1CF8L

Convergence of catalytic antibody and terpene cyclase mechanisms: polyene cyclization directed by carbocation-pi interactions
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
215
structure length
215
Chain Sequence
DIVLTQSPTIMSVSPGEKVTLTCSASSSVSSNYVYWYQQKPGSSPKVWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCLQWSSFPYTFGGGTKLELKRADVAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CATALYTIC ANTIBODY 19A4 (LIGHT CHAIN))
publication title Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
pubmed doi rcsb
molecule tags Catalytic antibody
total genus 51
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cf8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cf8L01
1QFWI 2ESVE 3DV6B 4O02H 1Z2KA 3VWJC 1FSKC 2VQ1A 4OCMC 4XP4H 2AI0H 1DFBH 1JTOA 3B9KB 2QHLA 1D5XA 5D93B 1L0XA 5HYJD 3FO9B 5ICZB 3RWFB 3BP7B 4OZ4B 3OTTA 4EXKA 1BECA 3HE7D 3U48A 2V2TB 3C2AH 3RY6A 2P8LA 4PRPD 1YDPB 2OX5A 1BZ7B 4FTVE 4I9WD 4M7JL 4MJIA 4HUXB 2BDNH 3OAYH 4Y16D 5DDHA 2IC2A 3RNQA 4X5LA 4UV4L 4NZJA 4F8QA 3GSWA 1NCBH 4Y2DA 1NLDH 2ITDA 2X9WA 3G6DL 5FYLD 1A6VH 1ZA3A 3QHZH 2HMID 1CFBA 4Y5YB 3LH2L 3VI3E 3O3EA 4OI8A 3TNMB 4JO1L 1E28A 1MNUL 4PJAE 4XRCB 3OG4B 2K3TA 2P8PA 3LKPB 4JR9L 3KJ4B 2R4SL 1PZ5B 4OSUL 2HH0H 3QISA 4RGNB 5FYKU 5I66B 1WEJH 3ZT5A 1SEBA 3V52H 1I1AA 3VXOB 1JYWA 3EIFA 5B39B 4XCFL 1MUJB 4A6YH 1QBLH 1RIVH 3VGAC 1MCHA 2C5DC 4TRPH 4RGOL 2BSRA 1U8HA 2A9NH 4X7SH 1WIOA 3WS3B 3W0WD 4OKVB 4G6JL 4L4JA 1MCJA 1RZIB 4IS6B 5GS0H 1NSNH 5C2UB 3WNKA 3NFSH 3F7PC 3H3KA 3W9EB 2BRRH 3QUYC 3MACL 4U6VL 4J1UB 1RHHA 4Y4KB 3O3AA 2GCYA 3REVA 3HC3L 4F7CA 5GZOC 1A6UH 4AK1A 2J3SA 2P5EB 3Q1SL 4Y1AB 3AB0B 5C7XL 3MRFB 4LU5H 4W70A 4NFBA 2DM7A 5IHZB 2AP2A 1A47A 2BNUA 1ULVA 3I6LE 4W6WB 5E7BA 2DS4A 4GKSA 4OUUA 2OTUB 4B5EA 1XF5B 2NY0D 2H45A 3MXVL 4U6HA 4F15B 4AENA 2WWKT 3SGEH 2QKIA 4AT6A 1RVFL 2BOCB 1YN7B 3U46B 2UZXB 2X7LA 1BFVL 5DMIL 3JWOL 4QYOB 4OZIE 3WMSA 1MRCH 4N5EC 3D3VA 1G1CA 2PR4H 3LQAC 5CHNA 5CJQH 3KJ6H 4KFZC 3X12A 3T2QA 1LE9B 3CU1A 5KSBA 1N6UA 1REIA 4LCWE 3IB4A 1JPGA 2R1WB 3QZWB 4R4ND 3PWUB 1NCNA 1INEH 2VWEE 5F9WC 1HXMB 5DK3A 1FIEA 3HC0A 5ICXB 2YD7A 4WI3A 3CZJA 4HMDA 2ZUQB 2Y25A 2X4TB 3L5XL 1C5DA 5FYJE 4D0DB 3MBXL 2G5BA 5D1XB 3MJ7A 2YZ8A 3G5VA 4XAKE 2CO6B 5LJYH 1CXIA 3F58H 1J0ZA 4ALAL 3ZYOA 1HEZA 3BX7C 1IT9L 4N8CL 3BYTA 3UDWC 5TDNA 1AGFA 1DUYB 2BVOA 4ZFOB 4YHML 1B0WA 1A2YB 2NY3D 3QEQA 3UJIH 1RUQL 2R2HB 2XY1A 5L0QB 4DW2H 1CGWA 1HHKB 1KJMA 3KPQB 5FHAH 4Q2ZA 1FN4A 1KEMH 7FABH 1TJGL 2R2BA 1IM9B 4KKCD 4OFYA 5HHVL 4N9GA 4PJIB 2JCCA 4K3JH 1T7ZA 1J86A 1G6VK 4ZFZA 5AG9A 2DQDL 15C8H 3QUYA 3VD5A 4LSTH 4R4BA 4F9LC 2GIYA 4GRLA 4AG4H 4EUPH 4A2LA 4OF3A 3I2CL 1MI5B 2HLFC 4GS7B 3VXRD 1T0PB 3TZVB 5K9QG 1M05B 4HCRH 2F19H 5HSFA 2NCMA 2J88H 3BZEA 4NRXB 1NAML 2YEZA 3L3JB 4PJCB 4P5TB 2NMSA 4R3SB 3DXAD 3RX5A 5IF0A 3CSYB 3ULVC 3P11L 5CIPB 1U3ZA 4EVNA 2VSDA 5F1NA 1N8ZB 3RWJB 1MRDH 1BJ1H 3TM6A 5JLZA 5FO7A 3W5MA 3I3DA 2CDEA 3ZYJA 1V3MA 4WI9A 3ZTNL 3C60D 4TUKL 3OAUH 1PX3A 4KDVA 3TWCL 4QF1B 3QO1A 4G80B 4ELMA 5F3BA 3LMJL 4ZUUB 2BSTA 1CIDA 4K2UH 1FP5A 1MCEA 3DRQA 5EN2B 5FYKL 2P24A 1RV6X 5HYQA 1JPSH 1YEIL 1K4CA 1DN0A 4HC1L 3GSNB 3HNSL 2GFBB 5BZDB 4HPOL 5AAWA 4WWKC 1SQ2N 1IFHH 2QLVB 4RIRB 1I4FA 3UTPD 1GC1C 3MRBA 3UDWA 5IBLC 4N0CD 4ZMAT 2EH7H 1FJ1A 1A4KB 3HG1A 2PO6D 1R3HB 3OX8B 3VI4F 1J05B 2E9JA 3NAAH 4IEFB 4EKXA 3UTTD 1PEZA 4QRTB 1P4BH 3SDCD 2EIEA 2PTTA 3ZT7A 4BH8A 3ES6B 2YXMA 1NC4D 2G75A 3PDGA 4TVPL 2I5YH 1ZLSH 5I18L 5L2JB 2EYTA 2GJ6A 4IMLA 2IAMA 4QRPA 4XWOC 1S9XA 5DQJA 4WUKH 5MERA 4MB4A 2PXYA 5GGTH 1RAMA 3BAEL 4NO5B 4MS8D 2F74B 3VFOA 1MWAB 4NFDA 1J1XH 4ODTH 3VG9B 1F3RB 1Q94A 2GSIB 4QTIH 3B9KD 4KJPD 2APBA 1KTLA 3OF6A 1QA9A 4WTZA 4HWZA 3D87B 1A9EA 3SE4C 3HZMA 3DMMA 3WFDH 4LDLB 3TO4A 2W38A 3HAEB 5H94A 2OR9L 4PY8J 5FKPA 9CGTA 5C07D 5F7FA 2K1MA 1U8NB 3MRPA 4CDGC 3MNWB 2XTJE 5ESVB 1HHIB 1KNOA 3LIZH 2Z8WC 1U8LA 3FHQA 5CEZD 1CLCA 4OZFB 3TCXA 2IBBA 1MFDL 1DEDA 3M1BA 1IGFL 2NZIA 5E03A 3LDBC 2DRUA 5IVZB 4JY5L 5GS1A 3MYZA 5C0EA 3RWHB 4U6TA 1B4JL 1EPFA 3BIAX 3ARPA 3BH8B 4HLZG 1SHMA 4PGBB 4XPFH 1Q0XL 3TBTA 3HMXA 3KPLB 3VH8G 5HTSA 5HGBA 4ZPTA 2XN9E 4HGMA 1J1OH 4WWKA 1P1ZA 4DTGH 5IVXA 1UXSA 4L3EE 2DLIA 1G0XA 1OARH 3BGAA 3BUYA 4OFVA 1HOCB 2A1WH 3LKOA 5I15H 3QH3B 2RJMA 3SKNA 2HAZA 1TTFA 4AMKH 1H3GA 5JW3H 4DGYL 1X5GA 4XTRC 1I7TA 4FQ2L 3CXHJ 5L8JB 2EYSB 3BKYL 1ZMYA 5MEQB 1PGRB 1XZ0B 1LO2H 2OXHA 3K1DA 5GGVY 3P30L 3A6OA 4Q0XL 3FAXA 2VH5L 3HI1A 3PDOA 4JFOA 3V6FA 2W1NA 3DO3A 4AQOA 1CU4L 1JP5A 2EDJA 2B2XL 4WRLA 3UX9B 1CVSC 3IKKA 3N50A 3CK0L 4Y4KD 5CD3A 1PJ9A 4YAQA 2P5ED 2OTWB 3IRPX 3C6SA 4M7JH 4C56E 3AU1B 4HF5H 2JJVA 3SE4A 1IEAB 1C7SA 5JXEC 3RIAF 4FABH 2EDOA 3QWRA 5JOFA 2Z4QB 4U1LA 1DLHA 3G6DH 3CH1B 5HI4C 1MCSA 4X98B 4P2RA 1RU9L 3QIWC 4E0RB 3WNMA 2B4CL 3LH2H 4D8PB 1V7MH 4DVBB 1MPAH 3RWDA 4JO1H 2X4SB 5L88L 5EO9A 4P3CH 1MNUH 3HUJA 4MD5B 2IGFH 4XWGL 5FK9B 3U79A 1JTTA 2YD2A 4JR9H 4PGCB 3WHXB 3HI6L 2ADIA 2R4SH 2VMFA 4OSUH 1U9KA 3X13B 4E42A 3VDBA 1E27B 2DQFA 4HEME 5EZLB 2J5LB 4P4KB 4H25A 2YUVA 4MA7H 2IJ0C 3QWOB 2CO7B 4XCFH 2GK2A 5GJSL 2ADFL 1AKJA 1T5XA 1R3IL 1WISA 3W2DL 5FYJH 2DB8A 1ED3A 4MAYB 3EYVA 4M9PA 5BW7A 1ZT1A 3OAZK 4G6JH 5D1XD 4M9OA 3ZKSD 5AD0A 1EEZB 3ARVA 2ILLA 5HHME 4LCIL 3SQBA 2VJXA 1DE4B 1S7RB 2BNRE 2V7HA 1KV3A 5TF1H 1JWMB 5FB8A 2ZUXA 5EWIL 3Q1SH 3RZCC 2ZNWA 3P0GB 4APQC 3JTTA 2ITCA 1IM9D 1AC0A 3QULB 3V5KB 1S9YA 1FQ9C 2E27H 4Y89A 4U1MA 2UWEA 2VXQL 3WBDA 1K4DB 4NRZB 1TNNA 3QNXA 4KDTC 5T3ZL 4PYGA 1KACB 2BVQB 3MXVH 4PJHF 1JWUA 1MI5D 2MHAB 1RVFH 2OZ4L 1I8MA 3VRIA 3PWJA 4WDIB 3TZVD 1U8IA 1A7QL 1HDMB 5DMIH 3O4OB 3JWOH 5IQ7H 1X7QB 1E0OB 5LAXB 1U2HA 4PTUB 1ZLVH 5JXEA 2FDBP 5J1TC 4P5TD 3P9LA 2DLEA 4HUUB 1HI6A 5K9KA 4JG0L 4MNGB 4NZRL 1A6PA 3FONA 1YEEL 3OGCA 1A3RL 2EYRA 1D7FA 1ERNA 1LHZA 3QIWA 1TETH 2G2RA 1P6FA 3HPJA 4FXKA 4HV8B 2XFXA 4D9RE 4NN5B 3MGOA 5I1AA 4NGHH 2FJHA 1H9VA 4NHCL 2BK8A 4YQXL 2EICA 5D7SH 5DFWH 1MCDA 1MIEL 2DD8L 2IPUK 1CF8L 5EO0A 1Q38A 5E8PB 2VLKD 1X6NA 1E4XH 5BV7L 3WYRA 1EEUA 1H5BC 2V6HA 1G7IA 4NN6C 2HRPL 4LQ1A 3IYLW 1S5IL 1K9TA 2EIBA 1U0QA 4PJEA 4PGEA 4QXGL 1T03L 2DWEA 1F11B 2Y5TA 5DD1L 3CCHA 3VI4E 5HHVH 4LBEB 4YHPA 4MQSB 2X4QA 3EFDL 3IS1X 3WNNA 1JI2A 2XWBA 3MCKA 3TGXA 5FECB 2PW2B 3VXTB 3I2CH 3RZCA 3MPCA 4APQA 2CUHA 4X83A 5T3ZE 2O93L 4MDIA 1W0YT 1BWWA 2MPAL 1FGNH 2YA0A 3UBXI 1ZGLP 3T0AA 1NAMH 1SMAA 2YWZA 3R0NA 1A1MB 1XR8A 5C86A 3P11H 2FJGA 1ACZA 1J8HA 4KDTA 1T2QL 3HZYB 4G6FB 4QY8A 3SDDB 4JM4L 5DHYA 1KG0A 3UJJL 3O2WL 3TWCH 5DK2B 3RL2B 1S7SA 2ARWA 5TF0A 4R0LA 2UUDH 4NWUL 3U0TA 1LP9A 4GMTL 5KANG 3DSNA 1BHGA 4UB0H 5J1AA 3LEVH 1WFNA 1YEIH 5J3HD 4UBDD 4HC1H 3HNSH 4C58B 3CFCH 4HPOH 1K8DB 1CFVL 2Z93A 5TE4H 2EIZA 5IMOB 2R1YA 2R23B 4QXUL 3KYAA 1EK3A 3H7BA 5I8CB 1GH7A 3BDBA 3BESR 3V0AC 1UB6A 1UWGL 4RFNB 5I0ZA 2A6DB 1T1XB 1O5DT 3UBXA 4HJJL 5BJTA 5JHDA 1H5BA 5T5NF 4POZD 5E94A 5ISZA 3EYUL 3P4NA 1MJUH 4C55A 2LU4A 2VZ3A 3MRJB 1RJZA 1A7RL 3ZHLA 3FZUC 4AM0A 1G6RA 4LLAA 1FDLL 1QFOA 4R96B 5GJTL 3QJHA 4WUUE 1AIFB 3U7WL 4UTBL 1TJIH 2YD4A 1UZ8B 2E8YA 3ILPA 4HUWB 3QRFM 3NCMA 1K6QL 1L9MA 1UB5A 4JQVC 5HVWA 5E8EA 3EFFB 3BAEH 5FA4B 2H3NA 1RZGA 1NCTA 3BZFA 4RMSA 3IJYA 4NQCA 2SEBB 1FFPB 3WS6C 3CX5J 4QHLA 4X6FB 1SVZA 2Q7YA 1IE5A 3NFPA 5FYLL 5I71B 2DWDA 2IH3A 1NGXB 5CILL 1MF2L 3QCTH 1TZHA 4BM7A 2CLRB 4QHUB 4WFHD 2FATL 3QJFA 2OCFD 1JGEB 4TULL 1LO0H 1NMCC 2B1AL 2IPKB 3R06B 4X4ME 1MAJA 5E8NB 3UO1L 5IB3A 4ZUTB 3C9NB 3MRDA 1MFDH 1KN2L 4L4VB 4Y2OA 3FFCA 4UQ3A 1D5ZA 4L8SB 1P84K 1VSCA 2UY6A 4JY5H 5GS0C 3MLVL 5TDPB 2HFEA 1B4JH 4Z7OF 3NVQA 2RFXA 2XIDA 4PRHB 4PP1D 3CFKA 3EYOB 4CVZB 2JIXB 2RQ8A 4A2MA 4IOFC 2H2PC 1EJOL 1T3FB 1MLCA 3PWPA 3TPKA 5BZWB 1T5WB 3FCTA 3ARSA 2QSTA 3P2TA 3LKQA 1VPOL 4NJAL 1MELA 3FO1B 3G6JF 5ACZB 4P4KD 3DROB 4N8VA 4KK9D 4QHMA 4NNXA 4WWID 5TJWK 4HS3B 5DJCB 3VXUB 1G7MB 3GMPA 4FQ2H 4PRPE 5F9AC 3MLPA 1QFUL 3ARBC 4M62L 1J0JA 4YK4C 4MAYD 1OGAB 3BKYH 4XI5C 3T2OA 4IJ3B 1XF3B 5DQDL 5GZND 4JRYE 4Q0XH 2AJ3B 2VH5H 1OTTD 2VQUA 3IFOA 4JFPB 4DFIA 5IW6A 3RVVD 1CU4H 4S1RL 4JQVA 3G5ZB 4JGJA 3BPOC 2QADC 1TQCC 2ATKB 4ORGA 2VLME 1NUGA 2GW5A 3BKMH 3IXTA 1HHJA 2A0LC 5F96L 5EIIB 1U8OB 3K1KC 4WFFD 1D5BB 3BDXA 3WHE1 3F7YA 4PJHE 1R5IA 5IHLB 3SGEI 3ECBB 5CP7A 4OM1L 1KPRA 3L9RB 2W07A 3UJTL 4LF3A 2ZSWB 5FOJA 3FQNA 3SDAA 4WTWA 3QUMB 4A6YA 1PX4A 3RVXD 2X4OA 3Q2CA 1RU9H 3CMGA 5FM4A 1VHPA 3I84A 4DUVA 3BPCA 5L88H 1P7QB 1UEYA 2XRAL 3W0WE 4JANA 4XWGH 2VXTL 4KROC 3HI6H 5FUOH 4PRAB 3MV01 1DQQB 4P3DB 5MENB 5I1KH 3U6RB 2W9EH 1AD9A 5BRZD 1RFDL 4KI1A 4YDVA 5D8JL 5KS9A 3D39A 1EO8H 1WBZB 2PNDA 3WUWB 4BKLA 1NEZA 4J4PC 4LNRA 2XQBL 5I74C 4POUB 3AXLA 2QQNL 4HGWB 3JZ7A 2UZIL 1YMMB 2WAHA 5J89A 1MY7A 2PN5A 4EBQL 3T0VA 1XFPA 4JDVA 32C2A 3BPLB 1Q9KA 4OLYH 4AJ0A 3T1FA 3QIBA 1KJ2L 4YHOL 4PY7A 4C83B 1DP0A 4KI5D 5HHOB 1A1OA 3K74B 3ARBA 5A3IC 1KLGA 2CIIA 3G04A 3HZKB 3O6FC 2H26B 1R3JB 4I0PC 1P2CB 2Z92B 3DX8A 2NW2A 4WW2C 3F65A 2HN7A 1CWVA 4M1DH 3FAWA 3IDYB 2BVTA 4NFCA 3N1FC 1Q9LB 5T3ZH 2ZUSA 5D9SA 3B6SA 4OD1L 2OZ4H 5JR1H 3QEUA 1A7QH 3TNNA 3GMRB 3OKEA 4QRRA 4JZJB 2A83A 3RDTB 3CXHK 2OMNA 4LLYA 4JG0H 4NZRH 1CDGA 1W72L 4JGMA 1A3RH 5EIQA 4Z9KB 3VFSB 4G6FD 4HUKB 5D2NE 3SDDD 2EDHA 4U31A 3BD4A 1KLUA 3VRJB 5J8OA 3QFJA 2EEDA 2ARJB 4YQXH 2HT4C 5TDOA 1T04B 3L3OA 4BFBD 4G8GB 1YC8A 2DD8H 3T0WA 4EUPA 2F5AL 1OQOA 3WXWL 1GJIA 5BV7H 4OJFH 4PJIF 4XPBL 1HZHL 4XCCH 2HRPH 3VFGL 1CXLA 2HA1A 4HCRA 4MD4A 3GMNA 4QXGH 1MY5A 1J5OL 4JRXE 1UACL 2NTFB 4XP5L 4I13B 1R5VA 3MMEB 4LSSL 4LLQB 4MX7A 4G9FA 2DICA 3ESUF 2VITB 3OBAA 5I1DA 1IGYA 2X70B 3KPNB 1WICA 4HAFA 4IHOA 3O6FA 4FS0A 1L7IL 4XNUL 3AS0A 4PJBF 4ZAKA 4M93C 1FZOB 3MUGA 4L9LC 3VFUA 2EXYD 4I0PA 1X5FA 4U7MA 1AP2B 4Y4FC 1GGBL 3MOBH 2PYEE 4WW2A 4GKNB 4U6XB 3LQZA 1H3UA 3KYKL 5D7LA 1Y0LA 4J3SA 1NCCL 3GSOA 5CEZL 1T2QH 1WWWX 3IDNA 3N1GC 5C09A 5EU4B 4RNRA 1A0QL 1PSKL 5IBUG 1KCSL 1FL3A 3VWKC 5E2TH 4OBSA 2MCG1 2DQTH 4NBXB 4XX1G 5KN5A 4X6BB 4NWUH 3UTPE 3QDGA 2R9HD 4GMTH 1TZIB 3OR6A 3B8YA 3TBYA 2EDLA 2FNBA 1ZGLA 1P5UA 1OTSC 3H6JA 2G60L 1WZMA 4HK0A 3CSGA 3PV7A 1NDMA 4Z7OE 5DZNA 1HYRC 1D9KB 2X4UB 5GGVL 3L5JA 3VDAA 3H9SB 2EKJA 3B2UD 4NPYB 4ZUVB 4GAGH 4L4VD 4XCNA 3FO0L 4QXUH 4XVTL 5C6TH 5ICYA 4PPTA 2Q7NA 4CMMB 2ESVA 3TV3L 4PLNC 3IETA 4HHAB 4PJGB 5IB2A 1UWGH 4XNYL 4KK6C 3RRQA 2IWGA 4PJXB 5GGTA 1PD6A 4OT1L 4PRHD 1BQHB 2HG5B 3JSSA 3F7RA 5DMJB 3D69A 1A7PH 4YNYA 2MQCA 2JIXD 3G6JE 3KPOB 3OKKA 3SKJL 1A7RH 1KCUH 5J13B 4UIMB 3S5LG 2R2CA 3I02A 1FDLH 1T80A 5GJTH 3RVUD 3QIUA 3DYOA 3U7WH 2A77L 4UTBH 5J12B 1KPUA 5F7EL 1PQZA 3NABH 5C07E 1CGSL 4FN0A 4FTVA 2I27N 2YD9A 3AM8C 2DBJA 3VXUD 1K6QH 3BH9A 2EECA 1GPOL 1ZHBA 2ZZUT 4PJ9B 3WIFB 1DTUA 5CEZE 4JZOA 4L9LA 3EYFB 4DWHA 4HUVA 1OGAD 2FWOA 3FQUA 1MFEL 2NZ9D 4FG6C 1HE7A 5DHVB 1DQLL 3SQOL 5CWSB 2ZSVA 5D5MB 4NQSA 2BSSA 3PL6A 4KV5F 4TUOB 3RBSA 3IAGC 2AQ2A 1RMFL 5CILH 1MF2H 2VDPL 3JV0A 2VWEC 4U1KA 5IM7B 3T09A 1IC7H 2AXJA 1Q0YL 4PJAA 2Z35B 4K9EL 4RX4D 2WIIA 5DMYA 1CFTB 4OIBA 2B1AH 1T20A 5GS2H 2Z0BA 3T0EB 1IAOB 4X4YA 1YEDB 3QG7L 4PJFF 3BUTA 2GEEA 5BVPL 1KXTB 3EDKA 1AGCA 5FEBA 2GHWB 3QPQC 3MLVH 4UINL 5FF6A 4QTHB 1ITBB 3BD5A 3KYMB 3PDDA 5I1EL 5FGSA 1LQSR 3DWTA 4S2SA 3KDMB 4MQ7A 1WVZA 1X3DA 5D1ZC 1BQSA 1PY4A 2VL5A 1J11A 1QKZH 3A6CL 1QRNB 1QPXA 4KPHL 2HT3C 1P7QD 1QPPA 4X0KA 3TBVB 4WI8A 3OKLB 5C0DA 3DO7A 4I3SH 4ZFOL 1X5IA 1VPOH 1K3ZA 5D72H 1K2DA 3HB3C 1A6WL 4QRQA 2V5MA 5MEND 4OM0L 2DQJL 4QHNB 2YK1L 1IGCL 3T4AA 4Z76B 3TYFB 3IGAA 3Q3GB 2P5EE 4LVHB 1QFUH 4ZYKA 3WLBA 3JWOC 5TQ2L 1HILA 3ARFC 1LK2A 3IRZA 5DQDH 2IANE 1U36A 1YMMD 2CLZA 2YSSA 3BIKA 2OTPA 3DVNA 4KMTH 3IKCA 1RHFA 5BOPA 4U7SA 5HD8C 3AM8A 4Q58C 4M7KL 3MA7B 4LCUA 2H9GB 1F58L 3LKRA 3BP4B 5HHOD 4OZIA 1MH5B 3P4MB 3PP3K 2M2DA 4Y4HC 3T4YB 1KB5B 5KSUB 5F96H 5B3NA 1FRGL 4JAMA 1T0MA 3K4AA 4LLUA 4XPTL 4LCWA 3GMMA 3GRWL 1LEGB 1TVBB 1X9QA 2ZOKB 3UJTH 5HDBF 5GQBA 5F1KC 1J8KA 4HLZH 4U1IB 1ZT7B 3IDJA 4LFHD 2FX8L 4MNQB 5GRJH 1F6AA 1FNFA 4O9HH 1OF2A 5E6IB 5JORB 1PLGH 3ABZA 5CCKL 4LCYB 3HKFA 3TA3C 4ZS6D 4YDIL 3DSFL 1SM3H 5EZIL 3RDTD 4Z7WA 4HXBL 4LAQH 3F6IA 2NY2C 2X40A 2VAAB 3MRMB 1XIWC 3JV6A 5CJXC 1BD2E 2ZKHL 3GSNL 3DVFA 1RFDH 5HY9B 3ARRA 2F15A 5D1ZA 4KH2A 5F93C 4I4WA 3V0VA 4H1LH 1A14L 2AABH 5DD3L 5F6IC 2XQBH 1TFHA 3HPLA 1E4XI 4EI6B 4ODUA 4PJIE 4H8WH 3E0GA 1E4KC 4OBRA 2UZIH 2IMNA 5FA3B 1I7ZA 3QNYB 1OAQL 4G8GD 5DVLA 2APFA 4YBLC 5E5MA 2X44D 2IH1B 3FQXA 1W0WB 5I76A 2FSEA 3HS0B 4YHOH 1VADA 1J87A 4ZG1A 1EGJH 1WJ3A 1FVEA 1RIUL 3DPBA 1JMZA 3JXAA 3ARFA 4UOW1 1KENH 5ESQA 4XZUB 3BRFA 3INUH 2AV1A 3G5XA 3QUXA 4X99B 4LP4A 4L8BA 5FCUL 4PJBE 3WKMH 5HDLA 2XTJC 3EJYC 1B2WL 1MWAL 5DZOA 5CEXA 4QLRA 2EZ0D 4DOHE 4UNUA 5KG9B 1JBJA 1KBGH 3DX6B 3EJZC 5INCB 4KUCF 3WDHA 2E6QA 4XMPL 1WSST 1FNGA 3THML 1KT2A 5HHNB 4FZ8L 4O2EA 1FL5B 1RZ8B 3GMOB 5EC1B 1PFCA 4X6CB 4MNHB 1FCCA 1Y18A 4IRZL 5DI8B 4QT5A 2W0FB 3DECA 4P59L 4GW1B 4H26B 4AEIL 3UTZB 2NY6C 2VLKE 1EHNA 3KYNB 4BZYA 1PDKA 5IIEA 1DL7L 1S78C 4MSWB 1FGVL 1IRAY 3G5YB 4HX1B 5DJ0B 4Q6IC 4KI5F 5EUOF 2FECI 5GSRA 3GIVB 3IFPA 5K33A 3VFRA 4M6MH 4JKPL 1XIWA 5CJXA 4AEHH 2X42A 3WXWH 1DDHA 1KYOJ 1GZPA 1ZHLA 3UROR 1HZHH 2EDBA 2YD3A 3VFGH 2XKSA 5JNYB 5F7DB 1D9KD 3H9SD 3U4BL 1NAMA 1SBBA 4FQXC 1PZUB 2IEPA 1SVCP 3KYOA 3MCG1 2I07B 4XP5H 2FR4B 2Y23A 3MO1B 5GHWL 2P46B 3ZL4L 2XA8H 3DHJA 4MWFA 1U2CA 2FEEL 2HKHL 1NGPH 3FB5A 4WTXA 3V4PH 5FDWA 3SJVB 3WFHA 2FHCA 2HJLA 5E2UL 3ET9F 4X5WA 4KHXL 4XNUH 5CZVL 5SWSE 3SO3C 4L1DA 5ACLA 4NKOA 3OHXA 2OJZL 3KPSB 1T1ZB 5C0BB 1FZJB 1GYAA 3KGRA 3F12B 4NZDA 1E4JA 3LB6C 1GGBH 3B4NA 5AZEH 1ZHNA 1QTYT 4JN1L 5F9OH 5T1KA 5CEZH 3AAZA 5I17B 4KV5E 5F6HI 4HC1A 4PJ9D 4YHKL 3OKYA 3FQTA 2DBLH 2CR3A 4F2MB 4NYLB 1FL6B 1PSKH 3SY0A 2BX5A 1KCSH 1EBAA 4JM2F 3I6KB 3BYYA 5ALCL 1FFOB 3MRQB 4WGWB 1KCLA 1NAKL 1TQBB 3ARDB 2XN9A 2Y6SC 4PJFE 1U8MB 2ARJQ 3O11A 3KLHD 2E7LC 4X4XB 4YWGH 1P53A 1X5YA 5GIRA 1YYML 3MRLB 1XGUB 2AERT 3BD3A 2JJTC 3T0ED 5DMKA 3QFDA 4Q6IA 5GGVH 1EFXA 3BO8A 5AAMA 4D0BA 1VFBB 2BVYA 3FO0H 4KK8D 4K3HA 4TSAH 1SYVB 3QQNA 3QT2A 1CR9L 4CUCA 4L8CB 3D85B 5DUBB 3E8UL 1YPZB 4OGZA 5H35A 1C8PA 3GNML 4MGXA 4XNZC 3SKJH 1QRND 4N0FA 2FRGP 2GAZB 2LVCA 5DHXB 4NP4L 5JOEA 5C0AB 5EU7E 1CGVA 5T1MA 3SBWC 4S1SH 4PREA 4YFEA 3QHFH 2MQ3A 5GISL 3BVNA 3U30B 1MCBA 4RWYL 3MROA 1T6WA 1TVDA 4Z0XA 2B1HH 4C56A 2B4CC 1GPOH 3V8CA 3L5WB 4HWBL 1BREA 3GKZA 3MV7B 1N6VA 4WU7B 2YZ1A 25C8L 4ELKB 3QQ9C 4NKQB 1DQLH 4IMKC 1VFMA 2QQLL 3DETD 1C12B 3DX7B 3NCBB 3U4EB 3ROOB 3WE6A 1NC2B 1G1YA 4TUJA 2GK0A 2NY7L 5IBTL 4EOWL 3X3FL 2E6PA 1GZQB 4BYHA 3QI9C 5HDBE 1WWBX 1J10A 3VXSB 2NXYB 2O5ZH 4N68A 2Q20A 2XKUA 4OF8A 5HPOA 2DKUA 4LSUL 2QHRL 3VGGA 2OI9B 2E7LA 3L3IB 3RU8L 2Z31D 2WK2A 5CD5D 4PLKC 3TO2B 1JYNA 4B7IA 3STZA 2JJTA 1EUTA 4FXLA 4JFQB 1CFNA 3UZQA 4R2GD 4FFWC 2L7JA 4KKAC 5DSCA 2BNRA 3PIQA 5I8EB 5KSAC 1P4IL 1JPFB 1A6WH 3SKOA 2YKLL 5TFSL 4OM0H 2WUCL 4DFHA 5GGUB 1Y6NR 1ZWIA 4FQLL 4MJ5A 4GXUM 4JO4L 5B38A 2DMBA 2FL5A 3QO0A 2J6EL 1FZKB 1I3RA 3SBWA 5TQ2H 3QCUL 4CMHB 4BFEA 5F1SA 3QDME 3D18B 5EBGA 3DBXA 3CVHB 5FOBB 4B0MM 3D0LA 4CU6A 3S8WA 4LHJB 1S9WB 4XX1E 4M7KH 3AS2A 3WO4C 1AI1L 1EAJA 4JPVL 4YC2B 5F8RC 1QLRB 2VL4A 3SDXF 4LAJH 1J0KA 4OF6A 4OLWL 4WENB 5HYFA 4IMKA 2WBKA 1FRGH 2WBJC 2Z91B 3TEUA 4P9MH 1WWAX 2PCPA 4XPTH 4XHJD 5ADOL 2UY7A 3GRWH 1DN2A 3MJ6A 3EHBC 3HTLX 1KELL 5BRZE 2AK1L 5B21A 4FFVC 2FX8H 1HHGB 5BV7C 1Q72L 4Z6AT 2EDNA 3CGTA 3RVTD 3UTQB 3GSUB 4JFDB 1QSFE 4YDIH 3MC0A 3KAAA 4G43B 4JQIH 1LO5A 4W6YB 4S1DD 4HXBH 2FIKB 3DNKA 1QFWM 5E00A 4R9HA 2ZKHH 4KJQC 5I16A 4KI5E 5EUOE 2BNQB 1DQJB 4G8IB 5CGMA 3EYQC 1A14H 5C0JB 1RIHL 3BZ4A 3EO1B 3QUZA 4BSWB 3SKMB 4ZODA 4XC3L 1A3LH 2O5YL 2WP3O 3HNVL 2JF1A 4ZO7A 1CLYL 3R0MA 2FGWL 2V2XB 4HJGA 5TH2A 2OZ4A 1F3DH 3U9UB 4EI5A 1F3JA 3HNTL 3CFBA 3PXHA 4N0UB 4DN3L 5F1IB 2WINB 2X5PA 1G9EA 1OP5K 2EDKA 4N8PA 2R1XA 3F7VA 1A8JH 1S7UA 1B2WH 1MWAH 5T1LB 3NCYP 2NY5L 3IFLL 3I75A 2MMXA 1A02N 2W9DH 4J3WA 3GBNL 3SJVD 3KR3L 3UEZA 5C8JB 1TTGA 3S5LB 4DKFH 1RJYB 4RMWA 1CICA 4R97B 2WBJA 3KPSD 3THMH 1MCQA 5C0BD 1PY9A 4FZ8H 2W92A 1UKSA 5CZXD 4M7LT 1YMHB 5T5FH 2F54A 3ALPA 1GL4B 4NKMB 2VB5A 4IRZH 3S4SB 5EPMB 4I48B 4P59H 2EC9U 4AEIH 1RULL 2NY1B 2HJFA 4DVRL 2XKNA 3MRRB 1CYGA 4PTTA 1QEWB 5I75C 3EOBB 4ONHA 2C7UA 4NZTL 1I7RA 4RISL 5IJKC 1MQ8A 4XBGA 4OTXL 3GBMH 3C5JA 1QP1A 1NKRA 1N64L 3T65B 1EVUA 1DSFL 2HJKB 3ARDD 4JKPH 4XH2A 1NCDH 2YBRB 4JN2B 5HHPA 5JW4N 3BQUC 1XCQA 4JFFD 5EG6C 1A6TA 1VA9A 2FZ3B 4Y16C 5CLTA 5IB1B 4U1HB 3JUYA 2VLRA 3U4BH 5J56B 5I1IL 3PGCB 4WV1C 2F8OA 5D96C 4XVUD 5HVGB 2HMIC 3D85D 4OV6F 5K9QI 2WIMA 4HDIA 3LN9A 4Y5XC 2I60L 3DV4A 1FC2D 4QHKJ 5E2UH 1GGCL 4KHXH 4LSPL 3LKNB 4DZ8A 5F89A 5C0AD 4F7MB 2IG2L 1BZ9A 1SY6L 1MVUB 3U82B 1A5FL 3WLWD 5DC0A 2P44B 4JN1H 4XCEB 4BK4A 4X4MA 3SGJC 1HSAB 5DJYA 5CLWA 2V7NA 4WJ5B 1BEYL 1AQKL 1KFAL 2YD6A 4I77H 3TBSA 43C9A 3MRCB 5H37H 3MV7D 1U92A 1QG3A 4M7ZB 2DM4A 3TT3L 4CDHA 4CU8A 2VXVL 1IGJA 1VGKB 2B20A 2CKBB 4UAOC 3WFEL 5FO8A 5BQ7A 3QDHA 2WUBH 1IGML 2A74B 1T21A 5ALCH 2NNAB 1NAKH 4P4RB 4PRBB 5DJ8A 3IDMA 3U7AA 5LQBL 2YHGA 3FB6A 3D0VB 2GY5A 1NC2D 4HBCH 4L4TE 1LD9B 2E9WA 3MV8B 3RWGA 1NBZB 5IGXL 3NZ8A 1YYMH 3FMGH 5IK3A 4P2OD 4G3YL 1PG7X 3T3PF 1KJVA 3VXSD 2NXYD 5IJKA 2Q86B 3NGBC 1RJLA 3TT1L 5IR1A 4UU9B 5ECJE 1IEBA 4IOIB 3ULSA 1OLLA 1S9VB 3L95B 4G6AD 2X2YA 2NY0C 3U0PA 4H88L 3DUUB 2N4IA 4OD2A 1XT5A 1BFOA 3E8UH 4WHTB 3BQUA 3U4AA 3W82A 5E0QA 1ZSDA 4MCZA 1MJ8L 4JRYA 4MVBD 4ZDHB 2NR6D 1OGAE 1T89C 1S7VB 1K5NA 3CFJA 1NH6A 4QXTA 5JIIA 4IRJA 4WV1A 3MV11 4KMLB 2XACC 4MZ3A 1BF8A 4UNVA 4G9DA 4MA1B 3D2UB 3O6ML 4X7DC 3KPTA 4G42A 5IB4B 4R4NC 4RWYH 4BFIB 3X11A 5CBEA 4Y5XA 5J0BA 3RJDA 2DN7A 4NUJB 1F4HA 3C8KA 4PJHA 4MD0A 2CRMA 2I24N 2C4FU 4CW1A 4YDKL 2EDQA 4G8FA 1HH9A 1KYOK 3SDXE 3FTGA 2APVA 3U9PH 2KZ1B 2NY3C 1KEGL 5D2NC 3SGJA 3WUZA 1D5XB 2D7NA 2OK0L 2NY7H 2ADJA 3KPRE 3W0WA 3X3FH 1ADQL 4KKCC 3C09C 3NCEB 4IDJH 4ZFGL 3EO9L 4LPTA 2AAVA 1C1EH 1IC1A 2P8LB 2X89A 3K7UA 4NBZB 4LSUH 4MJIB 4I2XE 4W6XB 5BMFL 3DTXA 5DRXA 3RNQB 4R7DA 1AR1D 1ES0A 2OJEA 2P5WD 2ITDB 3LS5H 4HKZA 1ZA3B 4JFDD 4URTB 5I6XC 1GOGA 3O3EB 4QRUA 3G6AB 4UDTA 3GHEL 1BIIA 1E28B 5AWNH 5EOQL 1KB9K 4M61A 1P4IH 2P8PB 3PNWA 2HP4A 1AHWC 1SEBB 3C60C 1I1AB 2V2WA 5IJVB 1T89A 3PUCA 3Q0HA 5HYIA 3E2HB 5C6WH 3QCUH 3Q6GH 3PP3H 2BSRB 5KW9H 1U8HB 4XBEL 1HCVA 5T3XD 3PABA 3LOWA 2Y9RT 3P4OA 3VFTA 3DX9A 5EU6D 1Y6KR 3VH8A 1AI1H 2DDQH 1IJ9A 4GJTB 2C1OA 3BWAA 1RHHB 5KTEH 3O3AB 2GCYB 3REVB 1FSKB 4F7CB 2O61A 4N0CC 4I0KA 2P45B 4Q74A 1B3JA 5D2NA 1A7NL 3BKCL 2X1XR 5CBAA 4MJ2A 3OPZL 5T1LD 1AGBA 2BNUB 3MUY1 2AK1H 4H1LA 1P6AB 1Q72H 4GKSB 4OUUB 1B88A 2OM5A 3IXAA 2N7AA 3MRIA 3W11D 3O3UN 4KTDL 2QKIB 5EOTA 3H8NA 4UMGA 2YC1A 2CUMA 2X7LB 3OB0K 4FFYH 4MS8C 1FNLA 2NY1D 2BOBA 3D3VB 5C0IA 5CUSL 1BJ8A 4PG9B 1NFDF 1EGJA 5EDXA 5CHNB 5F88A 5GGQH 2W0KA 2A6IA 4U1NA 1TTUA 4KJPC 5KSBB 4JRXA 1JPGB 4OQTL 4GRWF 1MFCL 4V1DE 2CGRL 3MUZ1 4NQDE 3RWEA 3HC0B 4ZPVA 2LU7A 3AY4C 1C5DB 1AHWA 2G5BB 3MJ7B 4XC3H 3G5VB 5ETUA 1CLYH 5ITFA 1HEZB 2JJSA 4CGTA 3VFWA 5TDNB 1AGFB 5I30L 2BVOB 4FQ1L 1UENA 5FO9A 4I5BB 3MLXL 2PYEA 4O4YL 4ZOCA 2QR0A 3QEQB 5DA0B 4O2FA 3QUKA 4OV5A 1HSBA 4NO3A 4ODWA 4ODVH 3UC0L 1OD9A 5GRZA 8FABA 4Q2ZB 1FN4B 1OP3K 5I1CL 4LLWA 1W0VA 1RY7B 5LCVL 2R2BB 2FEDD 4FFZL 2LFGA 4N9GB 1FO0H 2JCCB 3RPIA 4BJLA 2NY5H 1KXVC 4ZFZB 5F7LB 4X6CF 3QUYB 3I3EA 3DRTA 3KR3H 1F2QA 4R4BB 4GRLB 1MCNA 3V5DB 4O5LH 4RMTA 4WHYH 1IAIL 4KZEL 4NQXA 2R39A 1OW0A 2VLLB 3LPGA 1L0YA 3N85L 1QLEL 3LEXA 1R0AL 1X5HA 1FPTL 3BZEB 2YEZB 4DKAA 1ZANL 5IF0B 2WLYA 1KIPA 3SN6N 4LPWA 1AFVL 2D7TL 5F1NB 5D7KD 4EVNB 1NC4A 2RR3A 4JPKL 4OLZL 1TXKA 5JLZB 5FO7B 1X6LA 3H9SE 4NZTH 4FP8L 2GITA 2CDEB 1BBDL 2XWTA 3R1GH 5IMMA 2JJWA 1N64H 4FXGA 4JDZA 3DOSA 3QG6A 3QO1B 2WQ8A 4Q97A 1B4RA 1DSFH 3G6JA 5F3BB 3RWIA 1LDPL 2BSTB 3O4LD 3MV8D 3DRQB 4ETQA 4XT1C 3G08A 1OAUH 1NMBH 3V0WL 2Y5EA 1WCBA 2P24B 4C4KO 3EOTH 5HYQB 2X10A 5KVGL 1K4CB 1DN0B 1HQ4A 5C0NC 1P7KA 4TSCL 5C07A 1EH9A 5I1IH 3TVMA 3AY4A 4XP6H 4GKOA 1KN4H 1I4FB 3MRBB 4K9EC 5TE6L 5K59E 4D9QE 2I60H 1G7LA 1GGCH 4H0IA 4LSPH 3HG1B 1WAAE 3U83A 1ORQA 1SY6H 2NX5E 4NM8L 1A5FH 4NCDA 3D2UD 4LHUG 2PTTB 2R0WL 4BH8B 2I9LA 1J0HA 2WWMD 2G75B 3NTCH 1PG7H 2DQHL 2EYTB 5A40E 1KB5L 2GJ6B 4IMLB 5AG8A 1BEYH 1AQKH 3CJJA 2IAMB 4QRPB 4P9HL 1JF5A 3MQIA 5KANI 1S9XB 5DQJB 5MERB 5D1XC 2PXYB 2X1QA 2YPKB 1C08A 3VFOB 3TT3H 1Z5LA 3GI9H 5DJAA 3L5IA 2NYYD 3EZJB 4NC2B 4I8DA 1IC4L 1KTLB 4JZNA 1QA9B 3OGOE 1T83C 3OR7B 4HWZB 5L0QC 4FNLL 1A9EB 1JZ4A 1CK0L 3HZMB 3DMMB 1CG9A 3TO4B 5H94B 2J8UA 5FKPB 1X4YA 5JHLL 5IGXH 3H9HA 3MRPB 3S9DB 1I85C 1KNOB 3W9DA 2VZOA 1QBAA 4DAGL 2H32B 1U8LB 3TT1H 5C08D 3CSBA 1OL0A 5L7XL 4Y19E 2QTEA 3NPZB 1FORH 4MJID 2X9YA 3M1BB 2P5EA 3IFNL 4GS7C 3T2NH 5GS1B 3TZVC 4MHHG 1FH5L 2IANA 1DBKL 4ACPA 4K8RD 1MJ8H 4M03A 2FBJH 3I50L 3TBTB 1U41A 4P5TC 3P3YA 5HGBB 1MEXL 4ZPTB 5DVNA 1UWEH 5IVXB 3O6MH 3EYSH 1UXSB 2ENSA 2VDLH 3BUYB 4AIXA 5JPNA 2CH8A 3LKOB 3KWWA 2AJSH 1I1AD 3UTSE 1A6AA 3SKNB 4H20L 2NLJA 3O6KL 4KKBC 3QAZB 1VEOA 5EZJA 1I7TB 4O58H 1CDUA 2X1OA 4YDKH 3AC0A 3WL9A 5DUML 1V3JA 4UIKL 2V5TA 4AY0A 1N4XL 4RA3A 2J7LA 1M4KA 5ICXA 3DGGA 1L9NA 3NACL 3PDOB 4JFOB 3V6FB 3MJ9L 2QL1A 2VABA 4F9PC 4GQPH 5HI5C 4ZFGH 4YJZL 4HWUA 1CI5A 5CD3B 2DMKA 4YLQT 1G7QA 2C26A 2ORBL 4CADA 1J0YA 3C87A 4YAQB 3JTSA 3MRGA 4ZFOA 1BD2A 3C6SB 4IRSB 2PYFA 1LDSA 3RX8A 1T83A 2XT1B 5BMFH 2WZPD 5L2KE 1B0GA 1CS6A 3Q5TA 5K93A 5JOFB 4PJIA 4U1LB 5DA4A 1DLHB 1I85A 4P2RB 4I18A 1NFDE 5T33H 2K9UA 3B83A 4ZFFA 2VDRL 3RWDB 3GHEH 3IDUA 3S37L 2AW2A 5EO9B 1TVHA 4F3FA 3HUJB 4GRWE 3GIZL 3LDBB 1EJ6A 3JV4A 3MFFA 3PHQA 2ADIB 3OXSA 4E42B 2W65A 5F3HA 1M05A 4L3CA 2DQFB 4LRNH 1AXIB 4H25B 2WWKO 3CLFL 3L3JA 1G7PA 3L1OH 4PJBA 1T5XB 3GRWA 1ED3B 1A21A 1SEQL 4Z78B 4XBEH 3EYVB 1F4AA 1MFBH 1ZT1B 4D9LL 1VESA 2MCPL 2LU3A 3SHSA 3A67L 3HZVA 3S37X 5AD0B 5ITBL 4HK3J 4KZDH 1Q9WA 3IU3A 3LQAH 2ID5A 4N1EA 1NJ9A 2KDGA 3HR5A 2V7HB 3OZ9L 3IDGB 3KHOA 2VDQH 5FB8B 1AE6L 3RUGA 3PG2A 4UOJA 4X6CE 4OLXH 5D7IF 2VLKA 1HHHA 1HXYA 1JN6A 3JTTB 2WLZA 4POZC 4OFYD 1A7NH 4Z7VF 2YPLE 1NDGA 1QVOB 3D25A 3GJFK 1BVKA 4PLJD 1S9YB 4NIKB 4F9PA 4U1MB 2UWEB 1CXEA 3QUYD 4XVJH 5E1AA 2VISA 4S1QL 3CZFA 3QNXB 4GRLD 5GZOD 1IAMA 3MV9D 4BSVB 1JWUB 2A9MH 1I8MB 1WF5A 4K23L 3VRIB 1A4KA 2FH6A 3PWJB 2BHUA 1U8IB 5DEGA 4G7YL 1L6XA 1KCRH 3PWNA 2BC4B 4MAUH 3P9LB 4MJ4A 3AREB 1HI6B 5K9KB 3N06B 3FONB 3VFPA 3C5ZC 5EU7C 1YQVL 3HFMH 2EYRB 3K46A 3QIWB 1WITA 3K2MC 2G2RB 3HPJB 3ZDZF 4FXKB 2XFXB 3MGOB 5I1AB 2FJHB 5JA8B 1S8DA 4AH2B 2IQAA 2F74A 1YNKL 2VN4A 1MWAA 1T1WA 4N5ED 5JTWA 1ZHKA 4Q9QL 5DD0L 4QRSA 3FRUA 5SWSA 4OCRL 1OP5H 3SJVE 3PWLA 5EO0B 4Q9RL 1JF1A 4LPCA 4X7FC 3MNVA 4Z95L 5I30H 4FQ1H 4N9OB 3IDIA 3ORJA 3HE6A 1NPUA 1G7IB 2FEEI 4JY4A 4KQ4L 1U3JA 1QBBA 4YEFA 4PJEB 4PGEB 3L7FA 1WTLA 4KXZH 5DJ2A 5I1CH 5DO2C 2DWEB 3O3DA 4FFZH 2Y5TB 3LS4L 3CCHB 4YHPB 1JRHH 2RIKA 1A1NA 2X4QB 5I8KL 3MREA 3UCRA 2XWBB 3MCKB 4X6EA 4Y8DC 4R8WH 3HG1D 35C8H 3EKCA 1CXHA 1IAIH 3RZCB 4PJFA 4APQB 4G8EA 2X05A 2JK5A 4MDIB 3S98A 4U33A 5DRZA 1QLEH 1OT2A 3DHMA 4NNPL 5BVJA 1R0AH 4R4FH 1I3VA 3TH4T 1O0VA 1E6JH 1EEYB 1ZANH 1MRFL 2GJ6D 4JFFE 1AFVH 2FJGB 1J8HB 2IAMD 4QRPD 4F37K 4JPKH 1HOCA 4OLZH 5GZNC 2PXYD 1OTTC 5IWLC 2HLFD 2WW8A 3AFLA 3DUHA 4QY8B 4FP8H 2VRAA 5DHYB 1CD1A 2J12B 4K71B 1BGXH 5D71L 3RVVC 4PB9L 4MMZC 4QWWD 2DQIL 1U3HA 4N0YH 5I1HH 3ARGA 1S7SB 2DOCA 3OF6D 1I9JL 3LAFA 3P0YL 4R0LB 2CIKA 2ED7A 4LRIC 3U0TB 1LP9B 3DMMD 3C5ZA 1LDPH 3TO4D 2CDGA 1KC5H 3EJJX 5J1AB 4HFUL 5JW4R 2ERJC 5KVGH 1F6LL 3ZKXC 1X44A 4TSCH 1JHTB 4P2QB 3RVXC 2QSQA 3L7EB 3I85A 2CLVA 2EIZB 2R1YB 1OAKL 1JGVL 3H7BB 5DD5L 1HKFA 4QGYA 2J2ZA 5D7JC 1UB6B 3ZSSA 4RQQA 1J1PL 2CRZA 3O4OC 3I9GL 1XGYL 5I1LA 4OLVL 1YN6A 3UBXB 3MV7E 5BJTB 3FHAA 5JHDB 1H5BB 2VXUL 3DLQR 5ISZB 3P4NB 3VXME 1RJZB 3TIDB 4W81A 3DJ9A 2AEIT 5I2IA 2JKXA 4AM0B 2DL2A 1G6RB 2DJSA 4YIQA 2R0WH 3QJHB 5GRWA 4HIEB 2AS5M 4NN5C 3MA9L 5FXCH 2BMKA 5A2KH 2DQHH 1CDBA 1KB5H 2GTWA 1X5XA 4XAWH 3WHXA 3ILPB 2BCKA 1HIML 1UB5B 4RZCA 5E8EB 4CVXA 2H3NB 1RZGB 2Z8SA 2DJ4A 4ODSH 4TNVK 3IJYB 4NQCB 4QHLB 4KI5C 1IC4H 3NFPB 2X6MA 1N6QH 3W5NA 4MQXC 4KQ3H 4FNLH 2DWDB 2IH3B 2R4RL 1TZHB 1IGIL 4XWOD 1FLRL 1MLBA 5IWLA 5D2LF 4HMEA 3QJFB 3VFNA 5F72S 1IM3A 1EX0A 4IRSD 5IB3B 3MRDB 4WFGE 2ZPKL 2ZCKL 3LKSB 1S7WA 4KGLA 4JHWH 5ENWA 3IFNH 3FFCB 2DLFH 4UQ3B 1D5ZB 2DKMA 5SX4H 3QWRD 2CRYA 3QULA 2HFEB 1ZT4A 1FH5H 3QDMA 2HTKD 3FT4A 5JPMB 4J23A 1V8HA 2RFXB 3I50H 4P2RD 1MIML 3VD9A 5T3XL 1K4DA 4JFEE 1MEXH 4GRWH 5JW5B 1MLCB 3PWPB 1UA6H 4KU1A 1CGYA 3FCTB 2MHAA 3SDDC 3LKQB 1MFAL 3L3KA 5D7JA 1I9RL 1JPTL 1GOHA 4PR5A 1I8LC 4UQ2A 3WDJA 1R24A 4N8VB 4QOKB 3TF7C 5LAXA 3FL7A 4NSKB 4QHMB 4NNXB 1NLBH 5TPWL 1CTNA 3GMPB 1B0RA 4MCYA 5L8LB 2OS7A 1I75A 3VGFA 4F37F 2V9RA 4LLVA 5BRZA 1DR9A 1S7TA 4JM2C 5CMAB 5DUMH 4UIKH 2X4PA 1MQKH 4M6NL 5D7IE 3NACH 4XB7A 1QSFA 2P5WE 5FIEA 4BZ1L 4Z77A 5IW6B 2AV7A 4OGYL 1CBVH 4Z7VE 2AJVL 4GW4A 3TPUA 3HRZA 4JFDE 1VKXA 3CFIC 2BY3A 4ORGB 1SJHA 1NUNB 1KGCD 3JWNC 3IXTB 1HHJB 2HFTA 2JB5H 3AROA 5EUOA 5B3JE 3F7YB 1R5IB 3TC9A 2VXSH 4DEPC 5CP7B 1JFQL 4JFXA 1KPRB 3F5WA 1F11A 4LF3B 5DRNA 3FQNB 3SDAB 4A6YB 4BH7A 2PTUA 1NCAH 1K3IA 5C0GA 4LMQI 2CXKA 3KXFE 4FQCL 3V4VL 1EHAA 5D6CA 2VDRH 4GLRH 3BPCB 3HC4L 3S37H 5BS0B 5T3XE 2P7TA 3RVWC 4BQ9A 3MZTA 3GIZH 2AEPL 3CAFA 1RZJL 5FUZH 1I7UB 5JXED 3ZDZE 4PJDF 5EU6E 2NPLX 4GOSA 2NY5C 3ARED 1YECL 3FO2A 1AD9B 3CLFH 1NCWL 4Y7MA 4YDVB 5E8OA 43CAB 5KS9B 2AJUL 2R9HC 3D39B 4HKXA 3X3GL 4BKLB 1NEZB 4LNRB 4NQUA 3TP4A 2Y07H 2X4RA 2H41A 4DGVH 3AXLB 3RNKA 4RSVA 5C9JA 1SEQH 4PJ8C 4M00A 3WXVL 5IOPA 3ZYIA 1UKTA 2X1PA 4TNVF 5K9OB 2MCPH 1I8LA 4MXWL 4WEMB 1YA5A 2GI7A 3A67H 3MRHA 1C5BL 4JDVB 1RZ7H 32C2B 1Q9KB 1T22A 3T1FB 3QIBB 3B2UC 4PY7B 1RUPL 4L8SC 2EKSA 1AE6H 3RIFF 3ARBB 1OM3H 4JM2A 1KLGB 2CIIB 4U6YA 2J4WH 3G04B 4YR6A 2RB8A 1U6AL 3SPVA 3TIEA 1IC5L 2IPTH 1FNAA 1BJMA 3DX8B 3S36X 2HN7B 3BPOB 3OB0H 1JYXA 2CKBL 4S1QH 3RVUC 1V05A 5D9SB 3RZCD 3B6SB 4APQD 3E1F1 3MUHL 1P9MC 4K23H 4OZHF 3MLRL 4AEEA 3QEUB 2R8SL 4G7YH 3TNNB 4X9GA 1WIUA 4QRRB 1GOFA 2A83B 1KJ3L 2ATPA 4NJ9L 5IROC 4M7LH 4LLYB 3JV5A 4R96A 2NZ9C 2BFVL 3SCMA 4XPGL 5HI3D 4YHYC 2CMRL 4M43L 5DC9B 4PRNA 4ODXA 3NA9H 4XC1L 2R56H 5GRVK 3FOMA 4D3CH 3GSVA 1KLUB 1NFIB 1XGTA 4XNQA 1FO0A 1TIUA 2FX9H 4ZO6A 4KROB 5EUKB 3QFJB 5B38G 4Q9QH 5TDOB 3L3OB 4OD3L 4OCRH 4X6FA 3BP5A 2XNAA 4NHUA 2QEJA 1JZ2A 4EUPB 4Q9RH 4Z95H 1LE5A 2VDNL 1NL0L 1NGXA 1Z3GH 3MJGX 4P2QD 4PJ8A 4MD4B 3B2VL 1JGEA 4F33A 2MKLC 3PWVA 3S88L 3R06A 4E5XA 5IHBA 1NGWA 1R5VB 4MX7B 5D7KE 2W60A 5GGRA 2VNCA 5JHDD 5I1DB 1IGYB 1PG7W 5DJ6B 5ISZD 1J9CT 4IHOB 3O6FB 3GBLA 1CT8A 1VGEH 4GO6B 4ZAKB 4L4TA 3MUGB 1H0DA 5A2JH 1YQ2A 5E4EC 4I0PB 4CVZA 4NNPH 1OSZA 1TZGL 4HKBA 4RDQG 3E6FA 4WW2B 3LQZB 3O4LE 5D7LB 1MRFH 1Y0LB 3V7MA 4NKIL 3T0BA 1IAKA 2BVEA 5EULV 3GSOB 5DQ9B 2GTZA 2BHZA 4X6DF 4R90L 1EHLL 4WI4A 2JE8A 5C09B 4MDJB 1P9MA 3QWQB 3BPLC 4RMVA 4RNRB 1ZEAL 3L3DB 1BLNA 5D71H 4NQCD 5DJCA 2QQQA 4PB9H 5D2LE 5DVKA 3O45A 1FL3B 2N7BA 2QSCL 2UZYB 3O41A 5I1GL 2Y1VA 1WIPA 1WZ1L 5IROA 1I9JH 3P0YH 5KN5B 1OGAA 3QDGB 3NOIA 4HAGA 4OCSL 4UI2A 1AY1L 3V6OE 1XF3A 5B8CA 3OR6B 12E8H 3TBYB 5C0FA 3CDGA 1U58A 4Z7UE 3B9AA 1ZGLB 2VLJE 3D48R 4HK0B 1SY6A 3K2UH 5CJBA 3LY6A 3G5ZA 1NDMB 1BVLA 3B3IA 2IALA 1AR2A 1BJ1J 3MBED 3KPPA 1LO3L 3FFCD 3ALXA 1JGVH 4XCNB 1OCWL 5DD5H 5ICYB 4G5ZL 3J7HA 2ESVB 4ZS6C 5IB2B 3IETB 3IJHA 1K8IA 4L5FL 1XGYH 3SDXA 1R6VA 3CXDH 1Z0NA 1HH6A 3D69B 4YNYB 2EE6A 2V5YA 4PS4H 2D7MA 1ZLUH 3WJLC 1RZKL 3RZWA 2OMBA 3PWPD 1I1CA 2E7HA 3SDYH 3KPRA 4O2CA 4CRPA 3I02B 1VACA 3QIUB 3MYJA 2F8XC 3MA9H 1F8TL 1AO7D 1KPUB 4QOKD 5GSVA 1ZA6A 1PQZB 3WHE0 4TTDD 1H8SA 3ZE2F 2YWYA 4FTVB 5F9DC 1AGDA 4LKCA 1HIMH 4P3DA 3MFGB 4I2XA 1ZHBB 2V17L 3LQMA 3O6LL 1CLOL 3VWJA 4BQ6A 3FZUD 2OP4H 4JZOB 5C08E 2LVEA 4M93B 4L9LB 1G7HA 1DANT 2VR4A 4HUVB 3HHRB 2FWOB 3FQUB 4XVSH 4JPWL 2R15A 2G5RA 2ZSVB 4NQSB 2BSSB 3MOAL 2JB6A 1VDGA 3PL6B 2OL3L 4OLUL 2R4RH 3LD8C 5CSGA 2ICEA 4X8JA 4U1KB 2YUWA 4S0SD 1YY9C 4AIOA 5JUEL 1LILA 4PJAB 4YX2H 3CMOH 2RCSH 2WIIB 3QQ3A 4C83A 1T20B 2ZPKH 2L0DA 2FD6H 4XXCC 3V5HA 3WCYA 5FF6B 3SDAD 4HG4K 5LWYL 1P2CA 2Z92A 5IVXF 1P69B 4ZUWA 4PJDE 4S2SB 4MQ7B 5KVMC 1VFUA 5MI0B 5T3XH 3ZE1F 5DJDA 2VL5B 3MSPA 4NUGL 5BS0D 1Q9LA 2FX7L 4KVNL 4X0KB 1ODAA 1DBAH 4F57L 5BO1L 3ARYA 5C0DB 2R0LL 5GS0D 3BGMA 3DO7B 1MFAH 5DT1L 1I9RH 4FQHA 4QRQB 3EAKA 3PJSA 2ZG1A 5TPWH 3T4AB 3IGAB 3D39D 5IEKB 2H2PD 4M3KB 2P8MA 4ZYKB 5FM5O 3WLBB 4NC0B 1HILB 1LK2B 4DCQA 1CTOA 5LVEA 3WIIL 2CLZB 2YSSB 3BIKB 4M6NH 3DVNB 1XF4A 4RAVA 1D9KC 3IKCB 1VENA 2KKQA 3U1SH 5IUSA 3SE8L 3RJQB 3QIBD 4LCUB 4OGYH 5IW1A 3OJDA 5C2BL 1KIRA 5CEYA 2LTQC 4OZIB 3ARBD 3QXWA 4XI5D 5MHSE 2AJXL 3DI3B 2QJDA 3BRDA 4JAMB 1T0MB 1BOGB 1MHPL 1JI1A 2DTML 4LLUB 3ROLA 4LCWB 3GMMB 4OZHE 5J13C 1WBXA 4V1DA 5K9JL 4U7KA 1WZKA 2YMXL 4NQDA 3HUJF 3VRLF 3IDJB 1FZMA 1O7VA 3DARA 1F6AB 2A6JA 1OF2B 2ZG3A 2VITA 3SGDH 1OVZA 1T2JA 3O9WC 4QRRD 1GGUA 4XXCA 2AEPH 1RZJH 1JZ8A 2CJUL 4Z7WB 1FG2A 1DLFH 3T08A 3JV6B 1NCWH 4U6XA 3LCYA 3BEVA 5D1ZB 1EO7A 1WFTA 3L3GA 4I4WB 3V0VB 3EOYG 4JVUA 2XZAL 4OAWA 3BWUC 3HPLB 4RDQF 4KROD 3S36H 3QFJD 4EZMA 4N5UA 5GRUL 3OKNA 1YEHH 1I7ZB 2I25N 3BN3B 4MXWH 4N1HB 3T0EC 1C5BH 4K7FA 3FQXB 5ADPH 4KXZI 3G9AB 5I76B 2FSEB 5LG1A 4WI2A 3S34H 5C71A 1NCUA 1INDL 1VADB 3MV9E 1JRHI 1RUPH 3GJFH 4KK8C 1M7IA 1G84A 3N1PC 1FVEB 5JMRA 3ARFB 1BPVA 2FYYA 5ESQB 4GXVH 2BSED 4XP1H 3MGTA 1GHFL 3G5XB 4YO0A 3WFBL 3QUXB 3NIDF 2X4UA 1EBPA 4X9BA 1XF1A 3H9SA 4LLDA 1S9KC 2RBLA 3IDXH 1JNNL 5CEXB 2XA3A 4WHDA 4F9LA 1ZAGA 1EMTL 4LDOB 4X7CC 1IBGL 5A3ID 2IQ9L 2ZG2A 3OQ3B 1V7NL 4P5MA 1Z9OA 3GM8A 3MLYH 3OKDA 4ZAKD 3ULUD 3MLRH 1FNGB 1KT2B 2R8SH 4X6DE 1Z9SA 1NBVL 1NGQL 1ZXQA 1WUNT 1XMWA 4I0PD 3BW9A 1KJ3H 1Y18B 4NJ9H 4WU5A 4QT5B 4HT1L 5GRVL 1V3KA 5F7KC 3ARTA 1OAXL 5F7HA 4J2XA 2D4DA 1OGTA 1LEIA 4I0CC 4AL8L 4XPGH 4DZBA 3LV3A 3DETC 4M43H 1A64A 5IIEB 5C09D 1WQVT 3DVGA 4XC1H 4K3DH 4KJYA 2F53E 2UYLA 3X17A 5FYKE 3O9WA 3QNZA 3ISWA 1F4YL 2CXGA 3KNBA 4GRMA 4S10A 5GSRB 3IFPB 4OD3H 4ZSOA 4ORZC 3VFRB 1WAAA 3HMXL 1XIWB 4LPUA 2NX5A 4P9HC 4TUOA 3R4DA 3R8BB 1DDHB 1NL0H 1GZPB 3E3QE 1ZHLB 1UGNA 5F6IB 5EO1A 4OGXL 3D9AL 5CD5C 2Z31C 3KG5A 3M8OL 3H0TA 1QACA 1OWRM 1NAMB 3QDJE 3S88H 1XCTA 3KYOB 4YBLB 1IAOA 4JFZH 3IAQA 2ESVD 4RGND 4WEBH 3VCLA 4Z8FL 4FQPA 4PV9B 2DYPA 3FB7A 1CDHA 4R2GC 4TVPE 1ND0A 4WI6A 3FB5B 3GMQA 5FDWB 5CAYB 4HFWA 3RTQC 3WFHB 2HJLB 4OCLC 4H1LG 3ZE2E 3QCVL 1RK0A 4NKOB 3OHXB 1R3LB 5E24E 3QIUD 4OIAA 4ZXBC 5A43C 2XTJB 1ZHNB 4NKIH 1YNLL 3OKLA 3C6LC 1CZ8L 5B4MC 5HYSB 4Y19A 3AAZB 3UTOA 3UAJC 5CKGA 4HKJA 2QSVA 4R90H 2AJZA 3FQTB 1TJHL 4XXDA 5T5NG 1ZEAH 1FYTE 4CU7A 3ILQC 1EERB 4Y1AD 2QSCH 3MNZA 5I1GH 3PL6D 5AYUL 3PQYE 4NN7C 2NY6B 2XN9B 3EGSA 4UV4H 3S3JA 3O11B 2WANA 3RI5K 4XHJC 1DQDL 5DTFA 5GIRB 1ETZA 5SX4I 1UH2A 5M95B 2OBGA 3N1QC 3QFDB 3UTSA 4Q6IB 1EFXB 2DQEL 3BO8B 3JWDL 3WN5C 4D0BB 1LO3H 4TQEL 3T4YA 3ZE1E 1KB5A 3RVTC 4G5ZH 2H6PA 5KBNC 3HCVB 1KTKE 1OTSD 4L5FH 2DIJA 4S1DC 1KPVA 2C3GA 1FC1A 2XTLA 5H35B 3ZTJG 2ZOKA 2V5RA 4NWTL 3D6GA 2Z31A 4E41E 4M8VA 2IPUG 5C0CE 4GW5A 5AZ2L 1D5MA 1VERA 4GSDL 4RGOH 5T1MB 3C5SB 4PREB 4LCYA 3QQ4A 3P77A 4L8DA 3BVNB 4KK6D 4GG6F 4JO2L 5HGDA 3REWA 4ZQKA 3MROB 1U91A 1S5HA 4Z0XB 3RTQA 3D5OF 3IS0X 2FJFA 3MACH 3DI2B 4U6VH 2V17H 4QEGA 3O6LH 1CLOH 1AXSA 3SO3B 5L2KA 3HC3H 4ONOA 5SWQA 4NO0B 5HHXL 4G6KL 3I6LD 4ONGL 5C7XH 5HJ3A 4M8QA 4ZXBA 3MOAH 2OL3H 4M6OL 1NFDA 3C6LA 1CIUA 3CFEA 4OLUH 4KC3B 2ZOLA 3WE6B 1OP9A 2YR3A 4TUJB 4LEOB 2GK0B 1CFQA 3TN0C 4TVSa 2ZJSL 1F4WL 4JY6A 1QSEE 1EXUA 2VN7A 4LASL 4FG6D 5LXGL 3VRLE 1IZKA 2GUOA 4XNXL 1BFVH 4LCWD 2L4OA 1OWWA 4P2YA 5IP4A 3GB7B 1AGEA 5FGCB 5EBWA 2AK4E 4U0QB 5LWYH 5CZXC 5DR5L 1D5IL 1FNEA 5FYJD 1EFQA 2P4AB 5F6HJ 3STZB 4NZUL 4PP2A 4XAKD 1MHEB 5BXFA 1R5WA 3MODL 4OFDA 1CFNB 4KUZL 3WN5A 4LEXL 2FX7H 5HHMB 5EOCL 1IL1A 2R0LH 2H8PA 2BNRB 3L5XH 5DSCB 3PIQB 3QPQD 5DT1H 5E9DE 3MBXH 4UOW0 5EC1A 3SKOB 4D2NA 4X6CA 1YEKL 4ALAH 5HGHA 1IT9H 4N8CH 4NKDA 2W0FA 1UM6L 5D1ZD 4AYFA 1IGTB 3FN0L 2YPLA 3UTZA 4YHMH 1WZLA 1ZWIB 3UPRA 3CU7A 3ARDC 4MJ5B 2HT3D 1RUQH 2L7UA 3LN4A 1YEJL 2FL5B 3QO0B 1RD6A 4DGIL 3KPMA 1I3RB 1UQSA 4U3HA 3WIIH 1TJGH 2R69L 3HB3D 2A73B 3QHTC 4ZUSA 3RL1A 1LVEA 5B39G 1L7TL 3DBXB 3DURA 3RX7A 3D0LB 1CDIA 1TITA 1JGLL 2B0SL 2BHYA 3DYMA 4HX1A 2O26U 5DJ0A 4HEPG 2DQDH 1I9EA 1ZVSA 4PV8A 5C2BH 4NRYA 3GIVA 3NPSC 1FFQA 3NIDE 1KIUA 3MLUL 4ODHL 4LGSB 2VERN 4XVUC 3EO0A 2RAMA 4ETYA 4H5SA 3ARFD 3RI5F 2DF3A 2DTMH 2PCPB 3QUXD 4CAGA 2HVKA 4M1CC 4E9LA 2XZQL 5K9JH 4CNIA 3B9EA 3VMNA 3WIHL 1MAML 4RFEB 4EEEA 2YMXH 5C6PB 3TN0A 4MYWB 2YPVL 4BSJA 3S7GA 3WLWC 1Z9LA 3ZTNH 5MP6L 3SJVA 4TUKH 1DANU 1L4IA 1LO5B 2A2QT 4P99A 5C70A 4KRPC 4P48A 3B9VA 2AQ1A 1FZJA 3LMJH 5E00B 4OCWL 4RBPH 4PGJA 5I16B 1OB1A 5FYKH 1N7ML 4NQEE 4HQQL 4D0CA 3NMEA 1WBYA 4HS6A 2XZAH 4V2BA 4P46B 4HJ0D 4RAUA 1IEHA 3GDBA 2PTVA 5EBMA 3BZ4B 4P2OC 1VCAA 2IBZY 4HZAA 1UH4A 4F58L 1XIWD 3QUZB 3I6KA 3QZWG 2C1PA 3MRQA 4PB0L 1Y6MR 1BAFL 1INDH 1Q8MA 1OHQA 5SWZB 4HJGB 1G6RL 4EI5B 1DVFC 1U8MA 3OKOA 4XCYA 5C9KA 5L6YL 1ACYL 2QBWA 1TNMA 3CFBB 3JBG7 3P4LA 1ZK9A 3JVGC 1QHPA 1HWHB 1PKQE 4JFFA 3K8LA 1GHFH 3QPXL 2Q3AA 4TVPH 1U8PA 2R1XB 3F7VB 1MFNA 5I18H 4JRWA 4P3WA 1OOAA 3WO4B 1S7UB 1RPQA 3LHPL 4YXKL 4EDWL 1EMTH 1IBGH 1RUAL 3QYCA 1RK1A 1V7NH 1P7HL 4P23C 1CICB 2WBJB 3IF1A 1BBJA 5MEOA 2F54B 3VXPA 2XTJD 4HT1H 1FAIL 4JJHA 4OF7A 4CMHC 2H32H 2HJFB 1I8IA 3DUSA 5BV7B 2RGSA 4Q7DA 2OR9H 2XKNB 2NY4B 3LSOA 4PTTB 1UJ3C 3EJZD 3CDYA 4ONHB 4P2QE 3U36A 4HUNB 5DJXB 1FFRA 2FLBT 1I7RB 4YC2C 4N90E 1F4YH 3L5WA 4XBGB 3MV7A 1IGFH 2VIRB 2HFFB 3C5JB 1G7JA 2D31B 3FQRA 5IMKB 4C57C 2NY6D 4XH2B 2XN9D 3VXMA 5DRWA 2E8ZA 3BSZL 4XP4L 1C12A 4LKXA 2AI0L 4PBWD 4YHNA 3WKNA 1BF2A 5HHPB 4JHAL 3U4EA 5E5RB 1XCQB 5BCAA 1Q0XH 2VZSA 1M71A 3EZ8A 4GFTB 5JZ7D 3D9AH 4JEGB 3M8OH 2VLRB 1EFXD 1FFNA 2H2SC 4P2OA 1KCVL 3O81A 3C2AL 2DTSA 5HYJE 4Z8FH 1EAPA 3ULUF 2Y06L 3KS0H 5TGBA 3ZKMC 4HDIB 4DGYH 3GMLA 3OKMA 4GG8A 1DVFA 2V5SA 4NOBA 3ZSTA 3DV4B 4GG6E 2E9BA 4GAJL 3L3IA 3VE0A 3JVGA 2BP3A 4PRDA 2OSLA 5F89B 4I9WE 2OQJA 1BZ9B 1LNUA 1A6VL 5IQ9A 2CR6A 3P30H 3GGWA 3CX2A 1AQDA 2KQNA 5M7QA 3MJ8A 5I8EA 5DJYB 3RGVC 2B2XH 2V7NB 5FYLE 1JPFA 2E9IA 4G6ML 3CK0H 3FQWA 3TBSB 4P23A 2VKXA 43C9B 1U92B 4NO0D 5KSVA 3WS6A 1QR1A 3LB6D 1IGJB 5FO8B 4KWUA 1Z0MA 3FFCE 5BQ7B 4A6YL 5DEFA 5CGYD 1T21B 5DJ8B 3IDMB 4WGVB 4JFEA 3FB6B 2WSKA 4TRPL 3D18A 1BVZA 1UJ3A 4BELD 1DQDH 2EDRA 3BPNC 3RWGB 1X5JA 3NZ8B 2B4CH 5IK3B 5GS0L 1NSNL 1KJVB 1SMOA 1QBML 3V4UL 1RJLB 3GKWL 1S3KL 2DQEH 5IR1B 3HAEG 5CJ5A 1IEBB 1AO7E 3ULSB 3U0PB 4QOKE 1T4KA 1BFOB 1UCTA 3VD7A 4U49A 4LU5L 1JYVA 3BQUB 4OZFG 4M5YL 4NWTH 1ZSDB 4JRYB 5GJSH 2ADFH 5D7IA 4OZGB 1R3IH 3F62A 2P5WA 4EN3C 3W2DH 1K5NB 2D03L 3B5HA 5HHMD 5HGAA 4GSDH 3CFJB 4QXTB 4IRJB 4WV1B 4Z7VA 1HINL 2BNRD 5D96B 1VEPA 4JFDA 1NGZB 4WO4C 4G42B 1JGDA 2FLRT 4U1GB 4JO2H 5DGRA 3CLEL 2IFFL 3X11B 5J9PA 2R2EA 4LCIH 4Y5XB 3NFNA 4GBXC 1VFAA 5IMLA 3QXVA 3C8KB 1MRCL 4MD0B 1ONQA 1KTDB 3VA2C 3K0WA 1N26A 4HULB 5CJQL 3KJ6L 5EWIH 5F71A 3ZMRA 4G6KH 5HHXH 4CW1B 4G8FB 4ONGH 1HH9B 1RZJC 1OAZL 5I0DA 4PJAF 4TSBL 2I26N 3FTGB 4FMFA 3IJSA 3VW3L 3KXFA 3RGVA 1A9BA 1FVDA 3HI5L 5F7NC 2VXQH 3BDYL 2ADJB 1IVLA 3L6FB 2FEDC 2ZJSH 5EU6A 1F6FB 4MHHI 4LASH 3HLAA 1KOAA 1DQTA 1JUFA 5BS0E 4LHUA 5LXGH 2YN5A 3HMWL 3LN5A 4XNXH 4JJ5A 5GRXG 1JZ3A 3OXRA 3SGDI 5F1IA 1U93B 3DTXB 2YD1A 5DRXB 4YDLB 1BIHA 1JHKL 4R7DB 5FHAL 3K8KA 1KEML 1ES0B 1YEEH 2OJEB 2VR9A 7FABL 1QQDA 3WDIA 4PD4J 1X5ZA 4EQ2A 3T8XA 5J6GA 3P9MA 4NZUH 5H37G 3NGBB 4HKZB 3MODH 3BHBB 15C8L 4KUZH 4LEXH 1NBYA 4LSTL 4QRUB 5EOCH 4NHCH 4UDTB 4AG4L 1NFKA 1B90A 4M61B 4M7ZC 4PLKD 1MIEH 1C7TA 1ZVYA 3PNWB 4FQJL 2CKNA 1YEKH 3WNOA 1CF8H 1J12A 2J88L 4N1CA 3FN0H 2V2WB 1M6OA 4J4PA 3TFKC 4EN3A 3VXRE 4PRIB 1YEJH 3GSXA 1S5IH 4DGIH 1MRDL 4P46D 4OI7A 5JOPD 1T03H 1XR9B 4WO4A 4X7TA 2R69H 5IFJA 5DD1H 3PABB 4WNQA 5EU5B 3DXAE 3QUZD 4HH8A 3P4OB 1JGLH 2B0SH 3EFDH 3VFTB 3DX9B 4BQ8A 5T3ZD 4GBXA 1TCRA 3NBNA 3T0DA 4HXAL 3VH8B 3T65A 3ULUL 5SWZD 3ME0A 4ODHH 4EI5D 2C1OB 2YN3A 3BWAB 1BOYA 4PJCF 1D6EB 4K2UL 3M07A 2Y72A 2O61B 4XNMA 1ZLWK 3V6OC 2VAJA 2MPAH 1UZ6F 1FLTX 4JKWA 5HGGS 4BK5A 2UUDK 4UILL 1SJXA 2G9HA 3BIBX 4P49A 3MZGB 3WIHH 1MAMH 5CBAB 3U0WL 5GGSA 2DLGA 2D7PA 4CKVX 1AGBB 2YPVH 4U05A 1IFHL 4Z7WF 4K3GA 3IXAB 3KLSA 1BQUA 2COQA 2WWMC 4J3VA 3MRIB 4JM4H 2ICWI 1MCKA 1CICD 5ANMB 2WBJD 5MP6H 4EIZC 3UJJH 3O2WH 5EOTB 3QEHA 3QFJE 2EC8A 3SOBL 5FYJU 2EH7L 1UVQA 2F54D 2YC1B 4HIIA 1IILE 5E2WL 3EHBD 4KTEL 4WIQA 4OCWH 2BOBB 1FVCA 3GJFA 5C0IB 3GJEB 3VD4A 1P4BL 2NY4D 5F88B 4DK6A 1S7XA 1MJ7L 1OD7A 2A6IB 4U1NB 3IVKA 4JRXB 2HTLC 4O51B 4HQQH 4L29A 3UTTE 3RY4A 3C8DA 1T6VN 1RUKL 3RWEB 4WUKL 1CFVH 5EC2A 4ZPVB 5DJZA 1FV1B 3JUZA 4C4KT 4F58H 1AHWB 2UVFA 1A7OL 4KJQD 5EH1A 4PB0H 5ETUB 1CE6A 1BAFH 4K7PY 5ITFB 4HJJH 3EYQD 3VFWB 5EFIA 3EYUH 5FO9B 2PYEB 3WFDL 4BUHA 4LVOC 3ULUE 2QR0B 3O4LA 4RMQA 4O2FB 3QUKB 2VLRD 4OV5B 1HSBB 4NO3B 4ODWB 5C0RL 5DYOA 4RRPG 4HIJA 3LIZL 8FABB 4LLWB 1W0VB 2GYSA 2ICWA 3RPIB 5JQ6L 3LHPH 4YXKH 5D2LA 3H3PL 1S9VA 4M02A 3DRTB 4HS8L 1PYWA 1XGRA 3O3BA 4HH9A 4PLOB 3P0VL 1UWXK 2EO9A 3V6OA 3NZHL 1P5VA 4M5ZL 1I1AC 4RFOL 1AC6A 4NQXB 4POYA 4YBQD 5A2LH 4HZLA 4Y4FA 4Z7UA 3DYPA 2VLJA 3TH3T 2LE9A 3LEXB 3E2HC 4JHBA 5FYLH 1J1OL 4DTGL 1KIPB 3VU2A 1OARL 2VE6A 2FATH 1N2RA 2A1WL 4TULH 1LEKA 5I15L 1RZKC 2JTDA 3VWKA 2GITB 4PJ7B 3UO1H 1TDQA 2XWTB 2GKIA 4OUOA 4KDWA 5IMMB 1KN2H 5HDOA 4RGNE 3VXQA 3NH7L 4FXGB 4JDZB 3QG6B 5AEAA 3G6JB 4HLJA 2EE3A 1MCRA 3BSZH 3LEYL 4ZS7L 4YFLI 3RWIB 3HR6A 1LO2L 4JHAH 4ETQB 3TJEL 3G08B 1I1FA 1WCBB 3C08L 3GHBL 5CP3H 1HQ4B 4U3XA 1P7KB 2F5BL 1EJOH 5CJOL 5C07B 3TVMB 5KVEL 2EXWD 1KCVH 4NJAH 3FT2A 5C08A 3BEWB 1U42A 2Y06H 5JW4M 1DCLA 3BQUD 1IKFL 5FHBL 1F4XL 4HF5L 1G7LB 4GAJH 4JRYD 3ZKND 4FABL 2GJZA 4Y1AE 4LNVA 4M62H 4LCCC 1M7DA 1KIQA 4IRJD 1ORQB 3ARQA 1V7ML 1U3YA 1MPAL 2VLMD 2EC9T 2IMMA 2I9LB 3G6AA 1CL7L 3NN8A 3RBGA 2AKRA 4P3CL 2VDKL 2IGFL 4S1RH 4YGVB 4MA8L 4YPGB 3QRGL 4G6MH 5GS2D 4D94A 4S11A 1EIBA 4J3XA 1C08B 4KRNA 1JIBA 1Z5LB 2BY2A 4MA7L 5IJVA 5DJAB 3S96B 4ZO9A 4PJDA 3RP1A 4OM1H 2B5IC 4JZNB 5FYJL 3PGDB 2W59A 2PETA 1SJEA 1NBQA 1CG9B 5H2BA 3BXNA 2J8UB 4QCIA 2DI8A 3H9HB 4PLJC 3W9DB 1QBMH 3T2PA 3V4UH 4WHYG 1URLA 1U8KA 2X89D 3GKWH 1S3KH 3O8XC 2XRAH 4YBHA 5MEPA 5JO5A 5TF1L 4WFED 2VXTH 4GRLC 4P0DA 2K7QA 3STBA 5E95B 4OGAC 5JQHC 3UYPA 3CX5K 4M5YH 2BVUA 1U8QA 2JELL 2IANB 3OAZH 4HWEL 2E27L 5D8JH 5HPMA 4JCMA 1INQA 2AXGB 2D03H 2OL3A 2QQNH 1HINH 3LPFA 4EBQH 3CLEH 3X14A 4JPIA 2IFFH 5JPNB 3KWWB 4Y88A 5IQ7L 1KJ2H 1A6AB 1N3NA 2NLJB 4JG1L 1MI5E 4PG9A 5EZJB 4PRID 4OZHA 2C9AA 4LCCA 1PEWA 1MJJA 3WL9B 1TETL 1OAZH 4OLEA 4TSBH 1D6VL 5EBLB 4GQ9L 4PJCE 3VW3H 1A4JB 4NGHL 1T66D 3DGGB 3WFCL 4B53A 5JDSB 1JNLL 3HI5H 1UZ6E 4Q9BA 3BDYH 5D7SL 6CGTA 2VABB 3GEWB 4Y4HA 4OD1H 1G7QB 4CADB 3JTSB 3HMWH 3MRGB 3FKUS 1BD2B 4I5BA 1E4XL 4Z7WE 3CVIL 2PYFB 2YUZA 4QNPF 1JNHA 3E3QC 1B0GB 1JHKH 1W72H 3ZTJH 3EDDA 5IKCA 3TA3A 4J3OC 4I18B 3O8XA 1P4LA 2R0ZL 4NBYB 3OJMB 4ZFFB 2IAMC 5CSZA 3V5DA 3MV9A 1TVHB 4TOYL 4F3FB 1P84J 2PXYC 5DMGC 3K4DA 4J3UA 3RWCA 3JV4B 3MFFB 4FQJH 3SGKC 1K85A 3PHQB 2VLLA 2PKDA 2W65B 3OXSB 4PJ5B 1FGNL 2IBZX 5F3HB 4L3CB 4QWWC 2F5AH 1EZVY 3HN3A 4Y5VC 4JRXD 3UYOD 3NIFF 5JIKA 1KULA 4JFYA 1YEGL 4HMCA 4XPBH 1G7PB 2C4FT 4PJBB 3DMMC 2A6KA 3TO4C 3FFDA 4MA3A 3K8MA 4DOHB 1E4KA 1MHHA 3WO3B 5IV2A 3ZDYF 1UADC 1J5OH 1UACH 4ISVA 4LSSH 3WUWG 3HZVB 4HXAH 2XG5A 4X6DA 3ULUH 2GT9A 1Q9WB 3IU3B 4Z0BL 1NJ9B 2PYED 3HR5B 5A2IH 1L7IH 3OL2A 5GS1C 4UB0L 3RUGB 5I73C 3UYRL 1MCFA 2VLKB 3LEVL 1HHHB 4MXQC 3SKUD 1HXYB 1JN6B 5SX5K 2HT2C 5ID0A 4UILH 1NDGB 2FECL 2Q76A 3D25B 5FM5M 1BVKB 3KYKH 3U0WH 2F53A 3CFCL 3T77A 1XGQA 3RIAK 5TE4L 1NCCH 1ORSA 1CFSA 2JJUA 2BXYA 5E1AB 1F13A 2VISB 3CZFB 4R6UA 1A0QH 2J8OA 4DUXA 3SOBH 2FO4B 3QAZC 1MJUL 5DEGB 2APXA 5E2WH 1MHCA 4LFHG 4KTEH 3PWNB 3VJ6A 3T1WA 3WSQL 4JKLA 1H3XA 2D9QB 3VFPB 1MJ7H 1WTGT 2QQKL 3MR9A 3QDJA 2G60H 4L3EA 1TJIL 4XHQA 4U1JA 5D1QC 5ERWA 1RUKH 1S8DB 2IQAB 2YPKA 3BKJL 4XVTH 1T1WB 3SGKA 1ZHKB 1GGIL 5KVFL 1QLFA 1A7OH 3VA6A 4QRSB 3FRUB 5SWSB 3TV3H 1X5LA 4XNYH 3ZE0F 3GUTA 1SYSA 1YJDL 4IRSC 2B7DT 4Y5VA 4OT1H 3PWLB 4WY7L 1JF1B 2B8OT 3OR7A 3MNVB 3IDIB 3QCTL 3HE6B 4KK5C 4JY4B 3STLA 5FV1L 5C0RH 4FQXA 1LO4L 3TVMD 4PD4K 2HTKC 1LO0L 3L7FB 4HGKC 5DJ2B 2H32A 3O3DB 4GUPA 2A77H 3I6GA 4PUBL 2BXZA 1C16A 1FYTA 1A1NB 5F7EH 4ZTOL 5JQ6H 1CGSH 4S0TD 3H3PH 4WFHE 3MREB 3GSQA 4HS8H 1O7SA 3Q6FA 3P0VH 4X6EB 3BE1L 3PQYA 3CFDA 3NZHH 2XQYG 4M5ZH 3JWDC 4RFOH 4NCC1 1OSPL 1MFEH 4PJFB 4G8EB 3SQOH 2JK5B 5DRZB 3VFVA 1F3DJ 5I8OL 2ZCLL 3GFUA 5EA0L 5BVJB 1RMFH 2ICCA 1UJTA 2CQVA 2VDPH 3NCFB 4LOUC 1UC6A 1I8KA 3RFZC 4NT6A 1Q0YH 4K9EH 5BW7C 4F7PB 4LGRB 1S7QA 1I1YA 3MRNA 3EOAA 4ZD3L 3FB8A 1CD1B 3VG0L 1JV5A 3QG7H 3SO5A 5BVPH 2XPGA 1U3HB 3NH7H 3AMLA 3ARGB 5E6YA 1BZQK 4E41A 3W39A 2CIKB 3VFMA 4J8RB 4UINH 3LEYH 4RCAA 4ZS7H 5C0CA 1SBSL 4YXHL 3C5ZB 5I1EH 4EJ1C 2CDGB 4MNQD 3TJEH 2BJML 2BVPA 3P40A 5E6ID 4TYUA 3C08H 3LRSA 4M1GL 5D1QA 3A6CH 3GHBH 3PV6A 4KPHH 1H3VA 2F5BH 4NNYA 5CJOH 3OMZA 5KVEH 1UG9A 2CLVB 3BKML 2D2OA 4HPYL 4LSVL 4IRSA 5ILTL 3OWEA 1IKFH 2DQJH 4RQQB 5FHBH