4HBQA 5H2BB 3S34H 5CGTA 2JJSC 3U36B 2IH1A 2VDPL 1NCDH 5I1KL 2QJDA 4KI5C 4PRHD 1QEWA 4YC2B 4HJJL 1O7SA 4E0RA 5IM7B 5DEFB 2IEPA 2Q8BH 1D5ZA 1FVCA 1M71B 3VFRA 1LO2L 2VR9A 3L3JA 4K8RL 5INCB 4U6XB 4M4RA 5JW4R 4K7PY 3E2HB 3CLFL 5D6CB 1K5NA 2I24N 3KXFA 4NO3B 3EYVA 1P7QA 3MOAL 2LE9A 1P5VA 4NQSB 1T83A 2ESVD 5C07A 3IU3B 3ROOA 1ADQL 5IVZA 4J3OC 1B3JA 3OZ9L 1DQQA 4MQSB 1CXLA 3SOBL 4NP4H 2R69L 5INCA 3GUTA 5CD3B 5TFSL 5J57B 1EVTC 4CU6A 3LD8C 2G5BB 3SCMD 2NY1C 1OQOA 4PJCB 5I8OL 4LLAA 4HSQA 3Q1SH 3WHXB 4F9PA 3EDJA 2SEBA 5F6IB 5ELIA 2QLVB 3ARDB 3JBG7 2NY3D 1LK3L 2K1MA 3QDGD 2B7DT 2J4WL 5DYOA 5DJCB 1I9RL 3WFBL 1BZ9B 3VH8A 2BNUA 1IQDB 1CFVL 4FQHB 4HUXB 1H15B 2XFXA 3WUWG 2AJYL 3CX5K 1QFUH 5ID1B 3DVNB 4XZUA 3IRPX 5GS1C 3MYZA 2EDEA 4XBEL 4O58H 4JB9H 5HGAA 3QXDB 3V0VA 4K3EH 4V1DA 1A6VL 3X11A 3LPGA 4LCCC 2PTVA 4L3EB 3QXDA 1KNOA 4WFED 1JPGA 1YUHB 5CJXC 5I8EB 4N0YL 2Z8RA 2W92A 5K33A 3PGFH 4XCEB 1X5HA 1UB6B 1F42A 5ACMA 2ZUTA 1A02N 1P4BH 4YDIL 5FM8A 4ERSH 3OBAA 4OKDA 4ODUB 3MZGB 1NGPH 2E7CA 2V7HB 4BQ9A 1AD0A 1ERNA 1UH4A 4HFUH 4D0DA 5EA0L 1AQDA 4CVXA 2YPLA 3OJVC 1V7NL 5DEGA 5EO0A 3C08H 1HNFA 2BSSB 1AHWC 3GBMH 3MLRH 2P24B 2M2DA 4NYLB 4B5EA 1NPUA 4IRZH 4NWTH 5CILL 4KTEH 2ZUQB 4X9HA 5D7LB 1MF2L 3QJHB 4WV1C 4ZUUA 5EPMA 1NLDH 4ONGL 3AM8A 3AS0A 1LVEA 3VXSE 1UZ8A 5FUOH 1PZUB 4KWUA 5CUSH 2RCSL 3UAJD 4KKLC 5ERWA 5FUZL 2NR6D 3D3VE 3M1BB 4N9GB 3G5VA 4YR6A 1SVCP 2QQKL 1TCRA 1WZ1H 2MHAA 2P42B 1SEBB 1CDGA 5SX5H 1AY1H 4MXQD 2F5BH 5LWYL 4BZ2H 1ND0B 3MR9A 1UWXH 1J05B 2O5XH 4YIQB 4D94A 4P23B 4IRJC 3ILPB 5DHYB 3CVHA 1LE9A 1W72L 3S35X 2LV4A 4NUGH 3CAFA 1HKFA 1N6QH 3C6LC 4YGAB 2VWEC 2L0DA 1BVLB 2AXFB 3BHBB 1AKJD 4NKDB 5MI0B 4WJ5B 4G9FD 1F4YH 3WJJA 1U6AL 3LPWA 3IDUA 4LKXB 3S8WA 1A9BA 3T3MF 4J1UA 4XNQA 2FD6L 1MVUB 4ZSOB 5C7XH 4JKPH 3QXWA 4ETQA 5EB9A 1KB5H 1JMZA 3VXUB 1QO3B 3K8KA 1CICB 3QUMH 3NFNB 4F9LC 2BNQD 4R0LB 2IPUG 4RMSA 2HP4A 4LBEA 1T04A 3AY4C 3O6ML 4M00A 2B1HL 4N5ED 2Z0BA 1A9EB 4OZFH 2J7LA 4KDWA 4M93C 3D3VA 4S1SL 1QFOA 3EDFA 3QI9D 1FC2D 1NMBH 5EUKA 1CF8H 5ACZB 1R3HB 4JN2A 2R0LH 3BZEA 1HIMH 3AY4A 1MLCB 4Y16C 1XMWA 4G7YH 2YD9A 4TSCH 1QR1B 1MI5D 3BP6B 4U1GB 1OGAE 4I77H 3W11C 5D7JB 3HUJA 5A3ID 3T77A 4I77L 4EN3A 1UZ6F 5DFVD 1IAKB 5L6YL 3FFCE 3SY0B 3ULSA 4AEHL 3VRJA 3SDCB 5ISZE 5INDA 5IG7A 2XWJB 2JK5A 1RVFL 1OB1A 1QUNA 1R3LA 4EDXA 4GS7C 3KAAA 3BZDA 4JFFE 4NBZB 4AT6B 1VESA 3V5KA 2VDMH 3HE6D 3VMNA 1C08A 2PO6C 4Z5RB 1OGTB 2BP3A 4OQ1A 1XF3B 4D8PA 4MDJB 5T3XE 1QSZA 4HUXA 2XFXB 2PETA 3QHFL 5MEOA 5HYEA 5TF1H 4JPKH 1KXTB 2NY2C 2K9UA 3H9ZA 4MSWB 4L8CA 4GBXD 3QZWB 5E4IA 5EULV 3SDCD 4NOBA 1R5VA 1KJMB 2RCSH 4F2MA 1YN6A 2HJLB 1J1XL 3AROA 5AWNH 5C07E 1ZLVK 3C6LD 3RPIA 2D0FA 4KTDL 2J1KA 2OJZL 1BX2A 4DFIA 2FGWH 4ZNCD 5FEBA 4P57A 5F44A 3MRQA 3C5SB 5IBLC 2P8PB 4TUJA 5JO5B 2R9HD 1FO0A 2I9TA 2DQJL 3FFCD 4KXZH 3B3IA 3MJ8B 3OB0K 3B8YA 1QQDA 4IDJH 4XRCA 1YEEL 3BIKB 3PV6B 1IKNA 1C5CH 3INUH 3MOBL 1MFCH 1CLYH 3KPOA 1NGYA 1QNZH 1JI2A 4L4VE 3MLVH 3MRQB 2NW2A 5C07B 3L3KB 2VXSH 5EUOE 1WK0A 4AY0A 2HTKD 1WFTA 3ZKMD 4PTTA 3FONA 2AQ2A 2YPKA 2EDTA 5JPMB 3QG6B 2ADIB 1OW0A 2VZOA 5DUMH 4NQDA 4X6CF 5KSAA 3MV7A 3PGFL 2FR4B 3FB8B 4PY7A 3H42L 3JWDH 5D7JD 3WN5C 4LNRA 5M94B 1R3KB 3RZCC 3SDAB 2H2PC 4JVUA 5GGQL 4FQIL 4YXKL 2A6IB 1UH3A 1YMMA 4JZOA 3V4UL 1EAJA 3SOBH 2F74B 2XZCL 4GBXB 5DMJB 1HSAB 2AJYH 7CGTA 1T7ZA 5B8CB 1JPTL 1NBYB 1EAPB 2CDFA 5KVGH 1EEZA 4HK0A 3GMMA 5IOPA 1JGLH 1GOHA 1LQSR 4W81A 5I17A 2K7QA 4U3HA 3G5ZB 1FL5B 4YNYB 5HGHA 1CS6A 3V0AC 5MI0C 3UJIL 2EYSB 1Y18A 3D2UA 4F37F 2APXA 5ESVB 5C6TL 1QSEB 1DVFD 1UJTA 2AQ3A 2BSTB 4ISVB 2VC2L 3ARPA 1U58B 4UOW0 2Q8BL 3KPRA 3OGCB 4JFDD 4Z8FH 3GM0A 2IANB 3CUPA 7FABH 4JFED 3P9WB 3IDJA 1G0DA 3NZ8A 5KSBE 4X4ZA 5IK3B 1T2JA 2UYLA 1RJZA 3MGTA 2I27N 1RMFH 3SGEI 1GSMA 4NRXA 4QCIA 3D0VA 2Y25A 4H8WH 5I76B 2FH6A 4CRPA 1X5AA 1XIWD 3IJHB 1RUML 1JUFB 3N1FC 1MLCA 3MRPA 4LASL 5B39G 3L3HB 1A6PA 1P7QD 4NOFA 3K8MA 1HSBB 2BX5A 5KS9B 2ESVA 4XGZA 2BNRE 4GMSL 2VLRE 3FB5A 3KLSA 5AZEH 1FPTH 2JELL 4UT9L 3OG4B 4FTVD 3L3IA 2J5LC 3NTCL 4OZ4B 1DQJB 4G9FB 4LLYB 1NCDL 5I1KH 4P5TB 4DW2H 4TOYH 3FL7A 3GSUA 3SDDD 3P4OB 1WZMA 4XP1L 1RFDL 2E7HA 5IMLA 2XYCA 5DJXA 4JDVB 1DBBL 3VFSA 1CFSB 1KLUB 3VMOA 3QEQB 1L0QA 4JE4B 1T83C 1W0WA 3WIHL 2EH8H 4KI5D 4Y4KA 2DIBA 5DVKA 4GRWH 2H2SD 3QDAA 3RTQC 5ICYA 3X3FL 1EHNA 4LLUA 3Q5OA 4JO3H 3QNZA 2WBJA 3VFGL 5DD0H 4K9EL 1MIEH 3ROLA 3BZ4A 3LQAL 2ARJA 2XG5A 1CXIA 4C56A 4DUVA 5DRWA 4U6TA 4R6UA 4LRNH 2HKHH 5HVHB 5AAWA 3IGAA 1S5IL 4QOKB 3TO2A 1PY4A 3FO1A 4WW1B 2MPAL 3RGHA 4P4KC 4F7MB 4RWYH 2BNRD 1U8KA 2ARJB 5FM5O 3LRSA 5FM5M 1DLHB 4HLZH 1TIUA 4BSWA 5KSAB 2P8MA 4M43L 3T0AA 5E94B 3VD7A 2FR4A 1I3GH 5EU4B 1ADQA 1SJXA 1O0VA 4J4PD 4NUGL 1UYWH 4KV5E 4OGAD 4F7CB 2YR3A 3QEUB 1DJSA 1RIUL 4EBQH 2H2SC 4M8VA 1ZHNB 4YK4C 2PTTB 1NCCH 1PYWB 5DJAB 3TT1H 3GO1L 1S7QA 1D5MB 5EC1A 1K4DB 5IR1B 3VFTB 1QFPA 1MRFL 4NO3A 4X6CA 4GRLA 4MA8L 5IESH 1J1XH 2OK0L 4JFXB 1FFNA 5GSRA 1I8KB 2Y5TB 4RFOL 2VE6B 4PJGE 1UB5B 1T66D 5ALBH 1ZXQA 4DTGL 1CL7I 3MNVB 2R23A 1MPAL 5GISL 2NY3B 1P1ZB 1NC4A 5IVZB 4Z95H 3LV3B 3C08L 1I1FA 4P2RA 1XGUA 4HS3B 5C0CB 4PJAB 1FVEA 5CP7B 5A2FA 3IDXL 1IGYB 3CVHH 2LU7A 1JGVH 4UV7L 1UCBL 2B4CH 2VLKD 4ODVH 2UWEA 1RVFH 5DHXB 1JUFA 2W0KA 3W2DH 3L95A 1C12B 3FO0H 4FOMA 4HDIB 4HCRA 5I16B 1C5DB 3MLZH 2W0FA 4Q9QL 2WWMD 1IEBB 3OJDA 3ZKND 1XIWC 1TQCB 1QPXA 1YPZA 3KWWA 5F7MC 1T2XA 1IEAB 1KPVB 4LEOB 1JZ3A 5C9JA 5I1IH 4PJAE 2R29L 3OZ9H 5E5RB 5E2UL 2GJJA 2VL4A 2F19L 1BECA 1Q94B 1UM6H 2VZVA 3LEVL 4V1DE 1CDBA 4NNYA 3CX5J 1NH6A 3QULA 4CKVX 3TH3T 1YPZB 2FJHB 1UWGL 3KJ6H 4UINH 3QAZB 1T5XA 1G7PB 3K80A 5C9KA 5E08H 2IAND 2M1KA 3JV6B 1HXYA 2JJSA 3MV8B 2P24A 4Y4KD 1CIDA 5HPMA 4M7JL 4GBXC 4GSDL 4LAQH 2A6KA 4I0PA 1OM3H 2P7TB 2OR9L 1CDJA 3UDWA 1QBLH 2IAMD 4QT5B 4EJ1C 4KAQH 4LPXA 3TC9A 3ULVE 2CR6A 5SWSD 3LEYH 1VFAA 4NT6B 1YMHA 4OIIL 1Q9KB 3HKFA 5IV2B 4F15B 3FZUD 1FFRA 3BGFB 2G2RA 1RI8A 2AEPL 2CIKA 5IT2H 1MHCB 5D7LE 1KLFA 2H32B 3TO4B 1QFWI 3GHBL 3WDIA 2DL9A 2FHCA 1IGTB 2JCCF 3GZKA 3IETB 3NCYS 4BM7A 4HHAA 3V4VH 1AGBB 1D6EB 1EEZB 3VI3F 1M05A 3HRZB 5C0AA 4HWZA 1NBVH 2R56H 3O8XB 4N9GA 4YR6B 2AKRB 1CBVH 4YFLI 5D1XD 1RIVH 3HZKA 4P2QB 4OI9A 5EBWB 3H7BB 3IDGA 2EYRA 4XVJH 5CHNA 5JDSA 2HMID 1OSZA 3MGOA 4BSJA 3T09A 1P4IH 3BPOC 4BSVB 3PQYA 4QLRA 1SYSB 4Y5VB 2X1PA 2IFGA 1U42A 4J3WA 3UTTE 3F8UB 3UXFA 3S4SA 1DR9A 5ABDE 4ZUSB 3L3DA 4PGDA 1CDIA 3BN3B 4PP1D 3U7WH 1G9MC 3LMJH 4MJ5A 3BUYA 5LCVL 3VGFA 3S37X 1AR2A 2AK4A 4Z76B 4WNQA 5ADPH 4R4FH 4YLQT 2BK8A 1UXWB 2FEDD 4DFHA 1Z5LA 3G6DH 4MNGA 3EJYC 4F58L 5GHWH 4OLWH 1BQHG 4XPFL 3DOSA 5TDPA 4KZEH 5HHOA 1EFQA 1DDHA 1VGEL 3WYRA 4IRSA 4M62L 5T1MB 4CADB 4JLRA 3OKDA 1AC6A 1E27B 2W9EL 4RQQA 1T66C 4KK8D 4CADA 1CXFA 1XCQA 1A2YA 3MLYH 4OF8A 5SWZD 4AENB 1PLGL 3BIBX 5IW1B 1LNUB 2D0HA 1HQ4A 5E6YA 3FQTA 2A74A 5ETUA 4YDLC 4MYWB 3VXOB 1CT8A 2IQAA 4P2YA 1VSCA 2X6MA 4FZEH 2E27L 1J0IA 1U3HB 4H5SA 4NKIL 3U0PB 3VFSB 3ZE0E 4HX1A 4K3GA 4U3XA 3MC0A 2EECA 5DRZA 3ULUE 5KW9H 5JZ7C 4LLQA 1XGPA 2WLZA 1BQHB 2ICCA 3BQUA 1FRGH 5IQ9A 5SV4A 2CDEA 5FUCC 5DSCA 3VFWB 1OWRM 4MCYB 1F3DH 5CIPB 4ZS7L 4M5ZL 2Y23A 3MRCB 3NCFB 1G7QB 4HUWA 5DMKA 1GL4B 4FZ8L 1JNLL 1I1AD 5F9WB 2VN4A 1G7LB 4K8RC 1VGKA 4S1RL 3M8OL 1ZE3C 5F88A 3FO2A 2G9HA 4O5LH 4OJFH 1WICA 2P48B 1INDH 4QRPE 1ACZA 4MCYA 1MREH 1QFWH 3DGGB 4F7TB 3WLBB 2VDKH 5EUKB 5DVLA 3C8KA 1B2WH 1X5KA 3D2UD 4QTHB 2MOVA 2Y6SC 2QADD 1IMHC 2G9HB 2FB4H 5JW4Q 3MV11 1AGDA 4LIQE 3TJHD 4KJWD 4XTRC 4OUUB 1YDPA 5IB1A 1FGNH 1FH5L 1BWMA 3S4SG 3T04D 3TBTB 2Z93A 4HS3A 5IB2B 4L1DA 3LS4L 3PDOA 4Q0XL 4WV1B 3KPLA 2NCMA 1JFQH 3LKOB 3UZQA 1A22B 1EO7A 1MCWW 4JB9L 4OZFG 3LZFH 1X5XA 5L0QB 2MWCA 4XI5D 1SYVB 4Y16A 5C0CE 3RIFK 5MENA 1LGVA 4RISL 1FZKB 1WWWX 3H0TA 5E8NB 3VWKA 3MRRB 2OQJA 3DMMB 5I0ZA 4QKXB 4KQ3H 4ISVA 2YSSA 1ED3A 3MV9D 4C56E 2Z35B 4FTVA 4OZHA 5BRZD 2DJUA 1S7QB 2FYYB 5EIIA 4XNXL 5C9JB 1CFQA 4NPYB 2C3WA 3CVIL 5E00A 1Q0YL 3BVNB 1JWSB 2FO4A 4NHUB 4QRRD 2D7OA 2DF3A 1CD9B 3T0DA 1SJHB 4YFLF 4CMMB 5D7LD 4M1CC 1NJ9A 4HULB 3MJGX 5T3ZD 3RY6C 4KTEL 1HHIB 1C7SA 1J1PL 4UILH 3ZKNC 4TNVF 3X11B 1H15A 4M6NL 5BQ7B 4AIZA 5IBLD 5HVGB 4DUWA 1ZGLM 4IRSD 5C0CA 4L3ED 2KQNA 4ZFZB 3ES6B 4YHZL 2NY5H 4YDKH 3MRMA 5C09D 4X98B 2P47B 1MWAL 3WBDA 2DB8A 1OAKH 2NQCA 4QTIH 4LPTA 2Q6WB 3CX2A 2QQLL 5I8EA 1WIOA 5D2NA 3QEGL 1KENL 1RZ7H 2HFGL 1DN0B 5IFHH 1T22A 4YO0A 2VLRA 4RMTA 2XRAL 3CU7A 2O5YL 5DJYA 2IPKA 1EXUA 3QDGB 4PJ8B 3TM6A 1M05B 1MHPL 2VZUA 2H32H 4P46C 5C0AB 2DI7A 2JLLA 3HMXA 5TPWL 4I2XA 1V7NH 1DBAH 4P4KD 4FQQA 1CFSA 3HG1A 3DX6A 2GITB 1CLZL 3CPLB 5E08L 4WFGE 1A5FL 2QKIB 3KPMB 1HHHA 4LAJH 4S1QH 3T2NL 5DJYB 1N2RB 4U1KA 3KPRE 2J8UF 1T5XB 3D9AL 3D5OF 4LLWB 5EUOB 1L7IH 1S7VB 1MHCA 1U95A 4RGND 3KNBB 4YC2C 4HCRH 4LSQH 3WN5A 1F13A 3G5YA 2ZUXA 1N64L 4ZYKA 1EHXA 4D0BA 2YPLD 1PJ9A 2F54A 3RZCA 4X4XB 3RNQB 2EDRA 1AKJB 1ETZB 2XZAH 2E27H 1K6QH 2IGFH 1U8MA 4LOUD 1NCWL 4P9HC 2VDQL 3QNXB 1FE8L 4LKXA 3VFNA 4JCLA 3FHQA 2AQ1A 3LMJL 4WUUD 3RHWK 2OCFD 3BH8B 4Q6IB 4DGVL 4WO4C 1P2CA 1BVLA 3SKMA 4DK3A 4ZYKB 5LGHH 3OKEB 1R0AL 1FNAA 4P5MA 5F7YC 4L5FH 2BY1A 5D6DA 4JJ5B 1S7RB 3VFOB 1LMKA 4OZIA 5IFAL 2VXUH 3QCUH 2Q20A 4LPCA 5I8CA 3I6KB 3VD3A 2NZ9D 3CFCL 3ZHDA 4RX4A 2HFFB 2X7LA 4Y4HD 4HC1L 3OKEA 3X17A 4KHTL 5FKAA 5IBUB 4IRJD 3MNVA 1DQMH 2AERT 4FABH 3VE0A 1A6TB 4OLUH 4WWKC 3VWJA 3EO1B 4PLOB 1MJJB 5GGRY 1HWHB 2D7MA 3AAZB 1F2XK 1LD9A 5C8JB 1CD1A 1IM9B 4JAMA 1L7TL 3P4MB 3C2AH 2G5RA 2CKBB 5TF1L 3RJDA 1OAUH 2GTWA 2C3GA 4K7PH 2JJVA 2B5IB 1FFOA 2WIMA 1KJ3H 5CP7A 1TVHB 3PF2A 3N50A 4M8QA 1RZ8B 3AAZA 3H9SD 4ZOAA 4AIOA 5ITFB 3MO1A 1H3WM 1NEZB 4Z8FL 3WFHB 3DO7B 3ARBB 2XKNB 1MEXH 3BEVB 2WUCH 2D3VA 4PJEF 2QQLH 3EYOB 4FFZL 5F71A 3WLWD 2GK2A 2IC2A 3RDTA 1JIBA 3BXNA 1D6VH 4NC1C 4P3DB 3DBXA 4F8QA 3RTQA 4GKZA 1I7ZA 1A7NH 1N59A 3EUUA 2VDRL 4LGRB 5DMKB 2R1XB 1DFBH 2DQEL 1AR1C 2F5AL 3DUSA 1PKQA 2Z31B 2XTJD 4KRPB 3MUGB 4A6YB 5K9OB 5CCKL 2GK0A 5DD3H 2HFTA 3AUVA 3GSVA 4WU5A 4PRHA 4Y4KC 3LIZL 2Y7QB 3F12A 2OL3H 1MRDH 4X83A 3WEXA 3NN8B 3UC0L 1G7MB 4CVUA 2AJSH 3H3KA 5EBLA 1F90H 1BX2B 2IPTL 3ETBF 5B3NA 2E9JA 1HZHH 1XF2A 4P4KA 3SBWA 3UTZB 3U6RB 3BKYL 3SEPA 3MRNB 3Q6GL 2XNAB 1OCWH 2N56A 3MA7A 4RGMB 5EO0B 4UI2A 4P59H 1JN6A 1OPGL 1ZA3B 2ZZUT 1LE5B 5HHPB 2UWEF 2RR3A 3ZL4H 3HC3H 3DYOA 4K7FA 5GGRB 1OHQA 4Z7WA 5FYLH 4PJ9A 1YEFL 3CFKA 3V4PH 2R8SL 1FZOA 1ORQA 2QBWA 3IFPA 3FOMA 3NTCH 5DTFB 1EHLL 1G9ML 3LKSB 5DD6A 3HCVB 4IIQC 1CGWA 2GHWB 1E4WH 5TE4L 1YJDL 4XMKL 3VI3E 3ZDXF 5JPNB 4PJGA 3MRBB 3C09B 1JNNH 3MCKA 1KYOK 3AREC 3V8OA 1RUPL 4LHUB 3UTTA 1AGDB 1T5WB 5CHNB 5JDSB 1NANH 5E6IC 4OQTA 5SWQB 3P0VH 4MDIB 3THMH 4XX1E 3WUWB 1AXTH 4BKLA 5JIKA 4XHJC 4KU1A 1T0PB 1OAYH 5BOZG 1AGCB 4NFDA 1IGJB 5EN2B 1D5XB 4P48A 3L9RB 1AHWA 1FZMB 3IFNH 4O4YH 5IVNA 3V5DB 1P6AB 4HIXH 2DS4A 3VG0L 2X1WL 4NO2A 1RJZB 3MGTB 4Z7QF 4NN7C 5EC2B 4V1DD 5KW9L 1LO3L 3KPRB 2DM2A 2R2BA 4WTWA 3VFUB 4G6JL 3GGWB 1PVHA 3QHZH 3V0WH 4F33B 2R0KH 1JNLH 3QUZB 4AEHH 4Y4FD 4M1GL 4Z7VA 5KJRL 4Y16D 3CDGA 1RZJL 4X0KB 5F1IB 3VXSA 3TNMA 2JIXB 3L1OL 4LCWA 2IF7A 4GOSA 3A6CH 4UV4L 5E7BA 2G75B 5KZCD 3GSUB 5IBTL 2ADGB 5J6HA 5FYJL 1ZKAA 1U36A 5TE6H 3P9LA 3HUJB 1JCKA 1K3IA 2GSGA 3QFJD 4JFDA 1YMHB 5CFHA 2IMMA 1IBGL 3ISWA 3CDFA 2H3NA 1I9RH 3DXAE 5H8DA 3HZYB 1ROWA 5D7LA 1MLBA 1J1OL 5A40E 3IU4L 1OCWL 4HPYL 1CGSH 4O2FA 4DAGH 2OTUA 2R4SL 5C07D 1XGPB 5I1JH 1YPZE 2WUCL 4FP8H 4TSAL 4NGHL 4WIQA 5BV7L 5IROC 4H5SB 1CE6A 4NKQB 4MXQC 1CK0L 1MJ7H 4IDJL 2XA3A 1GCFA 4F58H 2H2PD 3TT3L 4PJ8A 3QWOA 3CIQA 1KTKE 5TDNA 4A2MA 3DRTA 4KUZL 3UDWC 5FHBH 3UJTH 1MREL 3MYJB 3S96B 2BRQA 3C5SA 5H37G 1AQKH 4U6HA 5HHMD 3UX9B 5J9PA 2VSDA 1XZ0B 4LK4A 1VADB 2A6JB 2V5YA 5BV7C 4PY7B 3CSBA 1C7TA 1MELA 2OI9B 1J9CT 4HK3J 1I8KA 2BNQA 2Y5TA 3BWAA 3QNXA 1NFDF 2BSRA 1NANI 4JPKL 3RQ3A 1H5BC 3ESVF 1JPFB 3G08B 3GMRB 5DLMH 4AEFA 2BXYA 5CBAA 2FB4L 6FABH 2X1XR 3AGVA 5EZJB 2NW2B 4QRRA 4EI5B 3HG1D 1ZWIB 4NWTL 3FQUA 5CILH 5IF0B 4RFNC 2CUMA 5LBSL 4OGXL 4OFVA 5C3TA 3PGCB 1ZMYA 4KJPC 1JPSH 4GSDH 1Z0NA 5E8PA 1ZWIA 5B38G 1FYTE 3IFLL 5HHMB 3ZYOA 3IAGC 4M48H 2AXGA 2E6QA 5D7KD 5JORB 3TJEH 5BS0E 3NGBB 2Z4QB 1KIQA 2EXYC 5JHLH 4MS8C 2VUYA 5CWSA 1N3NB 4LVNB 3GI8L 3L7EB 2Q7YA 5DVMA 5LQBH 4WY7L 3WO4B 2DQFB 1A0QL 1TJHL 4U1NB 1SVZA 1AGCA 1K6QL 3KYOB 1ED3B 4IRSC 5ICZA 4PRDA 4EXKA 1IZKA 1E0OB 4KJYB 7FABL 2XKSA 3AREB 4O58L 4X8JB 3EOYG 2VLLA 1JHKH 3VFMA 3HR5B 3J7HA 4HKBB 3DX9B 1HHJB 3AB0B 2P8PA 4TUJB 4NNYB 4NHUA 5DJ8B 1I4FA 2ATPA 3QXVA 4XCNB 3F12B 3S35H 3QFJB 4HPYH 4FTVE 3OR7B 4JPVL 1JYWA 5GRJH 3KPSB 3TA3A 1BEYH 3FO9B 3RAJL 3LN5B 3QZWA 3EFFB 1RUAL 1KCKA 3CXHJ 4LDLB 4JVPA 1FFQA 1ITCA 1JPTH 2F19H 3TJEL 2B2XL 4I0KA 5EBMA 4NQCE 3ARGA 1R3JB 2DLIA 4OFDA 3VDAA 5E9DD 1F90L 2D03H 1S8DB 1LDPH 2KUTA 2MJWA 5AG9A 4HCRL 4LSQL 1RUQH 5GHWL 3AVEA 4HUUB 1DQDL 1KGCE 5IHLB 4NRYA 1AD9B 4HAFA 2FJHA 3EYSH 1RZJC 1WWAX 3BQUC 4UQ2B 2XN9B 3SPVA 5C0IA 1GGUA 1QFHA 3RZCD 2FGWL 4FHBD 2ZNWA 2NXYD 5HYSG 4ZO7A 3PDOB 3IDMB 1FYHB 4UV7H 4HV8B 5LVEA 5JR1H 4HF5H 4N8VG 1KELH 4M6AA 5L2JA 1RK1B 2XTJB 3VGEA 1OAQH 3EYFA 1QSFB 1U93A 1AD9A 4LCIH 1RIUH 4OIIH 4G8GA 1MFCL 4N9OB 4NZTL 5IKCA 3ARBC 1UXSB 1BAFL 4F80A 1FNGB 3VWJC 3BD3A 1JI1A 4ZTPH 1QRKA 2VL5B 3ILPA 1U3HD 1JV5B 4JKKA 2CKBH 4EUPB 1YY9D 2JIXD 1FNEA 4WUKH 1PSKH 3OGCA 5IW3A 2R4SH 5T33H 3LKNB 4QRUB 4HFWB 4QTIL 5JPNA 5KBNC 1HN1A 3P0VL 2ZJSH 3QP3A 4WHYH 5HHVL 2VXQH 4MNHB 4N0UB 1UWGH 2Q8AL 1IFHH 2I07B 3G5ZA 4UIMA 4ZOBA 3GSNB 5FHBL 3RKDC 5IBUG 3KPRD 4PJ9B 3MODL 4Q6IA 1I7TB 1MHHB 4JFZL 2AJZB 2KPNA 2WUBL 3O4LD 3FT4A 3EO0A 4TNWF 2ZPKL 1Q72H 1ZLWK 4NJ9H 2YN3A 5ID0B 4GQPH 3QUYB 4NCDA 3OAZH 4JZJB 4JY4B 1YN7B 5HGHB 1KV3A 4ZOCA 4N1CA 3G04B 5JXAH 3O3AA 4HQQH 4X80L 2XY2A 5C7XL 1UGNA 1RZJH 1LO0L 1U2CA 4M9OA 3L7FA 1M7XA 4NBXB 4X4ME 4WI9A 2M8XA 3H6JA 5H35A 3S4SB 2WBJC 4XNZC 4X7TA 4Y7MA 1W8NA 3OX8A 3LSOB 3CMOL 5D8JL 1A7OL 2DM7A 4LCWE 1S78C 3G9AB 1N6QL 1CF8L 1WIUA 4LSSH 4XMLL 2VJXA 4PLKC 3SKOA 2YA0A 3OKDB 1UXWA 3VGDA 3RWFB 2XWBB 1VFBB 1NCBL 4JFPB 4JG0L 3S9DB 3RL2A 4TQEH 3B5HA 4XAWH 3PHOA 4L8BB 3STLB 4CN4A 1XF1A 1DUYA 4EQ3A 4RFEB 2F53D 3K2UL 5CJOH 2OX5A 2A74B 3KYNB 4K8RH 2D0GA 3MO1B 2GT9A 2QQNL 5FF6A 3W2DL 2B1AL 4RSVA 4IMLB 3JVGC 1KFAL 2DQGL 3FRPG 3QFJA 2J8HA 2FJGB 1U95B 2ZP0T 3RPKA 3GDBA 1IL1B 3TN0D 1KCVL 5LJYH 2D7TL 5CP3H 2P5EB 4JRXB 3SQOL 3QQ3A 1NEZA 5AYQA 1H0DA 2HWZH 5EU6A 3V7AG 1I9JH 5EO1A 1OWWA 2DTSA 4YBLC 4ZTOH 4C56D 4M61A 1Z9MA 1I1CA 2Z31D 1FG2A 1TTFA 4Y8DC 3QRFM 4NQDE 1HKLL 3PWPA 4DGYL 1OGTA 3PV6A 1P4LB 2X4SB 3JV6A 4PJ8D 4X6BB 3U4AA 4GG8A 1UC6A 1FYTD 2VR4A 2HRLA 4UT7L 2D7NA 1T21A 5SWZA 4N8CH 3SE9H 1INQB 1FC1A 3WFCL 3SKJL 1PEZA 5J9PB 1OW0C 2QHRL 1XGYL 1U8KB 1YEIH 3GSWB 3X3GH 3QCTH 4HJGA 5KSUB 4EI6A 2A73A 3UPRB 4ZUVA 3TZVC 1KG0B 2D4FA 4J8RB 4WI4A 12E8H 1CLOH 2CLRA 2QSTA 3R1GL 4D0CA 1ZS8B 3QWOB 1JWUA 2RFXA 5FGSA 5DVNA 4HZLB 3O2DA 2R8SH 4J3XA 2HVJB 1MJJA 2GJ6D 5D6CA 2X4PB 1NBZB 1NAML 1TTGA 4KROB 1HSAA 1HILB 2OJEB 2ICWJ 1D9KB 5SWSE 2PYFA 2NW3A 3RX8A 4GT7A 4DKEL 4IBLT 2BFVH 5C6WH 1V3MA 2C4XA 4XBPA 1IGIL 3DECA 5JA9A 3CH8A 3IJYA 4DKFH 5JNYB 1EEQA 2YK1L 3HLAB 2Q76B 1U92A 3B9KB 2CH8A 1CLYL 2J6EA 3P9MA 4WVRA 4QNPE 1X5YA 4P2RD 3HI6H 1NDGA 2X4UB 4G7VL 2OTPA 4OV5A 3EJYD 2HT3D 4KH2A 2IANE 5EU6E 3IRZA 4ZDHB 1J8HE 3DGCR 4K7PL 2AABL 3D9AH 4XCFL 1WF5A 2ZG2A 2IFFL 3P4NB 1IFHL 3MLSH 3LS5L 1Z3GH 1UA6L 4KJPD 3CSYA 3SGDH 3OHXA 3WIHA 1AH1A 1W72B 2H26B 4FFZH 4HUVA 1O5DT 5HDQH 3LV3A 3VXUA 1CTNA 1OL0A 4UAOC 4UOW1 4JDTL 2FEEI 3TBVA 3ZZ1A 3NPZB 4K2UL 1U8HB 1OGAB 5IP4A 4NQEE 1LEIB 1N8ZB 3Q5YA 3BEWA 2EEBA 1KC5H 4GQ9H 3DSNA 2WM0A 3H3PH 5IMKB 4KK9C 2JCCE 1JWMA 2C4FT 2HFGH 3N9GL 2GTZA 3MUZ1 3P30H 4NRXB 4QCIB 5GZND 1OF2B 4Z7NE 3ULVH 1CG9A 5GRUL 2UVFA 2GJ6E 2VLJE 1KACB 3UPCA 4WWKD 5T5FL 2IANA 4XC3H 4NC1E 1ZA3A 4OF0A 2YPLB 5T5FH 3OMZA 5BRZA 3KJ6L 2COQA 2W91A 4NM8H 3I75A 4KUCD 1ZGLA 3WE6B 1X4YA 1KN2L 5GGTH 3T0ED 3TPUB 4JG0H 2BCKA 4KHTH 3ZLQC 1JRHL 5GZOD 4OCWH 1R3IL 4PJGB 4YHYB 4LNVA 2B1HH 4OLVL 4MVBD 2R1WA 4ZUWB 5LXGL 2IBGA 2BOCA 3QIWC 2QADC 3OAUH 5E94A 1ZSDA 4WCYH 4JHZA 1QPPA 1U3HC 5DI8A 3DMMD 5L6YH 5EO9B 1R0AH 5C08A 1S7WB 5F6HJ 1A6ZB 4JZJC 3SBWC 3O4LB 4K9EC 1MCOL 5I1GL 1LP9E 1F58L 4ZUWA 1M7DB 4D0DB 3QH3B 4KQ4L 2D9CA 3I3EA 4OSUL 5IVXF 5KTEH 4U31A 5EOQH 3GMPA 3OKLB 2NPLX 3ILQC 1BFTA 4QHKJ 2HMIC 3T0EA 4LIQL 4N0UA 4Z18A 1CYGA 2YN5A 4PJ9C 3VJ6A 2FWOB 2QL1A 4Q2ZB 4CNIB 3PXHA 4BZ2L 1K8DB 3T0EC 1HCFX 3MRLA 2I5YL 3ARRA 4G6KH 1M7DA 2QHRH 1J86A 4D3CL 1IGIH 2DI9A 4MCZA 3SKJH 3BE1L 3EGSB 4Y5XB 2XG4A 5IB2A 1OT1A 4KKCD 4RNRA 5IB5A 5JQHC 4JAMB 1P7QB 2XICA 4KDTC 1A4KA 4G8GD 4I3SL 1UCBH 3ME0A 1EX0A 1A5FH 2NLJB 1QHPA 1GOGA 2FDBP 5HHOD 1L6XA 1BWWA 4HGKC 3UYRH 2X05A 3DROB 5C0AE 1IGFL 3ILQD 4X9BA 4Z95L 3EFDH 3EFDL 1VKXB 3QQ4A 1J18A 1FP5A 1INEH 3CFDB 3WIFB 1OTUD 4PP2B 1UM4L 4NQSA 5IM7A 2Z93B 3AM8C 2PUQT 4YXHH 1TJIL 3ULVC 1CZ8H 1CICD 3P4MA 1DVFB 5SX4I 4P2RE 2ZNXA 4LCYB 4MA8H 4S0TD 3VMPA 1AO7B 1TZGL 4U1JB 4JFHD 1JYNA 3K0WA 3BQUB 2CKBA 4LVOB 2QQNH 3QIWD 1A7PH 1CFNB 5T5NG 1BVKA 4NKOB 3H9SE 4L9DA 1LD9B 1S9WA 1N5YL 4XP9H 1G7QA 4PD4J 3N0PB 4I9WE 1YYLL 3SDCA 5C2BH 4PJIB 4FA8A 5K9JL 1J5OL 1UKQA 1XR8B 3C6LA 4E42A 3KPTA 3VGAB 4OT1H 2Q3ZA 2Z91B 2XZQL 4OB5H 1TZIB 2BVQA 1CI5A 2B20A 4FQ2H 4X4YB 2QQQA 1NAKH 5C86A 2VABB 1I1AA 1L0XA 5DQDL 3IF1A 3CZFA 4GRMB 4V1DB 1X3DA 5IFJB 4G8FA 1DQLH 4HUUA 1QLEH 4HWNA 2IBZX 3L3HA 4YHOL 3PV7A 5DJ6B 4MLIA 3AB0C 3HRPA 3PWPB 2J2ZA 3ALPA 3CH1B 4LLQB 3B2UC 4OCMC 5FV2A 5SX4H 1MCHA 2DRUA 1I9EA 4JM2F 4P9HL 4XMKH 4OM1H 1G6RA 3KPOB 3U83A 1BJ1J 4GBXA 2A9NL 4JM2C 5D1QC 1MH5A 4ZNEA 2UWEE 4YDJB 2PR4L 4NHCH 3VXMB 3HC3L 2EDXA 4RRPA 5EFIB 4ZUVB 3RKDD 3B5GA 2J6EL 3KJ4C 3WLWC 2HVKB 4PJDE 3VCLA 4UBDC 5D2LF 1IEAA 4Z0XB 3TJHC 1MFNA 2MCG1 1AE6L 3HN3A 3FRUA 4LGPB 2VB5A 5EU6D 1OSPL 2EXWC 5TE7L 2V9TA 1WISA 3IFLH 1EA9C 2X9WA 1NUDA 4YHKH 4PRDB 4HJ0C 4K55A 3LKPB 4RIRB 4PGJA 4U0RC 1H5BA 4O51A 5EC2A 5AEAA 1KG0A 6FABL 2GQHA 3BUYB 3GM8A 1H5BB 5T3ZH 3O4OB 5DRNB 2NZIA 5GISH 2A6DB 1C1EL 3JTTA 4KGLA 1CE1L 4OCYH 5BV7B 4QRSB 1D5XA 5GRXG 4FQLH 1HNGA 4O2EA 1BFSA 5T3ZE 5E2TH 2JJUA 3SE4C 3SY0A 3ULSB 1DBKH 1JF6A 3TBYB 4YXLH 2HT2C 1PZ5B 1PAMA 3SCMB 3VXTA 8CGTA 4R96A 1X5JA 5IJVB 3W9DA 5FGBA 1ZVYA 4DVRL 1GZQA 3TT1L 3IDYB 2E6JA 2YSSB 32C2B 1RY7B 3KVQA 1BAFH 3CSYB 3TCLA 3BDYL 1EGJA 4Y5YC 4J12A 2E8ZA 1EK3A 1LP9F 4NZTH 3RY4A 4R4ND 1FCGA 4LLMA 4M6OH 15C8H 4L3EA 3P3YA 4HKZA 1I1RA 1NGWA 2YA2A 3MJ7B 1WUNT 4YWGH 1JWSA 2FO4B 5C09A 2DLHA 4TUKL 4YHLH 1CICA 5KSAC 4ODSH 3HPJB 4RAUB 4HIJB 5AD0B 3HI1A 1S7XA 3G04A 4EDXB 5I19L 3EOTL 3RPIB 1B0RB 4GXVL 1TVDA 2BOBB 3EOTH 1PQZA 3ARGC 1J88A 3RUGA 43CAB 1EMTH 1BM3H 3KYMA 3BPNC 3I9GL 4WTZA 3EJZD 1ZT4A 3K81A 2X10A 1IKFH 3NCEB 4WGVB 4JPWH 4JQIL 4ORGB 5HHNA 2YS4A 5FYLD 1K2DB 2OZ4L 4G8IA 3X12A 3IS1X 4LL9A 4MA3B 3K4AA 5ISZD 4Q97A 3AC0A 4X6EB 5DRWB 3FOLA 5DD5L 3P73A 5BVPL 2EKSA 4NKMA 3UO1L 5D1ZC 2PNDA 5IGXL 3I50H 3MRJB 1FVEB 1MI5E 5F7UA 3GI8H 3S5LA 3RTQB 1A6UH 1IAKA 5D1ZA 1NDMA 4PJ7B 5K9OA 4MWFA 3JSSA 1A47A 3CLEL 1P7KB 5I8OH 1OAXL 1WCBB 3VXPB 2EKSB 1E4KC 4NKMB 5EIVA 3SGDI 4Z7OE 3BZFA 2WWKO 4L8DB 1MCPL 5C0NC 3VWKD 4ZMAT 4UDTB 5HYQA 2EIBA 4GJTB 4PJHF 1M7IB 2HAZA 4PY8J 3L3JB 3LEXA 4JANB 3BAEH 2BNRA 1M1SA 2ED7A 2ITCB 5ITBH 2P5EE 3SE8L 1DANT 5E7FA 2J5LB 4FFWC 1FLRH 5KG9B 4I13B 4NZDA 2DQIL 4BUGA 4PJXA 2WP3O 2QV2A 4J1UB 1DBKL 4XNQB 5KVMC 5GZOC 3QEUA 4GMTH 4PTUA 2CKNA 2IH1B 2DQTH 5D7SL 5DURB 3FAXA 4LQFL 3G6AA 3LS5H 2VLJB 3O2WL 1Z0MA 2FX8L 1AQKL 4MCZB 1D5MA 5EC1B 1UH2A 5IR1A 1RIHL 3IFPB 5DUBB 2Y06L 1L4IA 2NW3B 2PYFB 3C6SB 1PX3A 3KHOA 4JDZA 3X13A 1BQSA 4GRLD 2NY1D 3CUPB 3FMGH 1YEGL 3MOQA 2BZDA 1UG9A 2R29H 4M5YL 1DSFH 5CZXC 3O9WD 2PXYA 4KI1A 3EZJB 3QQ9D 3CFJA 4Q6YA 3KLDA 1ZT7B 3RP1A 3WFDH 2E7LC 1A14H 4MJ2A 5EWIH 1FL5A 4YNYA 2Q7YB 3ECBB 2X4UA 3VXNB 3U0WH 5DJCA 3GSNH 5F7DA 4F7MA 2BSED 4YHZH 1U58A 2GFBB 3RX7A 4O2EB 2P5ED 2OP4H 5J8OA 4BFIB 4GAGH 4NNXA 4P2CG 4KMTL 3TIDA 4ONHA 5TQ2H 5T1KD 2VDQH 1OLZA 5FA4B 3MA9L 3PP4L 1S8DA 3MA9H 3PP4H 2CK2A 3SO3B 4WFFD 2E3VA 1I1YB 5JXED 4NQEA 3SDXE 3ZT6A 3Q0HA 1Q8MA 1MHEB 1XF4B 3R8QA 1NGQL 1NC2D 1ZT1A 4W68A 4U1NA 4XHQA 5C0BD 4PJFA 3T1FB 4GKNB 2BFVL 2BNUB 2VUOA 1KLUA 1IC5L 4ZUTA 1T1YB 1QSFE 2VDNL 1JPGB 3KPNA 2EKJA 5EDXA 4EKXA 3T8XA 3N1PC 3QIBB 4ZUTB 2Q6WA 4Z0BL 4OCLC 3WHXA 1FZJA 5EUOF 4GAJH 1MCQA 3FB5B 5LGKA 1S78D 2GAZB 5TE6L 3UZVB 5JUEH 1ES0B 4ZFZA 2AJ3B 3S97C 5TDPB 4NZUH 3N1GC 4P2OD 1IC4L 5HDBF 1G6RB 3JWOC 1YEIL 4XP9L 1IQDA 4FQHA 2NY0C 4CU7A 4GRLC 3D85B 1L7TH 2X1QA 4H26B 4KDTA 4O51B 4GKSB 3F7YA 1HHIA 1CG9B 4GW5B 5FO9A 4XPTL 2AV7A 1R5IA 2V2XA 4X98A 4NFCA 2B1AH 2OJZH 1VFAB 4NT6A 4LKCA 2HJKB 5CZKA 4ESKA 2GUOB 2R2HB 3B6SA 3B9DA 5GGSB 5J12C 1G1YA 4JREC 4A2LA 1EO5A 1FBIL 1KLGB 2HH0H 3MXWL 3ZSTA 3D18A 4PJEE 1OAZL 5D96B 3NA4A 2B8OT 2GYSA 3DLQR 1A64A 2ORBL 1HOCB 4XBGB 3SJVD 1QFUL 2IWGA 4CJ1A 1AGFA 5KTEL 1A7QH 3ARQA 3V8CA 1EFXA 4WO4B 1PG7H 5CS7A 4DGVH 2C1OB 3RU8H 4X9GA 4YX2L 4LP5A 4UUJB 5JLZB 4K94C 4U1MA 3NFNA 3SDCC 2FZ3A 4R26H 5JXAL 3VFUA 1AGFB 1Q9OB 4Z7UE 2LQRA 5AYUL 5HHQB 1JZ8A 1SEQL 4NHCL 1YEKL 2GSIB 5FHAH 3RFZC 1NCBH 3BHBA 2P7TA 3QUMA 5EOTB 4YXKH 1NC4B 2X4RB 1TXKA 1JRHH 1RJLA 3MNZB 1I1AC 1T04B 1S9VA 4U1MB 4LCWB 3DI2B 4JY4A 3O3BB 1T7YA 2RQ8A 4YHNB 3BH8A 5DD3L 4JG1H 5DJ2B 4PIRF 1WFOA 4ZSOA 5IW6A 1FFNB 4OQTL 5C0AD 5AZEL 2I60L 1S5HA 2ED9A 1B88A 3VU2A 4WWID 2VQ1B 3LN4A 5J11B 3V6OA 5D1XA 5JW4N 1NMCB 5EIQA 4PJXE 4RNRB 5IB5B 4RBPK 4DN4L 3VXRA 4GUPA 4I0PC 2P5EA 1U8LA 5J3HD 4PJ8C 3W9DB 3F58H 2FIRT 5I2IA 1GIGH 5DGRA 2DDQH 5D1QA 4NNPL 4QHNB 5HY9A 1YQVH 3Q6FA 1TETL 5EO1B 5IHBA 3W0WB 2ZSWB 3OJMB 3GSXB 3KPQA 1JGDA 1KIQB 4ELMF 3QQ4B 2CDEB 3D0LB 5E8DH 5MEPB 5DLML 1MCPH 4MSWA 1NCAL 1GAFH 1QYGH 2HA1A 4I0PD 5LWYH 4PPTA 3N06B 1CDHA 5MP6L 1GGBL 3VFTA 1IC7H 1J0HA 3MLTA 1HXMB 4XB8A 4X5XA 3ZDXE 1AO7A 4LFHG 1NKRA 3PL6B 1Z3GL 1MI5A 3G9VA 1KBGH 3HE7C 3KPSE 4WGWB 3RDTC 4HUWB 3WXWL 5GS2D 4IJ3B 1IAOA 1G6RL 2AK1H 4K23L 4BJLA 1VGKB 1RZGB 5IQ7H 2C3VA 2GY7B 1BF2A 2FATL 4R2GC 1KULA 1YEDA 4CAGA 3WNNA 4JLRB 4K7FB 5D93B 2H6PB 3P0YL 4PRBB 4A6YH 1YN6B 2HJLA 3NPSB 4AT6A 1IAOB 4JFHE 2ZOLB 1BPVA 1MWAA 3UJIH 5KAQG 4ODUA 3K46A 1XF5A 2XIDA 5IW1A 1CFTB 5CJBA 4CU8A 3QZWG 2FL5B 3NA9L 5GSVA 3LEYL 1CFTA 3LEVH 4YQXL 5GS1A 3HTLX 1T1ZB 2AV1A 3WEXB 4P4RB 4MNQD 3C5JA 1WAAA 4G7VH 1E6JH 3F7QA 5L0QC 4XCEA 1FZKA 5JHDA 2DAVA 5IFAH 5E1AB 1MAKA 4G42A 4HC1A 2ZUWA 1YDPB 4BSVA 3MRGB 3KXFD 3WIIL 3NFPA 3L3OB 5GS1B 3DIFB 3LS4H 1ACYH 1BVZA 1X4ZA 5FCSH 4NN6C 3D1MC 4I18A 4NDMB 1FN4A 5MENE 3AREA 2X4TA 3HE7B 3O9WA 4OFYA 1UADC 5T1DH 4CDHA 1B9ZA 3D69A 4I18C 3KDMA 4OUUA 1E6OL 2ID5A 1B6DA 1VEOA 1YJDC 4I5BA 1MCRA 5T3XL 1CR9H 5LXGH 3T4AB 2APTA 4ZD3L 2NY1B 2FECL 5SX5K 4YE4H 4OLVH 2WP3T 4B7LA 5B38A 3QUXA 4Z77B 3P2TA 3IFOB 5H37H 2VAJA 5EZOL 2L7JA 2A6DA 1AC0A 5FUZH 1SEBA 5ESVA 4N1HB 3M8OH 2ICES 4M6ML 3FN9A 5JDJA 1X6LA 4FQPA 3OHXB 1NMCC 4ONOA 5D70L 5J11C 3QPXH 4R7DB 4KRNA 3C5ZB 2JB6A 1JMXA 3TYFA 4U1HB 3O4LE 1NBYA 4FXKB 4QHUA 4L3CA 5TGBA 2R2EA 5JQ6H 5IJKC 5HPOA 3HZYA 3VW3H 2FIKB 4JO1H 2FX7H 3BFOA 4MGXA 4RDQG 1ZHLB 5IHZA 2EO9A 1BQHA 4XWGL 4Y4HC 4D9LL 2VKWA 3TBVB 4PYHA 4FQCL 4QHLB 3HI1B 2BJML 1X9QA 2V2TB 3PIQB 3BRGC 4JFEA 2VSCA 4I3SH 2BXZA 4KKAC 3MJ7A 4W4NA 2HLFD 5F7LB 3PXJA 3BP7B 3WS3A 5CEZL 4S10A 4OZIE 3S6CA 4BH8B 3G6JA 4JY5L 5EOCJ 1X6NA 3MRHA 2V5MA 4PFEA 5I6XB 1RUKL 3GIZH 1ZLUH 5KOMC 2HKHL 2Q7NA 1V8HA 1HINL 4KKCC 1U3ZA 3UJJH 4DZBA 4NZJA 4JM2A 4F7PA 5FECA 3P73B 1KJVA 1CN4A 2FBJL 2ZUSA 5IMOA 4OLWL 4XPFH 4KZEL 3LQZA 1X5FA 3BYYA 4UILL 2FBJH 1RK0A 2NTFA 2F15A 5DC4B 3X3FH 2O5XL 2ADJA 4NRZB 5LAXA 1U9KA 1SEQH 4BK5A 3RWHA 4LSDA 4PJ5E 3UBXI 4JREB 4JQXA 2XA8L 4P2OB 1IL1A 2UV3A 4K3HA 3MBXL 1ZHKA 4PRBA 4Q0XH 2R1YB 4H25B 1S7VA 1A7RL 4OGAC 4PRAB 1INQA 4LSRL 1H3PH 4Q74A 1ONQA 2OXGA 4J4PC 3W0WE 2ERJB 5FO8A 1HHGB 1QKZL 2HJKA 4LGSB 5L2KA 1HHHB 5I30H 2UUDH 32C2A 3BIKA 4PJBF 1AKJA 1ETZA 1RJYA 1EUUA 1TJIH 4D0CB 2KZ1B 2DLGA 4MD5A 2MQCA 4DZ8A 2W0LA 4CVZB 4PRAA 3MRLB 1ZHNA 1N3NA 4QF1A 2RB8A 4G9DB 4XB7A 1KXQE 4J6RH 3PHQB 2CMRH 4TTGA 1ZK9A 4ZUSA 2FX8H 5J56B 4PV8B 3I84A 5D2NC 3K3QA 2O93L 2F8XC 2BSRB 4RX4D 1WV7T 2VDOL 1P6FA 4HKJA 3WCYA 5IT2L 3QEHA 1MAJA 5FGBC 4MXVE 1TNNA 4KI5F 3BT2H 4HIIB 2HLAB 3V6OE 1K4DA 3OAYH 4ODXB 4MD4A 4FZ8H 3QEHB 4JFOB 3BP6A 3HPLB 1A3RL 3BUTA 4PG9B 2ZKHH 2GCYA 4OM0H 5K9QI 1RSFA 4XP4H 1FL3A 3BP4A 1YQVL 1NFDA 3DRQB 3OAYK 1MIMH 3EKCA 3SO3C 1J7VR 4AIZB 5JUEL 4WUUA 4LIQH 3MNWA 3NACL 1SYVA 1QLRA 3QCVH 2MSPA 3GKWH 2XWBA 2VABA 5DT1L 3BVNA 3MRBA 3LOWA 3DV4B 4OZGE 2Y36L 3UTSD 1QBAA 1E6OH 4C59B 1FVCB 5FKAB 4TN9A 4FRWA 3E8UH 1EO8H 1CTOA 4G8EA 2VISA 2Z35A 4FTVB 2CIIA 4XP6H 4KPHH 4P2OC 5IGXH 3EYSL 4PJIA 4D9RD 2YD3A 4U6VH 3DBXB 4CN1A 1DL7H 3D39B 4MJID 3U79A 4FMKA 3QUKA 4JKMA 4BH7A 2L4OA 2VZTA 4Z7UB 1XF3A 3AS3A 4D8PB 1BZ7B 5T3XH 1G9MH 3I3BA 2ADFH 1XR8A 3CMGA 3CLEH 1XF2B 2BC4B 2ARJQ 2CQVA 1S9WB 5BRZE 3NN8A 2X9XA 1OT2A 4NQTA 3FO2B 4DOHB 1Q94A 3CLFH 4Y2DB 1Q1JH 1ZS8A 3HMXL 3UTQA 4WU5B 1FIGH 5D5MB 2OTWA 4HWUA 1CLZH 4Y4FC 1JNHB 1S3KL 3JTSB 5ENWA 3QISA 3RZWA 5TPWH 2Y6SD 3UTSE 1N59B 3O6FB 2EZ0D 3QDMD 1A6AB 1JHTB 5H94B 3WKML 4JQIH 1LO4H 4WHTA 1R3IH 3VD9A 4JGUA 4DTGH 2MHAB 4GW5A 2QKIA 2FX9H 2JJTA 3CDYA 3QG7H 4WHTB 4YDVA 1UVQB 5MHSD 2V5SA 4UIMB 4I5BB 4QOKE 4ODBD 5D71H 3RWJA