1CF8L

Convergence of catalytic antibody and terpene cyclase mechanisms: polyene cyclization directed by carbocation-pi interactions
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
215
structure length
215
Chain Sequence
DIVLTQSPTIMSVSPGEKVTLTCSASSSVSSNYVYWYQQKPGSSPKVWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCLQWSSFPYTFGGGTKLELKRADVAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CATALYTIC ANTIBODY 19A4 (LIGHT CHAIN))
publication title Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
pubmed doi rcsb
molecule tags Catalytic antibody
total genus 51
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cf8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cf8L01
4K3JH 4TSCH 2VZVA 4P5MB 2IANB 5IKCA 4NGHL 3MLZL 3G6JB 2CIIA 2FDBP 1LE5B 1JGDA 2C5DC 1H3PH 3ZKSD 4PJ9B 3SGJA 4FFZL 2VUYA 4XVJL 1IFHH 1J1OL 3C5ZD 1G0YR 5JXAL 2DICA 5T33L 4Z76A 3DBXA 5HI3C 1U41A 2A9NH 2V2WB 5I73B 3QI9C 4AQOA 1PBYA 3MRGA 4NCC1 5F1IA 4QY8B 3RAJL 3FB8A 3ARFD 5T5FH 4X7EC 4P3CH 4HPYL 3BUYB 5JR1L 2Y36L 3KPQB 5D1QC 5E8DH 3KYOA 1CDIA 5JIPA 2F9BT 1ZV5A 4X5XB 4MDJB 3EGSA 1PZ5B 5CWSB 4UINL 5FM5M 3HTLX 5DHVA 4B0MM 4EI5A 4ODWB 3STLB 4Q9BA 3BD3A 3O3AB 1R0AH 4ZUSA 5EC1A 3BAEL 3TBVA 2X1OA 1DVFC 4P2OB 4PRIE 3QNYA 2FECL 3L3JB 4FMKA 3LKNA 4JG0H 3MLWH 3WLWD 3E6HB 3GKWL 4Z7NE 4J7RA 1FDLH 2VITB 3VXME 4CNIA 2VXTH 5I8KH 3M8OL 3TN0C 2Y9RT 4W6YB 3S96B 3F5WB 4Z7QF 1D5BA 4X7DC 5IF0A 4WENB 3LD8C 5DO2D 2X9YA 4PJFB 5FAAA 3U2SB 1YYMH 4NM8H 1KXVC 2QHRL 1CD0A 3ULVC 1Q9LA 2H8PA 3JXAA 4F37K 4FP8L 1KB5H 5KOVC 2AJSH 4Z7WE 1U8PB 4OF5A 1TVHA 4Q9RH 2ZUTA 3BN3B 3DXAB 2OMBA 2W1NA 4Y2DB 1MLBB 1A6WH 4UTAL 2P44B 2R1YB 4JDZB 1G6VK 2PN5A 4Y8DC 5D93B 3MRJA 3WNOA 1HYSC 4FQ1H 2F54A 4JZJB 3SGDI 4PJ7E 1BLNA 4KFZC 3SDDA 1ZEAL 3HMWH 1G7IB 2CK0L 3HZKA 1ONQA 1YEEL 1UWXH 1BZQK 2F54D 3OKOA 4XVUD 2ADGB 1G0DA 3S37X 4D3CH 3S35X 1C12B 4DAGH 1NGZB 2F53B 3SDDD 3RX8A 1KIPA 4PJEB 1WJ3A 4AH2B 1J1PH 3KS0H 3LEXA 3BVNB 3U7YL 3C87A 1HXMB 1XZ0A 5DR5H 1J05A 3Q5YA 4WU7A 2HA1A 2X40A 1IQWH 5MEPA 4JE4B 5C9JB 2Z9TA 3MODH 4DN4L 5INDA 2OM5A 5DUMH 3TO4A 2X4NB 1N59A 4Y16C 5IB2B 5GSRA 4XNQA 3GBMH 1FN4A 3B2VH 3SDAB 4PGCA 2Z35B 4JM2C 3ARDA 3QQ9D 5DJDA 1X5LA 3SDCC 4LLYB 2VLJE 1AHWB 1XGRB 3TO4D 3TZVB 1JIBA 1G7HA 3NZHL 5TF1L 1HINH 2VZTA 1MIML 2OI9B 3ARDD 3MCKB 5I8CB 3T09A 5CZKA 3CXDL 4G6ML 4MAUL 4YDJB 4N0FA 4RAVA 5DXWA 1RZ8B 2GY5A 3H7BB 7FABL 3BDXA 2OTUA 2ATKB 4YK4C 4NKOB 3MJ9L 4G42A 5FIEA 2NY7H 5DJYB 4ZSOB 3QQ3A 3ZKXB 4D0DA 3LB6C 2GHWB 1V3JA 4S11A 1HIML 2AEPH 2PXYA 4NC0B 4PG9B 43C9B 2WBJD 1JHTA 5IW1A 1G7LB 3OXRB 3MBED 4NNPH 4Y4KA 2FRGP 4AIXA 3QFJB 4FQCH 2YD9A 3OKEA 4M7ZC 1AC0A 2WANA 1A6AB 3T0EC 5DQ9A 2BDNH 1EBAA 4Y4KD 2LABA 3ZE0E 5E94B 3HUJF 4UV7L 1JZ4A 3T1FA 1KFAL 4NO5A 1JF1B 1GH7A 3L7EA 1L0QA 4XMPH 3MREA 1KIQB 1CXEA 3H3BC 1S7UA 3IXTB 1JTPA 3P4OB 3ZKMC 1MVFA 4JFDE 4JFFA 3P11L 5I30H 2X7LB 2W0LA 2VLRA 5F96L 4W70A 5TPWH 1UZ6E 3T04D 3VMOA 2EKSB 5L2KB 1UWGL 4QTIL 5TDNB 4QOKE 2FB4L 1KTDA 1R3LB 4JFFD 4P2CG 3PGFH 3KS0J 3L5IA 4LASH 2VLRD 3KDMA 3ZL4H 2VE6A 5B38G 5EU3B 1NCBL 2M1KA 3ECBB 1EJ6A 3QG6A 3H9ZA 4NWTL 3OWEA 3FQUB 3RJDA 1KXQE 3SOBH 3EO0A 1NCUA 3ZT7A 4YHPA 1UWXK 3K2UH 3QT2A 1CDUA 4MJ5A 2XNAB 2VDMH 5SV4A 3QI9A 5ALBL 2C7UB 4POUB 1C1EL 1AH1A 3ROOA 1IC5L 4HH9A 4V1DE 1XF5A 3QZWB 4R8WH 4X4XB 4K71B 1QR1A 5FYLE 2PCPA 3V52L 5A16A 1J5OH 4FTVA 1MRCH 1N2RB 3QI9D 5GGQH 4S0SD 5CFHA 5IMKB 3TT1L 5FO9B 4HUVA 4WI9A 1OL0A 2G5BA 3L95A 5BVJA 1AR1C 4I48B 2FWOB 4LAJH 1GAFH 2ESVA 3BPCA 4J3OC 4NQDE 1KPUA 1JZ3A 3PWPE 3GSOA 2CLVA 4P0DA 3FOMA 2FX9L 5KSVB 1QR4A 1KJ3H 3RU8H 5BV7B 1ULVA 1DVFA 4HJJH 2ESVD 1LO4L 4ODBD 4DOHB 1FNAA 2VDOL 4BH8B 1T21A 3OJDB 3JV5A 4BZ1H 2ARJB 1RZJH 1ZSDA 2UYLB 3FT3B 1LP9F 4R6UA 2OSLB 2GIYA 2NY0D 3RGHA 2P49B 3GBLA 3TN0A 5GS0D 3NFNA 5D7JC 3IU3B 3G9AB 4FQHA 4LSTL 3DWTA 4V2CB 5D6DC 2E9BA 4YX2L 3VI3E 3EO9L 3O6LL 4XPFL 2YOCA 3MRHA 5C1MB 5CIPH 1WQVT 1CE1H 2DI8A 1J0ZA 4NO2B 3QB7C 3TJEL 4GUPA 2WQRA 5T5NF 1CFSB 4CMMA 4I1NB 4G9FE 5LGHH 4HXAH 2A83A 1OTUC 4FRWA 2A6JA 4UNVA 3T3ME 3LEYL 4DCQA 1T7ZA 1UG9A 4NZTL 1N6QL 4HLJA 3CCHB 4LQ1A 2VO5A 3P3YA 3GBNL 1K8IA 3IKCB 3V6FB 4U1KA 2YPLD 1NMCB 4XAWL 2ZCKL 3FCTB 1SYVB 2OJZH 2EDDA 4PB9H 3G6JE 3LKOB 4HKZB 1U9KA 2WP3T 3TJHD 1B4JL 3HHRB 1MUJA 3LEVL 5C0FA 2FIRT 5ICYA 4PJAB 1PX4A 5EZIL 1SY6H 4X99B 1R5IA 1X4ZA 5C0ND 3UBXA 1CXHA 4N1CA 4X4ZA 1LGVA 1UJ3C 1PFCA 5DLML 4N0YH 5MERB 1VHPA 1QA9B 2ADFL 3V5HA 4K8RL 5IJVB 4FQXC 1NPUA 2OL3H 3JV6A 3BKJL 1C5DB 4WUKL 1A7RL 5I71B 1HHJA 5IP4A 4UT6H 4HAGA 3ZTJG 2FGWH 5KVGH 4NT6B 4OM0H 4ORGB 1NFIB 1XGYL 1ND0A 1WK0A 3RY4A 1FVCA 2FL5B 4F2MA 3WE6B 3P4MB 1WZMA 4PV9A 1VA9A 2QQNL 4PRAA 5BS0A 3UTTE 4DKFL 2X4SA 1FAIH 2ID5A 2AJVH 1YJDC 1QFWI 4CKVX 5C70A 3QDGE 5BS0D 1CICA 5EB9A 3SDYL 1ITCA 4JRYB 4KROD 3BPOC 3PJSB 3NCFB 2R8SL 1CLCA 2QQKH 1LMKA 1ZGLB 1CICD 2OCFD 4OZGA 2A38A 3SE3C 1F11A 3H9SB 3HZMB 5BMFH 3DRQB 4WU5B 5FHAL 3MNZB 1BZ7B 2A6KB 4MA7L 2RBLA 1UKTA 5DEGB 4NM4H 1LDSA 3AAZA 4KQ4H 3VFTA 2L7UA 1EHXA 1Q1JH 4HDIB 4MAYC 5FYJL 3QIWC 3BKMH 1ZVSB 5E8EB 3NGBB 1NC4A 4ZO9A 2DWDB 1SJHA 3MRBA 1QRNA 3AS2A 5IBTH 4MCZB 1JTTA 1II4E 1L4IA 3JUZA 1QZ1A 5HVGB 3LB6D 4OBRA 1MI5B 4PV8A 4ZOAA 1PQZB 1NC4D 3DXAE 4GMTH 3VCLA 4XP9L 1FO0L 2CRYA 5IFHH 5D1ZB 1CD1A 1T2JA 5CBAB 3O6KL 5HHOB 3E6FB 3MOAH 3P9LA 1P4IH 4N8PA 2FZ3B 5T1MA 1RJLA 4PJDB 3UZEA 4JFXB 1KNOA 3TVMC 4OT1L 4OLVH 4QLRA 1HSBB 2ATPB 3BE1L 1KTKE 3QH3A 1WTGT 3MR9A 4Y5XB 4WI8A 5ITFA 2BFVH 4HD9A 5J57B 2KL6A 2HLAB 4WHDA 4PBVC 1KLFA 3PABA 2GSGA 1XF1A 4YDIH 1N4XL 2EE6A 3ZKMD 4HK0A 4YEEA 3QEGL 1HYRC 5BV7H 2NZIA 5MI0C 1WZ1H 1ZT7B 3QYCA 5GZNC 5CEZH 5L6YH 2GCYA 2RR3A 4J4PC 2XKSA 3RVTC 5IVXF 1A7NH 4HHAA 3O2DA 4OF6A 2MHAA 3WEXB 4WNQA 4PG2C 3TNNA 5GPRA 1H8SA 2C9AA 3HB3C 5D2NE 2B4CH 1UXSA 3LIZH 3MRNB 1KSRA 1Y6KR 4YHMH 5TGBA 4XPBH 1WF5A 4I2XB 4XRCB 3W81A 1GGBH 3BZ4B 5HHQB 1H3XA 1UCBL 1YEDB 3LN9A 1ZHBB 1DUYB 1FVEB 2YC1A 4MWFA 3S4SB 4BK5A 1K5NA 3OXSB 2NQCA 5DUBB 1C5CL 3O3BB 3CH1B 3KYMB 4QHKJ 3VRJB 5EPMB 4ONFL 1QYGH 4AT6B 1LDPH 1IZJA 3QRGH 4EOWL 5KTEH 4LEOA 1IEAB 3RX7A 4JKWA 4LCCB 2CMRL 4NC1E 1UVQB 1KCVL 4HIHA 4Y88A 4JPVL 2B5IC 5A2IH 1JWSA 1S7VA 4GRWF 5FEBA 4G8IA 5HDLA 4JANB 4HX1A 1UM5L 2AEQH 1DBMH 2CQVA 2KZ1B 5D7JA 5C09B 32C2A 3P2TA 1DR9A 1MWAH 2J12B 1RZIA 4XP6L 1YNKH 2CR6A 5D6DA 1FZOB 4U33A 4WWKB 4HAFA 1NLBH 3BSZL 4U6YB 2BNUA 2VISA 2VXUL 5D7JD 1JUFA 1ZTXL 4OZ4A 4YEFA 5AYUH 5HYJA 2G5RA 5I1EL 5KG9B 1JPSH 4YBLB 3KYAA 2VZUA 5HPMB 1AXSA 4JFHE 4FFVD 1EXUA 2A73A 1GC1L 1S7TA 2WWKO 2AS5M 3LKSA 4IRJC 1RJCA 3NIDF 3EYFB 1S7XA 5HYJD 4G3YL 4UAOB 1H0DA 4NOFA 3D2UA 3Q2CA 4YQXH 3INUH 3HE6C 3MBXL 2OS7A 2XZZA 4KHXL 3UAJC 3NCYS 2YKLL 3F7VB 4MJ6B 5EULV 4NCDA 2X89A 1TIUA 2AK4E 2JIXA 4KZEL 1J8HD 3SE4C 3D2UD 2VL4A 1Q0YH 1V7MH 4NZDA 1Q9WA 1I3GL 1NGWB 2X89D 4ZUTB 2HFEA 1ZHLA 3QEQB 5J1AA 2JIXD 3SGKA 3VA6A 4FQXA 2FR4A 4K7PL 4X98B 3O45B 1A7QL 2GK2A 2AJ3B 2CK2A 4WCYL 3AMKA 3QIUB 3MCLL 4S0TD 5C0AB 3QIBC 4PFEA 4X6DB 5FK9B 4EDWH 3I9GH 5DJZB 3D0LA 2X05A 4WFFE 4FQXD 3OX8B 3L3DB 3GIZH 3CDYA 4FOMA 4ELMF 3VGFA 1MCQA 4XTRD 3UBXI 15C8H 3VU2A 2YRLA 4K9EL 2E7CA 5F88B 4U3CA 3C60A 4Q9QH 1CTNA 1BQSA 4JREC 3ARGC 1YN7A 5JPNA 4D94A 4GAJH 4OCMC 3BGAA 25C8L 4XPAL 4JG1L 4XCEB 3MRDA 1CD9B 3IJYA 4ZS7H 5CEZE 3QUML 1ZLSL 3S36L 3C60D 2DMKA 3KJ4C 2NNAA 2YA2A 1U42A 4BUHA 3V8OA 4LBEB 3SE3A 2VDKH 4OCSL 2P24B 3QXAB 1NCAL 4D0CB 3GSNA 5HGHA 2OZ4L 5ISZA 3PV7A 4PJHB 2NXZB 1WZKA 4LCUA 2AXGB 2ZKHL 1TETH 4LQFH 5KS9B 4MAYA 3QIWA 4D9LL 5JW4M 1KCRH 4Q58C 3QO1A 5ISZD 5ICXA 1EVUA 4PGJA 2YUZA 4P4KB 3B3IB 1FV1B 1WAAA 2PW2A 1P4LB 1WUNT 4ODSH 2WSKA 3EDDA 4MAYD 1QG3A 1BQLL 5IG7B 5IFJB 5CJXA 1XCQA 4HJ0D 1JYVA 3OKDB 1WIPA 5DZLA 1B9ZA 5JHDA 1BIHA 2ZUWA 3GMRA 1J0YA 5J12B 5HGBB 4ZYKA 5IW6B 3V4VL 3U46A 2XACC 3O3EB 3TVMA 1ZOXA 4GMSH 4R7NA 4MD0B 3RWCA 5JHDD 3BFOA 3OKLB 2XG5A 3WN5B 1IARB 4POZD 4RIRA 1W72H 2N56A 2VNCA 4OF3A 2J88H 3EIFA 5I1JH 5LXGH 1XT5A 1CLYL 5C0DA 5LQBL 5E2JA 5AZEH 43CAB 1RULH 1OWWA 1MH5B 2X4OA 4M48L 5IIEA 4MA8H 3FO2B 5D7KD 2ITCB 3IS0X 5FM5O 4J4PA 4YHNB 4OF8A 3D3VE 5FCSH 3KPPB 3O6MH 2HVJA 4GQPH 1E6JH 1AGFB 4W4NA 4AY0A 2P8PB 5GZND 1H3VA 1YPZA 4PG2A 3T3PE 2DYPD 1AGBA 1MCDA 2R1XB 4J4PD 1P7QB 4KH2A 4N0UA 5D8JH 4NZRL 2E7HA 1U36A 1RAMA 2XPGB 3VWKD 4I3RL 4TTDC 2BNRE 4S1SH 2HTKD 1SVCP 1PLGL 1CIUA 3CUPB 3H9SE 3HB3D 3RWEA 5H37H 5CGYC 3H9YA 4NKMA 2UZIL 5C6WH 2AJXL 4Z7VB 3O6FB 4MMXC 5DGQA 1ZS8B 4MD4A 4UZGA 2VWEC 2P5WE 3TT3L 5KBNC 2Q8AH 3TIDB 5H8DA 2DQEL 1DQJB 4NFBA 5ECJE 1Z9OA 2R1WB 5GGSB 3IDUA 5I1HL 4L3CB 2YBRA 5EWIL 3TBWA 3ZDZF 5IMMA 5JPMB 1T2XA 3B9EA 3RIFF 4G6KL 3MLXH 1IGYA 1YNLL 3L3OB 1QLRB 3R0MA 3MRRA 4YFLF 2AVGA 4X8JA 8FABA 1S9YA 1DDHB 2FEDC 1S9VB 3RWDB 3GMLA 5GISH 3QULA 4M5YL 4PR5B 4M7LH 3NBNA 3QDHA 2ILLA 3O2WL 4W6WB 1T5WB 5C08E 5IV2A 3L6FB 3RWJA 4PRNA 4HKJB 5EIQA 1DN2A 1TQBC 2BC4A 3GSRA 4PUBL 3QG7L 3EYVB 4YDLB 3ZE2E 3RVUD 1NBZA 1EA9C 1CI5A 1QFWL 4L4VE 4HUNB 4JZNB 4ZFZB 3FB6A 4U1MA 1TVBA 1JGEA 3CSBA 1I1AC 4KTYA 5IB5B 3WFCL 5FGBC 2PTVA 1KJVB 2FJHA 3CVHH 4YWGH 2EO1A 1E4XI 2R2CA 3UTPD 4F58H 4P46C 3MGOA 3MLYL 3HRZA 3IYLW 5GS3A 3SE4A 1E4JA 4HJGA 2WUBH 3QNZB 4L9DA 3UAJD 1H5BC 1JPFA 1AGCA 3VFPB 5FUOH 2R69H 4JGUA 4XP5L 3RTQC 3GJEB 3V9FA 4I9WE 1YEGL 4X5LA 1XGPB 2VSDA 4NDMA 5I8OL 5I9QC 1NCNA 3QUZB 2J5LC 4DVRH 1DBKH 4QRPE 4ODHH 5K33A 5JLZA 2NY2C 3KR3L 3QIBA 2H41A 1A8JH 4KJYB 2ENSA 1QTYT 3UO1H 4G8GB 1NAMB 1KLGA 1BVLA 2ZUYA 3PV6B 3AMLA 4HWBH 4G7YL 1IAMA 1PW3A 1VFUA 3QIBD 2H32A 2VL5B 4XNXH 1J0IA 1KXTB 1NUNB 2HT3C 2BJMH 2P46B 4LHQB 3BP7A 1CWVA 4X9HA 3HLAB 5FYJU 3ARGA 2HJFB 2ZJSL 1ZA6B 4BH7B 2XFXA 3BEVB 3L3HB 4RFNB 4EN3D 2D7OA 5F9OH 3CU7A 2IQAA 1BPVA 3TESA 2ICEB 4PRBB 3UTQB 2BVUA 1I1YA 3FQRA 5KOMC 2XTJD 3ARGD 5D2LE 4DZ8A 5E99H 2VLKA 4RRPA 3QPQD 4OI9A 1V8HA 4HXBL 1JNLH 5DJXA 2CIKA 1RHFA 2XN9A 4ZNCD 2V9TA 5IKCB 3C5ZB 2UZXB 1OAYH 4X6EA 1JGDB 3VXSD 4QEGA 1RMFL 3WNMA 4YDKL 1KJ2L 2VLKD 3B83A 2MPAL 3B4NA 3SO3C 2XN9D 1NFDE 4ODVL 1IEBA 4FFYL 1P9MC 3HS0A 1KCLA 3WLBA 4Z76B 5ESAA 5F9WC 2R23B 3ARFB 4PRPA 3MZTA 1KOAA 3MRGB 3VW3H 1AY1H 3K0WA 3SGDH 3B5HA 4FQJL 5F1IB 3UYRH 1ED3B 3FB8B 3RVVC 1F6AA 1J9CT 4MXVE 4IRSC 4PRPD 5E6YA 4N5EC 3GSWA 4DKDC 2APWA 4JDTH 3I3EA 1KLUA 3OAYH 1FYTA 1T1YA 4UQ2A 3O8XC 5EBLA 3KYOB 4OKVA 1OCWH 3JVGA 3WFEH 5DHVB 2GT9A 9CGTA 4ISVA 1DJSA 1FYTD 5AWNH 2E6QA 5EC1B 1IGML 4PD4J 4DFIA 3TBVB 3VXQA 5GS1C 5EUOA 4HFUH 5I16A 5IM7A 3CMOH 1ORQA 3Q0HA 3LKNB 1A4JA 4YHYB 1KPRA 3C2AH 1BZ9A 4ONHB 3B6SA 1F4WH 4Q0XH 1FIGL 2E6JA 3NIGF 4LMQE 1GGCH 3IDIA 5IF0B 4RISL 4PD4K 1S7SA 3U30B 1KEML 4JFEA 1D6EA 1BWMA 4H26A 3ZHLA 4QKXB 5B38B 3MV7E 2I60L 1BBDH 2H8PB 5EZLB 2XWTA 4XMLH 1QFUH 4JFED 1L7TH 1TVHB 3P30L 2HTLC 5HSFA 5C0CE 1LD9A 2IFFL 1WT5C 2PNDA 4ZXBB 3VGBA 3MJ8B 3OJVC 3X3FH 4L8DA 4NN5C 3ZYIA 2DQTH 2F54B 2YPVH 4DGIH 1F02I 5E8PA 1I9RL 4M6NL 1BLNB 1A4KB 4TTDD 3SDDB 4HS3A 1JF6A 5KSBE 5KS9F 3N1QC 1FFRA 1LHZA 1WBXA 2E7BA 1KIPB 1AI1L 3F8UB 3PWLB 3DPBA 1Q9KA 2ADJA 3ULVL 4I5BA 3T65A 2Y07H 4BUGA 1BFTA 1J05B 4JO4H 3P0YH 4WU7B 1PDKA 1OPGL 4DVBB 3LS5H 1MFBL 5E1AA 2UY6A 1OT2A 5MEPB 4OKDA 4O00A 4R97B 4K2UH 4OFKA 2D4FA 4QXUL 3ZE1F 2A9ML 1U3ZA 2JJUA 1QBLH 2J6EA 3TO4B 3UZQA 3OGOE 5I1IH 1N59B 5DT1H 3VI4F 1CT8A 2FEDD 4XNQB 1X44A 1FN4B 3L5XL 4PGCB 3WUZA 1NAMH 3ARDB 5DJDB 1MNUH 5F8QC 5K9KA 2GQHA 2HKFH 3RDTB 3JZ7A 3I6LE 1E28A 2BNQA 3IFOA 3RGVC 1TJHH 4OB5L 2NZ9C 1C08A 1Q38A 3ZYOA 5F6HJ 4GG6F 1C16B 5HVFB 3G5VA 1T66D 4RMUA 4EIZC 5FGBA 4ZFGH 3MLSL 3CZJA 4N0FB 5AEAA 4RAVB 1WWAX 3AB0B 3NCJH 3OAYK 2APBA 5DSCA 2BNQD 2OTUB 2WBJB 3BO8B 2VDLH 2DQIH 2R0WL 4P46A 3MBEB 3D25A 5ANME 3QQ3B 2VDRL 4MNHA 1QBMH 1H5BA 4HIIA 4L4TE 2AABL 1AXTL 1TDQA 5IW1B 3RTQA 2ED9A 1NCCL 4RA0C 4P46D 4UILH 5C0EA 4GRLA 3I2CL 4HUMB 1F4YL 5HDQH 4Y4KB 4B7IA 5I74C 3QCVH 2OTWB 4UMGA 2EE3A 5ESVA 3BH8A 5GZOC 2FX8H 5BXFA 4O02L 1AE6H 3RTQD 2O5YH 4YXKL 4KKAC 4GRLD 3KPSA 1JGLL 4NQEE 5DQ9B 2FX7L 2DQUH 2JCCA 2ICWA 3FJTA 3T1FB 3FO1A 4X4MA 2NY2D 2VXQL 4NO5B 3L7EB 5DYOA 5TE4H 3MREB 1Q94A 4QRSB 1T0PB 4WGVB 3KPSD 2Y6SD 1QSVA 1LNUA 1UZ8A 1HQ4B 3K4DA 1OW0C 1S7UB 2HRPL 1EFXA 1TZHA 3KJ6H 5IT2L 3CFIC 2CDGB 4KC3B 1RJYB 4DWHA 3ULUL 1OB1A 4JFFB 3SE9L 2H2PD 1D5XA 2VLRB 3F7YA 5FOBA 3S6CA 2X4TA 1A6UL 3CD4A 3MRFA 1EFXD 4NNYA 5IROC 1B2WH 5DHVH 2IQ9H 1YEJL 4KK6D 4TSAH 4RMWA 3PWJA 4QXGH 3KDMB 5B3JE 2VE6B 3MXVH 5DRNA 4OV5A 1JZ6A 1XF2A 1RIHL 1GPOL 3I6KA 1ROWA 3EO0B 4JQIH 4HC1A 4Z95L 3OPZL 5HD8C 5JW3L 4M9OA 4YHPB 5IESL 1P9MA 1MCLA 3DURA 5DMIL 3OKMA 4CVZB 3QDJE 5KZCD 3U9UA 1U8IB 5GGTA 3FO0H 4QO1A 4UB0L 3RVXC 4FFWC 3QI9B 3IVKA 4AZ8A 3ROOB 3PP3H 3C8KA 4JY6A 3S97C 4HH9B 1T04A 1XF5B 4JHBA 1SYSA 4TUKH 2BSTB 1OGTA 1QR1B 1X5IA 2W60A 2PCPB 4IRSA 1BIIA 2A6IA 3Q3GA 5EBMB 2Z8SA 1RVFL 4DQOL 3ALXA 3VRIB 4HUVB 2EYSA 2G5BB 4QF1B 5BVJB 3O8XA 2Q6WA 4NN6B 5IVZB 3RVVD 4M6AA 4UIKL 2ESVB 3BPCB 1KPUB 4IRSD 2JELH 3IXAA 4N5ED 3GSOB 2EDFA 2CLVB 1AKJD 3VFUB 3FOMB 3JWOC 3O8XD 2YUVA 1AC6A 4UQ3A 1CVRA 2NY0B 5ID1A 1N6UA 1RK0B 3K80A 1KN4L 5LWYH 3PWUA 4RWHA 2MCPL 1V3KA 2ZOLA 1ZSDB 1N7MH 1NCDL 4G8FA 4WRLA 1KF9B 2CJUL 2K7QA 1MFCH 4HKBA 4JFZH 2EDHA 1OSZA 4EZMA 2XOTA 3GMOA 2K9UA 3PXHA 4FQHB 2D9CA 5D7LA 2OQJA 5C7XL 4TNVF 5F3HA 5C0RH 3TV3H 4L8SC 1VKXB 4RFOL 5DJ0A 3LH2H 3BDYH 4RSVA 5JIHA 4GUPB 4F7TA 4IDJH 4CMMB 3LHPL 2YPLB 2VKXA 2OR7A 4Z9KB 2A83B 2A6JB 3HUJE 3QAZB 3IFNL 5ADOL 2VZOA 4MCYA 1WT5A 1K8IB 2H26A 2VR5A 2BHZA 1FHGA 1MAKA 4W6XB 5LCVL 2HKHH 1V7NL 1VB9A 2HTLD 2QSCL 4P2QA 5I15H 1DQLH 3MA9H 4H88L 1MUJB 4HBCH 5C0FB 5ICYB 4XI5D 2ZPKH 2O5XL 2NY4D 1R5IB 3GMNB 1MJ8L 3QDMA 1ACYL 4UOW1 5CP3H 2EZ0C 4LGPB 4P2QD 3FFCA 3THMH 1CGTA 3NN8A 1E4XL 2PW1B 3PQYA 3V5HB 4YHOH 3X13A 4M3KB 2D7MA 3JV6B 3QDMD 4IDLA 1JZ7A 1ADQA 5TE6L 1HHJB 3FFCD 4HIJA 1GVIA 2IMMA 4MZ2A 3PQYD 3T4YA 4CU8A 2ZUQB 1CFQA 1QNZL 1A14H 3QJFA 5KAQG 1ZHKA 2P8MA 1FVCB 4OTXL 1TCMA 4PRAB 1OAZL 4QT5A 5BS0B 1WWWX 5D9SA 2X4SB 4KROB 2DIJA 1A7PL 1AGEB 5D1XC 3TIEA 3ZKQD 2Y23A 2YZ8A 4BQCA 4WWID 4M6MH 5E5UB 2J2ZA 1D5MA 4LVHB 2P8LA 4GSDL 1NBVL 1CICB 5F44A 2NY5H 3T0DA 4FQQA 2NY6C 3PP3K 2YK1L 3ZTJH 3T2QA 1QOKA 4XNYL 2DTMH 3RGVA 4TOYL 4YXLL 2YN3A 4OZGB 1ZT4A 1F11B 1N64L 1KENL 1TZGH 5FGSA 4JO1H 5DMJB 3RGVD 5BZWA 3L9RA 3AAZB 1OM3L 3VFTB 2NZ9D 4R4BA 3SKJH 1CCZA 1D5IH 1NDMA 1VENA 2IGFH 3CFEA 1F2XK 3J7HA 1NC4B 2YWZA 2R15A 4Z7UA 2DIBA 3VXTB 4KVNL 3O9WC 4FZEH 1IGCH 2RIKA 4PV8B 5EN2A 4M7ZB 2N1KA 2IG2L 2B1AH 4KVCH 3AGVA 1CD1B 3SDXF 5GZOD 2HLFC 1LK2A 2V5YA 2VJXA 3EYQD 1RJLB 4JJHA 3GSNL 4M1GH 2EYTB 4KKAD 5T1MB 4XCFL 4HW6A 1KNOB 3ZDXE 2H2SD 2L4OA 4NKDA 3TPUA 4FABH 3IJHB 4C4KT 1EK3A 3QH3B 4RNRB 1F13A 4JO3H 3MR9B 1CGYA 1F3RB 5ITFB 2KUTA 1A5FL 1SM3L 1JTOA 5CEXA 5F3BA 3PABB 2GSGB 1KULA 5IROA 4PLNC 2X1PA 1RIVL 3K8LA 4QHUA 5BO1L 3UPAA 5BOPA 2E27H 2CD0A 5GS0H 5H94A 3C09C 2GCYB 3EJYC 4R4FL 1CL7H 2E8YA 2AV1A 4OF7A 3A6CL 4HHAB 1MF2L 4RGNE 1XIWD 1DLFL 5CCKH 2CKBA 3D87B 2MHAB 4WNQB 2IC2A 1IGTA 4LPUA 4MS8D 3SPVA 4AEIL 5HYSA 1NQBA 1UXSB 2B0SL 4I77H 1U91A 3P40A 4PRIA 1Q8MA 4OUOA 1LEKB 5DD1H 5TGBB 1CU4L 1UB5B 4JCMA 2WLZA 3LMJL 4Z8FH 3BT2L 3RVXD 2XIDA 4FFWD 2EH8L 2R2HB 4F7MA 4TRPH 1FH5L 3V6ZA 4HIXH 4PRID 5CJ8A 3VXMA 3FO9B 4MX7A 1EERB 1K5NB 5C6TL 1Z3GH 1MJJA 4OI7A 3N85L 2EDOA 3ZSSA 1Z2KA 3I3DA 4ENEC 3VXMD 4KHTL 4JY5L 5SWQA 1M7DA 1Y18A 1G9NL 2BVTA 3C08H 4HS8H 1X6NA 4LSSL 2VR4A 1IGFL 3OAUH 4OLYL 3LQMA 4HIHB 2AJUH 4ZTOH 4P9HH 4O2CA 1S7VB 2AI0H 3MLTA 4IIQC 2ZWLT 1ACZA 4PGEA 4P4RA 1U8QA 32C2B 1CXIA 4CBPA 3EZJB 2DQJL 1PGRB 1RZIB 2WLYA 3GMMA 1MJ7H 4OIAA 4PJ7A 4EXKA 4F57H 3WD5L 1X5ZA 1AQKL 2VISB 4L8SA 4ZS6C 4XBEL 1PSKH 1TZIA 4YGAB 3WSQH 5HYJB 5F7EH 2DOCA 3VXRE 3VFWA 3I6GA 3U6RA 1AXSB 5CP7A 1EXUB 2A73B 5GGRB 5D70H 1S7TB 3EYSH 3LKSB 5JIKA 1FL6A 1K6QL 2DQDH 4M62H 4LP4A 4PTTA 1FFQA 4PJ8C 1NJ9A 1H0DB 4TULL 1J8HB 3NFPA 3D2UB 4PLKD 4CVWA 3JWDH 1GHFH 3Q6GL 4LLWA 1EHLL 1P1ZA 4AMKL 4U1LB 1F3JA 3UJJH 1FQ9C 2Y4SA 2JIXB 3Q5OA 3FOLA 5LAXA 3BWAA 4G6FB 3PUCA 2XKNA 4OF0A 4RGOH 5LGJA 4L8BA 3MMEB 5FV2A 1XR9B 2HFEB 1ZHLB 2X10A 5J1AB 2GKIA 4FQXB 2EIZA 4BQ6A 3KLHC 5F93C 1AXIB 1S9WA 1WBZB 4U6XA 2UY7A 2D0FA 4GW5A 5E08H 3D0LB 1MAJA 2JK5A 3ZT6A 4DGVL 4G9DA 3O41A 3HI5H 1T1XA 1HILA 2VLJD 5IUSA 4YHKL 4LSPH 4HFWB 1EMTH 5SWSB 5EZOH 3QHFL 5D1XA 2C1OA 4UU9A 5DURD 2BVEA 1MFDL 1JPGA 3C60B 1BM3H 4YGVB 1G7JA 1ZMYA 1YN7B 3MJ7A 4WFEE 4X7SH 3A6BH 4ORZC 5JPNB 5IFAL 1NMBH 5EBGA 3MUY1 4ETYA 3IJYB 4HGWA 3TPKA 1CE6B 5CD3B 3MXWL 1Q0XL 2Q8BL 2AXHA 4KPHH 2IPTH 3P0VL 4N5UA 3HNSH 4PY7A 1N6VA 4XAKE 1BHGA 1I8MA 5LBSH 3VFOA 5HGHB 2NY6D 5D93C 3GIVA 5ISZB 2C4XA 1RIUL 1BFOA 1I85C 1NBQA 1OAKL 3RIAK 3D18B 4MAYB 2Z92A 3QO1B 1BQHA 3ULVF 5ICXB 1JE6A 2H6PA 3WNNA 4GRWE 3O9WA 3EDJA 4ZOEA 1JI2A 35C8H 4JFDA 3H9HA 2PW2B 1F3DH 5C3TA 1WITA 5IMLB 3O2DH 1XCQB 3GGWA 3C8HA 1I8KB 3DETC 3O9WD 4QOKA 5GQBA 2EO9A 3MO1A 4JFDD 3FMGL 2QSTA 5E4IA 5EC2B 3AS1A 3GMRB 3A67L 1FE8L 4ZYKB 3U46B 4QOKD 5H35A 2HMIC 3RWCB 1MPAH 3CFKB 1KC5H 4JVPA 1F6LL 1PD6A 1MHEA 1KT2A 4RIRB 5EU7E 2VQUA 4QNPF 1GL4B 4TVPH 2W9DH 1DCLA 5C2BL 1GSMA 1S5IH 1AHWC 3TZVC 4XB8A 4IMLA 3RWGB 3WS3A 1N0LA 1JNNH 4V1DA 3ETBF 2BVYA 1T3FA 3MLVH 3P77A 3KPMA 5F70A 3KHQA 4EDXA 3WUWA 2OI9C 4NN7B 4G7VL 5T3ZL 1HI6A 5IIEB 1E4WH 1FRGL 1JRHH 3CFCL 2DYPB 3FB5A 3CSPA 2YRPA 2X1WL 1IC4H 4V1DD 3HE7D 1JGUH 1UH2A 4S10A 2HVJB 5FYLD 4NQDA 3VWKB 2Q7NA 4JM2F 1IZKA 1Z9LA 1G9ML 2ZCHH 5F1OB 3PWPA 1YPZB 4F9PC 1AGDA 4HUXA 2MJWA 1AGBB 3MRIA 3HI6H 4N0UB 3IKKA 3SE8L 5GRZA 3ES6A 4NQDD 1MCCA 4UOJA 1EO8H 3TM6A 4KAQH 2WIMA 4NC1C 2VSCA 4GRMA 5FCUL 1EJOL 3RWEB 1KJMB 4JVWA 3VGHA 4NKMB 4L8CA 1T2QH 5EORL 3ALWA 2PKDA 4JPWH 2RFXB 2NLJA 5HY9A 5C0BE 3D1MC 1K2DA 4MD4B 4YAQA 3ULUF 3IETB 2Y06L 1SEBA 3CK0L 1JMZA 3H7LA 1D5ZA 1TJGL 3GSQA 1K8DA 4Q6IB 1DBBH 1TMCB 1JK8A 2YBRB 1SJVA 4TNWF 3QCUL 1IL1A 2QEJA 4X9IA 4CMHB 1VGEH 4XVTH 4G9FA 5ABDE 2B5IB 4ENED 1UJTA 4JY4A 3RQ3A 3WJLC 4LAQH 5HGDA 2PTTA 2AQ1A 1Z0NA 4O58L 3MRRB 4U1GC 5DVKA 8FABB 3FN9A 4IIQA 1F3DJ 1S9YB 4ACPA 1INQA 4L9LB 3HNVH 3GMLB 4G9FD 1EGJH 1RU9L 3DVGB 3QULB 4P5MA 2OXGA 4K3EH 5CKGA 3G6JA 5CHNA 4LPWA 4PJ5E 4O2EB 5IV2B 1BREA 1CF8H 3CNKA 3RWJB 4PRNB 1JL8A 1NSNH 2BC4B 1IVLA 4NQSA 4QGYA 4Y19E 4TQEL 1YJDH 1I7TA 4RZCA 4OIIH 3HFML 4ZS6D 4NZUL 4ZQKA 3WIIL 3BP5B 3FB6B 4U1MB 1CDCA 4HCRH 4PJ8A 1CXLA 4OZIE 1BQHG 2W0FB 3VFGL 1MFAL 5KSAD 1DQMH 3RL2A 3MGOB 2C3VB 3HRZB 4PJ8D 4HJGB 5KVFL 4MDJA 1JPFB 4QRQB 1AGCB 3MUGA 1RUKH 4JB9L 1UM4H 4LGRB 4J3TA 4CADB 3UTTD 3KPRE 4OD3L 4NDMB 5BV7C 3GO1H 3EDKA 5DVLA 1HDMA 2ZUUA 4GKSB 4LCIL 3QIBB 3QDGD 2F74B 4HWEL 3E6HA 4MXQD 3UJIH 1H3GA 5DMYA 4MGXA 2VITA 1KLGB 1A6VH 4KRPD 4L3EE 5E9DE 4TVPE 2YWYA 2APTA 2X5PA 2H32B 4EN3B 3BP6A 1CG9B 2W91A 2UWEF 3BP7B 3RBGA 1B0RA 2XTJB 4JREB 3ARGB 4OGYL 3EZ8A 1PG7H 2XFXB 1MRDH 2WWMC 4OFDA 4XH2B 3U2SA 5C6PB 5BCAA 2D9QB 1JFQH 1X4XA 1VSCA 1RUQL 4OLUL 1MIEL 4KJPC 5IR1A 3IDXH 3FN0L 3KJ4B 3LN4A 3VXSB 4ERSL 1I1YB 3FQRB 4CU7A 2VMFA 4DZ8B 2VLKB 4IOFC 2FBJL 5GRVL 3CH8A 4GAGH 3DXAA 2XQYG 3ME0A 4XPTH 3IU4H 2XN9B 4OCYL 3PP4H 2R1YA 1NMCC 3NABL 3ZDZE 2IPUK 1YECH 1D7FA 1I85A 3DXAD 1U3JA 1F6FB 3V4UL 2W9EH 5BVPL 2ITDA 1FFNA 1OGAE 4LIQL 1IKFL 2HFFA 2QADD 5ESAB 1A7OH 1AFVH 2ADGA 4Y2OA 4H20H 1C12A 4OD1L 1JJUA 4PRPB 2F53A 1KN2H 4PJEA 5DJ6B 4AH2A 4XXDA 3AS0A 4XNUL 4GKOA 1YEIH 5B8CA 3X11A 1NBYA 1F58L 3BRGC 2N7BA 5JZ7C 1F6AB 2AK1L 3X3GH 1J8HE 2Y25A 3LVEA 1NFKA 4NKQB 4Z0XB 5DUPH 5CIPA 5GGUA 1LK3L 5LJYH 1KLUB 1FYTB 1T1YB 4UQ2B 4LLUA 4HMCA 4RFEB 1T6VN 2OR9H 4OKVB 5CLTA 3DETD 3TO2A 4XPGH 1KBGL 4ISVB 4M7JL 1KCSL 1JGVH 4FQ2H 2GUOA 2XY2A 2OP4L 4U1HA 1QBBA 3E8UH 3WNPA 4KK9C 4ALAH 5I16B 5IM7B 1ORQB 4NZJA 4Q2ZB 4LLYA 1AHWA 2X4PA 1QFOA 1MCNA 2ZSWB 3UTZB 5I18H 5DJCA 1MVUA 4N8VG 2NYYC 1IAOA 3B6SB 4YNYA 5I8CA 4JN2A 2B1HL 4FS0A 5DVOA 3IDIB 4JPKH 3H7BA 5SWSE 2ATKA 4JFEB 1D6EB 4KY1H 2OL3A 2VDPH 4PS4L 4LU5L 4H26B 1SVZA 4JHWH 5GHWH 1CZ8H 5KSUA 2JJTC 4F9PA 3VGEA 3NGBC 1UYWL 2XWTB 2O5ZL 4LP5A 3OXRA 3IFLL 3OKYA 4E41E 1PKOA 1JHKL 1WWBX 1LD9B 4FNLL 5JORA 2V9QA 3EYOB 2QLVB 3GMQA 3WXVL 3NAAL 3LN5A 2DDQL 5E8PB 4QRRE 4HS3B 3V4PH 3N0PB 1XF4A 3DJ9A 3LPGA 5I1CH 3S3JA 1EHAA 2FLBT 3QWQB 4FZ8L 1F90H 4JO2H 1WBXB 1BEYH 2GK0A 1KV3A 4G6AC 1CFTA 3EJJX 1Q9KB 4Y5XC 2ADJB 6FABH 1MREH 3TCXA 4UTBL 3WJLA 2EKSA 4JAMA 5E1AB 3OB0H 4P9MH 4U1JA 2NY1B 3OTTA 1T03H 3FHAA 1MCOL 4WUUE 4NBXB 5L9DL 3RI5F 4JFHD 3LKRA 4KV5F 3E3QE 2V7NA 5T3XL 4KKNA 3OF6A 1X9QA 5E2UL 4AL8H 2AK4A 5CJ5A 5L7XL 1CT8B 2Q86A 4IJ3B 4YIQB 2X09A 5K9KB 3UPCA 4C57C 2AK4D 5I6XB 2ORBL 1JZ8A 2H32H 5DD3L 1HEZA 3DYPA 3G08A 5D6CB 1INEL 1ADQL 1A47A 4X4XA 3G5VB 1OTSC 1RHHA 5ESQA 4RCAA 1N2RA 3HMXA 5DSCB 4WO4C 3AXLB 1IGIL 5FO9A 4EIGB 4WDIA 4Z78B 4G80B 4P46B 3D25B 4OD2A 4I48A 2FWOA 2JE8A 4HIIB 4KDTA 4WFFD 1ZGLP 1HZHH 2R9HC 5DFVD 5C0EB 4GRLB 3WKMH 4F9LC 1YY9C 3VFSA 5FYJE 3BH8B 3NIGE 2YEZA 5BXFB 4LCCC 2NY2B 4BH8A 1MEXH 5ITBL 1FBIL 2VXVH 3H2WA 3OJDA 4LF3A 3CDCA 1YQVH 3KPSB 2BRRH 3PHSA 4WI2A 2EECA 1WCBB 2JCCB 2ICWB 1EPFA 3Q1SH 1OOAA 1XGQB 3SKMA 3STZA 1MAMH 3KNBA 1A02N 1JPTH 1Q94B 3RZCA 3MV11 4MJIE 1LNUB 1UZ8B 3IFPA 3LSOB 1ZHNB 4WWKC 4UV4H 1EFXB 1TZHB 1A3RH 5EOQH 5DQDH 5C71A 1GRWA 1OB1B 4APQD 5T1DH 1FNSL 4GAYA 1D5XB 3RZCD 3F7YB 5FOBB 1CFSA 4YBLC 3JSSA 2ZG2A 3UMTA 4NNYB 4I0CC 1U0QA 4HF5H 3FKUS 3GRWA 2CGRL 4M03A 1P4BH 4ZUUA 3PWJB 3CCHA 2PETA 4ZD3L 4UAOC 4KJPD 1KG0B 3ZZ1A 5DRNB 4OV5B 3FCTA 3BIKB 3FB7A 3FL7A 4G5ZL 1XF2B 2H1PL 3U82B 1MCPH 2MQ0A 5KZCB 3CVIH 3LKOA 4HKZA 4YHIB 3G6DH 1EEZA 2YZ1A 3I6KB 3KPOB 3RX5A 3UPRB 4JM4H 3O4LE 3DURB 4C59B 3RVWC 3OKMB 4M6OH 3U9UB 1KPVA 5F9WB 3GHBL 4PIRF 1WFNA 1EO5A 4X6CB 3IVKB 1XR8A 1OAQL 4OGAD 3C8KB 4WW2C 4IEFB 1U3HA 4JY6B 3ZE1E 5A40E 1L7IH 1T04B 1SYSB 1MWAA 3QWOA 2W60B 4XX1G 3QIUC 4IRSB 4KRLB 4PY8J 1BIIB 3VI4E 2A6IB 4NT6A 5CKAA 4ORGA 1NFIA 2QQQA 2J8UB 2EYSB 5IQ7L 1U3HD 1AKJB 1JZ5A 3O8XB 4K7PX 4ESKA 3P4MA 1A3QA 5JZ7D 1LO0H 1MCWW 1O5DT 3HC4H 4I3GA 5SX5H 4K3DL 3GM0A 5BZDA 4MSWB 4GG6E 2CKBL 1CLZH 1DZBA 5ID1B 1NGQL 3D3VD 3PWUB 2F5BH 2ZOLB 4G8FB 2OTPA 3T4AA 3TGXA 1RURL 4KK9D 1T89A 5HDBE 4HKBB 1XFPA 1WZLA 1CK0L 2WUCL 3NMEA 5KJRH 1OSPL 4K23L 3H9SA 3HZMA 3GMOB 5L8JB 4WU5A 1BGXL 1CYGA 5L88L 5JMRA 5CUSH 2OQJB 5TE7L 4LPTA 3S36X 3JBG7 1RZ7L 4O9HL 3MOBL 2NXZC 4X6BA 2BNRD 2C3WA 5CSZA 4RWYH 3H9SD 4HDIA 2NR6C 3O3DA 2JJTA 2EDNA 1V3MA 4OM1L 2XQBH 5I1GH 4P4KC 4OGXH 3LAFA 5FV1L 4MCZA 3WFBL 5BW7A 4OLWH 3JWOL 4BZ2L 4ZMAT 2P5WD 2J6EH 4Y89A 3VXSE 4LHUG 3QA3A 4MCYB 1JYXA 2H26B 2R29H 1U58A 4YHLL 1HK6A 5BRZE 1FC2D 1G7PB 2NY4B 1NLDH 4P2QB 3U0WL 3QSKB 2DKSA 3BQUC 1IBGL 3GSXB 2XV6B 3IDGB 5IK3A 4KUZH 3E6FA 3S7GA 1L9NA 2F5AL 1AP2B 2WWKT 5E5MB 3QDMB 1LO2L 4PJDA 5GRXG 4X0KB 1UWEH 5C08A 4MQXC 3FFCB 2VYRE 4MNGE 3NN8B 5IQ9A 4I18C 3PQYB 1HSBA 5DD0H 2ATPA 5FB8B 3KXFE 4OZHF 3X13B 2AJYH 1VESA 4Y5XA 4YXHL 2IH3B 5ID0B 3LKPA 5C08D 5MENE 4HIJB 4KMQA 3HC3H 4L4VA 5FUCE 2BSRA 2DBLL 2RGSA 3T4YB 1QKZL 4G6AD 3OR6A 1HHGA 2P8MB 1EZVY 3CFJA 2V17L 1I8IB 4QT5B 1QSFE 5D9SB 4NJ9L 4L4VD 4YHZH 1TPXB 3TIEB 1U95A 2DQCL 3ISWA 5DDHA 4MA1C 2F58L 3KYKL 2P8LB 4OFPA 5IVNA 2DJUA 2JKXA 4J23A 4KDVA 1NMAH 5EUOF 1W8OA 2Y72A 4QHKI 3QPXL 1MCHA 4LSRL 4E42A 4A6YA 4DK6A 2W0PA 2FJGA 1CS6A 1X5AA 3D9AL 5KVDL 3FAXA 1E4KC 3RGVB 2Z4QA 4K3JL 4TSCL 5KW9H 2YA1A 1T20B 3QUKA 4QRPA 1ZT4B 3BZ4A 1H3PL 4I9WD 1PEZA 4Z5RA 4WO4A 4WI3A 3L9RB 1QLEH 1FVEA 1IFHL 2LVCA 1W72A 4QRPD 4L5FH 3O6FC 3NCCB 3OXSA 3MACH 3KLAA 1SEQH 1NDMB 3CFEB 2XRAH 5SX5K 4LDLB 4WO4D 2A9NL 4H5SA 3KYMA 5SWZE 5EPMA 4AT6A 4KRMB 3K1KC 4O4YH 4S1DC 1A9BB 1OAXH 5EN2B 4HC1H 4LCCA 2WV3A 1UVQA 5T5FL 1U8MB 2R9HD 4P3CL 5D2LA 4QTHB 2XWJB 1YY9D 5GGTH 2NW3A 5E8DL 5HYQB 3MNWA 4EUPG 3ULSA 3W11C 1TFHA 1LK2B 1L0XA 4U31A 1R0AL 1FZOA 2AAVA 4OUUB 5K9JH 4TUOA 4NKDB 5C9KA 3TPUB 1NFDA 1X5JA 3ZTNH 3H42H 3OHXA 4JG0L 3VGDA 3MLWL 5CINH 5KG9A 2AERT 3DO3A 4KXZI 4YDLC 5CEXB 3HAEG 5HPMA 1FDLL 4D9QE 1GCFA 4OZFA 1A9EA 2D2OA 3HRPA 2W0KA 1BQUA 2VXTL 3BXNA 5I8KL 3D39E 1NC2B 1EAPA 4QHUB 2PF6A 4YBQC 1HSAA 1XIWB 5FKPA 1QO3B 3SQOH 2LV4A 1BOGA 1SJEB 4JN1H 1E27A 3F7VA 3I50H 2NX5E 1W8NA 1YYML 3UX9B 4NM8L 1S9XA 4LOUC 3MOQA 4BK4A 3VG9B 1KB5L 1IGTB 1SQ2N 2AJSL 5JHLH 3BD5A 4LLQA 5E24E 1NGWA 2YUWA 5HYSB 4Q9RL 1QPPA 3EYUH 4ZUTA 1U91B 3ESVF 3C8DA 4PRIB 4WW2A 1A6WL 2ICWJ 3B43A 3QUZC 4ELKB 4FQ1L 3QQ4B 3V6OE 2Q87A 4F7MB 4X6DA 5DJZA 5IEHA 1HQRA 2DAVA 3HMWL 3VXMB 3L3DA 4P99A 4MX7B 3KLSA 1INDH 1K3ZA 1QUNA 1HE7A 1MJJB 2V5SA 4EKXA 3F6IA 4EBQH 4D3CL 3MTRA 4U2ZA 4DAGL 3H3PH 2VQTA 2R4SH 2I07A 1P69B 1JVKA 3F6LA 1J1PL 5SWQB 1M7DB 2W9LA 1Y18B 3NA9H 3MV7A 4DGYH 5DR5L 2PYEE 4RFNC 2KPNA 3QO0A 3CVHA 4IS6B 3B9KD 1IQWL 4Z7WB 4O2CB 5HHXH 1CBVH 5C0CA 2V5TA 3MODL 3MV7D 4P3DB 4LBEA 2XZAH 1U8QB 4XPHH 4DK3A 5EUKA 3C5ZC 5DUML 4BKLB 4YC2B 3GMMB 4D9RE 5C0CD 1K4CB 4PJ7B 1NEZA 3GBML 4KTDH 4WEBH 2YD6A 3B2VL 2L7JA 4JZOB 3NIFE 4L8SB 5ETUA 5KSBA 5TDOA 5TQ2H 2R56H 5GRUH 3VFWB 3U6RB 1HINL 5CP7B 4KJWC 3ARFC 3ZDYF 3SDXE 1FL6B 4HWBA 1AO7E 5ELIA 1M6OB 2AEWA 5J9PA 4PTTB 1K85A 1NJ9B 3NFPB 5ALCH 4ZAKA 2FEEI 4LVNB 4PBWD 3MLRH 5FGRA 2EYRA 3FQXB 2IBZY 4V2BA 2NY7L 2ZCLH 1P1ZB 2IPKB 3BQUA 1F3JB 2WP3O 4J6RH 3FOLB 2AEPL 5LAXB 5KVEH 1BOYA 5HGBA 4ZAKD 5IW6A 3RHWK 2XKNB 2YD2A 5LGJB 4L8BB 2ED7A 4Y4HC 1PJ9A 3BQUD 2GITA 4NNPL 4I18A 3F7QA 4YZFF 1EDQA 3WMSA 2QQLH 3DUSB 4KKLC 2EIZB 4FQCL 4X6CE 4ODXB 2DQHH 4HPOH 1W0WA 2VLJB 5D72H 3GSUA 5MHSE 1IT9H 1S9WB 4MQXD 2BDNL 2CSPA 2HT2D 2VTFA 3CXHJ 5DURB 1SMAA 1IEHA 3NACH 4G9DB 4YHYC 43CAA 3O41B 4YE4H 1T1XB 1HILB 4XMPL 1MH5A 3I6LD 3QFDB 1EEYA 1MJUH 4PGBA 1VFBA 5EO0A 2C1OB 4UU9B 1F8TH 4L4JA 5F8RC 2CDEA 4XC3H 1JPGB 1P5UA 5ANMA 3RNQA 4OZFG 5I30L 4R96A 4G6JH 3KPPA 1R3HA 1G7JB 3R1GH 3MJ7B 3VD3A 1AGFA 4L4TA 4WTWA 5TPWL 2BCKA 4HGWB 4N90E 4WTZG 3CXHK 3LS4H 3U4EA 1YYLH 1E4KA 3PGFL 2YD4A 1YC7A 2A77H 4LASL 4K3GA 2XPGA 4L4TD 5DS8A 3ZL4L 3TBSA 4PY7B 4YR6B 1I8MB 4PJBE 4ZXBC 3VFOB 3CUPA 4R3SA 4NQEA 2G60H 3GIVB 2A0LD 3SOBL 3REWA 4Z0BH 5EOTA 4XVUC 4GBXA 3RFZC 3O6FA 4NHCH 3K2UL 3GK8H 4MNQE 2Z92B 3CX2A 5H2BA 1BQHB 2VDML 4FG6D 4NQED 4IRZH 1B0WA 2H6PB 3O2VH 2R1WA 5EU5A 5AG9A 3O9WB 3SEPA 3GMPB 4GBXD 4JFDB 3H9HB 3VD5A 2EH7H 1A3LH 2P5ED 3V0AC 3IDYC 4R8WL 5SX4H 3V79C 2X1QA 4U6HA 3L3OA 1J5OL 1MRCL 3DX9A 5GGQL 1H15B 3PNWB 3TBTA 5J13B 5DC9B 3GGWB 4PJXE 3IGAA 4QOKB 5D4QA 2JB5H 4S1DD 4PP1D 1GAFL 3O11A 4LARH 2WNGA 3EFDH 3MYJB 5HXMA 4UDUB 4H1LG 1WEJH 2CUIA 1DUZA 5H35B 3QQ9C 3DSNA 5EO1A 1KJ3L 4LRNH 3RU8L 1T5WA 1U93A 4Z7OE 5IB1A 4HJJL 3W11D 4RGNC 1KT2B 3ILQD 4HKJA 2R2BB 3QDJA 1T7YA 4BZ1L 1RZJL 4M1DH 3OZ9H 1BWWA 3W39B 4UT9H 3RDTC 3WS3B 3HE7B 2RB8A 1T3FB 3KVQA 3P77B 3QDJD 1G7QB 2CH8A 1B3JA 1IE5A 1HI6B 3BMWA 3WDJA 2XY1A 3C09B 3FB5B 3QCTH 1IC1A 3GI8H 3ARYA 2WBJC 4RX4A 1CE1L 5DA4A 5L8KB 3MBEC 1FSKB 4NQDB 4B5EA 4C54A 1S7QA 2Q1EA 1R5WB 5LGHL 1AGDB 4HXAL 4HUXB 3MRIB 4RX4D 3GJEA 3VRLF 1WBYB 3RY6C 3ES6B 2VLME 2Q7YB 2X4UA 4Y4KC 1SBSH 3DIFB 3QUZA 3H6JA 4GRMB 5GGSY 2OJZL 4PB9L 1ZE3C 3HI1A 4KJYA 3UDWC 3DV6A 2DLTA 5HY9B 3PV6A 1SY6L 1K2DB 2YUXA 1SEBB 4LGSB 2NY5C 4KZDH 1M71B 1DBAH 4N0YL 2FHBA 4Z7UF 2EC9U 4N9GA 3AREC 3GEWB 3B5GA 4Z6AT 3K4ZA 5F1NA 2OL3L 2B2XH 5D5ME 2HJFA 1ZA6A 3BEVA 1IL1B 4S1RH 5FDWA 2DI7A 1RSFA 3IF1B 4G9FB 4UT6L 5KVGL 2FGWL 4OM0L 4JY4B 1U2CA 3HUJA 4NC2B 1I1RA 2ICEA 4PRBA 2PTTB 5HGDB 2P43B 2RCSH 3MRLA 4OQTH 1BMGA 1X5HA 3RKDD 1INQB 4OCWH 1FAIL 3FFDA 2AJVL 3C5ZA 1HHHA 5CHNB 3L3IA 3BUTA 3TEUA 3GHEH 4AG4H 4N8VB 5MEOB 5J6GA 5ACZB 3N9GH 3ARUA 1IC7H 3MPCA 3DGCR 4NNXB 4OLZH 4R4NC 2OYPA 4NQSB 2KQNA 2QQKL 2R23A 3ARFA 4RZCB 1I7TB 5KSAB 3HR6A 4R9HA 3UTSE 2CDFA 2GI7A 4ZQKB 5BMFL 1UQSB 1GOHA 5T1KA 3GJFK 1A22B 2XKUA 4PJ8B 1OQXA 4OFIA 1ED3A 2CXKA 2KZWA 5CILH 5M95B 2FBOJ 4NM4L 1L6XA 4KJWD 2Z8RA 4KQ4L 5J3HC 3VDBA 1Q1JL 5TQ0H 2BOBA 3RL2B 4QNPE 3IAQA 2Z93A 5T1KD 1NUGA 3UTTB 3BKML 3BHBA 4NN6C 5C86A 4PJIB 3VWJA 5IBTL 3ELAT 1D9KA 3MUGB 5FKAB 3ARBB 1MQKH 2BY1A 4Y4HA 3QDGB 5DEFA 1CDBA 5EDXA 3ZKNC 2EC9T 3VG0H 1RV6X 2GFBA 4KRPB 3VWJD 4PGDB 1GGTA 4GMTL 1D9KD 2FIKA 2NY0C 1J1XH 1HDMB 5GS0C 1FL5A 5IFHL 4Y4HD 3S37H 3S35H 5DHXB 4Z7NF 2HFGH 4KKLD 4BELD 2BY0A 3MOAL 1P4IL 5HYFA 3QNXB 4ONHA 1S78D 4J3XA 3C2SA 2E7MA 4NJAH 4OLVL 3BP6B 4QCIB 4OI8A 1B90A 1RZFH 1SJXA 5FM8A 1B0RB 1P84J 3BIBX 2BFVL 1UH4A 5F1SA 1RUMH 3G6AB 5B38A 4YDIL 5EZLA 2Q76A 5IR1B 1RQ5A 1XMWA 3LN4B 5DRWB 1WFOA 3QAZC 3ULUE 3TJHC 5BV7L 1WZ1L 5CEZL 5L6YL 4ZXBA 2X9WA 3MJ8A 2QADB 3TA3C 5DJ8A 1OT1A 3RPKA 5C0NC 1P84K 4F37F 1A7NL 4EEEA 3M1BB 1T4KB 1VFAB 1A4KA 2ITDB 1FFNB 1M05A 3F65A 4ZXBD 5D7IF 2HFFB 3WFDH 5FYLH 1A1OB 4P9HC 2HJKA 3I02B 1EBPA 2B4CL 3LIZL 3T0EE 1R3KA 2P45B 3NA4A 4YHML 4XPBL 4YPJA 4XXDB 3PWLA 1CQKA 1GGBL 3TNMA 5B8CB 3X11B 1NBYB 3CAFA 1BF8A 1A6ZA 4AEHH 3VXOA 4DVBA 1XGTA 3EDFA 5CIPB 2ZUQC 5GGUB 3K8MA 5CZVH 5JW5A 4WVRA 5F6HI 4LLUB 2P47B 1HH6A 4BQ9A 5TDPA 1T22B 3LQAH 3TO2B 1QYGL 1LDPL 4KROC 1IJ9A 3QRGL 3L7FA 2GUOB 3HZYA 4U1HB 5KTEL 4NQXA 4LVHC 2I5YH 2XZCH 1CICC 1NGXA 3JWDC 4FQLH 3HPJA 1RFDH 5D2NB 2X4PB 3RDTA 2VABA 1AD0B 5DTFA 1CFNB 1KCUH 3GZKA 4RGND 4JDVA 5DJCB 4HLZH 1YZZA 5E2TH 4YBHA 2AEQL 1DBML 1MVUB 2OR8A 1IAOB 2I26N 4YNYB 4JN2B 1MWAL 5CP3A 5M7QA 1C16A 1YNKL 3RDTD 1CVSC 3W82A 1NLBL 1B88A 1A64A 3T8XB 3BO8A 2WBJA 5GGVH 4LSQH 5DA0B 4X7CC 4G43A 4KJQD 2OL3B 3MBEA 5AYUL 3T2OA 4QRTA 1JPSL 2FGZA 5KSUB 2CLZA 2A1WH 3BN9D 4PRHE 3TWCH 3RY6A 3BOVA 2IAMA 5FYKH 2P42B 4WJ5A 2OTWA 4YQXL 4RDQF 3INUL 5JORB 3GI9H 2C4FU 1GIGH 2UWEE 2LAGB 3GMQB 2IAMD 2R0KH 3LN5B 3UDWA 1FVDA 4I8DA 5F7NC 1Q0YL 3BX7C 1V7ML 4LSVH 2BVQA 2HAZA 1XF4B 3U7AA 2FEEL 4QRSA 5C0JB 3AREA 3ABZA 1HQ4A 4X9GA 1GGYA 2GK0B 2CDGA 1CFTB 1RJYA 2VOTA 5F7UA 3VFVB 1MFEH 1C5BH 3VXRA 1U2HA 5AZ2H 4XBGA 3O0RH 4EDWL 3I9GL 3ARED 4XCNA 1M7IB 5GJSH 1ZANH 3GIZL 4JAMB 4NWUH 4U1GB 4U1JB 3GSVA 4NO3A 4OFYA 3BDBA 3VXRD 3S9DB 3DVNA 15C8L 4ZTPH 3LKRB 2IBGA 4XZUB 2V7NB 4PJCB 4Q9QL 3IRPX 4M02A 2AK4B 2P4AB 4OFYD 2Q86B 3RUGB 3BESR 4GAJL 4KDWA 1I3RA 2VIRA 4ZS7L 1HXYA 4CVZA 1U8IA 4PTUB 5I1LA 2XQYK 1HEZB 4Y5YB 2VDKL 4N9OB 3G08B 5T5NG 1JYNA 1TJIH 3I75B 2J8HA 4R4ND 3E2HC 3IB4A 3SY0A 2BSTA 2CRZA 1RHHB 3OJMB 5ESQB 3VXNA 5F97E 1U8KA 5EBMA 1TETL 4LQFL 3IDJB 1SHMA 4WDIB 2VUOA 5DK2B 1OP5H 1EV2E 3VRIA 2EDRA 3OAZH 4R26H 3GNMH 1KCRL 4QF1A 3KPTA 5E2VH 4P48A 4OD2B 5IVZA 1CTOA 5J3HD 1UKQA 3MV9D 2EDBA 2ZG1A 4ODSL 3LV3B 3VFUA 1AJ7H 5DI8A 2D7TH 3PL6D 3O3UN 3VFSB 3CLEH 2YEZB 1RK0A 2DIAA 5KANG 4XWOD 4LF3B 3R8QA 5EU6E 4WFED 3ZKND 3QHZH 5IMOB 4U6VH 3TYGH 2OK0H 2NTFB 4OLEA 4XB7A 1SMOA 4APQB 3SKMB 3STZB 5JNYA 3EBAA 3KNBB 4GMSL 3RZCB 1KB9J 4ODUA 3P73B 3IFPB 3VI3F 4FFVC 1W72L 4XAKD 1VKXA 1N0XH 4WI4A 4LLMA 5C8JA 12E8H 2J88L 1QSEB 4GAYB 5LXGL 5I1JL 3K46A 4PREA 2YPLA 5I8EB 4H0HB 3FT4B 4L1HA 3OV6A 4PB0H 5AZEL 1RULL 2DN7A 4GT7A 4ZUUB 3S34H 4ZOCA 4GW1A 4MA8L 1HHKB 1KB9K 5IOPA 3BGMA 5JA9A 4M7KH 3TA3A 4P2YA 3FB7B 3G6JF 2DD8H 5DK0B 3O6ML 1E6JL 1EEZB 3DYMA 4DN3H 1X3DA 5FYKE 2MFNA 3TA3D 4JHAH 3GMNA 4KKCC 1JYWA 5D8JL 5EFIA 1KPVB 1PAMA 1CGSH 4W4OC 1BP3B 2PW1A 1XR8B 3SGKC 2J4WH 4S1SL 1U3HB 4F7CA 1RD6A 1MWAB 1TQCB 3QWOB 3MUJA 1HNGA 1BFVH 2NXYB 4XTRC 4AM0B 3MRKA 4N8CH 3P9MA 2Q8AL 2A6DA 4JLRB 4WY7H 1A6TA 4IM8A 4OAWB 5AUMA 4PJIE 3ARSA 1AGEA 3D3VB 4ZOBA 3C60C 4ETQA 4LSUH 4ONGH 3MLXL 5BZDB 4WV1B 1AQDA 3WJJC 5EZJB 1D6VH 2Q20A 2YD7A 2D4DA 3T4AB 2M8XA 5GISL 4JKMA 2BNRB 4PLJD 4M7LL 1GZPA 3OKKA 1GOFA 1VPOH 1OP5K 3OAZK 3RWHA 3B8SA 1ODAA 4X6BB 4HK3N 5C0BA 1UACH 4UT7H 2EEDA 2P5WB 5CSZB 4MD5B 2ARWA 3KPLA 4PJFF 3O3DB 3H3KA 2APVA 5FGCE 3VXTA 4HJ0C 5C0BD 1OAUH 4I3SH 5B4MC 3X12A 4I13B 3SGEH 3QA3B 3KWWB 4GH7B 5AYQA 1QQDA 1U58B 4PJGE 5CJXC 3U9PH 1DFBH 2FNBA 3CVHL 2ADIB 4YWGL 3FAWA 3LQZA 4K94H 4F58L 5IHUH 2WUBL 5IK3B 4KTEH 3E3QC 4POZC 5FUOL 2R69L 2VH5H 3AU1A 3ZSTA 4WI6A 4PJ5A 2QR0B 2EYTA 2H45A 4H8WH 3V0WH 5C08B 5IQ9B 5C0IA 3IJHA 1U8JA 3HMXH 4RNRA 3V5KA 1DBKL 4DVRL 4PJEF 4ODHL 1IGJA 4WW1A 4PJ5D 2FD6H 3BYYA 3LKPB 1T80A 3L1OH 4L4VB 3U7WH 3UO1L 2BSRB 5FF6B 3OR6B 1HHGB 3SO5A 4HWBL 2YXFA 5F9JA 3CFJB 1EH9A 2XXMB 1P6AB 2ED8A 4OZIA 5B3NA 4KQ3H 4NN7C 4Y19D 3C6SA 4XNXL 2B39A 3G5ZB 5F7LB 2BJML 4KXZH 1H8NA 1YEHH 1U95B 5DDHB 4BSWA 4O5LH 5E95B 4X80H 4KU1A 3U4BH 1WTLA 5D7SH 3SKOA 3VWKC 5F9OL 1MHPH 1LEGA 3B9DA 2C3HA 1LEIA 2HTKC 3CZFB 3U1SH 4E42B 4A6YB 5E99L 2DM7A 2FJGB 4MJ2A 1GZQA 3FTGB 2Z4QB 1JNLL 3L5WA 5JUEH 3QUKB 4PRDB 4QRPB 1LEKA 4O2FA 1OAYL 4KI1A 1UB5A 2C1PB 1QHPA 4HQQH 4Z5RB 3KPRD 2R2HA 1IILE 4WO4B 4R0LC 1T0MA 4L3EA 5E9DA 1BAFH 2ZNWA 1W72B 3FO9A 2CUMA 3K2MC 3GRWH 2HH0H 3KLAB 2FSEB 3UJTH 1YA5A 1FPTH 1MCSA 3PGDA 1F4HA 4Q6IC 4H5SB 4MB4A 1GGIH 4L3ED 5E9DD 1PYWB 3VW3L 1AY1L 4OLXH 3SQBA 4TVPD 3BKCH 3UYRL 1U3YA 3SN6N 4P23C 2ERJB 4R7DA 5IEKA 4GKZA 4CMHC 5C2UB 1NGPH 3LRGA 4CVUA 2VDQH 4U1IA 5D2LB 1I7ZA 4JDTL 4R90H 2NW3B 3F12B 3MNWB 1BVKB 4XHJC 3ULSB 5JO5A 1OCWL 4LHJB 4ZDHA 4L9LC 5GRWA 3U79A 1VGKA 4U3XA 3WFEL 3RA7H 4XX1E 4EXPX 8CGTA 4QHNA 4K55A 1FGNH 4K7FA 5AWNL 2R0ZH 4TUOB 4LEXH 3RVUC 1OGAA 2C26A 4QXWA 1NFDB 4IOSD 4HFUL 3O81A 4JQXA 3SKNA 3CMOL 3OHXB 1PY9A 1N5AA 3CJJA 1I7RA 3L3GA 3OMZA 4J3UA 1FORH 1CL7I 1OGAD 4OZFB 1A9EB 5GGRA 3EOTH 3SJVE 3C2AL 3F7PC 3BXNB 4JRWA 1LILA 1ERNA 1DN0B 1F4WL 4Q0XL 1EAPB 4EUPH 5K9QG 1GGCL 1EHNA 1HSAB 4LFHG 1J8HA 2R4RH 4U7KA 1QLFA 1FAKT 3CC5A 5FKPB 2V5MA 4XNMB 1BOGB 2B7DT 1E27B 5JIIA 1F45A 4PJCE 2LAAA 4PYGA 4U1LA 4KMTH 4OZHE 3RUGE 1S9XB 1BBDL 5T3ZE 4XMLL 5I19H 1QFUL 1L7TL 3HAEH 4LLQB 2MWCA 3MMEA 1T7XA 1XR9A 4W4OA 1J88A 1FNEB 3VE0B 5E7BA 4WW2B 1EGJA 4G6FD 2J7LA 4KKCD 3X3FL 5HDOA 2DQTL 2YPVL 1WBZA 4DGIL 3BWUC 1HQRB 3QUYB 4FQIH 5MP6H 5IEHB 3DROA 4HGKC 4QYOA 3MCG1 3MGAA 4BJLA 1R5VB 4HFWA 5CLWA 5SWSA 4EN3C 3B9KB 4CN4A 3CSYB 2I07B 4HCRA 4YGVA 3CPLB 2XTJC 3MV7B 3QPQC 5C92A 5FUZH 3WJJA 2D31B 2Y07L 1TXKA 3PIQA 4JO4L 4H1LB 3P0YL 5SWSD 3QO0B 3CVHB 5D71H 2XA8H 3LS5L 1CE6A 5CD3A 2JJSC 4E41A 1S3KH 1Y0LB 2D7PA 1OQOA 5C0CB 1KEGH 4K2UL 1HHIB 1IKNC 5B22A 5GGRY 2IMNA 5EUKB 1QBLL 4E41D 5I1IL 4P5KA 5DT1L 4I0PA 1NEZB 3BEWA 5B39A 4QRRA 4M43H 1XGUB 5ETUB 1NAML 3VH8G 5KSBB 1F4XH 2MMXA 1MNUL 3C9NB 2YXMA 3D18A 1ZAGA 5TDOB 2HKFL 1G6RB 2IJ0C 5EA0H 1QSEE 4I0PD 1RZKH 4QRRD 1NAKH 1N8ZB 1O7VA 1TJHL 4NO0B 4RMRA 5J9PB 4ZFGL 5HPOA 5IMLA 3H0TA 3NCJL 4ZAKB 5FUCC 1OWRM 2EYRB 1I8KA 2VDLL 2DQIL 4NRZA 4WUUA 5B4MD 4A6YH 3BQUB 5EC2A 1QBML 4TPRH 1RK1B 3J8F7 4PJAF 3KG5A 3JVGC 4K8RD 1G7MB 4UILL 4WUUD 5HDQL 5CJQH 2GITB 2VN7A 1Q72H 3CFKA 4I18B 3QCVL 3CMGA 5D96B 4B53A 1JPST 2FX8L 1NUDA 1W0WB 1AE6L 3GSUB 4JEGB 2O5YL 5FECB 4XCCH 5I0ZA 4BA8A 1U92A 3DI2B 2DQUL 5DJ2B 2AQ2A 3RL1B 3RWGA 3S88H 2VAAA 5F72S 3VFNA 5HHME 5TE4L 1FFPA 1A0QH 2W07A 4XNZC 1EEYB 5DC0A 5DVMA 4HZAA 2WBWB 1V3LA 1VFBB 3KJ6L 2DYPA 4JR9H 4PGBB 5EO0B 3VA2C 5DWUH 2CDEB 4MA1B 5ANMB 4KUCF 3RNQB 5BJTB 4R96B 1R3HB 2EDKA 1Y6NR 3DLQR 1OD9A 1MRFH 3VWKA 4L4TB 4Z77A 2BCKB 2R0LH 2Z31C 1B2WL 2D3VA 3U4EB 4HMDA 2IQ9L 1WIOA 4DKEH 4TSAL 5HHNB 4QXGL 5DS8B 2XZQH 3TBSB 2EIBA 3MXVL 4DJMA 4NP4H 2I24N 1CR9H 4R3SB 4NQEB 1KJMA 4FA8A 4R0LA 3REWB 1DBJH 5EOTB 4JQIL 5FYJD 4X4YB 4OZFH 4GBXB 2RFXA 4C56E 2P5EB 3F58H 3MGTB 3IETA 1FO0A 3BD4A 5H2BB 5TJWK 5GRJH 4MJIA 3FO0L 4Q6IA 5EU5B 5A3IC 4I4WA 1NDGA 1A1MB 4TUKL 4X4ME 4P23A 4LIQE 4U6HB 4MJID 1IM3A 3FRUB 3DX9B 4XWGH 3TBTB 1VFMA 1H9VA 3IGAB 4X6FA 1I7UB 4JFOA 5DHYA 1YY8A 2BSED 1DL7H 2CKNA 2NY1C 4P23D 3O11B 4L9LA 5HI4D 3NFSH 3DVGA 2JELL 1DUZB 2J3SA 4OIBA 4PJDF 5EO1B 1FLRH 4O2EA 4MHHG 4JCLA 1KELH 3BKYH 1U93B 4XHJD 5IB1B 1MQ8A 2EE9A 4TUJB 4C4KO 4IJ3C 3O4LA 4CJ1A 5E2WH 3QDJB 1JRHI 5LWYL 5EG6C 3MFGB 1N7ML 2YD5A 1RJZA 1T66C 2FATH 5I6XC 1MFCL 4JFZL 5B39G 2BP3A 3O4LD 3BP5A 1FNGA 5DD6B 2PR4H 4FXGB 2W0FA 2LFGA 4H1LH 5C0RL 1DSFH 3TV3L 4U2YA 1FJ1B 3BDYL 3LH2L 3R8BB 1OLLA 1A1NA 2C3VA 4IDJL 1CFVH 1UH3A 1S7QB 4QRQA 2VDNH 3V7AE 4LNRA 2VKWA 4CADA 2D7NA 4Q7DA 4GRLC 2X4UB 5HVHC 1WGOA 1VADA 1A7BA 5FA4A 3V95A 2HKHL 2ZNXA 4HT1H 3W5MA 4GKSA 5I15L 3MA9L 1DQLL 1G6RH 2F74A 3HI1B 3B9AA 4AIZA 2Y6SC 4HBCL 1Z9MA 1HOCB 2CXGA 3DV6B 2ZPKL 2V2TB 1HH9B 4DUVA 2VAJA 4BQBA 4DTGH 1YEKH 1FG9C 3MSPA 2H2PC 1WC7A 1MELA 4OFVA 3THML 4EN3A 1CG9A 2DS4A 4N9GB 1EEUA 4YHOL 2DI9A 2ZOKB 5IBUG 1YUHA 5F1NB 2DJSA 4XH2A 3VGAB 4KK6C 2MTPA 2N4IA 5FDWB 4LVOC 5D7LE 2JJSA 5FHBH 3HUJB 5CJOH 5CD5D 1A14L 3EW3B 3DX8B 1NEUA 4XVSH 3VXSA 3MRLB 4DKAA 4M61A 3MC0A 4WTXA 2WMPA 3C6LB 3JUYA 3L5JA 5BRZA 1IKNA 3FFDB 2E9JA 1UXWA 4UDTA 1HHHB 4M8QB 3L3IB 2DBJA 4M6ML 1UC6A 5E5RB 2DLFH 2ICES 1BJ8A 4U1SB 1W0VB 1NFDF 5BRZD 5J6GB 4E0RA 3MV8E 2NY5L 2EXYC 5T3XE 4MNGA 1X4YA 2DTML 5FO7A 3KXFA 4J3WA 2CDFB 1UFUA 3VXUE 5DJ6A 5T1KB 5MENA 1TZGL 4JO1L 3QXWA 5JW4R 3KXFD 1C7TA 3NZ8A 2GYSA 4Z0XA 2BOBB 3SKJL 2Z93B 3GUTA 1D5IL 2IGFL 2QKIB 1QSFA 5MEND 3BHBB 4RFEA 2NMSA 3VWJB 1D9KB 2ZP0T 2RQ8A 3HKFA 5A1AA 4FZEL 4Y4HB 3UC0H 1PVHA 5DEFB 3PHQA 1IGCL 4XP4H 1QSFD 3CFBA 1KUMA 4WW2F 2VXSH 2GFBB 1T1ZB 2FIKB 4KI5E 4Q2ZA 1FL5B 2B1AL 4KVCL 3K3QA 4NHUA 2ZUVA 2UVEA 2ZSWA 3BH9B 3UTZA 3V7MA 4X6DF 3NPZB 3MRPA 4LKXB 1HKLL 1X7QA 4UI2A 5FA3A 4EI6A 1F5WA 1QP1A 4M1GL 1WFUA 3QUMA 4XXCA 2EDEA 2DF3A 4FABL 4XC1H 3P9WB 4JO3L 5JW4Q 1FCCA 3G5XA 2VQ1A 3MNVB 4U7MA 3DYOA 2IALA 4LCYB 1O7SA 3BPLB 5FDYA 1LO3H 2HWZH 4WFGE 5CSGA 5SWZA 1LP9B 2Z31A 2Q76B 1RUPH 4RMTA 3T77A 5I1KH 3LRSA 1G1YA 2HG5A 1ZK9A 3BISA 3ARRA 2E27L 5SWZD 5GS0L 2Z31D 4Z7UE 3B9VA 3EYOA 4LDEB 4XI5C 2CPCA 5DJ8B 2NY4C 4OCXH 1CL7L 4JRXE 4IHOA 4JKPH 3T2NH 4PJHF 5CCKL 1M05B 2G75A 2I27N 2HJKB 2GSIB 4I77L 1R3KB 1N5YH 2XYCA 5DD1L 2I9LB 1LQSR 3IDYB 1E6OH 3TNMB 4Z8FL 1A6ZB 4TRPL 5A3ID 4HIXL 2I9TA 3VXOB 5JQ6H 4Y7MA 1XGTB 3STBA 3D39A 1JN6A 1Z3GL 5JW5B 4NOBA 2AW2A 1HH6B 4FHBD 1QBAA 4G8EB 4D9QD 4HWUA 5TDPB 2NX5A 1TPXC 3D39D 2NY1D 2ZZUT 3L7FB 1ZKAA 3HZYB 1MCJA 2HFTA 3C08L 4RGNB 4HS8L 4NQXB 3OAUL 4YIQA 5DD5H 2AJUL 4LKCA 4LLDA 4ZTOL 1NGXB 1YMME 4P9HL 3DUUB 3HPJB 5IGXH 3CDGB 2NX5D 4XP1H 5C07E 5IHBA 2VABB 1T6WA 5DTFB 1P53A 2AI0L 4NRYA 4M4PA 4JDVB 1R6VA 2GJZA 2IADA 1PKQB 1PX3A 3EDEA 5D6CA 3NTCH 3WXWH 3V6OA 1MJ7L 4NUGH 4F57L 3WHE0 4X8XA 3AXLA 3TFKC 4MXWH 4G43B 4P59H 4G80A 1PSKL 4Z78A 3WSQL 2GY7B 4QRTB 1LWRA 5F7EL 4EI5D 1B0GB 1BD2E 3WHE1 5TFSH 3T0BA 1YEFH 2CLZB 2JJVA 5D70L 1MLCA 3EYSL 4F3FB 2DQDL 4WHTB 4M62L 2IAMB 2NTSP 3FQWA 4XMKH 2PYEA 4OSUH 4WJ5B 3JWDL 4Z7QE 1GHFL 2Y1VA 5I1DA 3EYQC 2F19H 3UJJL 3RZWA 1FVDB 2H2SC 2YMXH 1WCBA 2PYED 2RJMA 1DQDH 3DOSA 4Z7VF 2Z8WC 1CIDA 4RGOL 2WBKA 1XGQA 2BVQB 2P5EE 3F7RA 1MCBA 5GJTH 2G2RA 3AREB 1UA6H 3LSOA 5CS7A 1ZHNA 3CLFH 4JFQA 1IAIH 4H25A 4MQTB 5E4EB 3VXRB 4D9RD 4GQ9H 4Y5VC 4XBGB 5E08L 4XCNB 3SDXA 5IB3A 4U6TA 1AO7A 3GSVB 2V2XA 2WK2A 3HI5L 4NO3B 1DANU 2WINA 1HCFX 4LSPL 3QQNA 5B3JF 3DVNB 5D7IE 1EMTL 3LY6A 5EZOL 1XIWC 4DW2H 3WNLA 1KG0A 4PY8I 3BIKA 4H0IA 4GXVH 3VGGA 1BM3L 1AO7D 4U0RC 2ZUXA 4MS8C 4X7SL 4YHIA 3REVA 3A6BL 5I66A 1DLHA 1FL3A 3O4OC 1NMBL 5ADPH 3KPOA 2O93L 4Y4FC 3UPRA 1I3RB 2VIRB 1HXYB 3VG9C 5EBWA 2E7LC 4E9LA 1NL0H 4KPHL 2YS4A 2IPTL 3IDNB 3HNSL 5I1LB 2BXZA 4X6CA 3KHOA 5CSBA 1QEWA 2EXYD 5LBSL 1QVOA 3SY0B 3WNKA 4WI7A 5J0BA 5IVXB 4TSBH 4NFCA 3VXNB 1U8KB 3MV9B 1U8NA 5MHSD 2J8UA 1AKJA 5HGAA 4F7EB 3ET9F 3PL6B 1J10A 3PF2A 2GJ6E 3WDIA 1HN1A 5JA8B 35C8L 1I4FA 1MOEA 5DI8B 1JHLH 4MSWA 3O2DL 3AROA 3VXPB 3ARZA 1FGVH 1YMHB 1Q9OA 1UCTA 3KAAA 1I9JH 3ULUC 4N90D 1L9MA 4PJBA 1DANT 4NQCE 5JNYB 3LZFH 2R2EA 1MPAL 1KC5L 3TF7C 3Q48A 4YC2C 4ODUB 3V0VA 1UM6H 1OARH 5F1KC 4LCWE 3HNTH 4MNQA 4TVPL 2IH1B 2PXYD 2W9DL 5JOFA 4J1UB 2MKLC 5HHVH 4LLMB 5C8JB 3U0PB 1S5IL 4GRWB 1KJ2A 4PREB 1RPQA 1S5HB 4PLKC 1JNNL 4MNQD 1T83A 3MLVL 2DKUA 1I9IH 4GW1B 3EHBD 1E4WL 3MQIA 4HSQA 1JRHL 4PJXA 5IOPB 2DQGH 3EOYG 3BGMB 1G7PA 3TA3B 4LVNC 2MQCA 1IC4L 5IBLD 1JGUL 3WFHB 3BZEA 3NH7H 3PDDA 4UOW0 3BRFA 3PXJA 3GSXA 3IDGA 3HG1E 2NPLX 2ZCHL 4Y1AE 3VD7A 5DF0A 1AP2A 5E5MA 1K4DA 3HI6L 3BGFC 4X0KA 5EFIB 3OKNA 2DLEA 2BHUA 1EO8L 5FB8A 4KAQL 2FLRT 5F9AC 5KVMC 3C5SA 4TYUA 4F7CB 5LKNA 1WSST 3W0WE 2IH3A 2Y7QA 5ID0A 4CN1A 2ARJQ 4GO6B 1T2QL 4JPWL 3MRKB 1YN6A 1NCWH 1J7VR 5K93A 2XA3A 2ZSVB 3P9MB 4BFBD 2X41A 2A6DB 3MLUH 1A6TB 4WEUD 1I8IA 4M5ZH 1DBBL 7CGTA 5AUMB 5EOCH 1TTGA 4ETQB 4NSKB 1CGUA 2VZ3A 5EO9A 1VGEL 1AQDB 4XVTL 3BZFB 5HI3D 1U8LA 4P2RE 4YO0A 4ODTH 5I76A 1BJ1H 4LAQL 1X5FA 1CGXA 1R3IH 2YD8A 5D1QA 4ELMB 1RUAH 3HNVL 1EGJL 1T20A 4K3EL 4FTVD 3HZVB 4HIEB 1GZPB 3OKKB 3ARTA 4XHQA 1FYHB 4BM7A 3DSFH 5ILTH 2VLMD 5D1QD 1CLOH 1CF8L 3RWHB 3IRZA 3D0VA 5C0BB 1NANH 4JKKA 1NSNL 3MUHL 5C3LD 3KPLB 4ZUWA 4OCRH 1XAUA 1YJDL 4OIIL 1PEWA 3TFKD 1DVFD 1LP9E 2QSVA 5D5MA 5E03A 1PZUB 4HCRL 5GIRB 3X12B 1A9BA 1QQDB 5J06A 1DQML 1U8MA 3LQZB 5J13C 4S1QH 4QTHA 2XWJA 2YA0A 3TN0D 3QEUA 5DMKA 2OX5A 3TH3T 5HYQA 4HWZA 2Y5TA 1TNNA 1RUKL 3AU1B 4PJ5B 4C83B 5E6ZA 1UM4L 3ZDXF 4OUUA 3WIHH 5C0IB 1ZLVH 4OJFH 1U8JB 2CO7B 3GO1L 3ULVD 4LPYA 3V5KB 1WVZA 1IGJB 4WW1B 2IANE 4Y5VA 4UNUA 4Y19B 1NUFA 2D03H 4NKIH 3UJIL 4X7TA 3UTSA 3QEHA 1VEPA 1A6VL 4OBSA 2AGJH 3ESUF 4MB3A 2ICWI 5F9JB 3HE7C 1HYSD 2VC2H 1NC2A 4OZIB 4K3HA 4YUEH 1XIWA 3C6SB 2LVEA 1QO3A 3UTSD 4AQ1B 1SJEA 1KCKA 4BSWB 1VCAA 1PG7L 1MRDL 1NC2D 4Y4FA 3W2DH 3IAPA 3D6GA 1FSKC 1JFQL 2FHCA 3SKOB 1VEOA 3GJFA 5I17B 1LEGB 1U6AH 2NY3C 3IDXL 5EOCJ 3WL9B 2E7LA 1LEIB 3KPRB 2RAMA 1ITBB 1BBJA 1GZQB 4GAGL 4Y4FD 3VH8B 1CN4A 4XPTL 3IU4L 3L5WB 3PP4L 4O2FB 3E2HB 1PKQE 3LQAC 4RA3A 4NGHH 1BJ1J 3MLZH 3ZHKA 4ELKA 3QQ4A 4Y16A 3QBTB 1YECL 4GRWH 1T0MB 2W9EL 4L3EB 5E9DB 3W9DA 4JM2A 4FFZH 3ALPA 4XVJH 4XCYA 3SDCA 5J7CC 1J1OH