1CFSB

Anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
213
structure length
213
Chain Sequence
QDQLQQSGAELVRPGASVKLSCKALGYIFTDYEIHWVKQTPVHGLEWIGGIHPGSSGTAYNQKFKGKATLTADKSSTTAFMELSSLTSEDSAVYYCTRKDYWGQGTLVTVSAAKTTAPSVYPLVPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN))
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
molecule tags Polyspecificity
total genus 37
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 1999-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfsB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfsB02
1TMCB 4UDTB 3TNMA 3SCMB 5FCUL 2FX8L 2GCYA 4WV1A 3KPMB 1NPUA 3RY6C 3RVTC 1LVEA 1OP3H 1NAML 3O4LD 3GMQA 3IAGC 1WT5A 1MCNA 1EH9A 1A2YB 4NFBA 3MFFA 5IVZB 1WC7A 3WFBH 4XHJD 5IFJA 2OL3L 3KPRE 3O6FB 5C92A 2YD9A 3EJZC 3CDFA 5BV7B 3SGDH 3V8OA 3DRQB 4IMLA 15C8L 5HYIA 1DEEB 3EJYD 1Q9KA 3SE4C 4MAUL 4CKVX 4MCYB 3W0WE 2A0LC 1NAKL 4Y19D 5HDBF 1R3IH 3KDMA 1LO2L 3SQOL 1QSFE 5JW5B 5KTEH 1I7TA 2ADGB 2CRIA 5SWSE 3T0XA 4ZUVA 3VXUB 1J18A 2O61B 4FFWD 1WBXA 3D9AH 3FO1A 1S9WA 5T3ZE 5I8CB 3OXSB 4IRSB 2YUXA 4CDHA 1IL1A 1CFTB 4N0CC 3DTXA 2VXTH 1FBIL 3MYJA 4U1JB 4YE4H 4QXTB 1IGFH 1Y18B 4O00A 4WI9A 1EJOH 4HJ0D 3LS4L 1RJZA 3WXVH 1AC6A 4EUPA 3ULUF 3OKKA 3OAUH 4PLKD 4Y4HC 3VH8A 1F4XH 4JVUA 3G6AA 4RGMC 3EGSB 3PL6C 4I3SL 3V95A 1U3ZA 1IGML 4O02L 5E6IB 2P24B 4PJAF 4KUCF 1JTTA 1RURH 5TFSL 4TOYL 2XZZA 2VRAA 3TIDA 5FGCE 3OXRA 3EO1B 5JPMA 2BNQD 5C0BD 4I18C 5C0CB 3MV11 3QIUB 3SJVD 3ARXA 5B39B 1KN4H 2QSVA 1GYAA 1ZLWK 4P2RE 1UGNA 4M1GH 3QWRA 5KVEL 1D9KA 2IEPA 3BPLB 2HKHH 3BE1H 2ZSVB 3KLAB 1NCCL 5MEND 3AM8A 1K2DA 4TTDD 2BX5A 1I7UA 2XPGA 4DUXA 1J05B 5FF6B 2W60B 3RDTA 2AJVH 3RNKB 2FJHA 2DJSA 2XY2A 1SYSB 2BK8A 2YR3A 2YD3A 1P7HL 1UVQB 4P9ML 5E2VL 3V0VA 2N7AA 2F5AL 4WENB 3QEGH 4Z7VB 4KKAC 3S5LA 3EOBA 4PJ7E 4Z7NF 3W9DA 4G8FA 2DD8H 4RWHA 1Q0XL 1T66D 3EOTH 4PRID 1R0AH 2Y36H 1UA6H 4NO5B 1RQ5A 4JFDB 1N7ML 2IADA 2CDGB 4S10A 4APQB 1Z9MA 1FL6B 2YN3A 4BQ6A 2Y25A 1OAXH 3MV8E 2B4CC 2EYRB 4Z8FL 2VLJB 4JG1H 4FNLL 4U6VH 2Z31D 3KWWA 2COQA 3VFPA 3DETD 1T1XA 2A6JA 2DTSA 2EIEA 5EU7E 4PRHA 3GRWL 1LO3H 2QHLA 4FN0A 3ZTNH 1YEHH 5B38B 5I1CH 3BFOA 3TWCL 5KVDH 2KQMA 5CSZB 5DJAB 1TNMA 1RZKH 4F3FB 1OSZB 2VLMD 4EI5B 3SDDC 5KSVA 2DQEL 1ZANH 1D5ZB 5ITFB 3RWEB 4DAGH 1L7IL 4YNYA 4LQ1A 1D5XB 2YWYA 3MA9H 3KYAA 4NQDD 4JM4L 3MJ7A 5D7JC 1I8LC 1RULL 2I9TB 1YEDB 1NH6A 3PWNB 4HMCA 5DFVD 3WS3A 3DHJA 4XNQB 2RIKA 4QHKI 3QQ9C 2Z35B 5TE6H 1IC7H 4RMUA 1Q9WA 5DFTA 4WUUA 3FQRA 3U0WL 1R3KA 1XZ0B 3RGVC 1J88A 1EUUA 2WINB 4KK6D 1OF2A 4JKPL 3D0LB 3MRLA 3EYOA 1Y0LA 3UPRA 5KANG 5GZND 5EA0L 4M8QB 4DGVL 4AYFA 2HTKC 4HF5H 2JF1A 2MCPL 3NFSL 1WIUA 1DN2A 1RI8A 2I5YL 3T09A 5JPNB 3L9RA 4UAOB 4G5ZH 2HT2D 1ZVSA 3HLAA 3CMOH 3FFDB 3SN6N 2ICWI 3C6LC 2ZG2A 5DGQA 3TBYA 1ZSDB 1T7VA 1NEZA 4LLMB 4FQHB 4R26H 2OTPA 2E7LA 4HS8H 1RK1B 3KPNB 1N5AB 5HPMA 3KJ4B 1TXKA 4PRPE 5C07E 4H0HB 2C4FU 3QQ4A 3T4YB 4YX2L 3CZJA 3TN0C 5IM7B 1XCTB 3O0RH 4NN6C 2H3NA 5JIHA 2NX5D 3TBSA 1LK2B 2NYYD 5H2BA 2EYSB 4HEME 1FRGL 2YD4A 2RQ8A 3RIAK 5F6IC 2HRLA 4QXGL 3ARGD 4N8PA 4R96B 5D1QA 3HR5B 3MJ9L 5E2UL 4M61A 5J4MA 1QNZL 2F54E 3OG4B 3WFHA 1DZBA 5CHNA 5IT2L 1JNLL 1WV7T 1DSFL 4X7TB 4G6AC 4QCIA 4GRLD 1JI1A 4P2QE 5DURD 1KNOA 4KC3B 1FORH 4TNVK 1ACZA 2AK4A 3U30C 1V7NH 1OAYL 2IH1A 1U8PA 3IRZA 2W9LA 3FONB 4WW2F 2YKLL 1NFDF 1T89C 1UWEL 3MJ6A 4N0YL 3HCVB 5FUCE 2AV7A 4G9FE 5C0RH 1AO7A 1AY1H 4RQQA 4X7SL 2ENSA 4L4JA 3RVUC 3LKRB 4M9OA 4X8JA 5BXFA 5ID0B 5EBGA 4ODUB 1BEYL 4LLUB 2UUDK 3W82A 4JVPA 5HGHB 2VE6A 1QZ1A 1XCQB 4NRYB 4MD5B 4U1IA 2LAAA 4GMSL 3JTSA 3T0EA 3PGFH 2GTWB 4Z7UF 1P4BL 5CEZH 1AGEB 4R4BA 4JKLA 2NNAB 5JIPA 2DMKA 1B0GA 43CAA 1CS6A 5I0ZA 3MCLL 4JDZB 1EX0A 3DV6B 4PV8B 5D5ME 4CW1A 5FK9B 4Y2DD 4UV4H 1L7TH 4X7CC 4WI8A 1B4JH 1EAPA 4PGDB 2BNUB 4P3WA 5KJRL 4K3EH 3KPSB 5GGSB 1FVEB 4HUWA 2YK1L 3RVVD 5I66A 5JXAL 1BFTA 3OKYA 1JFQH 5F96H 4WY7L 3VI4F 3JV5A 2HMIC 3NAAH 1I8KB 4J3VA 5IVOA 5GRZA 1H0DA 3UPCA 4AH2B 4WW1B 5D7KD 1FG2B 1AGBA 1YEFL 4Y5VB 4W4NA 1PYWB 1V3JA 4CVXA 3F7YA 5HVWA 3DMMD 2W9EH 4NO0A 2DQHL 3BI9X 2PTUA 3O8XA 1T0MA 2D7OA 5J89A 5DEFB 5DRXA 4FQIL 1IQWH 1M05A 2VSCA 4JM2A 1JYVA 3HRPA 3W11C 5D96B 1DQML 2OM5A 2R2BB 1NMBH 1KCUL 1F3JB 3ZE0E 4HXAL 5D6CA 1GZQB 3RPIA 4PJGB 1MHCA 2CJUH 1TQBC 5I2IB 4LHUA 2VLLB 5JZ7D 2ADFH 3P11L 3TF7C 3GMLA 4ORGA 4HJJH 5CIPH 4ZS6C 3VU2A 5TE7H 3QDMD 4IM8A 4NWTH 1F3RB 1AIFA 1UXSA 2BSTA 4Q0XL 3KJ6H 3F62A 4H88H 4F9LC 3LIZH 4LASL 1MWAL 3WUZA 4NUGH 1CGUA 5F7DA 4Y19B 1FIEA 2KQNA 1JF5A 4JFHD 4IJ3C 1WWWX 4ZFFB 2J6EA 5EUOE 4I18A 2DQGL 4Y4KC 5CJOH 1LDSA 3MLRH 3TVMC 4LLYA 3HS0A 2WLZA 4LCYB 5AZ2L 4ZODA 4FQQA 5IW6B 3BGMB 4UINH 5FYLE 5C09D 3VD4A 4S1DD 4YHPA 4NQVB 1RZFL 3S4SA 1IMHC 4L29B 4XPHL 5DD3H 4HPYL 3L95A 2RJMA 4XNUL 4WFEE 1OT1A 5GGRY 2DM7A 3I3DA 5EO0A 2EIDA 4OV6F 3VDBA 4M62L 4U6XB 4RFOL 4M00A 2CRZA 1KC5L 3T77A 3KNBA 3UTOA 5I1IH 2ADIB 3UTTE 4F37K 3CX5J 2CDFA 3V6OE 5IHBA 3T65B 1QEWB 3JUZA 4NQED 2VABB 4QOKE 5C0BB 1SJEA 1LNUB 4J3XA 4AL8H 3S6CA 4C56D 5FCUH 2FX8H 4GAJL 4H5SB 2HLAB 1NGXA 2ID5A 1VESA 5M94B 4NO3A 4EIGB 1TCRB 4MJIB 1NAMH 2V9QA 3C09B 1MCWW 5C0GA 2J2ZA 3MRPB 1TJIL 1F00I 2FDBP 4P3CL 3GBML 5GGVL 4NSKA 1IT9L 8FABA 5DJCA 1B6UA 3D3VE 3SDDA 3GJFA 2OL3H 3PWPA 3L3KB 3O11A 5BOZG 2GJ6D 2WQRA 2BOCA 3RJDA 5DJ2A 4K8RC 15C8H 5D7JA 1I8LA 2DWDB 2A38A 4LF3A 2YPKB 4PRIB 4MAUH 1PDKA 3S3PA 1NAKH 2EIZB 1NMAL 1LO2H 1YEIL 3SQOH 4OFVA 5E5MA 5D93C 4MAYB 5HGAB 1XF1A 4OZFA 3WLBB 1KLFA 1ZGLP 4HFUL 5ID1B 2B1AL 4DOHB 4F7MA 3VGBA 4AIZB 3CD4A 1OOAA 2BCKA 3BP6A 5KVGL 4HHAB 1ZA3B 2W0FA 3FB8B 1FBIH 1YY8A 2WLYA 1K4DA 1A3RL 3F7RA 3QNXA 1MRFL 3LS4H 1UEMA 4OGZA 2Z4QB 4QF1A 1TVBA 2P47B 5L6YH 4I3SH 4AEHL 1IGMH 4O02H 5IMKB 4HIXL 4ZG1A 2M26A 5IB1A 43C9B 5C0CE 4PJFE 4XCYB 1RZJC 1AGDB 3LKOB 1T04A 3TN0A 1HH6B 1L9MA 4TOYH 3U2SA 4PJ7F 3LVEA 1WQVT 2UWEB 4EQ3A 1DCLA 4R0LB 1EUTA 4K3JL 3DURA 3QWRD 2CDEB 1EGJA 2IBGA 2A6IA 1A7OL 5C0FB 3VXMA 5IJKC 1D9KD 4GXUM 5KVEH 3TM6A 5K9OB 1BQHG 4G9DA 3C5JA 4OZGB 5IJVB 1NCCH 2NY4D 4YR6A 4NC1C 2UZXB 2YUVA 4GOSA 4HDIB 2VZUA 4NKOA 3RY5A 2IBZY 4PFEA 4WFFD 5TPWL 1LP9A 1G6RA 3L5WA 5EO9B 3IDMB 5HGDB 4I48B 2Y72A 4P9MH 5E2VH 2F5AH 2FJGB 1MJUL 3EKCA 4XI5D 2HTLC 1VEOA 2AXHA 1RUML 4A6YB 2X1WL 1P7QD 1UWGL 4N5UA 3H8NA 3TGXA 2GUOB 5T3XE 4KK5C 5F6HJ 4UIMA 1T89A 1H15B 3J7HA 4KKCD 4Z77B 3TNNB 5CD5C 3L3JA 2VLJE 4JAMA 2EXWC 5HHOA 4PJCE 1N7MH 4WHTA 3DX7A 1JUFA 2Y23A 3D69B 5T5NF 3KYMA 1YEGL 5T1KA 2DMCA 3RKPA 3ARQA 4XVTH 4Z8FH 4M5YL 4X4ME 4FNLH 4M03A 1HQRA 2I07B 1DP0A 3GRWH 1JZ8A 3OJ2C 5EB9A 1UENA 1ZLWH 2J5LB 4MB5A 3TWCH 4BA8A 2P42B 5DJ0B 1T1YA 4F9PA 3V5KB 3O9WB 1OWRM 3PJSA 4X0KA 3MLSL 4PGBA 4Y16C 3HE7A 3NCJL 3QZWG 2DQEH 4X9HA 1B90A 1L7IH 3SDYL 3RWDB 4LSPL 4OGXL 3ET9F 5FV2A 4ZYKB 3F6IA 2FSEB 4JM4H 1RULH 1S7QB 2R29L 3R4DA 1U8MB 4LIQL 1CQKA 1A6ZB 4NIKB 5J8OA 1YMMA 2WWKT 5E00B 4ZUTA 2X09A 4CNIB 3OWEA 2J8UA 4YXKL 3U0WH 3VFSA 1H8OA 3M17A 3MACL 4XNYL 5IQ7L 2RHEA 4JKPH 4PB9L 4DN3L 3RX8A 2R0LL 4ODBD 4X6EB 4ISVB 2DM4A 5EA0H 4JRWA 2MCPH 4WUKL 2DF3A 3NFSH 3MRDB 3K1KC 4X6FA 4ZPVA 2I5YH 5IQ9A 1T5XB 2HJLB 3L3DB 1IGTB 2QADC 2LQRA 5HYSA 5FA4A 4OCMC 1KELL 3QA3B 4PJHA 4RISL 1I3RA 4DK3A 1OTSC 4BFGA 5BJTB 1NJ9B 3BIBX 4F9LA 5KS9F 1N59A 5TDOA 1PGRB 3AVEA 1FCCA 1GCFA 3DBXB 4RAHA 4YX2H 1CL7L 4Z7OE 1TDQA 5HY9A 3CFDA 4Y4KA 1NGPL 5E2TL 5C6PB 3BPNC 1HINL 3TVMA 3DMMB 3G08B 1AD0A 2APXA 2GAZA 2XQBL 4Z0XB 5LAXB 5ICYA 1QLRA 3BZFA 4JLRA 2BVQB 3MSPA 3MBED 1FRGH 4XRCA 5D1QD 2JCCE 2AJZB 2EDBA 4QXGH 1OGAB 5B4MD 4AQ1B 4JFXB 4EBQL 3MJ9H 5E2UH 1QNZH 2WIMA 3EOAA 3AU1A 3S34L 5IT2H 1PG7L 2IQAB 1DSFH 1UEYA 2EE3A 3CK0L 2VLRA 1QFUL 1W2KT 4JY4B 2A74B 4NBZB 2UV3A 4WDIA 1LEKB 3GMPB 1T2QL 2YBRB 5GHWL 3V5HB 2CIIA 3F12A 3L5JA 1TVDA 3WE6B 1OAYH 5DMKB 4IRJB 2IAMD 2YKLH 2ITCB 3B9DA 4YHIB 1UWEH 4N0YH 3F6LA 4X98A 3JV4B 4JO2L 4L3EB 4RZCB 1AO7D 3QG7L 5MI0B 4DCQA 4X7SH 5EIIA 3MLUL 2IG2L 3T1FA 1WIOA 3RVTD 1BQHB 2APBA 2G60L 2KPNA 3RJQB 1BEYH 3VXSB 1MRDL 2FO1A 2CMRL 1P4LB 4E0RA 3F8UB 4K23L 1CVSC 4GMSH 2BY2A 1CD9B 1P4BH 1NBYB 4UMGA 5IIEA 1EVTC 3EJZD 3MCLH 4YHLL 5J1AA 1X5YA 1HSBA 1KCVL 1D6EB 1R3HB 2E7CA 4L1HA 5DYOB 1JF6A 3QI9B 4X5WB 3TYFB 3UTPD 3ZE0F 4Z78B 4HXBL 3TBTA 2AXFB 4UT7L 5KJRH 1G9MC 2YK1H 4X4ZA 4KKBC 3NIFE 2A0LD 5JXAH 3DO3A 4P2OC 2DICA 2VO5A 4WY7H 4M1CC 1DDHA 4KHTL 4E41E 3PABA 1FNAA 3BVNB 4NQEB 4XC1L 1CBVL 4HIHB 3SGKC 1QUNA 3UZEA 4FXGB 4HMDA 1HILB 1YEFH 2NY6B 3GSXB 3WIIL 4QHMB 3QP3A 4C56B 3CH1A 5DRZB 5EOTB 3N85L 4OCRL 5T33L 1X44A 1ND0A 2DQHH 4CN1A 1Z0NA 2VDRL 5DK2A 2GK2A 4FQIH 5EUOF 2C9AA 4TNWF 2FH6A 2R1YB 1YY9C 4N0CD 4NQSA 1DQMH 3LKNB 1PY9A 4FXKA 4WTZG 4WI6A 1KCUH 5DRWA 3QZWB 4RMSA 4HXAH 3RWCA 1G1CA 3ULUC 4NRZA 3B9VA 2GJ6B 5E8PA 4Y4HD 3CXHK 5SWZA 3P11H 1ZXQA 5DEZA 1QO3B 3PL6D 1JNHA 4Q0XH 4F58L 4LASH 1U3YA 5EU4B 3HC4L 3QNZA 4HBQA 4F80A 2X4QB 3G6JB 1J5OH 4J1UA 4TULL 1A1OA 4CADA 2ZSWB 1LEIA 1A6AA 4POYA 1X7QB 3MFGB 3Q5YA 5BOPA 2EE9A 3OX8A 1JZ2A 5IUSA 1QKZL 2Z91A 5AZ2H 5J9PA 2FBJL 3BW9B 5GS1B 3E8UL 4N8VG 2YUZA 5J7CC 1RJYA 4LOUC 1CN4A 1RZFH 5I16B 2NMSA 3ARPA 1FSKB 3NPSB 5FEBA 4MX7A 4XPHH 1MVFA 3U0TA 4HPYH 3QJHA 2HJFA 3MLZL 5CGYC 4XNUH 3FRPG 3HZKB 4GAGL 3PV6B 2FHCA 3UJTL 4WO4C 1KXVC 4KTDL 4M62H 4XGZB 2RFXB 1A14L 4Q2ZB 1F2XK 4RFOH 4KKAD 1KC5H 2BC4A 4I9WD 4MB3A 3HZVB 1YEJL 3FQUB 3W39A 25C8H 5I75B 4QHNA 3OF6A 4KI5D 4S1RL 1CXHA 3HNVL 2DN7A 5EBWA 4F33A 5HHMD 3T0BA 4GRWE 5I1DA 1MAKA 2L4OA 4GAJH 1FL3B 5FO9B 4N90D 5DHVH 2C1OA 1U8HA 1KV3A 1JWUA 1TJGL 4PRDA 1N3NB 2NY4B 4R90L 3WHXB 3L6FB 5CBEB 1XGRB 1TJIH 2ESVB 3GBMH 4P3CH 5GGVH 1IT9H 5FYKE 3BH8B 3SDDD 1EHNA 4Y16A 4UT6L 3L3HB 3EW3B 3PWPD 3WS6A 3B3IB 1E4JA 1JWSB 1ITCA 3PDDA 5GSRB 2BY3A 4ODSL 2F74B 2LVCA 4JG0L 4MJ5A 3D39D 5D7JD 2J6EL 1J0ZA 4Y4FA 1P53A 4KMLB 3W5NA 2XTLA 4PRBA 5DA4A 4DFIA 4X6DA 3QQ9D 3HRZB 1N0LA 3CZFB 3MRMB 3LV3B 3RUGA 4GS7B 4L4TB 1CFBA 1S7RB 1NMAH 1YEIH 3GJFK 3IDUA 4V1DA 3RGVD 3MC0A 2XWJB 1Q9LB 3WHE0 1DL7L 4KGJA 1SM3L 3T08A 3G04B 1LE5A 4PJFF 3UZVB 4O2FA 3P0YH 2A2QT 4HFUH 5BZDA 4ETYA 2HTKD 3KXFD 2B1AH 2OR8A 2HFEA 4QT5B 2V5MA 3EYFA 1O7SA 2WIIB 3C6LD 1FN4B 4QRUA 4CVUA 5KVGH 3VFOB 2VMFA 4R4FL 4OZ4A 2OS7A 5DZNA 3UTQA 1HHIB 4JPKL 1RJLA 4R3SB 1A3RH 3HTLX 1MRFH 3VRLF 4YIQB 5FA3B 4HKXA 2RAMA 2DWEB 1A5FL 1HQ4A 4Z7VF 4GW4A 1S9YA 4JFOA 3NOIA 5T3ZL 4AEHH 5LJYH 3U46A 2B4CL 4HIXH 4I4WA 5F44A 5GGSY 3TN0D 1J1PL 2HFGL 4NKIL 5CWSA 4HC1A 2F19L 3AS1A 3VE0B 1RIVL 1H3XA 1XGUA 5HYJB 4U1NA 5DJZB 1T20A 3WN5C 3X12B 2WUCL 4UIKL 4JDVB 3PQYD 1I7RA 1CG9B 1CD8A 4K3JH 2XKUA 3JV0A 1KUMA 4U0RB 1A7OH 4MD4A 4PJCF 1T1WA 2XWBB 2G9HB 4JFZL 3GIVB 4C4KT 3VG9C 4QHUA 3MV9B 4AM0B 1FJ1B 4M8VA 2FZ3A 5AYUL 4OIAA 1ED3A 3ARDB 1BM3L 2E27L 4G6AD 5TPWH 2FRGP 3SKNB 2ZUSA 4OLVL 3QJFA 3JBG7 4KZEL 1MJUH 1OTUC 4JQVC 3WFDL 3CDGA 1DJSA 1RUMH 1MLCA 2C3HA 1UWGH 3HMWL 2BOBB 3NFNB 4PJDE 1FZOA 1KCSL 1KIRA 5JW4Q 5HHOD 2H6PB 3HC3L 1ORQA 4ZFOA 4ZUUA 1W0YT 3MRFB 1AHWB 5GS0C 4R97C 5EFIB 2X4SA 5HDQL 3RVUD 2VZSA 4KTEH 5T1KD 2O5YH 1YEGH 4OZHB 1XF2B 4N8VB 1HXMA 1YC8A 2APVA 3QFDA 4M5YH 4L4VE 2X4TB 3PHQA 2NY0C 1VFUA 4EUPH 4ZO7A 3IDNA 1X6NA 5C8JB 5AD0B 2ICEA 1R5IB 4EN3B 1PD6A 1D5MB 2YA1A 3FTGB 3MUGA 4JO1L 5JHLL 1CFQA 5HHXL 4NN5B 3MLSH 3VFMA 3NCJH 1CL7I 1I3UA 2QQKL 1Z9LA 2F8VA 3SDYH 2XN9B 1T1ZA 4LSPH 4N1HB 4OGXH 4OZIB 5F7EL 4K7PH 1KLGA 4JZNA 5K9JL 4P2OA 1YYLL 2HMID 3L5IA 3NZ8B 1O7VA 2R29H 4F2MB 3SGKA 3NZHL 1EGJL 4LIQH 4JRYD 1YMMD 3CXDH 1ZTXL 3M45A 4X7EC 3QUZB 1NCBL 1CDYA 1R5WA 2CXKA 3QUXA 4O2CB 4YXKH 3SDCA 1DN0B 5EZLB 2R1WA 3UDWA 4JFYA 4Z7OF 5GGUB 4UQ3B 3KLHC 3MACH 4XNYH 5IQ7H 1F4WH 4PB9H 4PJEA 3W11D 1AD9A 4DN3H 2P5WA 4R7NA 1PVHA 2R0LH 3ZKXB 5CJQL 3H0TB 5HHNA 3QEQE 4QWWD 2ARJA 1G6RL 4WUKH 3GMMB 4YEEA 3JTTA 4XAKE 5DJDB 5KBNC 2AABL 2FEDC 4R8WL 2E7MA 4G6FD 3U48A 3MR9A 5ITBL 3L7FB 4MD0B 4XX1G 1KELH 2IH3B 4ZS6D 3S35X 2EDRA 5F3BA 3D6GA 1A9EB 3GHBL 4PJAA 1FFQA 1PX4A 4YFDB 3REVB 3PP4L 1B6DA 4PGCA 1CIUA 2BXYA 2NY5L 1IGYB 1CXEA 1ES0B 3NCEB 3GSUB 4PJ8A 5K59E 3PWLA 1J8HA 1CL7H 3BKML 3I50L 4Y4KD 4GG8A 1A7RL 1NGPH 3C60B 2CUMA 4QTIL 3IXTA 3TVMD 2E8ZA 2C4XA 5DC9B 2XQBH 1PQZB 2OSLA 1PSKL 4K7PX 2VZ3A 5J57B 3VFVB 1IC4L 2ATPB 4EBQH 3RI5K 4S1QL 1AGCB 1YPZB 2AJ3B 3WIFB 2BSSA 1XF5B 1U41A 3IETB 4HAGA 2X4OB 3S34H 5CSBA 1PG7H 1VCAA 2VLRD 1INEL 3CK0H 1QFUH 1OLZA 5B3JE 1I1FA 2I9LB 1A7PL 3BP4B 4QRRB 3VWKC 1T2QH 5GHWH 3CFKA 2P8LB 1RZIA 1KB5A 1FYTE 1XIWB 2C7UB 2DI8A 3MRKA 2K9UA 2W38A 2ZCLL 1PZ5B 4JO2H 5HHQB 5IOPB 1BVLA 1T7YA 3QG7H 4KQ4L 5HTSA 2NW3B 3MLUH 4PJ5A 2IG2H 3E6HA 4MQSB 1LWRA 1SBBA 2G60H 1JYNA 3LQZB 2WWKO 1MRDH 2CMRH 3GK8L 4HIIA 4K23H 1FAKT 1CD1B 3G5XB 2AK1L 1ZT7A 4TUKL 4Z76A 4NO2A 3VGHA 4YHLH 1CFSB 2ZP0T 5FGSA 2ATKA 1KCVH 4NM4L 4KXZH 1P4IL 1G6VK 4NQCD 4OCSL 4BFBD 4K8RD 1QRNE 2PN5A 3VFTB 1KPUB 5DJYB 3ZDXE 4HXBH 2XFXB 4UT7H 2I27N 2OZ4A 1CFNA 2GT9B 2LU7A 4I2XB 4N9OB 5I8EB 1Z5LA 2E9IA 3I6LD 3EYVB 5E4EB 3MCKA 4MA1C 4KHTH 4XC1H 1MAML 2DBLL 1CBVH 2VZVA 5C9JB 5CS7A 5L2KA 1TZGL 2GEEA 5M95B 3DRTB 4J8RA 5IBLC 2A77H 1NDMB 5FXCH 5IK3A 1PG7X 3N85H 4OCRH 5T33H 4BSWB 3HUJB 3KHOA 2YD7A 5J0BA 1D7FA 1FLRL 3FB6B 4XBGB 1I4FA 3VMPA 1KTLB 2VDRH 2IANE 3T4AB 3D2UD 3TP4A 3JV6B 3FT3B 3CU7A 3QDJE 4JANB 3JUYA 1ACYL 4G42B 3LY6A 2APWA 5D1XB 3EO9L 2FX7H 5CSGA 1QQDB 1MCOL 2NR6C 3ARZA 1CLYH 2LVEA 4OAWA 3MRJB 5ICZB 5SWZD 3FFCA 4BFEA 4RIRA 2NW2A 3D39B 3CIQA 4XMLL 1ZLVK 3T8XB 1MCSA 2PUQT 4Y1AB 4F58H 3Q2CA 1KPRA 3TH2T 1WBYA 3DX8A 1Z3GL 4LHQB 4TULH 4UU9A 3WN5A 1MCFA 2CK2A 2FL5B 5FGBC 2AKRA 4N1EA 3PWUA 3VXOB 4TUOA 2V5SA 3EJJX 1F45A 1QKZH 3KXFB 1KTKE 1AP2B 3U7YL 3OKMA 5LGHL 3E8UH 4YO0A 4U05A 2VLKB 2G75A 4JRXA 3WUWG 1XFPA 3C6LB 4X9GA 4PYHA 3BO8B 4PJBA 4KK9C 1HHJB 3FJTA 4ODXB 1FL5A 1T3FA 4XZUB 1WFTA 3RWGA 1HWHB 4GAGH 2DYPB 4YGAB 4G43A 2P45B 1A21A 3IU3A 3UJTH 1INDL 4IHOA 4KTDH 4NPYA 4RBPH 1A14H 4R7DB 1HHKA 2HTLD 1XGYL 3RWHB 3QULA 3RL2B 4KK8C 4KK5D 3QIBC 1YUHA 2X40A 4NN6B 3DUSB 2OL3B 5CD5D 2EXWD 4S1RH 3C5SB 3HNVH 3C8KA 1HDMB 1ZT4A 3CFBA 3W81A 3PQYB 1KCKA 3OZ9L 4MA3A 2L7JA 2GJZA 3QIWB 4NRXA 2R0WL 1CFVL 2FYYB 5HHPA 4KKLC 5DK0A 1MRCL 5D2NC 3E2HB 5FHAL 1IAKB 3GSNB 3TZVA 1TJGH 3TBWB 3M1BA 3ZZ1A 4YFLF 1H3TA 4ZSOB 3BUYA 4R90H 1OSPL 1BIIB 1E27B 1JF1B 1NBZB 3WJJC 3RHWK 5D70L 5IMOA 2YPLB 4Y16D 2D7PA 3MRRA 4F7EA 1MCHA 1F42A 4UT6H 1RZJL 2C1PA 2YWZA 4DVBA 3SY0A 4ODSH 5CILL 4JG0H 1YN7B 4LBEB 5ELIA 3U9UA 1DBML 2GW5A 1WZMA 2J6EH 5KG9B 2Z93A 3UTSE 3TJHC 4YXLL 3T3ME 2J1KA 3X3FL 2C3VB 4Y2OA 2NTFA 3UTZB 3NA4A 3Q5TA 3FN9A 4N0FB 5DA0B 4V1DD 2C3GA 1DL7H 1SM3H 5D7IB 1I1AB 1R5VA 4I5BA 1FIGL 1EBPA 1K8DB 3BKCL 4NYLA 1QBAA 2DTML 2APFA 4ZOAA 5JIKA 4P4KB 5MEQB 3QAZC 3ZDYF 2QADD 3V6ZB 2BHYA 3G5ZB 4HUVA 1JYXA 4PY7A 4R4FH 3U6RB 3S37L 1OTSD 3VCLA 1BJ8A 3VXRA 2UVFA 3IDGB 3MRHA 4JPKH 4PTUA 1S5HB 5CLTA 2YEZA 4MDIB 2P8PA 3BZ4A 1I1RA 2P8MA 5ANME 1KBGH 3QR2A 5LWYH 1XGPA 1A5FH 1ETZB 4Q6IC 4QLRA 4YBHA 1JPTL 5T3ZH 1ZHBB 2B4CH 4KDVA 3VXPA 3VI3F 1NKOA 1J1PH 2HFGH 4JRYB 1OLLA 4NKIH 2F19H 1RIVH 1DLFL 5JDJA 2OJEB 1FFRA 1U9KA 2WUCH 2R2EA 1IAOA 3I3BA 3BIKB 4X6CA 5MERB 5DF0A 4MNHA 3NH7L 3MNZA 4IOFC 5FUCC 2Q87A 4HKZB 3QUMA 1MJJB 3GJFH 1MCLA 4LCCB 5J1TC 3BEWA 5CUSL 4XWGL 5E94B 2F58L 3HI1A 4JFZH 1TQBB 3R06A 4ERSL 1QFWL 3I02A 4QYOB 5AYUH 4KJYB 1OAUL 3ZKNC 1BM3H 2E27H 3FOMA 1XGTA 5FKPA 4OLVH 4RNRA 3ZE2E 2EE6A 1ZLSL 1Q0YH 1X4XA 3SDXB 3VWKA 4KZEH 3WFDH 3QEUB 3U4AA 5IVXA 4Y5XC 1JRHH 2RGSA 3ARYA 3HMWH 3DX9A 3LPWA 4QRQB 4LVOB 4OZHE 1X4YA 5JORA 1KCSH 1ZHLA 3HC3H 4XCEA 3MUHL 4HS6A 1CICA 2OP4L 3O41A 5TQ2L 3P9LA 2Q7YB 1CF8L 1KYOJ 1TZIB 3QEQA 2XA8L 4FRWA 4N0UE 2W07A 1LD9B 2UZIL 1T03L 4Y5YB 2MPAL 4Z7WE 2GY7B 1XGQB 4FTVB 5F1IA 2XN9E 1U0QA 1G7JA 3IKCA 4PJIB 4JO1H 1DUYB 1GL4B 4TVSa 5JHLH 2ZUXA 1U6AL 3NCBB 1MVUA 5HHXH 4LSDA 3QRFM 4WEMB 2W0KA 4UQ2B 3IJYA 2QQKH 4O2EA 4PRNB 2EDHA 4G3YL 4KKBD 3K8MA 4NT6B 4RGOH 4P2OD 5F7EH 5K9JH 5E7FA 2HT3C 1YYLH 3QUKB 4M1CD 5KSBB 3DX6B 3G5YA 4K3GA 5FUOL 4JREC 3NZHH 1EGJH 1ZTXH 4LKCA 5DUBB 5D7LD 3EDDA 2VYRE 2V7HA 1NCBH 1T7WA 4WNQA 5JR1L 1FZMA 1LO0H 3PG2A 1H3VA 2IPUK 1YY9D 4MHHI 3CVHA 5GS2D 4LCWE 1FVDA 1G7QA 5HVHC 2A1WL 3I6GA 4K7FB 1G6RH 3O2WL 2R2HB 2VXUL 1T5WB 4E5XB 1XAUA 4MXVE 3AXLA 2DJ4A 3ULUD 2AABH 4XXDA 3U79A 1UM4L 4R8WH 4P5TB 5IHZB 1UB6A 2R56L 2CLZA 1MF2L 2J8HA 5ITBH 1QLFB 4NQCB 2C3XA 5CAYB 4K3DL 1SVCP 4C4KO 3GHBH 1I85C 4KUCD 2E6PA 1JHLL 2P46B 5L8KB 2X41A 4I3RL 3PP4H 4ZFOL 4KAQL 3STLA 2F53A 1G7HB 2NY5H 4WWKA 5TH2A 4DVRL 4C83A 1GZPB 3QDGA 5B3JF 3V6OC 3BKMH 3I50H 2BHZA 5FGBA 2IPKA 3SCMC 1A7RH 2YN5A 4QTIH 5JXEA 4EXKA 5C0IB 5IMMB 1HK6A 4BSVA 4Y89A 3OR7A 4X9BA 1CXLA 5ISZB 1ZWIA 2PYEA 5GRYA 3QEHA 3D2UB 4ZUSB 5A16A 1PSKH 2VR4A 4LOUD 4IOIA 3V5DB 1SJHA 5JHDE 1IC1A 3RFZC 1IC4H 1G9ML 3O6FC 3WKML 4S1QH 5CGYD 4OTXH 4HCRA 5EU6D 5BRZE 4PY8I 4UUJA 4WO4D 5CEZE 4XWOC 2Y5TB 4GFTB 5DHYB 3ZSTA 1BZ7A 1INEH 1NDGB 2BNRA 1TTGA 2Q8BH 1WCBA 1JGDA 1NC2A 1VA9A 5DMJB 1TFHA 1A7PH 1OW0C 4HAFA 3QIBA 5CZXC 4GAYA 3FQWB 3ECBB 4JFED 4OD1L 5CBAA 5D8JL 4RFEB 2ZCLH 5TDNB 4UZGA 3KPPA 4OFPA 2GQHA 4HH9A 4L8CB 2IANA 4KQ4H 3DIFA 5D2NA 4IRSC 2EYTB 2OR9L 3ZYOA 4OF5A 1PKOA 5GGRA 3GK8H 3E1F1 3WJJA 1RVFL 4ONGL 5IGXL 3K2UL 1A7BA 2AK1H 1BOGA 4TUKH 5IW3A 1EBAA 1MI5B 5B8CB 1VACA 4NM4H 5K9KA 5E8NA 1P4IH 4OCSH 5I17B 1WF5A 4N0RA 3VGAB 3H6JA 4NHCL 4NKMB 5HJ3B 5C0AE 2PW2A 1OM3H 5F9DC 4LMQI 1EZVX 2FB4L 5ALCL 2AJXH 2AEWA 2ZOKA 1V7ML 5FO7A 4KH2A 3GMRA 1F11A 4PJXE 1MAMH 2BP3A 2DBLH 3UYRH 5L2KD 1SY6A 3QIUC 3TLRA 1G7LA 1TZGH 2GITB 1G7IA 1BIHA 4L1DA 2HN7B 4QRPB 1OHQA 1W0WB 5EPMA 4L8BB 5IB2B 2DM2A 1GRWA 4KVCL 2HG5B 2ITDB 3BPLC 3KYNB 3PXJA 1FLRH 4LLDA 4XXCA 5F88B 3V0AC 4O9HL 1OARL 2VL5A 2D31A 4ZPTB 3QXVA 1FFNB 5BS0A 4D0CA 1ACYH 3Q6FB 4KJPC 3O3BA 3EO9H 2ZOLA 4XVJL 3IAPA 3IF1B 1ZHKB 3GMOB 4TPRL 4G8GA 1S9XA 1MCOH 5KS9A 3FFCD 4X5LA 1KB5L 4G6ML 3I6KB 5T1LB 4GW1A 3NCMA 4PG9A 1D5BB 2X1OA 4XMLH 4P5MA 3CUPA 3MMEA 4OCXL 1A8JH 4TUJA 5F21B 4PTTA 3NPZB 3MLWL 3CFJA 4POZC 1R3LA 1Q8MA 1BJ1H 4G7VL 4YHYB 1H3WM 1Y6NR 1Z3GH 4APQC 4K71B 3ARSA 1S7SB 4HH8A 3ZSSA 3STZA 3H3KA 4LGSB 4WTWA 1AKJB 5ESAA 3WFCL 2EDOA 4ETQA 3J8F7 4HX1B 3DXAA 4BQ8A 1BD2A 3CCHB 3MRNA 2XRAL 1ZA6A 3U7YH 3EIFA 1BWMA 5C08A 4V2CB 5LGHH 4JRXD 1KIPB 4JFFE 1ONQA 2QADB 1I8IB 3PGCB 4EI5C 2XQYG 2AXGA 2L7UA 2OZ4L 4OCWL 3MRIB 3ARFA 1RUQL 3H9HB 3FT4B 1ZS8B 4WFHE 3O3AB 1INDH 1OTUD 5GRVL 3NFPB 1UB5A 1XGYH 1SMAA 3TO4D 2Q3ZA 1AJ7L 3D18A 3P73A 4CU6A 5E1AA 4HWZB 3K0WA 1MFEH 2MFNA 1CE6A 1ZLVH 5GS0D 3T3MF 2MNUA 2W91A 3QG6B 3B5GA 1X5AA 1DBBL 1SJVA 2FCBA 2HJKB 5INCA 3OZ9H 3MLTB 3AUVA 4ZSOE 5KN5B 2R0WH 1CFVH 5IF0A 3RX7A 4QNPE 3B5TA 4M6ML 1MRCH 2NY0D 3HB3C 5FHAH 2ED9A 4UAOC 3MLVL 1OSPH 1WISA 3BP7A 2G5BB 4A2LA 5D70H 1K8IB 4LL9A 1OB1B 3B2VL 5IB4B 2V2XA 1FFPA 1RZJH 1T2JA 1OAKL 4LEXL 3KJ4C 3AB0B 2DB8A 1UZ8B 4PYGA 5CILH 4MS8C 1DBMH 3ARWA 2CQVA 4YXLH 4NNYA 2PXYC 4R2GB 3TT3L 2UY7A 5EU3B 1T7ZA 3X3FH 2IGFL 1F4YL 5D7IE 1CK0L 4BQCA 4YUEL 4MNQB 1Q1JL 4PRAA 3OHXA 1IGIL 3EO0B 2CIKB 3RVXC 3D25A 3U36A 3KLHD 5C0EA 1CT8A 1K3IA 3GUTB 1QFWI 3K46A 5DVLA 3HZMB 1FIGH 2P5EA 4S2SA 5F3HA 3O4LE 1HYRC 4KJWC 2GCYB 3LAFA 1TNNA 3RPKA 3BKCH 2DTMH 2GTZA 1X5HA 1MFAL 1OPGL 3NVQA 2FR4A 2FEDD 4Q6YA 1BWWA 2A9NL 3OJDB 1U95A 3H3PL 2AS5M 5HVFB 1FVCB 3S37H 2EEDA 3LS5L 3MRGA 2H32B 1I85A 4YEFA 1H8NA 1MFCL 3O3DA 4ONHA 3BD4A 1JPTH 2XACC 1XH3B 5K9QI 4DGYH 5C0NC 4W4OC 2PW1B 4UDTA 2OBGA 3SCMA 4BZ2L 3OKEA 5IVNA 1DLFH 3BOVA 5ENWB 1MIEL 4KMQA 4I0KA 3NH7H 1I7TB 3LQAL 4OZHF 1A2YA 4ZUVB 3I3EA 5CJXC 1QFHA 1MREL 5CUSH 4XWGH 3O6FA 1KN2L 2F58H 3NTCL 2R69L 3OKOB 4AT6B 1QSEB 3QHZL 4ERSH 4OKVB 1QFWH 1OP5K 3KPRD 3TT1L 1OAUH 1DEEA 4MNGB 4Z7WF 4NDMB 4KU1A 1IGCL 4MCYA 5EBMB 1F13A 2P7TA 3VWKD 1ZLSH 4XP4L 1EEZB 3QO0B 5D2LE 4D8PB 2VDQL 3GI9L 3LEXB 5JW5A 2YRZA 4NJ9L 4AIXA 3W0WD 2ADGA 5EDXA 1FO0B 4Y5VC 2JIXB 4P5KB 3AMLA 4XP5L 3VXUA 2BNQE 5C7XL 2O61A 3GI8L 3WHE1 1FNGB 1OQXA 3SJVE 3S37X 5E9DB 1P7KB 4N8CL 5I8CA 5KZCD 1KF9B 2OP4H 3OXSA 1JBJA 5TQ2H 2O5ZL 4HD9A 2ORBL 3O6LL 1JMZA 1CF8H 5D96C 3V6FA 2XA8H 1CWVA 4FTVE 2VB5A 5MENE 2Z9TA 4U1JA 5T5FL 1WCQA 2RBLA 4X7DC 4XHJC 4YZFE 2UZIH 1Y18A 4QXTA 1T03H 2DRUA 3K8LA 4NKDA 1A3LL 3LOWA 2MPAH 1A1MB 4U2ZA 5IW1B 1UT9A 5EU6B 1DLHB 1JL8A 5T3XH 1KT2B 3T0AA 1I7UB 1U6AH 3NCCB 3EGSA 1WK0A 1J87A 5E6IA 4MLIA 4MXVF 4JO4L 2P24A 5ESQA 4KY1L 4D9QE 1X9QA 3EO1A 4JFEB 4KDWA 2ZJSL 1XR8B 4Z5RA 3QUML 5FUOH 4OJFL 5SX5H 5B39A 5IBLD 2OK0L 4OD2B 1FC1A 1CE1L 1J9CT 3BN9C 5I6XB 1E4XL 3M8OL 2ZSVA 3KLAA 5JR1H 4XHQA 4WHCA 1GXEA 4H25B 1P84K 2RCSL 1V3LA 1J05A 3WEXB 2W60A 4C59B 5FF6A 2VTFA 2FLBT 2A1WH 3VFPB 1DQJB 4XPBL 1T1XB 3O2WH 3RNKA 1H3PL 5D72H 3ALPA 2VXUH 1YPZF 3MQIA 4U1SB 4YQXL 4CJ1A 1SYSA 2NR6D 2VLME 4HUUB 5DFWH 1UM4H 1UVQA 2R56H 1MF2H 4LPTA 4Z7VA 1E6JL 5GQBA 3BYTA 1KJMB 3HI5L 4NQDE 5ADOL 1ZK9A 1JHLH 1G0XA 3QISA 4I3RH 2WP3T 4KAQH 3X14B 1NCAL 4Y7MA 2F53D 4JFDA 4DVRH 1W8NA 2R1XA 2CDGA 4APQA 4LPYA 1FL6A 3DSNA 3D85D 3NBNA 4ONFL 4WI7A 1L0XA 3WV0A 5AEAA 2R0KL 3SE3C 4N1CA 1RHHB 5DT1L 3RVWD 2PYED 3MV8D 3C09C 4LAJH 1QD0A 3D5OF 5B38A 1OF2B 3H9SA 1DANT 1IARB 1JPGB 5DJAA 4F3FA 1V05A 1OSZA 4KK9D 3CSBA 4EI5A 1G9MH 2J7LA 3WKMH 1D5ZA 5ITFA 5FYJD 2VXVL 4NWUL 1JHTB 3HLAB 1KENL 5DSCB 1U58B 1ZV5A 1DVFC 2I9TA 1YEDA 3DYOA 1WLHA 3HAEA 5E8OB 3PWNA 2DQJL 1A0QL 3IRPX 4KK8D 1A1NB 3HG1B 3QIBD 2Z35A 1KIQB 1O5DT 4Z95L 1XZ0A 4MAYC 3NGBC 2WINA 1KTDA 3CVHL 4OD1H 5FDYA 5E7BA 4TSAL 5D8JH 3D0LA 5F97E 2MQ0A 4KKLD 4M8QA 4PJXF 4XP9L 3SKMB 2VQ1B 4YWGL 2P4AB 3SDAB 1FDLL 3L7EA 1LE9B 4HGMA 2OR9H 3I75B 3QUYA 3V2AR 4YBLB 1ZSDA 5J6HB 1RVFH 4ONGH 1N64L 1YN6B 3K2UH 5IGXH 4M61B 3TCXA 1RK1A 3KPNA 1N5AA 4RMQA 2D03L 2Z8WC 1V8HA 1X5GA 4WW2B 4M6OL 4NHCH 3TJHD 3TO4B 2D7TL 1ZKAA 4GRMA 3QFJB 2VKWA 5DTFB 5C3TA 4QCIB 2FB4H 5ALCH 5DZLA 1UJ3B 1NFIB 3VFWB 5IM7A 4NKQB 3G9VA 1XCTA 1V7MH 3WDIA 2F15A 2JK5B 1LK2A 2AK4B 4R97B 5E70A 2EYSA 4R0LC 2CRMA 5C6WH 3AS0A 3MV7E 3P4MB 5TE4H 1TZHA 2LFGA 4Z7UB 4LPVA 4R96A 3S7GA 4HCRL 2AV7B 3HR5A 4KVCH 1NGWB 4RQQB 5FYJL 5L2JB 4RGNE 4O9HH 1DBKL 1OARH 2HT2C 3CLFL 3BN3B 2QSTA 4JFQB 3FO2A 5C0JB 5E03A 4OGAC 4F7CB 2APTA 1NGQL 4XCNB 4U1IB 3QHFL 4YPGB 4IMKC 4X7TA 4XVJH 2VAJA 2V5RA 4TPRH 5GGQL 3PHSA 1ADQA 43CAB 2HVKB 4PLJC 4G6MH 3IFNL 3CU1A 4CMMB 2NLJA 1WAAF 4OFDA 2SEBB 1MHEB 3FMGL 3L5XL 5BVJB 5E24E 4P2QD 3FONA 1OCWL 2WUBL 4OCXH 2EDTA 3MLWH 4W4OA 1U8QA 3HCVA 4G7VH 3LZFL 1ZAGA 5D7KE 4OLEA 1F4HA 3LQMA 3LKRA 4DFHA 5ID0A 4ODUA 1WITA 4LLUA 4IOFD 5JW3L 3WFCH 1BD2D 1XCQA 4MD5A 4NRYA 2BXZA 3RAJL 2GTWA 2DMBA 5CJXA 1AGEA 2XRAH 5C08D 3RBSA 3OL2A 5ICXA 1T0MB 5DRXB 2J5LC 4JDZA 1Y6KR 3DV6A 4YFEA 1QR1B 1S7TA 2H8PB 3O9WC 4IDLA 3EDKA 1EAJA 1YMHB 1UXWB 4PGDA 5JOFB 3ZKND 4OCWH 1IILE 1LK3L 1RUQH 3KPSA 5GGSA 1FVEA 4PS4L 5D6CB 4TTGA 3Q3GB 1P1ZB 1TETL 2DQCL 3QDME 1U91A 4CVZB 1SY6L 2A6DB 2PF6A 4G6KL 3EZ8A 4ORGB 4TVPD 2YD6A 2N56A 4JFHE 1FG2A 4WW1A 2AEIT 1AJ7H 3CC5B 3ULVC 5DQJB 4Y5VA 4D2NA 4G8EA 1PYWA 4OFIA 5EIVA 1W0VB 5F7UA 4TSCL 3LD8B 5T5NG 3ZKSD 1K85A 5DEFA 2EO1A 3U0PB 1DBBH 3R0NA 3O4LA 2GSGB 4P3DB 5D7IF 2KH2B 2R2BA 2AP2A 3V4PL 4GH7B 4LSRL 4M6MH 1MHPL 5C09E 1AXIB 1YEKL 1P9MC 1GZQA 5DJ6B 5ERWB 4PJGA 2GKIA 5I2IA 2BMKA 3MLVH 1C7SA 2VLLA 4YHPB 4JPIA 3S4SB 3BMWA 1I9RL 3B2VH 5D6DA 1UKQA 2MWCA 1S7XB 2AJUL 3WNMA 1OAKH 4GRWH 4LEXH 1XEDA 2JJTC 4Y19A 1EEQA 2HT3D 3LRSB 4NC2B 1WFOA 3FQTA 2DS4A 3TT3H 2AVGA 3ZDZE 1AR1C 4RMWA 4M43L 2IGFH 7CGTA 1F4YH 3ZL4L 1CK0H 2VOTA 3CPLA 4YUEH 2VDOL 1QSFB 1HE7A 4LCYA 1IGIH 3KR3L 1FNLA 5SWSB 3BGMA 2X9WA 5J6GA 4MQ7B 2ZWLT 3OR6B 2P5ED 4YDLB 3PF2A 5B22A 5AUMB 5SWQA 1Z9OA 4QRTB 4WI5A 5T1DL 4L29A 4NJAL 6CGTA 1M7IB 4M6NL 5FUZL 4JQXA 1XT5A 1MFAH 1OPGH 4LRNL 3MODL 2DDQL 2A9NH 3QXTA 3H3PH 4TVPL 1T83C 4NSKB 3JWDC 4WFED 3LS5H 2ADIA 4M4PA 4NQUA 4RRPG 1MFCH 3VD3A 3T65A 4FFVC 1QEWA 4MA1B 5HYSG 4GBXD 4HG4K 2VABA 4IRJC 1IKFL 5C0BA 1H8SA 1LNUA 2WMPA 4U3CA 3EDJA 1G1YA 4LF3B 3SCMD 4BZ2H 4QOKD 5MI0C 2HLAA 4POUB 1MCCA 2DLTA 4Q9RL 3SE3A 1M6OA 1KG0A 1MIEH 1TCRA 3NN8B 1D3CA 4QXUL 3O2DA 4MJIA 4ZO6A 1IEAB 4YXHL 1EV2E 3LQAH 4P2RB 3MRPA 2R4RL 1ODAA 4MCZA 4A2MA 1MREH 3O6FD 4OBRA 1KN2H 4D0DA 4TRPL 2OLDA 1M7XA 4U1HA 3NTCH 3L3KA 2R69H 1Z6JT 3KGRA 1VHPA 4JKWA 3QHZH 4XWOD 2F5BL 4M6AA 4PJIF 1DE4A 4G80B 3QI9C 3TT1H 2DWDA 1YQ2A 4P4RA 3WJLC 5LGKA 3QNXB 4PRIA 3VA2C 1IGCH 5C6TL 1A02N 2EIZA 5CZXD 4PJ7B 4XP4H 4K2UL 1HCVA 2VDQH 1E4XI 3GI9H 3FB5B 1MY5A 4NJ9H 4MAYA 1M71B 3DI2B 2NY6C 2XKNB 5HGAA 3VXUD 3D85B 4XP5H 5C7XH 3GI8H 2Z31A 1TENA 2VJXA 4N8CH 4IRSD 4LIQE 3DO7B 1FNEB 3MV8B 2O5ZH 4AIZA 2K1MA 3O6LH 2ORBH 5TQ0L 1IM3B 4F7TB 1CGWA 4KFZC 4B7IA 4HHAA 1ZA3A 4EDWL 3DURB 3FB8A 5T5FH 3VXMB 1EIBA 1C5CL 1A3LH 5I74B 2Z4QA 4OLXL 3QH3B 4KUZL 4WFFE 1AI1L 5DJXB 4NQDA 4QXWA 3PWJB 1KACB 5IMKA 4JO4H 43C9A 4XCYA 4KY1H 1OP5H 1AGDA 3LKOA 3LRHA 1G6RB 1CIDA 1HH6A 4RAVB 4MJ6B 4PUBL 1F8TL 2UWEA 1RIHH 5C0CD 2ZJSH 3QIUD 1LILA 2MOVA 3QUMH 4N9GB 4OJFH 3QCUL 5CD3B 2NY3B 3H42L 2HLFC 2CDEA 2OK0H 1CE1H 5C0FA 3RY4A 1B0RA 5GS1C 4LDEB 4D0BB 5K9OA 1BMGA 4OZGA 1E4XH 5BV7L 5IJVA 4PRHE 3V6BR 3BESR 2RCSH 1FSKC 3JWNC 1N2RB 4HDIA 3GIZL 2QQNL 4KJPD 4XPBH 4JCLA 2W65B 1LO4L 1N4XL 3GO1L 5HGDA 5EO9A 2Z8RA 2QSQA 2FJGA 4GXUN 1U8JB 1E6JH 1A6TB 4A6YA 4PGBB 5HYEA 3HE7B 1A9BB 2EDEA 3HI5H 4J3UA 5I75C 4GT7A 2GUOA 4PRPB 1RV6X 5C07B 3PDOB 4POZD 1GPOL 4HUMB 1NCAH 4Z77A 4JFDD 4YHNA 3TNNA 2NX5A 3RIAF 4NM8L 4APQD 4Z9KB 3D69A 4HIEB 4WUUE 4RDQF 1CU4L 4LGRB 2VLJD 4ONFH 1ZGLB 3IAQA 3CMGA 4I1NB 4ZUTB 2R0KH 2ZG1A 2I07A 4DKEL 2B1HL 2YD2A 5DT1H 3CJJA 3FB7B 2JJVA 3F7VB 1GC1C 1IC5L 2D0FA 2VISB 5DJ0A 4EI5D 3V5KA 3O9WA 5KSAB 4M7ZB 4OLWL 2F54B 2YZ8A 1NUDA 4TNVF 2YA2A 5JLZB 3T3PF 4GRLA 2VXVH 4NWUH 3RWDA 3OKNB 4ZYKA 1KENH 2FSEA 4Q6IB 5HYSB 1FFOB 5GZOC 5FA4B 1PKQE 1S7QA 4D9RD 2OXGA 4P2QB 5EUKB 1O0VA 3ETBF 1U8MA 2DQJH 5E2WL 3U82B 1A0QH 1A6ZA 1U2CA 4O5LL 4PIRF 1BF8A 4GS7C 5E00A 2N1KA 4CNIA 4Z95H 2IFFL 4FQJL 3CVHH 2H9GA 5KOMC 4XMKL 3UPAA 4TSAH 3ARRA 4G9FB 4X6EA 4ISVA 2VIRA 3HB3D 3P77B 4XP9H 3MRDA 4YWGH 1EHLL 1TLKA 1FDLH 3DVGB 5ICYB 3VD7A 2HJLA 5MEOB 1FQ9C 3KS0J 1IGTA 2BZDA 3WNPA 4XRCB 3MYZA 3B83A 1MEXH 3QA3A 3IDXL 5CINL 1N64H 5D5MB 3DHMA 5BJTA 1NJ9A 1NLBL 5KAQG 3NABL 3EOAB 3N9GL 1VFAB 3AU1B 2JJTA 2YPVL 4XP6L 2D03H 1KJ2A 4MS8D 1UADC 1KFAL 4M6OH 3DBXA 4U6YB 2QSCL 2D7TH 2PXYD 4HUXB 2AK4E 3BWUC 2VXSL 4RA0C 4R4NC 3IKKA 3DMMA 3G08A 3X17A 4Z0XA 5LAXA 3F12B 2BVQA 1AO7E 1PEZA 2CR3A 3RVXD 2WP3O 3K4ZA 2Q3AA 4U0RC 1F6LL 1QBLL 1OGAA 5F1KC 4KJWD 4HCRH 4JFXA 3RNQB 4L3CB 5FYJH 3T0EE 4K7PY 1DBKH 2J88L 1NGQH 2X70B 2IQAA 3ARDC 3EYUL 3QHFH 3P4LA 4U7MA 4JY4A 4YAQB 4YDKL 5IIEB 4PB0L 5GGQH 4HLZH 1X6LA 4JEGB 1LEKA 3GMPA 4JKKA 1ZHNB 2YBRA 3IFNH 3V5HA 5DWUH 1TTFA 3WE6A 5DMKA 3FMGH 3L5XH 4IRJA 2R9HC 4PBVC 1RZKC 5C0ND 4JREB 1OCWH 2WUBH 2ITCA 4M48L 4YHIA 4FQXB 3JV4A 4L3EA 3LZFH 4RZCA 1AHWC 3PUCA 4I0PB 2CSPA 1DDHB 5EUOB 4MYWB 1BQHA 1PLGL 2FO4B 3VXSA 5JW3H 1P4LA 3WNKA 1J0KA 3RAJH 5HI4C 3U7WL 1NBYA 4IS6A 4ZXBB 2BJML 5KOVC 4EN3C 3CDYA 5DK2B 4GSDL 1R3HA 4UOW0 3QXAB 1EJ6A 5DYOA 1UYWL 4NN5C 3RX5A 4F37F 5TGBB 4QY8B 4BUHA 3QI9A 3TYFA 3ES6B 4Z78A 3MRQA 1LK3H 5BCAA 4PS4H 3WJLA 1NCUA 1TETH 2DQCH 3GBLA 1MCEA 1SY6H 5E8PB 4GBXB 3BVNA 4G6KH 3C5ZB 4GXVL 2XOTA 4NQEA 3GMNB 4HIHA 4OF6A 3UTTB 2DQFB 4OLUL 3FRUA 4V2BA 4FXGA 2R8SL 4L8SC 1HILA 3GSXA 4C56A 4QHMA 1CI5A 3QUZC 4QOKB 5EOTA 5EZJB 2DKSA 3OB0H 1WTLA 2CH8A 5HYFA 5AAMA 2ADJB 1BQUA 4MB4A 3ZDZF 1A6AB 3N50A 2R1YA 3ZKXC 3V4PH 2JB5L 4LSRH 3N1FC 1MHPH 5HD8C 1XF3A 3G6DL 3S8WA 3MXWL 3QZWA 2KBGA 1YEKH 4YHOL 5GRXG 2BVUA 3DNKA 2EDLA 2GJ6A 5EC1B 3D3VB 3WO4C 1I9RH 1QO3A 5BW7C 4EEEA 1QFOA 2ZCHL 3U0TB 2F9BT 3GSOB 1U3HB 4I9WE 2NCMA 3QO1B 2X4QA 2IALB 3B8YA 3G6JA 3WNOA 1YA5A 1X7QA 3QWQB 3MOBL 3W39B 3C60C 4M43H 4RAUB 1NCDL 3GSQB 2V9RA 3ZL4H 3FZUC 5HHME 2IPUG 2VDOH 3KR3H 3BW9A 3BN9D 5GS1A 3QPQC 4HBCL 5GGTA 4F33B 4N90E 1AC0A 5T1DH 5I1LB 3E6FB 4NJAH 1WUNT 1D6VL 3WDHA 4M6NH 3V7AE 5FUZH 1FGNL 3HZKA 3V9FA 12E8L 3PV6A 4C57C 4QGYA 4LRNH 2DDQH 3K8KA 4XGZA 2RFXA 4Q2ZA 3PWPE 3VXQB 4TVPH 1VGKB 3DUUB 3DGCR 5HI5C 4AIOA 5C1MB 2DIJA 5H35B 1BFOA 4DZ8B 1JZ7A 1XIWC 1IKFH 3HPJB 5DVOA 4PJFB 3CXHJ 1U8IB 2D9CA 4Y4FB 3OGOE 1JGEB 1FL3A 5FO9A 1VPOL 3RUGB 2FJFA 2ED8A 4Q9RH 5DLML 4MJID 1N3NA 4YBQC 4NFCA 4QXUH 4YXHH 2OXHA 2BY0A 3WHXA 5EOCJ 3L6FA 1LE5B 5CBEA 1XGRA 2YS4A 4JHZA 2ESVA 2R4RH 4W6XB 1V5JA 3BH8A 1S7WB 4ZFZB 1IEBB 1TQCB 2HFEB 3SPVA 4TRPH 3B3IA 4PP2B 1JWSA 5GSRA 4LLWA 2F74A 3IU4L 2F5BH 5F6HI 4I77L 4QRUB 4XT1C 1G7PA 2X7LB 1DVFD 5D4QA 5IEHB 4PREB 1AQDB 1P7QA 5FYKU 5CEYB 5F9AC 4HFWA 1I3GL 5C6TH 1T21B 1JV5A 5E4EC 3CZFA 4OFYA 3LV3A 4KI5C 4HKXB 3L5HA 4L4TA 1S7RA 4K2UH 4OF7A 4MAYD 2MHAA 3G04A 2ZZUT 3DROB 1YECL 4PJCB 5CWSB 1QHOA 5I73B 1T4KA 4P59L 3VXME 2DIBA 2EC9T 4KRNA 3BKJH 2WIIA 5HDLA 5TQ0H 3MJGX 3EFFB 5J12B 1FN4A 1NGZB 3VFOA 4BELD 4EDWH 5D1XC 3ILPB 1C5CH 4R3SA 2VERN 4U1KA 1TIUA 1PBYA 5IWLC 2UY6A 4YIQA 5FIEA 5FA3A 2X4RA 1LP9E 2DWEA 2IBZX 4KUZH 4YGVB 4AK1A 1AI1H 5EZIL 2VITB 1Z0MA 3CNKA 1RUAL 4OUOA 2YA0A 4X83A 1SBSL 2EDYA 2WBKA 5FB8B 3IFLL 3SBWC 4PUBH 1F8TH 3QJFB 2X10A 4QRSB 3BDYL 3ZO0A 5C0DB 2UYLB 1HXYB 2JE8A 4JDVA 5A40E 1B3JA 5HHOE 4XNMB 3FAWA 1GJIA 1CG9A 3QCUH 3UJJL 2ERJB 3H42H 1L6ZA 3B9KB 1MCJA 5AG8A 4WTZA 1FZJB 2XWBA 4ZUUB 1WBZA 3ZYZA 2G9HA 5BV7H 3GIVA 2NY7L 4QGTA 5JDSB 3MV9A 4ZAKB 4OGAD 4AM0A 2R4SL 5CGTA 3Q1SL 3GIZH 3ARDA 4WHDA 1LO4H 1N4XH 3GO1H 4WEBL 3SKNA 4PLJD 1PKQA 5A1AA 4I13B 1GOGA 3JVGA 1PFCA 3FT2B 2PXYB 1FAIL 3ABZA 3NFNA 2BOBA 1GPOH 3RGHA 1T1ZB 2H6PA 4LKXB 4EQ2A 4NM8H 1YMME 3MRFA 5EFIA 2J8UE 1K9TA 3MBEA 5EBLB 1CU4H 3X13A 3QIWC 1MPAL 1XF2A 1OQOA 4N8VA 1N8ZA 4OF3A 1HIML 1KXTB 4F15B 2B0SL 2XXMB 1P69B 2X4TA 3E2HC 2JJWA 5I76B 3E0GA 4DKEH 2B1HH 1ORSB 1J1OL 5C8JA 5AD0A 1BECA 3FRPA 4EDXB 2BRRL 3RP1A 4EN3A 3MA7B 2JCCB 2YHGA 3BXNB 1IC5H 4JPWL 1D5MA 3FTGA 3O9WD 5DDHA 2P5WB 3MNWB 4OLWH 2ARJB 4CJ0A 4PJHE 1R6VA 4OZIA 2DLFL 3JWOC 4CMHB 5LG1A 3ZE1E 4DUVA 2K7PA 5FKAA 4F2MA 4GQPH 4OQTL 2IAMA 5E2WH 3ULVD 4O5LH 4WI3A 4OV5B 3CFEB 2DKMA 4OIBA 1N26A 1UM5L 4O2CA 3RY6A 3T0DA 2IFFH 1DN0A 5EZLA 3OBAA 4XB7A 2EE2A 1I1YA 1QOKA 4FQJH 4Q9BA 4UQ3A 1I1AC 5GGUA 1J8HB 1UCTA 5DVNA 4XMKH 4X9IA 4GG8B 4S11A 3QXWA 3IXTB 1HHHB 1EHLH 4P4KC 5DJDA 1K5NB 2DM3A 2BVTA 3Q48A 3DVNB 3P9MB 5BMFL 4A6YL 3L7FA 4AZ8A 2IH3A 3IDXH 5CINH 5GISH 5BW7A 5CLWA 4KROB 1A9EA 1YNKL 3K74B 3SE4A 1NLBH 2VLRE 4FFYL 2NY1B 3NABH 2LE9A 2XA3A 2YPVH 4XP6H 1QFPA 1IGYA 1ES0A 3DUHA 1KFAH 4NUJB 2QSCH 1DUZB 1AR1D 2CKBB 3QXUA 1I1FB 3C60A 4E41B 3MCG1 1MCKA 3QQNA 4MMXC 3CFKB 4BH8B 1PQZA 3BGFC 2DQUL 2VDKL 4NGHL 1X5IA 4JN1L 1OGAD 4LCCC 3UZQA 4QWWC 1QBLH 3VFVA 4MQXC 2ATPA 3VD9A 3WIFA 1AGCA 1YPZA 2AJ3A 4IIQB 4PJ5B 3U1SL 4LMQE 2J88H 3C9NB 1XF5A 3IETA 3TC9A 2X4OA 4JM2F 3HMXA 3LN5A 5E6YA 5IR1B 3HAEH 4Y4HA 5B3NA 4ELKB 5DMYA 3EYUH 3PL6A 4KTYA 3B2UC 3K4DA 1CQYA 5TF0A 3ULVL 3TH3T 4YDKH 4PB0H 1ZT7B 2A9ML 4Z76B 2PO6B 1CGSH 5D7SL 4FFVD 3VGGA 2ATKB 2P8LA 4IRJD 3I6LE 1XIWA 4LEOA 2C7UA 3UC0L 3G5VA 2QEJA 4LVOC 4M48H 2R23B 2Q7NA 4L3ED 1PZ5A 5E2JA 1Z5LB 5HHQA 5IOPA 1QG3A 2NW3A 2Y4SA 3FHAA 1RAMA 4ZUWA 2FNBA 3VXSD 1DANU 3LQZA 3BQUD 1CD1A 3G5XA 3RZWA 3TCLB 3NCYP 5GPRA 3T0VA 3U7WH 4Y5YC 3S3SA 3AREC 1KJ2L 4GSDH 2VL4A 1CFSA 4HS3B 5D9SA 2BVYA 3CSPA 2YD1A 2XV6B 1FYHB 1UYWH 3QI9D 4NZDA 3VFTA 2AERT 1P2CB 1S9VA 1KPUA 5DJYA 2A83A 5SWZE 2BVOB 2XFXA 4I2XA 2GT9A 5I8EA 1CTNA 1BLNB 1LO5B 3O3EB 4XNZB 3EYVA 2LU4A 5J56B 3N06B 4GXVH 4RIRB 1R24B 2NW2B 5F89A 1EZVY 5C9JA 4OLUH 4PJ9B 2R8SH 4ODVL 2NY6D 3DRTA 1NDMA 1H3GA 5F7KC 1TITA 4BSWA 5DD5L 3HUJA 1WWBX 2GSIA 4GRWB 3FB6A 4XBGA 5GIRB 4UU9B 3T4AA 5CZKA 2QR0B 3JV6A 3C6SB 3FT3A 4U7SA 4JY6A 2JB5H 4EI6B 4JANA 1J86A 4MZ2A 3G6DH 4G42A 4NC1E 5D1XA 2AGJL 3MXWH 5FGRA 3UP1A 1D5IL 4YHOH 1QQDA 4P5TC 3MO1A 4KQ3L 5EU5B 4AEFA 3MRJA 5IWLA 4YO0B 5ICZA 4KWUA 2I60L 3D39A 3RKDC 1DVFB 2C26A 2CUHA 2ZCHH 3T8XA 1T3FB 4Y1AA 5IB5B 1E4KC 3KPOB 1NANI 3RIFK 3SBWA 3BYYA 2MQ3A 1HHKB 3RGVA 3NGBB 4H1LG 3ARBD 2XIDA 2BSRA 2FL5A 3MOBH 2WANA 3VXOA 2HLFD 3QBTB 3ZHDA 1K3ZA 1W72B 3KXFA 2WV3A 4JFPB 3C8KB 4HBCH 2VQUA 1BBJA 4H20L 2VLKA 1T80A 4JZOA 5DC4B 1EEYA 3C6LA 3DGGB 3RWJB 3BO8A 2QQLL 4QHLB 5DK0B 4ZTOL 1HHJA 5KVMC 1D6VH 4LCUA 1FGNH 5DJ8B 3TZVB 3L1OL 5CP7A 3M1BB 12E8H 2DYPA 5GSVB 3AGVA 3BUYB 2BY1A 4R7DA 5HBBA 3GBNL 1WAAA 4XAWL 4YDVB 2DBJA 5IMOB 3DV4B 4F7EB 1IKNC 3RWHA 5KW9L 3RL2A 1IZJA 5TFSH 5CJBA 3SY0B 4X9FA 1CLZL 5AYQA 2OL3A 4X6DE 2NY2B 2A6KB 3C5SA 3U9UB 3OAZK 1HDMA 3RUGE 3PQYA 4V1DE 2VWEC 3ALWA 2FYYA 1EHAA 1VGEL 2HA1A 1NANH 3S9DB 1AXTL 1IAKA 1VPOH 1BREA 4DN4L 3GSNA 5DLMH 5DO2C 3TBWA 1JWMB 1II4E 1QPXA 5DUML 5CKAA 1BIIA 1NCTA 2ESVD 1KLUB 1E27A 3ULSB 1JF1A 1NBZA 3C8HA 1M7DB 4BQBA 1MY7A 2BDNL 2YPLA 1HEZA 2NZIA 2X89A 2J8OA 3BP5B 3CLEL 5B8CC 1JN6B 3LN4A 4F57L 1YN7A 3G9AB 3IU4H 4I77H 3VGAC 5GZOD 2ZNWA 2R15A 1Q0XH 3VXRB 4PTUB 2C3VA 1I3GH 1LP9F 4OFYD 3UTZA 4EKXA 4L4TD 2B39A 5F9JB 2P8MB 3UTSD 5GGTL 3S3JA 2Q6WA 4CAGA 3IJSA 4GMTL 1RUKL 4PJDB 2FIKA 4HW6A 3IXAA 3B6SB 4PBWD 5TDPB 3M07A 4J6RL 1YECH 1K8DA 1BFSA 3REWB 5DZOA 4P59H 4P23B 2ZUVA 4P4KA 3U4EB 1IAIM 4CUCA 4L4VB 1U8KB 4MNHB 3V6ZA 3MRBB 3MNZB 5DEGB 5SX4I 2E8YA 4QTHB 4RGNC 3U6RA 4ELMA 3BEWB 3IDGA 5DD6A 4Q9CA 1OVZA 4MDIA 4U1MA 3R06B 3VWJB 1WZKA 2BHUA 4NNXB 5I1JL 1ETZA 4JVWA 5EZIH 3EZJB 4OUUB 1ZHBA 2AQ1A 2CR6A 1RUAH 2D9QB 1SBSH 2CK0L 4JRYA 4KRPC 1XGTB 4YHYC 5FOBA 3D1MC 5HYJD 5FKPB 3IFLH 4R4ND 4HZLB 3BDYH 4K71C 2XZQL 1S3KL 3L3GB 2CRYA 2EO9A 1GVIA 3BIKA 1GC1L 5MERA 4XB8A 3GSVB 3FO0L 3UJJH 3VGFA 3W9EB 3IVKB 4DGVH 5MEPA 1TPXB 1ZHLB 1KPVB 4HS6B 5E94A 1CICB 1CDUA 3O41B 4LPCA 4AENB 2NY7H 3MV9D 2NXZC 4YHZL 1X5FA 1U2HA 3QEQB 1FNHA 1XR9B 2EDXA 2R4SH 4QYOA 3Q1SH 3ARDD 4KJYA 2Y9RT 5F1NB 2AAVA 2OTWB 2W1NA 4WEBH 1UH4A 1GGYA 2VQTA 2OCFD 3GRWA 5F1IB 3SDXA 3OAUL 1JPFB 1GGCL 5L8LB 5SX4H 4X6BA 1KB9J 2R9HD 4H1LB 1FAIH 5EO1A 4GKNB 3IJYB 3WLWC 4QRQA 2EH8L 4MJ2A 1NUNB 3LDBB 3FQNB 4LSUL 4LP5A 5BO1L 3G5YB 2Q7YA 1MPAH 3KVQA 3RI5F 1NMCB 1KGCE 1HIMH 3WUWA 5KSUB 5F7MC 2B0SH 2DL2A 3DJ9A 3DSFL 1LD9A 1MCRA 1TJHL 4PJEE 5HI4D 4KGLA 2P5WE 2ZKHL 4HUNB 1J1OH 4EN3D 1XGQA 4ODWA 2BRRH 1U3JA 3RZCB 1JNLH 2EDQA 4JPWH 4UOJA 1DUYA 4WU7A 1SEQL 4PRNA 2XN9D 2OMNA 5D5MF 3BHBA 3AB0C 2HFFA 2XT1B 4NT6A 4PJAE 3NA9L 1KJVB 2DLFH 3NIGE 3QUKA 5KSBA 3TIEB 3DX6A 3PNWA 4R2GC 4GUPB 4OQTH 4E42B 4GG6A 2Z8VC 1J8HE 2KUTA 5DUBA 3QUZD 3SGEI 4DUWA 4BM7A 1UM5H 1FYTB 3D87B 3STLB 4ZOEA 3ORJA 4N5EC 1JGUL 3K2MC 4TN9A 2DQDL 3BQUB 2WAHA 4JG1L 4NOFA 5HD8D 4U33A 4K7FA 2R2HA 1HSAB 1T5WA 4E5XA 1MAJA 3EUUA 2HFTA 5IHZA 1KOAA 5I8OL 5BMFH 4A6YH 1QLFA 4UILL 4NQCA 3IDJB 3H7LA 5IV2B 1VB9A 1YNKH 1DQQB 2MJWA 2WBJB 5EZOL 4DAGL 4FFYH 1F90L 4PPTA 3CFIC 1QRNB 3CSGA 4D94A 5EWIL 2QTEA 1NKRA 3BX7C 2DLHA 4X4XB 1GZPA 4KKNA 3ZT6A 4FABL 4MWFB 2Z0BA 1IBGL 3C60D 4N68A 3VRIB 2ED7A 1T0PB 3FZUD 2VZOA 1P6AB 1GIGL 3I84A 5TE6L 4FZ8L 4CGTA 3IFOB 1Q9OB 3QPQD 2DQUH 1YJDL 4NGHH 5JA8B 4JN1H 4PJ5E 5E56A 4ZNEA 3D2UA 3V5DA 4RBPK 3SGEH 2JB6B 2IANB 2AJYL 5L0QC 3U1SH 4LFHD 5E8EB 3QDJB 4FS0A 5DHYA 5LKNA 4GKZA 1NDGA 3FHQA 3ULVH 4DQOL 2FGZA 5HI5D 1IKNA 5BRZD 1MWAH 4HK0B 5CEZD 2LABA 2A9MH 3BEVB 4QRRD 3TV3L 2WM0A 5D7SH 1HH9B 5C70A 2NXYC 1IM9B 5K9KB 3FQWA 3ECBA 4DW2L 1XIWD 4OCYL 4ZOCA 3ARBB 3UC0H 2DQGH 1JZ4A 5CJ8A 1JJUA 5TDNA 1JZ5A 3IDYC 5L2KE 2XYCA 5ABDE 4UTAL 4L8CA 3FN0L 5FO7B 2IQ9L 5IJKA 5I9QC 2EYTA 2YOCA 4YBQD 1AR2A 1G7LB 3I85A 5TF1L 3KPLB 1IGJA 5EPMB 3GM8A 3MROB 5GJSL 3X3GL 2VNCA 4LLDB 1RZGB 1QA9B 3AM8C 1KJ2H 1MI5A 2YMXL 3DWTA 3SGJC 5B8CA 3AAZB 5BQ7B 2OTUB 1LQSR 4EOWL 3RDTC 4RMVA 5F9WB 4D0CB 1ROWA 3FFCE 5HJ3A 4NKMA 2FECI 2XKSA 2ZOLB 3GKWL 4OM1L 4U1LA 4G8GB 1S9XB 5AG9A 1JVKA 3THML 4FP8L 5C0AD 3D0VB 4GW1B 5CEXA 2ZUQB 4P46B 1RK0B 1Q94B 4ODVH 4P5MB 3CUPB 3MMEB 2HN7A 4QRPA 4TUJB 1CDCA 4HKBB 3SE8L 1SYVB 1W0WA 5LGJB 1YQVL 4L8BA 3CDCA 5DD5H 3FAXA 4UT9L 2HG5A 3BWAB 3KYNA 5F88A 5I6XC 3RHWF 3HMXL 1EO8L 1J0JA 4ZPTA 2X9YA 4O4YL 4ZS7L 4UB0L 1BZ9B 2HKFL 5J11C 4WJ5A 2PCPB 4JRXE 1X5XA 5D1XD 5AAWA 5IMLA 2AGJH 3MRNB 5C2BL 3IF1A 4PJBE 1ZHKA 1D5IH 4I8DA 5IFHL 4KQ3H 4NBYB 3SKUD 5F1SA 3WD5L 2CLRB 1TVHB 3I6KA 5I1AB 3GHEL 4WU5B 5T1LA 1HI6B 5KAQF 2I60H 3QB7C 5I1GL 4U31A 4Y1AD 3ARFB 3PWVB 3T2NL 1JZ6A 1C5DA 4J4PC 5J1SC 3UTSB 4FMKA 1FLTX 2ICCA 4PBXA 1S7SA 1UB5B 2X4PB 5DMGC 3O2VL 2Q8AL 3LKQB 2EKSB 1AKJA 2EZ0C 3D18B 4HX1A 5E1AB 5K93A 4X6DF 4YDJB 5I19L 3CCHA 1A47A 3RTQD 3RUGF 4HT1L 3PIQB 2VLKD 3B43A 1RY7B 3WSQL 1CDJA 4H20H 1KIPA 4H26B 4BK5A 3PGCA 2QQLH 3LMJL 5L7XL 4ZTOH 5T1MB 1W8OA 3MRIA 2DI7A 2XZAL 4UOW1 2DYPD 4LFHG 3LSOB 3O3AA 4AY0A 3GBNH 3NFPA 4XAWH 3VGDA 2JLLA 3VI4E 4K94C 4WFHD 1MIML 5KW9H 2E7LC 5ANMB 5LVEA 4ZDHB 3OTTA 1FHGA 4CU7A 1CLZH 1JYWA 3QG6A 1F6AB 1TTUA 3O45A 2HJKA 3MOQA 3QIWD 3MLTA 3UBXA 3QWOB 4B0MM 1M1SA 4NOBA 4R9HA 1VGEH 3BSZL 4W6YB 1AXTH 3SDAC 4NNPL 5IP4A 4DN4H 3U36B 5DUMH 5C0EB 4YBLC 2YPLD 1K8IA 3RWFB 2BDNH 2X89D 1OB1A 4G8IB 4MQTB 4AG4L 1WFNA 4LPWA 3CLEH 2GTZB 1WGOA 3VXRE 1UZ8A 2EIBA 4U2YA 4F57H 1NC4B 2DQTL 1U95B 4M4RA 4WW2C 4JGJA 1HHGB 3TO4C 2AV1B 2KDGA 5CZVL 5EU3A 1UJ3C 4H8WC 4J2XA 1S7VB 3HZYB 3PGDB 4MNQA 5GGTH 2V2TB 3EO0A 4GMTH 2CIKA 1RUKH 3HAEG 1I1AD 2D7QA 3GUTA 5JOEA 5IHLB 3HZMA 4X6CE 4J6RH 3CVIL 3MGTB 3OAZH 2E9BA 3OKEB 5GXBB 3TESA 4P4KD 4FOMA 5BZWA 2M2DA 1SEBB 2A73B 4N0UB 1C12B 3OGCA 4ZFGL 4JDTL 2FHBA 3OJDA 3TO2A 3OKDB 3T0EC 1FVCA 4Z7WB 3P3YA 2H32A 4M3JA 4XMPL 4WEUD 3VFUA 5I1JH 4UV7L 5FFLA 5FM5O 2DJUA 2LV4A 1XH3A 3PHOB 5FDWB 4RFNB 5JOPE 4L8SB 5IVXE 2PW1A 3H2WA 4WCYL 2CK0H 1U8NB 3GSNL 2XI9A 5D7LA 2M1KA 2P7TB 4YHKL 3OMZA 1DTUA 2XZQH 5ENWA 1S3KH 1IVLA 1BX2B 3EFDL 1GC1H 3N1PC 3FO0H 1A3QA 1VFOA 3MNVA 1QHPA 4K9EC 1R3JB 4MQXD 3WFEL 5L88L 1U8LB 1NL0L 3QQ3B 3O8XC 2FATL 4JM2C 1DR9A 3L3IB 2PYFB 3OKOA 4X99A 3BH9A 3JWOL 1QSEA 4LCWB 4YHZH 3TA3B 4AT6A 4BKLB 3LHPL 2JCCF 4OKVA 3V6FB 1UG9A 4PJEF 2AJSL 4RISH 3WO4B 3S36L 2EKJA 5ACZA 3B2UD 4MNGA 1DQLL 4NDMA 1VKXB 4NKDB 5F93C 5EBMA 3BUTA 1EEZA 1T22B 3QO0A 4D8PA 1GGCH 3LEXA 5L6YL 2ZCKL 1FO0A 2JIXA 4P5KA 5E2TH 5ESQB 2EH8H 1HINH 4HIJB 3NIGF 1FNGA 4LLVB 3LD8C 5HGBB 3W2DL 4LSUH 5E9DA 1P7KA 4RX4A 4PV9B 5BO1H 2ICWB 3IGAA 3LB6C 4Z5RB 5DC0A 1L9NA 1JZ3A 3DSFH 1TJHH 4ONOA 1UCBL 4ZQKB 2ZKHH 1T0NA 3ARED 3WL9B 4FTVD 2FBOJ 1UQSB 1A1MA 5IW1A 5EU6A 4PLNC 1MCPL 1DLHA 4LSTL 4WO4A 1KT2A 3SGJA 5JHDB 2YC1B 1F3DH 3GSWB 3MRCB 1CTOA 1SEQH 5L9DL 3P4NB 5BRZB 1F6FB 5DQ9A 2X42A 1HOCB 4MA8L 3NA9H 1EFXD 32C2B 4Q7DA 2EDFA 1JMXA 4JFEA 4D9QD 1XR8A 2F53E 1F2QA 4KV5E 3CGTA 3NIFF 3RL1B 5I1HL 1ZOXA 4DZBB 3P2TA 3QDGE 5H94B 2E9WA 4OD2A 5D1ZB 1WWAX 2EC9U 4WFGE 2R1XB 2FEEL 1E4WL 1JNNL 4YDLC 1JGUH 2DQDH 4NCC2 3C87A 4H25A 2KKQA 4XVTL 2PYEE 4EJ1C 1DQDL 3FKUS 3WEXA 4F7PB 1DQJA 1GGBL 4UTBL 4U1SA 4HUUA 3GFUA 3RRQA 4P0DA 4P5TD 3F7PC 5I8OH 5CMAB 3H9SB 1CXFA 4UILH 1G7MB 4LVNB 5F8RC 5FYJE 4WIQA 2JTDA 2QBWA 1KJMA 3RKDD 2RR3A 2JJSC 2AEQL 2Q86B 5EZOH 1F90H 2BNRE 3X14A 3U4BL 3BPCA 4J4PA 1BZQK 5C0AB 3IJHB 5E5UB 5EWIH 1JP5A 4FABH 3BD3A 1RSFA 3HAEB 5CIPB 1IBGH 1JE6A 4KHXL 3WIIH 1VFBA 1RZ8B 4PJXB 1GIGH 4OI7A 5TJWK 3MX0A 2CXGA 4FZ8H 2RB8A 2R2CA 1RHHA 4MSWB 5ISZD 1YJDH 5D2NE 2ZUWA 3BMVA 1KTDB 5F7HA 3HE6D 3WNLA 4L9LB 1REIA 1JPGA 4J7RA 1JI2A 3O6ML 5HYQB 3MLPA 5DRNB 2AJYH 3L7EB 3WKNA 1JHTA 2VAAB 1ZGLM 3QUYB 2EEBA 1YZZA 5DSCA 1U58A 1WSST 1E28B 1P84J 4JN2A 5E8OA 4DQOH 1A1NA 3HG1A 4S0SD 3TV3H 3HC4H 5GJTL 1KIQA 2HP4A 5DXWA 4LPXA 4DW2H 2D4DA 4OCYH 1F97A 5I8KL 4GRMB 2XTJB 4RA3A 4EVNB 2LTQB 4D3CL 5A2FA 4UTAH 3FN0H 2IQ9H 2FBJH 2VN7A 2VQ1A 3RTQB 3SKMA 2AI0L 3SDAA 3RVWC 4XH2B 5DO2D 4GRWF 1LE9A 1I9IL 3RA7L 3MXVL 2OI9B 4YDIL 3I75A 4WGWB 3QNYB 4K8RL 5EU7C 5TF1H 1J1XL 2PR4L 3LEVL 1TZHB 1CLCA 2DQIL 4J23A 5J6HA 3MLZH 4FHBD 1YN6A 4PD4K 5BS0E 5GJSH 3X3GH 4XP1L 4WI2A 4JFFB 5I74C 1MI5D 2GK0B 1BVKB 1RIUL 2YMXH 4G8GE 3FO2B 1NAMB 3ARTA 4JQVA 4EOWH 5KS9E 4WW2A 3TO4A 2CO7B 1YEJH 4PJBF 1NFDA 3QFJA 5DTFA 5FHBL 3GKWH 4NQXB 4OM1H 1ZLUK 4S1SL 1UJ3A 1NFIA 3VFWA 3THMH 2Y7QB 4FP8H 3KPQB 3RWIB 2HVJB 2JK5A 4HGWA 2NLJB 2X4NB 5FM8A 4DEPB 3DPBA 2NY3C 4QRPD 3P4MA 2W92A 1YDPA 2BVEA 3CSYB 3SE8H 1U8QB 1YQVH 4Z7UA 3QXDB 2OMBA 5ESVB 1NGWA 3DXAE 2DI9A 4UT9H 5L2JA 1BD2E 3MV7D 3HMXH 5DHXB 2NY5C 1EO8H 4JZJB 1JGVL 4JFQA 4BUGA 5C0JA 5C08E 4O4YH 4DKDC 4F7CA 4ZS7H 1AE6L 4XCNA 3F7QA 2XY1A 4MXQC 4UB0H 2HKFH 4P57B 4RGND 4YPGA 1PAMA 5C2BH 5EOQL 4AQOA 5ICXB 5IFHH 4ZO8A 3K3QA 2HVKA 3GJEB 5MHSD 1AFVL 5T1LD 3WD5H 4ORZC 3GHEH 4CMMA 1JHKL 1T2XA 1S7TB 4LNRB 4F9PC 5IEKB 2SEBA 1MHEA 3HE7C 5BVJA 5I1GH 3ZLQC 3C2AL 2QKIB 3FOLB 1C08A 4KRPD 2VR5A 4TVPE 3T2NH 4MLSA 1U91B 5H8DA 3O2VH 1CDGA 3GB7B 2Q8AH 1AKJD 3IFPA 2OJZL 4YC2C 4G8EB 2H26A 5I19H 5I1EL 4Z6AT 4HT1H 5F7LB 3WSQH 2NXZD 4M02A 3O4LB 1AGFB 3ZYJA 1QR1A 2H8PA 1FP5A 3SO3C 1YMHA 1KCLA 3LMJH 5KSAC 1UXWA 4M7ZC 5L7XH 5JOFA 2V7NB 2XZAH 3VFNB 5CP3A 3Q3GA 1P1ZA 1N6UA 3OPZL 3O3UN 2BMKB 4CVZA 4UBDC 2AXJA 3A6CL 2A6DA 1U36A 4JPIB 1MLBB 1CXKA 4LLAA 3VXTB 1MIMH 5F70A 4BYHA 4HJGB 3CC5A 5DQJA 3WLWD 4DTGL 3MGOB 1BAFL 5JNYB 3VFRA 1I7ZB 1W0VA 1MUJB 2V2WB 4RDQG 1J5OL 3BGFB 4UIKH 3U0PA 4HV8B 3T2OA 3BAEL 4PJDF 3FQTB 2GSGA 1V3KA 4P3DA 4OD3L 1EK3A 1RFDL 2D2OA 3QRGL 1MH5B 4OCNC 3BSZH 3CPLB 3S96B 2E6QA 3HPLB 2P5EE 3KYOB 4NNPH 3ESVF 3IDIB 5ERWA 1TCMA 5DJ6A 5J6GB 3VMOA 5J13C