1CFSB

Anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
213
structure length
213
Chain Sequence
b'QDQLQQSGAELVRPGASVKLSCKALGYIFTDYEIHWVKQTPVHGLEWIGGIHPGSSGTAYNQKFKGKATLTADKSSTTAFMELSSLTSEDSAVYYCTRKDYWGQGTLVTVSAAKTTAPSVYPLVPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN))
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
molecule tags Polyspecificity
total genus 37
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 1999-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfsB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfsB02
2ARWA 2FX8L 4R26L 4PR5B 1RZ7H 3D39D 4LCWA 5IJKC 2Y1VA 3V5HA 4MXQC 3TJEL 1HWGB 4J3UA 4RFNB 2I9TA 5JW4Q 4U7MA 4K94L 1ZANH 4PJEF 3HLAA 2EE6A 4FQXB 2FATH 1IGTA 4J2XA 2AJYL 4PJDA 2H3NB 4HUXB 1BVLA 5ESVB 3VWKC 2MTPA 3PQYB 3FT4A 4AM0B 4NFDA 4RWYH 2AJUL 2W0FB 2H8PB 1ZWIB 4GAGH 4X9FA 4C56E 4MJIE 5GS1B 3HE6B 4WFHD 4OB5L 5E1AB 4LHJB 3RZCC 4JHWH 2D9QB 2LQRA 3BPLB 4G6ML 4GW5B 3PWNA 1Z9MA 2FX8H 4R26H 5ACMA 5TH2A 3EFFB 4P5KB 2A6IB 5T1MB 5TE4L 4TVPD 2XQBL 3GMMB 3TJEH 4U1JA 3CVHB 1HSBA 3FB6A 5DVNA 2A0LD 4K94H 5GS0C 2JIXD 3W11D 1A6PA 4U1NA 1A3QA 3TCLB 3THML 4UDUB 1T22B 3IFLL 4UNVA 1SEBB 3HE7B 4OUOA 4BH8B 1IAIM 4PG2C 4XP4L 3EYUL 3QEUB 4QLRA 3HC4H 4JFZL 1EUTA 1CDUA 1AGBB 4Z18A 5LCVH 3CUPB 3OPZL 12E8L 4G6MH 4CNIB 5FYLD 1SM3L 3VXSD 1GZQA 2DM7A 1P2CA 2P5EB 1IAOB 3OJ2C 4NRXB 3K80A 2XQBH 2LVEA 4JREB 1QYGL 4PGBA 2ICCA 1JWSA 5KSAA 4Y4HD 4R90L 3THMH 4NQED 1LO5B 5SWZD 1JGVL 3V5HB 4U6VH 3EYUH 1F58L 2FLRT 2FZ3B 3CXHJ 4JFZH 5E2TL 3HRPA 4WWKC 4GBXD 2E7LC 1PX3A 1IGTB 4Z7UE 4PJDB 1EXUB 5DRXA 1BVLB 12E8H 1INQA 4U0QB 3FT4B 5ITBL 3TN0D 1NLDL 3EDDA 4XHJC 5EZIL 3H8NA 1ROWA 5F6HI 1TTFA 4XZUA 1C5BL 2YWYA 1PZ5A 3EDEA 4P99A 2ORBH 3KHQA 4M7KH 3BRGC 1QYGH 3S3JA 3PWNB 2V2TB 4H0HB 1H5BC 4PJ5E 4R90H 5TH2B 1Z0MA 5C3TA 4XPAL 4U1JB 4LVOC 1HSBB 1T83C 3FB6B 1F58H 4KK8D 2EC9T 5IBUB 1S7WA 4U1NB 5E2TH 3EYFA 1NC4D 3VMOA 4CRPA 1WCQA 3NACL 1PSKL 2WSKA 1WWCA 1UB5A 1T7YA 1LO4H 5ITBH 2DI7A 1NLDH 4TNWK 5L88L 1C5BH 4NWTL 4OZIA 2BK8A 4PJBE 2AS5M 3C60D 1GZQB 2LTQC 3ULVE 1S7QB 1P2CB 5EIVA 5D2LF 4AJ0A 3MLTB 3S37L 4XPAH 4XP5H 4PRPA 3WNKA 4M1CC 3GSWA 2HT4D 1OSPL 2V9RA 4PGBB 4HWUA 3QI9A 1JWSB 4FMKA 5KSAB 2VB5A 3RL2A 5EIIA 3NACH 1PSKH 5ALBL 4RQQB 5FYKE 4M4RA 3S4SG 1I9JL 2A38A 5E8PA 3QG6A 4UT6L 1BIHA 1PFCA 3K3QA 3SJVB 2HLFD 4LVNB 5LVEA 4NWTH 1OTTC 4Y4KC 3IVKA 5DRXB 5EZLA 3OF6D 2FJGA 1INQB 1FYTA 2ITCA 3WUZA 2EDNA 2IWGA 5FCUL 1DLFL 4E41A 3D9AH 4WFED 1BQLL 3I6GA 1JWMB 3N9GL 3S37H 1P5VA 1V3MA 1PZ5B 2DMBA 3GMPA 4FZ8L 1OSPH 3L5XL 1ERNA 5GS2D 3U48A 1F3RB 5ALBH 32C2A 4NUGH 2P1YA 5DFVC 5DYOA 1I9JH 3FZUD 4UT6H 3BDYH 1CGXA 3QB7C 5EWIL 4PJXF 5HGAA 3EYFB 1RFDL 1FL5A 1FE8L 4PJCA 3GMOA 2EDXA 1KLGA 5DC9B 3IRPX 5IB2A 1AO7D 3A6OA 1UB5B 2NW2A 1A1MA 3RX8A 5FCUH 1DLFH 4FNLL 2R1YA 3N9GH 3FONA 4L4TA 3BH9A 4EVNA 4LMQI 4OZIB 2XV6B 4FZ8H 5KVDL 3K2MC 1T4KA 3L5XH 5ITFA 3WNPA 4ZXBA 1CD1B 3TYFA 4LCWE 3GSWB 1G7HA 1TTUA 4WVRA 5EWIH 1RFDH 4MQ7B 3RL2B 1FE8H 5EIIB 4OLEA 5EFIA 1J12A 3LHPL 5E8PB 3QG6B 4EZMA 3RWHB 4PJDE 3HZMA 4JCLA 3U4BL 3DVIA 3QH3A 2XPGA 2K7QA 1OAKL 3IVKB 1DLHA 4CMMA 1JFQL 2NPLX 2X4NA 3RGVA 1A02N 5EZLB 5KVDH 2FJGB 5CP3H 4HPOL 1FYTB 2ITCB 1XEDA 3QNXA 4I48A 2ADGA 1C08A 4KI5C 4E41B 1NAMA 1P53A 4EN3D 3B9DA 4P2OB 2C9AA 1MH5A 2EDFA 1OAQL 2R56L 5ILTL 1CL7L 1JYXA 32C2B 3LHPH 1FORL 1V5JA 5I1GH 5D5MF 1XF5A 5HGAB 1XIWC 3U4BH 5A43C 5L7XL 1FL5B 3EYQD 4PJCB 1OAKH 3GMOB 2AK4E 3W0WD 1KLGB 1JFQH 5IB2B 4DN3L 2NW2B 1A1MB 4HPOH 3S7GA 4JQXA 3SKMA 3DGCR 3X17A 2VLRA 4XAKD 3FONB 4L4TB 4GQ9H 5D1QD 4EVNB 3KVQA 4HS6A 1JTOA 2B8OT 4WI3A 2H45A 1T4KB 3QDJD 2R56H 1INDL 1JI2A 5JA8B 4QKXB 4ZXBB 4W4NA 1F45A 1JPSL 1FORH 3ZHDA 2MQ0A 3TYFB 1PQZB 1U8JA 1G7HB 1KIRB 3BQUD 2ZUUA 3WDHA 3UC0L 5L7XH 3SDDA 3VXQA 1CFVL 1VGKA 5EFIB 5C0DA 3MV9D 3B2UD 1HH9A 3UXFA 4DN3H 1VGEL 2YD2A 2AQ1A 1PKQE 4QTHA 1JZ6A 3AM8A 3HZMB 3QH3B 2XPGB 2DM4A 5ERWA 4CMMB 1I1FA 2X4NB 3RGVB 4QRPD 1AQKL 5GXBB 5F8QC 3QNXB 1GGCH 4I48B 1JN6A 2ADGB 1C08B 1INDH 3V79C 3WV0A 3UJJL 4DEPB 3F5WA 1DUZA 1JPSH 2PR4L 35C8L 4PUBL 5DVLA 3ZZ1A 2YS4A 5E6ID 5FV2A 1MH5B 2VXTL 2N7AA 5DMJB 3SGEI 1T1YA 2B1AL 2DKMA 4S1DD 3UC0H 2MKWA 2YUVA 1TCRA 4FS0A 3VI3E 4K7PX 1L4IA 1VGEH 5CD5D 1VKXA 1KNOA 1XF5B 4WUUD 1QZ1A 1NKOA 4OCNC 1KJ3H 3BXNA 1CXFA 3MLVL 2JCCA 2EIDA 3SKMB 2XIDA 1EERB 1ZVHA 2VLRB 3D87B 4DKDC 1MJ7H 4RMQA 4HS6B 2PR4H 4KVCL 4Z7NF 35C8H 4PUBH 3EDFA 2VXTH 5IJKA 3BN3B 4XPTL 2B1AH 4PRPE 4LAQH 3C60C 4HK0A 3FHQA 4K7PY 1LGVA 5DXWA 1FC2D 2X09A 3GI8L 5MHSE 1QFWL 2PYEA 4A2MA 4QGTA 1Q9KB 2R2CA 5CIPA 3SDDB 3VXQB 2HT4C 1VGKB 3VWKA 4R96A 5C0DB 3MLVH 4UI2A 1HH9B 4YXLL 2R2HA 1FSKC 1TZHA 4QTHB 1ADQL 1HHKA 3RZCA 4DKEH 1IC1A 1FYTE 4IMLA 5ERWB 4KVCH 3AXLA 3UJTL 1I1FB 4E41E 4KROB 5TE6H 1Y6MR 2JTDA 4XPTH 2CKBL 4KI5F 4Y1AB 1IAII 3F5WB 1DUZB 3VXMB 3NFNA 4PJXA 3GI8H 4QNPE 1QFWH 1I8IA 1WIPA 2AERT 1T1YB 4UNTA 4ELKA 3NCEB 4PG2A 4YZFF 1YQVH 4GRMA 5HHOA 2NLJB 1BFSA 1TCRB 4MZ3A 2AJSL 1EEZA 4P2QB 4HSQA 4YXLH 4PJCE 1PZUB 5LBSL 1VKXB 1ADQH 1KNOB 4HLZG 2BX5A 1S5IH 2X4OA 3VRLE 3RAJL 1U6AL 2MHAA 3BXNB 2JCCB 4ZO9A 3UJTH 5KZCB 1QO3B 1FN4B 2A9ML 1BIIA 3SKNA 1YMMD 4L4TE 2CKBH 1WAAF 4NT6A 5JNYA 4FOMA 3QO1A 3E6HA 3F12A 5DT1L 3VGGA 3L3DA 1KIPA 1TVHA 1HOCA 3B8SA 4HBQA 4NFCA 1YQ2A 1BBDL 1X3DA 2AJSH 3DARA 1SMAA 1NC2A 3OHXB 5LBSH 3V0AC 4WWKA 2E7LA 1U8OA 3RAJH 1U6AH 5CIPB 5DWUH 3AS1A 5FEBA 4HDIA 3VWKB 2C7UA 3U46B 4R96B 2R2HB 2A9MH 2IH1A 1TZHB 1JGUL 2QV2A 5E08L 5DT1H 4R4BA 4K7FA 5JOFA 4IMLB 1AJ7L 3AXLB 4QHUA 1H3UA 4RIRA 5DS8A 2CRMA 1MIEL 2CRYA 2AEQL 3DO7A 5J6GA 1JTPA 4WHTA 1VESA 1MREL 1BBDH 1T83A 5D7KE 3P40A 5BV7C 1X5AA 5F6IC 3NFNB 5L8KB 3QA3A 4PJXB 4EN3C 4L4VD 1I8IB 3CAFA 3PDGA 4LF3A 2HA1A 4K9EL 3RA7L 2F5BL 3PP3H 4Q6IB 1LP9E 4JGJA 1JGUH 2X4OB 1P4LA 2DQFA 3MUJA 1KB9K 1YEFL 2MHAB 1AJ7H 3N50A 4KRLB 3LKNB 1CLCA 3SKNB 1BIIB 3EYQC 2VLRE 3RWIA 1MIEH 3Q0HA 4DOHB 2FH8A 4NT6B 3IAGC 1NCUA 3QO1B 1MREH 3E6HB 4ENED 4LPYA 3JV4A 3F12B 1RUPL 3L3DB 3GBNL 4YUEL 5C0CD 4N8CL 5T1DL 1KIPB 1TVHB 2WMPA 3V95A 1NQBA 3LD8C 3VDBA 1TJGL 3T0BA 4K9EH 3RA7H 2E6JA 1LNUA 5FFLA 3QPXL 1NC2B 1FPTL 4U3CA 4JFED 4WWKB 5KVEL 1U8OB 4Y4KA 1ZEAL 3WLBA 1T6WA 1YEFH 2C7UB 3M07A 1YNLL 1BJMA 1A7QL 4M5ZL 2IH1B 3WFHA 1EVUA 4M43H 2HFEB 3CNKA 1AXTL 4G80A 1LHZA 4R4BB 4K7FB 3GBNH 2QJDA 3L7EA 4YUEH 1QFPA 4HJJH 4N8CH 4RIRB 5T1DH 5DS8B 1DVFD 1NAKL 2YUWA 3DO7B 4ODWA 5J6GB 3QJFA 1TJGH 4ZNCD 4WHTB 4LVOB 3BP4A 3QIBD 1F4WL 3PJSA 5JPMA 5FA3A 1FPTH 3QA3B 4B7LA 5KVEH 4LF3B 1FNHA 3A6CL 3D85A 3KPNA 4L4JA 1ZEAH 1A3RL 4X7SL 1YNLH 1C8PA 3MBXL 4IJ3C 1A7QH 1CN4A 3RY6C 3HC0A 4M5ZH 3U36A 1DFBL 2JCCE 4YEFA 5BS0A 1AXTH 1RZ8A 2WUBH 1P4LB 2DQFB 4H26B 2LTQB 4HBCL 1NAKH 2OL3L 1RHHA 1WFUA 5ACLA 5KSVA 3GSNA 4R4FL 4I13B 1AGFA 2VAAA 1EZVX 3JV4B 3PXHA 1F4WH 3C5ZD 5A2KH 3BZFA 5IB5A 4D0BA 3UZQA 2OTWA 1A3RH 1LNUB 4L3EA 2PYEE 4PJIF 5F9WB 3MBXH 3OKLA 4U3XA 4B0MM 1G7PA 2HVJB 1DQML 4ZOBA 1DFBH 3K8LA 4Y4KB 3C87A 2HAZA 3VDCA 3WLBB 2CIKA 2UZXB 3LDBC 3G04A 1FZMA 2F19L 4F2MA 5MP6H 2OL3H 4JJHA 4JVWA 4K71C 4R4FH 4G80B 3PL6C 4MYWB 1DANT 2VMFA 3TH4T 1EZVY 3GMRA 4AYFA 4IDLA 4YHIA 3L7EB 2ILLA 5DD3L 5HVHC 1NUFA 1AD9A 1RK0A 4ODWB 2FHCA 3QJFB 1JPTH 2WLYA 3BVNA 4YFDB 3PJSB 5JPMB 2I07A 1RU9L 2X7LA 1TENA 5FA3B 1XIWA 3O6FC 5HI3C 3RBSA 1RUKL 1DQMH 5HHOE 3GUTB 1GGBL 1F3DH 3VI4E 3V52L 4PJFF 1IQWL 1QPXA 3D85B 3G6JF 3P2TA 2YRLA 4YE4L 4YNYA 5SX4H 2F19H 3EO1A 1WAAA 1MLBA 2GJJA 1KPRA 3C5SB 1Z9LA 3HC0B 3U36B 4NZUL 5BS0B 1RZ8B 4TN9A 2CQVA 5T3ZD 5C92A 5DD3H 4MA1C 2X9WA 1RIVL 1D5IL 1RHHB 4U0RC 4PRHA 5KSVB 3GSNB 2Y07L 1AGFB 3QPQD 1HZHL 2VAAB 3V5KB 5D1ZC 4HLJA 3KNBB 1QSEA 3BZFB 3NA9L 5IB5B 4D0BB 1RUKH 2VN7A 4M6NL 2OR9L 4R2GC 2OTWB 1MFBL 4D9QD 1BAFL 2Z31C 4YE4H 5C7XL 3JTSB 3LRGA 4M3KB 4L3EB 4XGZA 5EU3A 4C4KO 3JWOH 1KENL 1G7PB 4DKAA 2NXZD 4NZUH 2ZZUT 1OQOA 2CIKB 3G04B 4G9FB 1FZMB 2FR4A 2V5MA 2APVA 4F2MB 2JLLA 4E5XA 1RIVH 1K6QL 3U0TB 2BNRA 1D5IH 3QEGL 4WW2F 3MA7A 2Y07H 3P9MA 3BYTA 1HZHH 3ZE0E 3GMRB 4YHIB 5JUEL 4I77L 5HYQA 3VGDA 1AD9B 1RK0B 2APWA 4M6NH 2OR9H 1EMTL 4M7ZC 5M94B 1MFBH 2LU4A 1BAFH 3BVNB 5C7XH 3UTQA 1CK0L 3EOYG 2I07B 5T33H 3ZE1E 1U91A 2X7LB 1KENH 1XIWB 4Z76A 4L3CA 3UAJD 2EE2A 3WXVL 3GBML 2DJ4A 4OCXL 4YNYB 1T7XA 3EHBC 3ARFD 1KT2A 1MFEH 3EO1B 5E8NA 1KPRB 2ED8A 1K6QH 5IB1A 3QEGH 5GSVA 4I4WA 3ZTNL 2BVTA 5H37H 1JIBA 3LB6D 5JUEH 4I77H 3C09C 3KPRD 3E2HB 3C60A 3IT8D 1EMTH 2DLHA 4PRHB 3Q1SL 4IDJL 2BNUA 5GZOD 3IXAA 1CK0H 1DQLL 2X1XR 3GB7A 1GOHA 4M9PA 5TDOA 1QSEB 4ENEC 1JWUA 5CWSA 3S35X 1A7PL 3WXVH 3GBMH 1AKJA 4JCMA 2JKXA 3GMLA 4OCXH 4XGZB 5EU3B 2AV1A 2E9IA 3HRZA 4X4XA 1U2CA 3FRPA 1HHIA 4R7NA 1CWVA 3FOLA 5D8JH 4FP8L 1R3JA 3ZTNH 3QFJD 5I1AA 3OF6A 3PHQA 4E5XB 2BNRB 3Q1SH 3HG1D 3MA7B 5J6HB 3P9MB 3WL9A 3ARBC 2XKNA 1JK8B 3FQNA 5HYQB 3VD3A 1A7PH 1RUAL 4LSPL 2D7PA 2ZG2A 1DVFC 2A77L 1FFQA 3UTQB 4KMTL 1YJDL 3RWJA 4NWUL 4Z76B 2WUCL 3GMQA 4L3CB 4MA3B 2ZJSL 1A6AA 4FABL 1LD9A 3R4DA 1XF4A 1EO8L 5JDSA 4FP8H 3T0AA 5BS0E 1KT2B 4P2RD 5E8NB 3PWPB 4YHOL 5IB1B 3RHWK 5IVXF 2V2WA 3I50L 5GSVB 4I4WB 3I75B 3T3MF 5JW4R 5IBLD 1MUJA 4HFWA 1C7SA 1FHGA 1RUAH 1OW0C 4LSPH 2IPTL 4HKXA 1WC7A 1JL8A 4PJIA 2BNUB 1FLRL 5F7YC 2A77H 3IXAB 1JRHI 3T1WA 4KMTH 1YJDH 3GB7B 2EDOA 5TDOB 5DUPH 2VLLB 1U3YA 4YHLL 2WUCH 1JWUB 3D39E 5CWSB 3TIDA 1WCBA 2P8PA 3E3QC 5KG9A 1MHCA 4UAOC 2ZJSH 3B5HA 3QBTB 4WO4D 1AKJB 3GMLB 1EO8H 5ID1A 4GKSA 1FSKB 2AV1B 3CFIC 4NO0B 5ICYA 3QIWC 3HRZB 4X4XB 4YHOH 1T04A 2BSRA 3R8BB 1HHIB 3H42H 2YPLD 3I50H 4R7NB 4OLWL 3V6ZA 3LH2L 3U0PA 4JRXA 3FOLB 2QHLA 1Q9WB 1I1YB 1IJ9A 3FAXA 1CTNA 4JZOA 5I1AB 1XGTA 3PHQB 5DSCA 4PB0L 2FDBP 4WFHE 4DKFH 4IOIA 2IPTH 5M95B 1FLRH 4MXVE 3WL9B 4EN3A 2XKNB 1DQQA 1IRAY 2NX5B 5F6HJ 1CI5A 3FQNB 2WAHA 2VZ3A 5FCSH 4Y88A 2Y5TA 4JM2C 4PJFA 3G6JA 2DJSA 4ELME 2KDGA 1J0KA 3OXRA 1PJ9A 3LEYL 5HDBF 2EKSA 2Y06L 5IOPA 3RWJB 4BK5A 4Q97A 1R0AL 2QQNL 1DQJA 2DAVA 3LKQA 3O4LD 4OI9A 1KXQE 1A6AB 1G9ML 4OLWH 1LD9B 1H8SA 3FFDA 3LH2H 1XGRA 2ARJA 1XF4B 4ZPTA 3HR6A 3W0WA 5EDXA 5JDSB 5JW5A 4JRYA 1RAMA 4Y19B 5F7FA 3HZVA 4PB0H 5LAXB 4YQXL 2V2WB 1J0HA 4XCYA 5FO8A 1ORSA 1EX0A 2XN9D 4PRHE 1P84K 1K4DA 1MUJB 4HFWB 2UY6A 5CEZE 1R3LA 4HKXB 1QSEE 4PJIB 3HUJF 4M6OL 4QEGA 3LEYH 1E4JA 1K8DA 2MJWA 4IS6A 2Y06H 1P7KA 3QPQC 2QQNH 3LEXA 1OF2A 1QD0A 1QFOA 3S9DB 1WCBB 2P8PB 1T7WA 5KG9B 1MHCB 3N1MC 3GSUA 4X80H 3VRJA 5C0NC 4K7PL 1GGUA 5ID1B 4GKSB 5ICYB 2VSDA 3OJDB 2A1WH 2BNQA 4LHUG 5E56A 5E9DA 1JZ7A 1NGQL 2PUQT 1T04B 1WITA 2BSRB 3TNNA 1UZ8A 5B3JF 3DRQA 4YQXH 2D7QA 1D9KC 3V6ZB 1N5YL 3U0PB 5DR5L 4JRXB 2BNRE 4LEXL 3L5HA 3BP7A 2JJSC 4JZOB 4FFVD 4QRPA 1XGTB 2OMBA 2D4DA 5DSCB 2P48B 5BV7B 4I0KA 4IOIB 3OMZA 1TZGL 3BKJL 1LEKA 5F6IB 1G7JA 3X11A 4M6OH 3TA3D 1DQQB 2ZNWA 4Z7WF 2ZOKB 2H2SC 3ECBA 2Y5TB 3PHOA 4PJFB 1EA9C 3G6JB 3WYRA 4FQIL 3RY6A 4K7PH 2WWMC 3VD9A 2KUTA 2CMRL 2EKSB 3IXTA 5GRVL 5IOPB 2GJ6D 4NM8L 3CPLA 2KKQA 5GRVK 3WKML 5SWQA 1NGQH 2I5YL 3LKQB 3MFGB 5F1OB 4KH2A 3MRNA 3FFDB 1N5YH 1XGRB 2ARJB 5DR5H 4LEXH 4ZPTB 1CICD 1NGYB 4U1KB 5JW5B 3GIZH 4JRYB 4OQTA 2HRLA 3RL1A 5CP7B 1AR1C 4U2YA 3X12A 4I9WE 1TZGH 3BKJH 3TO2A 1T66C 2ICES 4XCYB 2OQJA 2QADC 3NCYS 5FO8B 3E6FA 1ORSB 4MA8L 3V4UL 3L1OL 1K4DB 3SO3C 4Z95H 3VMNA 1R3LB 4NZJA 1Z9SA 4FQIH 1A1OA 2BSED 4N68A 1K8DB 2CMRH 4IS6B 1JHKL 1P7KB 4NM8H 3LEXB 4PP1D 1OF2B 3S3PA 4QRSA 1JZ8A 2I5YH 1T5XA 4PLKD 3JBG7 1AD0A 4KXZH 2BJML 3GSUB 3VRJB 2J8HA 5D1XD 5T1LD 3UTTD 3Q5TA 3U7AA 3NAAL 5IHUH 1XT5A 2BNQB 4Q74A 1G9EA 1MFCH 3PL6A 4WW2B 4UUJA 5E9DB 4MQTB 3OX8B 1QQDA 4XNQA 1JPST 3TNNB 1UZ8B 5IKCA 3DRQB 1IMHC 5KTEL 1UEYA 3BP7B 3D3VD 3V4UH 1NMCC 3L1OH 5E2VL 1G0XA 4DVBA 1OHQA 2EEAA 3O45B 1LEKB 2A73A 3X11B 3O6FA 1VB9A 4K55A 4LIQE 1JHKH 2D31A 4FHBD 4JM2F 3ECBB 3DVFA 4EDWH 3PHOB 4KQ3L 3HPJA 4IJ3B 4HG4K 2EXYC 1FGVL 4ZD3L 5E2UL 3LCYA 3NAAH 3IXTB 4XWGL 3CPLB 4XMPL 2R1WA 3DBXA 5DGRA 5CGYD 1G6RA 5BCAA 3IF1B 2XA3A 3T2PA 3MRNB 5KTEH 5EIQA 2HT2D 9CGTA 4JKWA 4LK4A 1JZ2A 1BFOA 2FJFB 3RL1B 1T89C 5E2VH 2NXYC 5B38A 3VFMB 5D1ZA 2BHUA 3TO2B 1J05A 2N7BA 2OQJB 3IFOB 1UWXK 3E6FB 4PJIE 4TUOA 4G8GD 3UTSA 5B39A 4MQXD 2YWZA 4XP1L 2Z31A 5C08D 4KQ3H 3CVIL 1FVEA 3G08B 2WIMA 1A1OB 4G6KL 5GGTA 2F8OA 1FGVH 4ZD3H 4Y16A 4G5ZL 5E2UH 4XWGH 1KIQA 1C16A 4KY1L 4XMPH 3MV8D 5KN5A 4QRSB 3OL2A 5K9JH 1T5XB 2W0KA 3LDBB 4G8EA 4NFBA 1WWBX 4KKAD 1AD0B 1YN6A 3MUGA 5KSBF 5JDJA 2WWKT 4WCYL 4K71B 4WO4C 1S9XB 3PL6B 4UUJB 3ZDXF 3E8UL 4RFOL 3UO1L 4LGPB 5IKCB 3FB8A 1C12B 3S8WA 5DA4A 3WFBH 1UWXH 3W5NA 1U8NA 5HVHB 3MV7B 3BE1H 4LSSL 3PWLA 4QHLA 4R7DA 4FQLL 1A6UL 1DZBA 3WNMA 4DVBB 3QP3A 3I9GL 2E7MA 2A73B 3O6FB 3NMEA 4ZFZB 1RV6X 4G5ZH 4Z9KB 2YSSA 4WEUD 3WD5L 5IVOA 2D31B 4KY1H 4EJ1C 5FGSA 4NNXA 4OZGA 1IGYA 4UIKL 2NY7L 3HPJB 3BRFA 2OMNA 2J8UE 4H5SA 1IKNC 1G0DA 4WCYH 2W9LA 2X1QA 1OVZA 4LARL 3QFDA 4HXAL 3KJ4B 2R1WB 3DBXB 3W0WE 4RFOH 4JRYE 1XGPB 4P2YA 1J0IA 4AG4H 1TQCC 4MA1B 4LSSH 4XPFL 1BFOB 1MCOL 3CMGA 4FQLH 5B38B 1K8IA 4HQQH 5D1ZB 5HSFA 4YHYB 2UVEA 3I9GH 1ZT4A 5J13C 5FGBC 3WD5H 4R2GB 2J5LC 4TUOB 3UTSB 2BMKA 5CBAA 2Z31B 4UIKH 3EKCA 4I3GA 1FVEB 1N6QH 4KKLD 4Y16B 1KIQB 3WFEL 1C16B 1OCWL 4HXAH 5KN5B 3MV9E 1A21A 1MHHA 1MCLA 4G8EB 3MRRA 2BNQE 3V0VA 1YN6B 5E9DE 4TQEL 3MUGB 3QUKA 1MCKA 4XPFH 4HGKC 2IAMD 1MCOH 3S36X 3ARBA 2DD8L 4N0UA 3FB8B 4Z7WA 4QRPE 1U8NB 3OG6B 3PWLB 4M7ZB 4QHLB 1M71A 5E99L 3S5LG 4R7DB 2HKHL 1DVFA 4XMKL 1UKTA 2EECA 5C6WH 1B0RA 2D7MA 3P0YL 4YBQD 5I73B 2YSSB 3D6GA 3WFEH 3BHBA 1OCWH 2DIAA 3CU7A 3SKUD 4P9HL 4NNXB 4OZGB 3TA3C 1IGYB 3I85A 3D69A 3QDMA 4LPUA 4TQEH 4KKBD 4ZFOB 4Z0BL 1L0QA 4Q58C 4ODHL 3HNSL 1X5IA 4KHTH 3QFDB 2VISA 3C09B 5DHVA 3JV5A 1DJSA 4UDTA 1OW0A 5DJZB 2M26A 5E99H 3GGWA 2HKHH 5EOCJ 4XMKH 1CICC 3HUJB 4YC2C 1K8IB 2X44D 4ONOA 2ZNXA 1ZT4B 2G5BA 3P0YH 3INUL 4N5ED 1IC4H 3SDYL 4HUMB 3NIDF 1VA9A 2BMKB 4P9HH 5CBAB 5C0BA 3MMEA 5LWYL 1E28A 3QIWA 1RJLA 3T0WA 5C0EB 1QNZL 1AP2A 2CR3A 4NUJA 4Z0BH 5DD1L 4ODHH 2DLFL 5JIIA 3OR7A 5IFHH 4WI5A 1MHHB 4NHCL 4X0KA 3VXUA 3MRRB 1HYSD 2ZKHL 4PP1C 3HR5A 3V0VB 1B2WH 5CS7A 3QUKB 4PJ9D 1NFDE 4PJHA 4DQOL 4NQXA 1BHGA 5C07D 1MCJA 1XH3A 3ARBB 4N0UB 4GAYA 3DLQR 4Z7WB 5IWLC 1GJIA 3INUH 1GAFL 4JM2A 4HIJB 5EOQL 1AH1A 3PDDA 5DQDL 1M71B 4OIAA 2NCMA 4JVPA 4K8RC 5LWYH 5EC2A 3TIEA 4LVHC 2DL9A 1QNZH 1QFUL 3QDHA 5DD1H 2I27N 4PIRF 3BHBB 4P5MA 3NCBB 4XX1E 3MRFA 4HLZH 4Y2DC 4CVWA 5CKAA 4NHCH 4M7JL 2ZKHH 4ONGH 1HQ4A 3QDMB 3TO4C 5GQBA 3BIAX 4DQOH 3T3ME 4X99A 4MS8D 4M48H 3RTQA 5AWNL 5I1EL 2P5WD 5ISZB 4QGYA 4F33A 3ESUF 4LSVH 1CDGA 1GOGA 4Q0XL 5GSRB 1CT8A 3DXAA 1ZLSH 5F9JA 1YMME 1GAFH 2R29L 5DHVB 5EOQH 2HKFH 4F7CA 4UDTB 4XNUL 5DQDH 5C70A 3GGWB 1MCCA 4RGNC 4L8SC 3QYCA 1M7IA 3UP1A 2IMNA 4GMTL 4HZLA 4PV9A 2UUDH 2G5BB 1NMBH 1QFUH 4KDTC 4UAOB 2HFGL 2CLRB 3N85L 2B4CC 3GMNA 5C0BB 2IQAA 1BLNA 3MMEB 4Z7QE 4M7JH 5KSBA 4OFPA 3QIWB 1RJLB 1KN4L 2QQLL 4MQXC 1X44A 3LKPA 1AP2B 4NUJB 4F37K 4NQUA 1MAML 4G7VL 4PRID 3FHAA 3OR7B 1D9KA 2VUYA 1G1YA 5AWNH 5I1EH 3DHMA 4X0KB 3VXUB 4Q0XH 2JJSA 3HR5B 3AC0A 2HFFA 3MLXL 1I1AC 4PJHB 3WIIL 1XH3B 2CDGA 1BPVA 4X6CF 4N0CD 3RWFA 4GAYB 3KPSA 3IDJB 4JM2B 2FD6L 1CCZA 3N85H 2FBJL 1VFAA 4YFLI 1CGTA 3UMTA 2NY6C 5DJAA 5EC2B 2HTLC 1KN4H 2A6KA 2QQLH 3SGEH 3TIEB 2AABL 4L4VE 4OZGE 2BFVL 1DL7L 1WFOA 1X4XA 2G5RA 5T3XH 4BSJA 1MAMH 4G7VH 3S35L 2PXYB 4P5MB 3MRFB 3T65B 5TDNA 5BOZG 2LAGB 2PTUA 3FT3A 2KQMA 3RVTD 5EU4A 4J8RA 4QRQA 3MLXH 4PJGA 4FFYL 2K1MA 4X99B 3RTQB 3STZA 1RZGA 3CH8A 4OBRA 1SYVB 1CT8B 3DXAB 4U31A 3DMMD 1MIML 2VOTA 5F9JB 4F7CB 2FD6H 4K94C 5JOPE 1A0QL 1M7IB 5HGGS 1RJZA 2MFNA 4HZLB 5C0CE 2BFVH 4P5TD 1DL7H 4CKVX 1IAIL 2GY7B 3S35H 1R5WA 5B4MC 1KLFA 3GMNB 1BLNB 3HS0A 4HPYH 5KSBB 1JUFB 3SCMD 3AVEA 4KK6C 3LKPB 5BRZD 3IDNA 5I2IA 3OJMB 4KKLC 2XYCA 1D9KB 4WU5B 5ICZA 4RMSA 3MOAL 4HV8A 3SDAB 1MIMH 3H9SA 3ZSTA 2HFFB 5DMGC 1ZTXL 2R8SL 2XTJC 4C83A 3BFOA 4Z7WE 3AMKA 2CUMA 2CDGB 2XY2A 1I9IH 2IAMC 3RWFB 1ES0A 4OIIH 4AL8L 3KPSB 4TNVK 2HJKA 3OKEA 1GSMA 1IAIH 2WIIA 1N3NA 3JUZA 4PYGA 1WZ1L 1VFAB 4Z0XA 3T0EC 1SVZA 5SX5K 3C6SA 3RKDC 5F21B 5IMOA 3QDME 3VXTA 3S5LB 5TDNB 3FN3A 4X7DC 3RKPA 1MSPA 4OQ1A 3FT3B 1T89A 5EU4B 3ZE2E 5AG8A 1ZTXH 4QRQB 4PJGB 4Y8DC 1T7ZA 2ZUYA 4BSWA 5DURD 3BWAA 5JXEC 1U3HC 4U1MA 4WIQA 2QADB 3STZB 1UH2A 4AL8H 5CLTA 3N1FC 3ARGD 1HHHA 3SO3B 4K3DL 2I24N 5D6DC 1JTTA 4YFLF 4QHKI 3E3QE 4NM4H 5JPNA 4JDVA 2FX9L 2LABA 2WBJC 2G60L 3RIAK 5C0BE 4LQ1A 3WO4C 1PW3A 2CO7B 2DDQL 1JHLH 3NABL 3HS0B 2XXCB 4PLOB 3BKYL 3MRLA 1AR2A 5F7DA 4BJLA 3VXUE 3WS3A 3QUXA 1LQSR 2I26N 3IDNB 5E4IA 5I2IB 1JF6A 5ICZB 2VLJD 1HHGA 4RRPG 3VJ6A 4PJHE 1Q72L 1MRCL 1S8DA 2YPLA 1JBJA 2J2ZA 4WV1C 1NMCB 4JO4L 4HV8B 3H9SB 3VU2A 5H8DA 3KYOA 3WIHA 2P44B 1R6VA 4C83B 1A22B 1EHLL 3BIKA 2WANA 1H3PL 1ES0B 4HD9A 2FX9H 4R9HA 4AY0A 3PGCA 2HJKB 3OKEB 2G60H 1KSRA 4N9OB 4ZNEE 3BIBX 1E6JL 2N4IA 1N3NB 2WIIB 2DDQH 4ONHA 3ILQD 4N1CA 3KDMA 5CUSL 2ID5A 3NABH 1IKNA 3T4YA 5JTWA 3BJLA 3JV0A 3C6SB 5CINL 3BKYH 5IMOB 3C2AH 3ZL4L 3DURB 3VXTB 1DP0A 3I6LE 1Q72H 2V5YA 5KBNC 4N90D 3IDXL 3STBA 1P1ZA 2NXYB 3TT1L 5CHNA 2DWDA 1NUNB 4KRMB 4BSWB 3BWAB 3DXAE 1EV2E 5FGBA 5HHNA 4MAYC 4MS8C 1A8JH 4P46D 1HHHB 4XNZC 1E6JH 1S78D 4XVUC 2GITA 3N06B 4KRPD 1CFNA 5GRZA 5ESAA 5ICXB 2P8MA 2DM3A 3O8XC 2V5RA 4N0YH 2BY1A 5TQ2L 3ZL4H 4PJ7F 1P4BL 4HJ0D 1C7TA 3ZKMD 1RI8A 2OBGA 3TH2T 3BZEA 3LV3A 1A6ZA 3IDXH 1I7TA 3TT1H 3O6LL 3MRLB 5F7DB 3WS3B 3QUXB 5TF1H 2VLKA 2OCFD 4MJID 5HHMD 1HHGB 1FP5A 4YHPA 3VJ6B 1WFTA 1S8DB 1MJJA 2VYRE 3MJ7A 3KYOB 3HI1A 3B9KC 5L2KD 1ZGLM 3L5WA 4LQFL 1ND0A 3BIKB 4KTEH 2DBLL 3HTLX 2E9JA 2YZ8A 2X4PA 3PGCB 4W4OC 3TA3A 2J6EL 4ONHB 1QEWB 5TQ2H 2Q7YA 3KDMB 1P4BH 3T4YB 4LP5A 1NCAL 5HD8D 1FIGL 2DIBA 3O6LH 2FHFA 5DJXA 1KXTB 4XVSL 1TQCB 1NEUA 4F80A 4PJGE 1MJUL 1P7QA 2ZUVA 1P1ZB 1CICA 2VE6A 4JO1L 3EZ8A 5BVJA 5CHNB 2DWDB 3ULUD 5J13B 1DUYA 4LQFH 1E4KC 2FO4B 1QRKA 4OFDA 3OG4B 5A2LH 2DBLH 5HHNB 3L9RA 1IC7H 1MQKL 5BQ7A 2J5LB 3KPRE 5A1AA 2J6EH 1LO0L 2GITB 3UBXA 1CFNB 1RSFA 1NCAH 3C5JB 5ESAB 2P8MB 3QXWA 3E1F1 5HYJA 5CJ8A 1XGQA 4NZRL 2UYLA 3KLDA 4MCYB 2WQ8A 4F15C 4BQCA 4XVSH 4P5TC 2AXHA 2FWOA 2AXFA 2J88H 1X6LA 3BZEB 3LV3B 1A6ZB 4G43A 1OTUD 1I7TB 4JO1H 2VQ1A 3UTTA 1PEWA 4K3EL 3RJDA 4J3TA 4X6CB 2VLKB 3CFJA 3H9SE 5IWLA 5I17B 1K85A 4YHPB 4K3HA 4HWBL 1MI5A 1RZKL 1MJJB 1MQKH 3GNML 5MEOA 1TQBB 5E2WL 1YECL 4Q9QL 1QBLH 1BGXL 3HI1B 4OFYD 1LO0H 5DJ6A 3RI5K 5DMIL 2NY2D 2P45B 4OUUA 5IT2L 1TJHL 3L5WB 4GT7A 1ND0B 4LRNL 5D7LA 4GAFB 1IGFL 4MVBD 2X4PB 3RX7A 1NDGA 4Y2DA 5F93C 4TNWF 5E8EA 1T0MA 2YD6A 4XNMB 4CVZA 2Q7YB 4APQD 1EGJA 3TO4A 5DQ9A 1CDYA 2YKLL 3T3PF 3MTRA 4Z7OF 5DJXB 4NO5A 3FQWA 3ZLQC 4IHOA 4NPYA 4HWBH 3KPTA 3QULA 1RZKH 1MY7A 2OJEA 3GNMH 1P7QB 3GBLA 2VXSL 3K74B 5E2WH 1YECH 1CLZL 4Q9QH 1BGXH 2VE6B 4L8SA 4YC2B 3ULVD 5A40E 4J7RA 3H3PL 1K3IA 5IT2H 1DUYB 4LRNH 1HN1A 2IANA 4WI7A 5HYSG 4KDTA 5BQ7B 2VNCA 1KCLA 5KOVC 4Z7VF 2NY5L 3FRUA 1QTYT 4KJPC 3ARGC 3UBXB 1B90A 3JSSA 5FYKD 2YKLH 4U33A 3WJJC 4EQ3A 4FQXD 2HT3C 3RDTC 5HYJB 3MGOA 4LVEA 1XGQB 2UYLB 2EDBA 4NNPL 4UT7L 3PQYD 4UBDD 1I1AA 2FWOB 2AXFB 1CR9L 2VXSH 3HAEH 1CLZH 3HE6D 3U7YL 4OTXL 2VQ1B 2J4WL 2YPLE 3H3PH 4XCCL 4ZMAT 1KG0B 5L6YL 1MI5B 2BVEA 4PBXA 3FKUS 2BXYA 1VADB 1EBPA 5MEOB 3GSOB 2XWBB 5SWSA 5DJ6B 4FZEL 5DC4B 3PWJA 3P0GB 4OUUB 2NY5H 5HGHA 1PY4A 2RAMA 5D7LB 5IM7A 2DLIA 3V7AE 4JKKA 2GJZA 1SJVA 1NDGB 3NCMA 3RUGE 3EYSH 4Y2DB 3HE7D 3SBWC 5FECB 4HK3J 5E8EB 4CVZB 4NNPH 3VG9C 4UT7H 4FMFA 3TO4B 5DQ9B 5I6XC 3QZWG 5F97E 3H6JA 3U2SA 3U7YH 2G75A 2VERN 4OTXH 4XVTH 3O4LE 4NO5B 2J4WH 3D2UA 4XCCH 3FQWB 4IHOB 4NPYB 5L6YH 2B1HH 5MEQA 2P5ED 2P7TA 4YWGL 3QULB 2OJEB 3QUYC 5EUKA 2PKDA 3ETBF 1ZVYA 3ZKXC 4RGNB 4L8SB 4BKLB 3S36L 3KAAA 1AXSA 3UPAA 4J23A 1I7UA 1JE6A 3D1MC 3GSQA 2IANB 3OAZK 4ZFOL 3HKFA 3LRHA 4QWWC 3FO0L 2GFBA 3FRUB 3SHSA 4D2NA 1GL4B 1S78C 2DTML 1I7ZA 3P30H 3QIUC 4Y8AA 3QUML 3U1SL 2Q8BL 3MGOB 3BWUC 2DQTH 3EJJX 5FM4A 4N9GA 1I1AB 1VFOA 1KTDA 2RQ8A 4KK9D 4HJ0C 3ZKMC 3S36H 2B0SL 1X5KA 4OGZA 1FVDA 4NSKA 1NGXA 2Y25A 1ZSDA 1MHEA 5SWSB 3FO0H 3L5JA 1CGSL 3PWJB 3T0EA 2BY2A 4HMEA 1EAJA 2NY6B 4YO0A 3H3BC 5FYJE 4WGWB 2DTMH 5IM7B 1UT9A 4NO2B 5I1DA 2GJZB 4XBGA 3QUMH 3U1SH 2Q8BH 5J1AA 1JRHL 4XX1G 2DQEH 3FCTB 4HXBL 1R3KA 3L3JA 5A2FA 2GJ6E 3T77A 4NQCA 5DMYA 2CGRL 3U2SB 5JXEA 1U3HA 2G75B 5AZ2H 4HUNB 2GEEA 2B0SH 3D2UB 4EUPG 5HI5C 1F6AA 4HWZA 1YMHA 3UZVB 1KPUA 4QF1A 1U8LA 1HDMA 5D6DA 1S7TA 5EUKB 1YC7A 4WRLA 2I60H 3FO1B 3MRMA 1CGSH 3DPBA 1AXSB 1I7UB 2WBJA 2O5XL 3GSQB 5C6TL 5KSAD 3T2OA 1HYRC 1R5VA 4NKDA 1JRHH 2GFBB 2XXMB 3EJYC 2EXWC 5HYJE 1OARH 3SJVD 1I7ZB 5IR1A 3HI5L 3SGKC 5HYSA 5DJYA 5F44A 4KKCC 3CFDA 3P0VL 4BFIA 3OV6A 4ZQKA 3UTTE 5FYKU 1ONQB 4N9GB 4DTGL 2XTJB 1KTDB 2EO1A 1DCLA 1NAMH 5EC1A 3FB5A 5D96C 2Z8VC 3FL7A 1OTUC 1HQRB 4NSKB 1NGXB 4K9EC 2O5XH 1CIUA 5C6TH 1MWAL 1ZSDB 1MHEB 4X6BB 3HPLA 4ZS7L 5B8CC 4EEEA 5D7LE 2Z93B 3T0EB 3QO0A 4ZUWA 4YO0B 1XF1A 2YD3A 3BKCL 5DJ2A 5DFWH 5I1DB 1BVZA 3HI5H 1XF3A 2NYYD 4XBGB 3UTZA 5J1AB 2BHYA 2Y36L 1YNTB 4DAGL 4NN7C 4RDQF 1R3KB 3P0VH 3L3JB 1B4JL 4XXDA 4DTGH 3T77B 2GY5A 4NQCB 1BOYA 1U3HB 4MAYA 4H0IA 3F6LA 1OM3L 1NCNA 1F6AB 4HWZB 5TF0A 4RGNE 1MWAH 4PD4K 1YMHB 3WFDH 1HDMB 1S7TB 2FEDC 4WW1B 3REWA 4ZS7H 4A2LA 3MRMB 2IANE 2YN3A 1OGTA 4N8VA 4D0DA 4KTYA 4JG1L 3LY6A 3O8XA 4OGAD 3BKCH 2WBJB 2EEBA 1X5YA 5EPMA 3WO4B 5IEKA 4QXTA 2ZSVA 5C08E 3CFBA 1MCQA 5C86A 1R5VB 2EIEA 4NKDB 2J1KA 2Y36H 3VG0L 4AMKL 4DAGH 1U93B 1HKLL 2ZPKL 1B4JH 4JLRB 5ADPL 5J4MA 3S6CA 5HYSB 4JKLA 3U82B 4DWHA 5DJYB 3DVNA 4ZYKB 3CFDB 4OT1L 3ZDZE 1OM3H 4M93B 2YUXA 2Q3AA 1KC5L 1FYTD 4BFIB 4ZQKB 1GOFA 3R0MA 3WDJA 3B9KA 4E41D 5F1IA 4CL7A 3L7FA 5EC1B 3VDAA 3FB5B 4P2OD 2LVCA 4JG1H 5GS1C 5EORL 2Y23A 1IQDA 3HE6C 4OV5A 4LL9A 5SWSE 4W4OA 4D94A 3DNKA 4X5XA 5IESL 3HPLB 1N4XL 1I7RB 3RIFK 3VG0H 2VRAA 3QO0B 4ZUWB 2Y72A 2W0PA 1HKLH 2ZPKH 5EO1A 5HJ3A 5DJ2B 2FRGP 5CP3A 5ADPH 1XF3B 1U3JA 4WI9A 3CDCA 3UTZB 4OT1H 4U49A 3RY4A 3GK8L 3O2WH 5I66A 2H1PL 1OD9A 4JB9H 4XXDB 2EIBA 4GRWE 4LASL 3T0DA 1X5LA 4L4TD 4PGDA 4X7FC 1E4KA 5E7FA 2QQKL 5BXFA 2VABA 4MAYB 1LO2L 5EORH 5AYQA 3NCCB 1CVRA 4XNZB 4PJAE 5IESH 1N4XH 3REWB 1EFXA 1QLRA 4ZXBD 3LQZB 5KVFL 1OGTB 4N8VB 4D0DB 1BVKA 1IC5L 3O8XB 2JE8A 4WHYG 1H8NA 3HNVL 4JREC 5EPMB 3RVUD 4QXTB 2ZSVB 2CK2A 4LAJH 3CFBB 2XZCH 1W0WA 3GK8H 2IALA 4Y7MA 3F7PC 2H1PH 4LASH 4MJ4A 3V4PL 2QQKH 1Q9LA 3EOTL 4LPTA 4O2FA 3RGVD 2XTJE 1LO2H 3GHBL 2IQ9L 5IP4A 3QXVA 5GGRA 2VJXA 1CXKA 1WEJL 2AJZA 3B9KB 3CK0L 2R2BA 1T20A 5F7UA 3L7FB 3S34L 5KVFH 4YEEA 1IC5H 2E8ZA 1IQDB 1M6OA 4OV5B 1QUNA 3HNVH 1FO0L 3HZYA 4X5XB 3RJQB 3ZKSD 3MJ9L 5LQBL 4QXUL 1F4AA 3CX2A 4XHQA 5EO1B 3JXAA 5HJ3B 4ZTPH 3V4PH 5IBTL 1AGEA 2NR6D 3EOTH 4HH9B 3GHBH 5DQJA 2IQ9H 4NQCE 1VDGA 4U6XB 1WEJH 5I66B 4X5WB 2NZ9D 4KV5E 3CK0H 3CMOL 2VLRD 4PGDB 2HG5B 2C1PA 1A6WL 2CH8A 5BXFB 1FZKA 2VABB 4HX1A 5GZND 5IG7A 4A6YL 1FO0H 3CSYA 5L0QC 3ARGA 1EFXB 1QLRB 4Z78A 5C09A 3MJ9H 5LQBH 3DIFA 1RZFH 1BVKB 4QXUH 3MUHL 4HMDA 1QR4A 4WI6A 4P23A 1MNUL 3RDTA 3SDDD 5IBTH 4F15B 3H9YA 3JVGC 1FBIL 3EFDL 1KIUA 2EIZA 5JHLL 1W0WB 2IALB 3ARVA 2C3GA 4XI5C 3CMOH 3KPLA 3H7BA 4O2FB 1A6WH 1Q9LB 4KROD 5K9QI 3TZVC 5GGRB 2C4FT 3C6LC 1B6DA 4A6YH 2AJZB 2R2BB 4Y1AD 3MCKA 3VXMD 3OXSA 4UB0H 4BQ6A 2VL5A 1URLA 3L3OA 1BQHA 4TTDD 1M6OB 1FQ9C 2ED7A 2V2XB 4FTVA 5HHVL 1J7VR 2F9BT 1MNUH 3SBWA 3HZYB 4TSAL 3VFOA 3S96A 3VFSA 4P2QD 2L0DA 3EFDH 3VRIB 4QOKA 3C8KA 1LEIA 5JHLH 1BWWA 2R9HC 3WMSA 5IHLB 1J5OL 1I3VA 1PEZA 1AGEB 4EI5C 5KZCD 5DQJB 1YN7B 2APTA 3QUYA 4LDLB 4NZTL 3WLWC 1RUML 1WIOA 1F4HA 2GSIB 4BK4A 2P5WE 1T1ZA 5I1KL 1FZKB 3HFML 5CSZA 1MCPL 4HX1B 2RCSL 1IM9A 5HHVH 5IG7B 3CSYB 5E03A 4H88L 4TSAH 1ADQA 4POUB 3IDUA 1HKFA 4Z78B 5E5MA 2AXGA 1KV3A 5C09B 3LKSA 1HSAA 3DIFB 2NY3B 3QIUA 4M6MH 1OWWA 4ZUVA 4AIOA 3SDCC 4P23B 3RDTB 4OZHE 2X89A 4WDIA 2CKBA 4EDXA 3VWKD 4ZFGL 5KVGL 4I5BA 1H3VA 1Q0XL 4ZSOB 1UA6L 2EIZB 4NZTH 3OKMA 3X3GH 5IEHA 1RUMH 2UY7A 3NFSL 5E6ZA 3SGDH 1KELL 3KPLB 4PRIE 4L29A 3H7BB 4UOW0 3L95A 4YH6A 3MLRL 5I1KH 5J12B 3HFMH 3MA9L 3ZT6A 1MCPH 3DI3B 2RCSH 4PB9L 1Y18A 1U36A 1CQYA 1G6VK 5FKAA 4X8XA 1YJDC 4H88H 5EUOA 4P9ML 2PO6B 1S7VA 1WT5C 1JGLH 3OXSB 5GS0D 1MCHA 2VL5B 5L2KA 1FGNL 3L3OB 1BQHB 3EJZC 4LSUL 5DK3A 3MYJA 4FTVB 4P2OC 5FM8A 1Z0NA 2B2XL 1VSCA 1LE9A 1U8QA 3SOBL 3QDGA 3VG9B 3VFOB 4ZFGH 3S96B 3VFSB 3GKWL 1LEIB 5KVGH 4QOKB 3C8KB 1Q0XH 1UA6H 4NQDA 4Z8FL 5GGQH 5I6XB 4HS3A 1H0DB 2AJ3B 5F7WC 3BP5A 5HBBA 3LEVL 4KKNA 2QSCL 3RPKA 4LBEA 1SYSA 3MLRH 3MA9H 5ENWB 3QUYB 5DJ8A 3ORJA 4O02L 4PB9H 3EOAA 3MXVL 2XWJA 4P9MH 1T1ZB 4QRRA 1GGIL 1FGNH 1ZS8A 4XPBL 5CSZB 4LSUH 1IM9B 4O58L 1CQKA 3O6KH 2B2XH 3SOBH 1EPFA 4G6FB 1EO7A 3GKWH 5E5MB 2AXGB 1DEEA 3LKSB 1HSAB 4TVPL 4Z8FH 1NC2D 3QIUB 1NANH 3SGKA 1T2QL 4ZUVB 4WWKD 4KGLA 3CH1B 1NBZA 4QHKJ 4JFHE 4WDIB 4JM4L 2QSCH 2CKBB 4EDXB 5F7KC 3VH8G 4L3AA 4R8WL 5MERA 4I5BB 2JJWA 2UV3A 4XHJD 4F7TA 3SDXF 1QBAA 3G5XA 3OKMB 5IEHB 5D2NC 3SQBA 1L6XA 4JFDA 4UMGA 4QY8A 3MXVH 1V3JA 4LCIL 3MNZA 4KHXL 43CAA 4L29B 3LN9A 3L95B 1GGIH 1BF2A 2GAZA 4P49A 1I3GH 4O58H 5B8CA 5FYLL 5FKAB 5K9QG 2HWZL 5EUOB 4NNYA 3UYPA 5AEAA 2P8LA 1S7VB 4LLQA 4J12A 4TVPH 3FTGA 2BXZA 2XFXA 4DEPC 1UJTA 1G9MC 1T2QH 4FXKA 1U8PA 3NZHL 2OK0L 3LS4L 1UZ6F 4JM4H 5CBEA 1U8QB 4OJFL 1LE9B 3QDGB 4R8WH 2EZ0C 4NQDB 4JHAL 4PS4L 4HS3B 3TPUA 5KW9L 1X7QA 3OKKA 2AGJL 5IFAL 4LCIH 4KHXH 4TOYL 2Q86A 2OXHA 3BAEL 4JR9L 4MGXA 4LBEB 1SYSB 3BYYA 2X4SA 5DJ8B 5K93A 2A6JA 2AKRA 3QUZC 5FYLH 3EOAB 2XWJB 2HWZH 2W59A 5ALCL 2R0WL 1G84A 4M1CD 4J6RL 4PJ8C 4QRRB 1YY9C 1ZS8B 4QO1A 1OWRM 4E9LA 3NZHH 2OK0H 4QRTA 3EZJB 3LS4H 4PV8A 1YEKH 4EI6A 4LSDA 1I3RA 3EO9L 4E42A 1DEEB 1C5CL 4JHAH 4PS4H 4HEPG 5KW9H 3DUSA 3WCYA 1OTTD 2BY0A 3NPSC 4Y4KD 1NBZB 2AGJH 5GRUL 5T5NG 3U0WL 5IFAH 3DYOA 4O5LL 4TOYH 1CE6A 2QQQA 2M2DA 1CF8L 5MERB 5HDOA 4OF5A 4F7TB 5ESVA 4CGTA 4AM0A 3G5XB 3BN9D 4JFDB 2W0FA 4QY8B 5ALCH 3MNZB 43CAB 5GS1A 4J6RH 3HE6A 1DQTA 1A14L 5E1AA 2GAZB 3AU1A 3KYKL 5D7SL 2E7CA 5DFVD 2A6IA 3QWRA 4NNYB 4M1GL 3CLFL 1CXHA 4FTVE 4LLQB 3EO9H 1MEXL 3FTGB 1EBAA 2VR4A 1W8OA 4FXKB 5JZ7D 2XNAA 3Q5YA 5GRUH 4QOKE 3QQ9C 3U0WH 3CU1A 2OL3A 3MGTB 3S98A 3D85D 4TTDC 4O5LH 1BREA 2EC8A 5A2IH 5K59F 4NN7B 1SEBA 3RHWF 4JN1L 1CF8H 1XCTA 2DQHL 2YUZA 4P2CG 3VXOA 1X7QB 3OKKB 4P4RB 5BS0D 3BISA 1PBYA 2DBJA 2Q86B 3C8HA 2VZVA 3BMVA 1A14H 4RZCA 3KYKH 1HHJA 2X4SB 4JJ5B 4N90E 5D7SH 2A6JB 2AKRB 2F5AL 1UADC 1NLBL 4RWYL 5K9KB 5GGVH 4ESKA 3MV11 5I8OL 4M1GH 1DBBL 4ZOEA 1QFWM 4OAWA 5C9KA 4HUVB 4MA7H 4QRTB 4PV8B 4EI6B 1CGWA 4OZ4A 1LO5A 1JF1A 2ZUSA 1KB5L 1OTSC 4L3ED 1I3RB 4JN1H 2DQHH 3P11L 5E24E 3QWOA 4E42B 2FZ3A 2YXFA 4KXZI 3DUSB 2DQDL 3SO5A 2GIYA 1CE6B 3K0WA 1NFKA 2P46B 4G9FD 1LK3L 1EXUA 3D18A 3P4MA 1UM4H 4KI5D 1JVKA 2F5AH 1NLBH 3HC4L 4GH7B 1KFAL 5ECJE 2JB5L 4O51B 5I8OH 1DBBH 5HHME 25C8L 2CO6B 2MNUA 3HI6L 5DRWA 5LCVL 2X1OA 1EEYA 1WQVT 2X05A 2MWCA 3AU1B 5EUOE 3QT2A 3PGFH 2V2TA 2WK2A 4LNVA 5C0GA 1L7IL 5L2KE 3AREA 4HIIA 1KB5H 5GS2H 1QKZH 3P11H 1YZZA 1D6EA 1XIWD 2FCBA 2KBGA 1RZIB 2XNAB 2DQDH 4R3SB 2OL3B 4NQDE 3B9VA 2FECI 1AGDA 4MD0A 1LK3H 1XCTB 3EOBA 4U6VL 3B3IA 5AAMA 3PXJA 3VXOB 4S0SD 3IJSA 1UC6A 2LAAA 1WZMA 1KFAH 2WW8A 3O3DA 2XA8L 2JB5H 4Q6IC 3BEWA 25C8H 3HI6H 5H35A 4GLRI 1IM3A 4RZCB 1HHJB 2ZUQB 3LN5A 4LPWA 1S7QA 4PRHD 4R97C 1L7IH 2FEEI 4FXGA 3MLTA 3ULUE 5BO1L 5CEZD 4MX7A 4B5EA 5CEYA 1QSED 2ORBL 4OAWB 2OTPA 5ESQA 4M7KL 1N0LA 1D5ZB 3JVGA 1T2XA 3MACL 5GHWL 4OZ4B 4TSBL 1JF1B 4NCC1 3SDXA 4RQQA 2C3HA 3OKYA 3QWOB 2F74A 5GIRA 1YEJH 5J11C 4W68A 2FH6A 4LPCA 3SJVA 2XA8H 4OLUL 5DD5L 3TZVA 3C6LA 3P4MB 1WV7T 3D18B 4U2ZA 1ZT1A 2QSTA 4OFIA 1LO4L 2BNRD 2J3SA 4KGJA 4M4PA 1TVDA 5E5UB 1JWMA 5BO1H 5DRWB 2A9NL 3QCTL 4M8QA 4Y2OA 4WY7L 1EEYB 4JFFA 5DJ0A 3V8OA 2BOBB 2GKIA 3MACH 5GHWH 5C0GB 3AREB 4TSBH 4HIIB 3SY0A 1D6VL 1J11A 2BVYA 4XP5L 1MJ8L 1D6EB 4FN0A 4X98B 5D7IA 4EI5A 4XVJL 4OLUH 4PBWD 5DD5H 4CVXA 1AGDB 1QVOB 4MD0B 5TQ0L 3EOBB 3B3IB 4WEBH 3PWPD 1K2DA 3IJSB 3LQAL 3NBNA 4MZ2A 3O3DB 1AI1L 1ZV5A 3KPOB 5HHPA 3BEWB 2ENYA 5H35B 2A9NH 1SJEA 3QCTH 1IM3B 4I9WD 4TUKL 4WY7H 5E8OA 1F90L 1QSVA 5L0QB 3LN5B 1F5WA 2NNAA 3D9AL 5EU7C 4FXGB 1D6VH 4MX7B 3SDCA 4HGWA 1CD1A 3F65A 1MJ8H 2PNDA 3F62A 5CEYB 1A4KA 4CDHA 5ESQB 2RFXA 5CJOL 3SE8L 2OR7A 3AS2A 5DD6A 3FO9A 3DSNA 4XVJH 4MQ7A 1AKJD 4JFPA 1CGUA 3B9EA 1E4XI 4NUGL 4JE4B 4NO0D 5TQ0H 3SDXB 3HZKA 2F74B 5GIRB 1IT9L 3BDYL 3LQAH 5DO2C 5F9WC 4HHAA 5DVOA 2DF3A 1A7OL 3RWHA 3HC3L 1RIHL 4HZAA 3DHJA 1DSFL 1AI1H 1MQ8A 3PQYE 4ZAKC 3T4AA 1TMCB 1JPGA 5F96L 3TZVB 3PABA 5AAWA 4OLZL 3C6LB 1KEML 4TUKH 2PW2A 3QQNA 1ZT1B 2IPUK 1F90H 3IJYA 2KH2B 4X7TA 1VFBA 1NMAL 3WFCL 1WT5A 4LGRB 4W6WB 1IARB 3BN9C 5DJDA 2NX5D 2VTFA 4P2OA 4M8QB 4P9HC 2L7UA 1RPQA 5CJOH 4JFFB 5DJ0B 3SE8H 4RMVA 1UM6L 4C58B 1WUNT 1FV1A 4FQJL 4OLVL 3SY0B 4G42B 1R3HA 1YYLL 1SQ2N 1IT9H 1TXKA 4XPHL 2H9GA 1A7OH 3GRWL 1HXMA 5D7IB 3HC3H 1RIHH 4EI5B 5CEXA 1AE6H 1DSFH 1YNKL 5JZ7C 4CVXB 5F96H 3QJHA 4OLZH 2D7TL 4GW4B 1KEMH 4BA8A 1I8LC 3UYRH 2VZ1A 1F4XH 1ZLVK 4LLVA 4Y19D 1KEGH 3BT2L 1K2DB 1NMAH 2XY1A 3WFCH 1Z2KA 4M03A 4OI8A 1A1NA 5HHPB 1EIBA 1SJEB 2P5EE 5E8OB 5FV1L 3NCYP 3SE4C 4WI2A 1UM6H 2NNAB 4FQJH 4OLVH 5JIPA 5FHBL 1IEAA 4OD1H 4HGWB 3SDCB 1YYLH 3NIGF 1A4KB 4PJEA 1PQZA 1YEEL 2RFXB 1JZ4A 4XPHH 1KIRA 3GRWH 5DD6B 3FO9B 3IGAA 1RZJL 1YNKH 3MBEA 4JFPB 1W8NA 5C0AA 2NY0B 2D7TH 5D2NA 4HIHA 3HZKB 2CK0L 1F6FB 5I1GL 3BT2H 2EDJA 2EDEA 1X5HA 4HHAB 3CCHA 2OTUA 3BJ91 1QBML 3BGFC 3BH8B 4JRXD 1JPGB 4MNQA 3T4AB 3PABB 5MENA 1BD2A 3OTTA 2PW2B 1VEMA 3IJYB 4X7TB 5LG1A 1VFBB 1A6VL 2YA1A 1DN0B 2E6QA 1VCAA 5I0ZA 3BKML 5T1KA 5FHBH 5CKGA 3MCG1 5DJDB 4GQ9L 2YPKA 5DVMA 1YEEH 2W91A 2CRIA 5C9JA 1G0YR 3F7YA 3MLYH 3P73A 3U4EA 1RMFL 1RZJH 1FV1B 3I3DA 2H32H 2DIJA 5F3HA 1R3HB 2X40A 5C0FA 4DGIH 2W9EL 2CK0H 2APFA 1CFSA 2H9GB 1HXMB 3QRGL 1G6RH 5CEXB 4XAWL 3KJ6L 1QBMH 3QSKB 3OAUH 3QJHB 3EGSB 1ZA3A 3QUZA 4JRYD 1O7SA 4EUPH 1PDKA 3KWWA 1CGVA 4LLVB 1A6VH 5IB3A 3J7HA 4PJ8A 3U30C 1JGEB 2CXGA 4AIZA 2KZ1B 3OKOB 1Q94A 3BKMH 1A1NB 5I8EA 5JORB 3MYZA 1SBSL 4PRAB 3MLZL 3O2VL 1LILA 4GKNA 1GGCL 1MAJA 1CG9A 1RMFH 3E2HC 4YGAB 1JP5A 1QRNA 1IEAB 15C8H 4FFZL 1REIA 4KZEH 2J7LA 2W9EH 2ENSA 4PJEB 1RUQH 1QFHA 3KYMA 3DGGA 4BM7A 5CJXA 1Q9KA 3IGAB 3QRGH 1OAZL 1GHFL 4GAJL 4XAWH 3KJ6H 3MBEB 5C0AB 2OYPA 5FM5M 3T2QA 5D2NB 4HIHB 3SJVE 2BNQD 4B53A 3H9HA 1IL1A 5E9DD 4ZFFA 4LOUC 3CCHB 1KB9J 2OTUB 3U4AA 2HP4A 4H25A 1KJ3L 1QSZA 4HF5H 4MNQB 5MENB 1BD2B 1SBSH 2AK1L 4KK5C 3S4SA 3IU4L 3MLZH 4IM8A 3O2VH 4KMLB 3IDYC 5C8JA 1ZLUK 4N0RA 4Y1AA 1UZ6E 2Y6SC 5T1KB 3VXMA 2YPKB 1MJ7L 3DVGA 4FFZH 2FO1A 1JMXA 2A83A 3N1QC 4JDZA 5C9JB 5DZNA 3F7YB 4LU5L 1HE7A 2VQTA 3Q6FB 1OAZH 1GHFH 3P73B 2BERA 3H0TA 4GAJH 4LAQL 4FFWC 3U4EB 1ZKAA 2NLJA 4P4KC 4P2QA 5F3HB 5D7IE 5C0FB 1FL3A 3WBDA 5C3LD 1CFSB 3WDIA 1H3XA 1YDPB 3P4OA 1ZA3B 3QUZB 1OAUL 2V5TA 2AK1H 3HN3A 1QO3A 1FN4A 5HTSA 1IVLA 3KWWB 3IU4H 1DBML 5D2LA 4OZIE 1ZLUH 4ZS6D 5IB3B 4PJ8B 4LKXA 3ZDYF 4ERSL 4AIZB 2VDKH 5I8EB 1Q94B 4DKEL 3ZYZA 2K7PA 3TBWA 3RWDA 3OR6A 5FUCC 3BSZL 3VXRA 5TE6L 2JB6A 4BFEA 3HNTL 2EH8L 4GKNB 2F15A 4LU5H 1CG9B 4CBPA 5JW3L 2Q8AL 2CDEA 1QRNB 2AW2A 4ZUTA 1EO5A 3B83A 3NPSB 2Q76B 2V7HA 3OHXA 5FDWA 3TJHC 3KYMB 3DGGB 4FQQA 4EXPX 1F8TL 1YQVL 3U46A 1EFQA 1OAUH 1NFIB 3MLUL 3H9HB 3GI9L 3PL6D 1IL1B 4ZFFB 1DBMH 2DMCA 1FNGA 6FABH 1S5IL 4NN5C 4ERSH 1QSFA 3K46A 4H25B 3VD7A 3MV7D 3BSZH 2EDQA 1P6FA 3S4SB 3HNTH 2EH8H 5C2BH 5J3HD 5C8JB 1IBGL 4X4ZA 3MOBL 3O6FD 5HI3D 2Q8AH 5JW3H 2VWEC 3DVGB 1NCWL 5L2JB 2A83B 4S1SL 1X5JA 4JDZB 3TEUA 3ARUA 3E0GA 5CSGA 1I9EA 1G9NL 3H0TB 5GGSY 1F8TH 4PFEA 4H1LG 2XG5A 1FL3B 3V4VL 1CZ8H 3MLUH 3QEQA 3GI9H 4RA0C 3GM8A 4Q6IA 1F3DJ 5DVKA 5CSBA 5DWUL 3P4OB 3L3KA 3LKNA 4J4PC 3VD4A 5JO5B 3S97C 5D2LB 5D1ZD 1OP3K 4HK3N 1IBGH 4LKXB 3MOBH 4RMUA 3TBWB 3RWDB 1DR9A 1PG7L 3OR6B 4R2GD 3VXRB 1NCWH 3UTSD 3DOSA 2JB6B 4S1SH 2Z31D 5F8RC 4WHYH 3WNOA 4V1DB 4F37F 1D7FA 1G9NH 1T0NA 4PJEE 4V2CB 1P5UA 1G7QA 4Y16D 2CDEB 3KXFA 4ZUTB 1JNLL 3V4VH 3GO1H 2V7HB 4Y5VC 5C0AE 4IOFC 5FDWB 4MD5A 4FQQB 1XZ0A 1MFNA 1N26A 5E0QA 5F70A 3H7LA 4Q9BA 2W0LA 3TBSA 4WFGD 1CD9B 3U6RA 2MOVA 3QCVL 2HFEA 1BD2E 5JHDA 1FNGB 5MENE 1N2RA 1QSFB 2HTKC 1PG7H 4NDMA 3VWJB 2KPNA 4OLYH 5T3ZL 5JW4N 1JNLH 5D5MA 3TBTA 2EKJA 4J1UA 3W9EB 4D9LL 3WUWG 1IGCH 3EHBD 5KSUA 5DK0A 3R1GL 4RNRA 1FFRA 1P9MC 2F53A 8FABA 3QEQB 2ARJQ 3QCVH 5EG6C 5I75C 4H26A 4WTWA 3MRJA 5ACZA 3L3KB 1FJ1A 3VFTA 4R97B 2Y5EA 5T3ZH 2WNGA 3AAZA 3OGCA 4C54A 4M43L 1FG9C 3AB0C 5FGCB 5JOPD 3J8F7 5DLML 1N0XL 2DLGA 4HJJL 5EN2A 2ZWLT 5GRXG 3MSPA 4D9LH 3CFCL 4MDJA 3DX8A 4OFVA 1AIFA 3RPIB 1T0NB 2UZIL 3CZJA 1G7QB 1XR8A 3R1GH 3KPQA 5J11B 1LWRA 3KXFB 1X5ZA 4RGMC 2RB8A 3TC9A 2HVJA 4ZAKA 2V17L 2YK1L 4MD5B 3OZ9H 1XZ0B 3DV6A 5CD3A 1IKFL 3K4ZA 4GOSA 3TBSB 4TNVF 2IBBA 3U6RB 3ARBD 5JHDB 2VDPH 4LRIC 2WUBL 1N2RB 4WW2C 4EKXA 5DLMH 2CUIA 1G7MB 2F8VA 4L9LB 1N0XH 2ATKA 3ARDC 4NDMB 4XPGL 3CDFA 4Y1AE 4KRNA 3VXME 2YD5A 3CFCH 4P3CL 2UZIH 4EXKA 1LK2A 5HPOA 2X2YA 5D5MB 5ABDE 4Z7UF 5I71C 1KYOK 3GUTA 1II4E 2V17H 2YK1H 4J1UB 4P2QE 3TBTB 2ADFL 1I8LA 5KSUB 3QDMD 5DK0B 2VZSA 3EO0B 2FGWH 1IKFH 2R23A 4RNRB 3IS1X 2F53B 8FABB 3D0LA 4XC3L 3C5SA 5ISZD 5DMKA 2ICWI 4H8WL 2A6DA 2GT9A 4K3JL 3RNKA 2AEWA 3SE4A 3MRJB 5D2LE 5ACZB 3O3UN 1FJ1B 4XC1L 4XPGH 2MCG1 3VFTB 5I76A 1SJHA 2MQCA 3RIAF 3V7MA 5MP6L 3AAZB 3OGCB 4P3CH 1LEGA 1P7HL 3VXRE 2O61A 1UACH 2RBLA 3V5KA 4PGCA 4ZS6C 3KNBA 1OY3B 3HMXH 5EN2B 1J10A 4W6YB 5DF0A 3ALPA 5C0BD 2ADFH 4BZ1L 4MDJB 3DX8B 3QIWD 1JPTL 1AIFB 1D5MB 1Q1JH 3JTSA 1XR8B 3KPQB 4ETYA 3IKCA 1R3IL 4XC3H 4F57H 1S5HB 2W92A 1RZKC 4HWNA 4ZAKB 1A2YB 2VZOA 1EH9A 1JNNL 4H8WH 1F11B 2VDQL 2XOTA 3VXUD 1ZLWK 2ZG3A 3DV6B 4K3JH 2OJZL 5CD3B 3ULVF 1K5NA 5C71A 3NOIA 4G9FA 2XKUA 4XC1H 3O9WC 1BECA 2DB8A 3U0TA 1S3KL 3BO8A 2JELH 3VFPA 4JM2D 2XKSA 2ATKB 2B7DT 1T3FB 4X6EA 2VH5L 4BZ1H 3UJIL 4PJXE 4OZFG 1LK2B 5J3HC 1DQDL 1R3IH 1XMWA 2PXYD 4JO3L 1JNNH 2VDQH 4HS8L 1BFTA 3W2DL 1FNEA 2OJZH 1WLHA 5CGTA 2R23B 3I6LD 2R39A 3D0LB 3JWOL 3O6ML 3WN5C 5IHBA 1LDPH 3PIQA 5I15L 2NY4B 3RTQD 3ZMRA 5DMKB 4RBPK 1S3KH 2A6DB 2GT9B 2R1XA 3DXAD 3KJ4C 1VFMA 3JTTA 4DOHE 2I25N 3RNKB 2NY5C 1NUGA 5FGCE 1SJHB 1AC0A 4CU8A 5I76B 1EJ6A 2NY1C 2VH5H 4LNRA 1CDHA 3TNMA 1CYGA 1LEGB 1B0GB 2O61B 3UJIH 2C3VA 3RZWA 4ZUSA 4I0PC 1GCFA 4PGCB 4YHYC 1OSZA 5D7JC 1DQDH 5EBLA 5C0ND 4JO3H 3ARRA 3UZEA 4ODUA 4HS8H 4PRBA 3W2DH 5I0DA 3MRQA 4OKDA 3TVMC 3WHE1 4PLJC 2ATPB 4L8DA 3IKCB 5T33L 3WSQL 3O6MH 2EC9U 5I15H 1D9KD 2Z92A 3LZFH 4Y16C 3RWEA 5EU6B 3BGFB 1UG9A 2WP3O 3SDAD 2EDLA 1F02I 3NTCL 1K5NB 2FJHA 2VDML 5JHDE 4QXGL 4LSQH 1MFEL 3MROA 4YK4B 5ETUA 3G5ZA 3CZFA 3KPSD 5J6HA 3BO8B 1MFAL 2H2SD 2RIKA 2HJFA 3VFPB 3OKNB 1P84J 1IZJA 1JK8A 4ZO8A 2FYYA 4HH8A 3GSRB 4X6EB 2VXUL 2WWMD 1RURL 4P4KA 5D5ME 3X3FH 2IH3A 4XXCA 2OSLA 3FN9A 4NC1C 4C56A 1KJ2L 1VFUA 3CSGA 2M8XA 3WSQH 5I73C 4MA3A 2F53E 1ZHLA 1IGMH 1BQSA 1FNEB 2XI9A 4ONFL 3NTCH 2VDMH 1AR1D 1XAUA 4QXGH 3VFWA 3U30B 3QXUA 4F7MA 1T66D 1L7TL 3PIQB 3PWPA 1OP9A 2QADD 4MMZC 3BRDA 1TVBB 2R1XB 2HRPL 1MFAH 4HKBB 3JTTB 5EU7E 1G7IA 3I75A 2PF6A 5D8JL 4MJ5A 1RIUL 2VXUH 4LNRB 4HAGA 1RURH 3TNMB 2R15A 1U95A 2C3VB 4ZUSB 4L9DA 1KJ2H 1ZXQA 1OSZB 4ZODA 5EBLB 2VLLA 3O81A 1KCSL 4ODUB 4PRBB 3MRQB 4ONFH 4NO0A 4L8DB 3MZTA 4LMQE 1RK1A 4RFEA 1L7TH 2E27L 3KLAA 2Z92B 4F7PA 3RWEB 3RI5F 1JZ3A 4X4YB 3QXDA 2HRPH 3H9SD 2FJHB 1Q9WA 1I1YA 1BZ7A 3IKKA 1RIUH 4DUWA 3IDYB 3MROB 5I1CL 5ETUB 3G5ZB 3CZFB 4O4YL 4KJQC 2AQ2A 4JFOA 4GUPA 2HJFB 4Z7UA 1FVCA 5C2UB 2NX5A 1DN2A 2FYYB 1I75A 3RVVD 1KCSH 3QHTC 2EXYD 4HIXL 1CFBA 1TFHA 4P4KB 2IH3B 5IBUG 2OSLB 4C56B 3NFPA 5CILL 5DUPL 1B6UA 3C8DA 3SPVA 2E27H 3LPFA 5FKPA 2BSSA 4UINL 1ZHLB 4J4PA 2D4FA 1BQUA 2NXYD 2DOCA 3VFWB 3DETC 5I1CH 4F7MB 4Y19A 4Z7NE 5LAXA 4F9LC 4O4YH 4M02A 1BBJA 3H42L 4JGMA 5DRNA 5FHAL 1G7IB 1JYWA 2IEPA 4MJ5B 5EBMB 3SKOA 2N1KA 3VI3F 2F58L 4HIXH 4DKFL 5BVPL 1U95B 4WU7A 4Y5VA 5IK3B 2E6PA 3BGAA 2QR0B 5CILH 2VSCA 4EIGB 4L3EE 4OI7A 1Z5LB 4HG4J 1WIUA 4UINH 2MSPA 2DMKA 3L3HA 3W5MA 1ZA6A 1QLFA 3RU8L 3GKZA 1LDSA 3OJDA 3QUXD 1RK1B 4RFEB 4NN5B 3O3EB 1U0QA 3KLAB 4F7PB 5IUSA 3QISA 4G9FE 2X1PA 3G9AB 4RMWA 3QXDB 3MODL 4KI5E 5FHAH 3QCUL 3HAEG 2AI0L 3LPWA 4KUCF 1BZ7B 4UQ3A 5IFJA 4W81A 1GZPA 2C3XA 2F58H 2R4SL 2ZOLA 5BVPH 4JFOB 4GUPB 4NKOA 4Z7UB 1FVCB 5F72S 3L6FB 3DWTA 4YZFE 4KPHH 2ZOKA 5AZEL 2YA2A 5L9DL 1KCVH 4EBQH 4DCQA 4O9HH 3G5VA 1T80A 3D5OF 1EGJH 3MNVA 1P9MA 2BOCA 4YBLC 4GXUM 3DV4A 4MLSA 3NFPB 1P69B 4BZ2H 3RU8H 4POZC 3SPVB 5FKPB 2BSSB 5I30L 4PJ5B 4YXHH 2PXYC 1WAAE 3MODH 2DLEA 4X80L 3QCUH 4CADA 1NGYA 2AI0H 4PREB 4U1KA 3PV6A 3ZKNC 4OCMC 1S7XA 2A1WL 4NKIL 2H6PA 4U1GC 5CP7A 2DWEA 2R4SH 4GKZA 1BBJB 5DRNB 3RTQC 2YMXL 3SKOB 5AZEH 1WF5A 5L9DH 5JIKA 4Z6AT 4JRWA 2AEIT 2CJUL 1RJYB 1OQXA 4MCZA 1BJ1J 3RGHA 4JQIL 4WU7B 2YOCA 4Y5VB 1OGAA 4YHZH 4G8IA 3VRLF 3T04D 1S9YA 2ICWA 5EA0L 2Q20A 3O11A 3ZSSA 3O2DL 5I30H 3UROR 2DYPA 5HGDA 5CLWA 3L3HB 1SY6L 1ZA6B 1I9RL 4LLAA 1QLFB 4NKIH 4LRIA 2VLKD 2J6EA 4WW2A 4WTXA 3OX8A 1R5IB 5HDLA 3LN4A 4RGOL 1N5AA 2J12B 3ARDA 4QHNA 5TPWL 3GIZL 1H9VA 2YMXH 4UQ3B 5IFJB 3SDAC 1GZPB 2CJUH 1D3CA 4G6AC 5IMLA 3O45A 2ZOLB 4JQIH 5FYJD 1BZQK 4NKOB 3T8XA 3C9NA 4GRLC 1CTOA 2YD1A 3TCXA 4KDWA 5EA0H 3RVWC 4Z95L 4DCQB 3O2DH 3G5VB 3MNVB 2BOCB 4M3JA 4S11A 4AEHL 3DV4B 1SY6H 1I9RH 5I75B 4GRWH 4OSUL 3IF1A 4RGOH 4JZNA 3PHSA 1P7QD 3PWPE 4QHMA 4CADB 2X1WL 4RX4D 5TPWH 3PV6B 5IHUL 5FIEA 5FUCE 1S7XB 2FJFA 2H6PB 1MFCL 3AB0B 3VFMA 2AJYH 2DWEB 4GKZB 1B4RA 2AK4A 3IFOA 5C0RL 2AJUH 2GI7A 3S3SA 1PLGL 1OD7A 3MRPA 5F9AC 4OB5H 4IEFB 4HUWA 2BRRL 4MCZB 1LP9F 1HCFX 3G08A 2D03L 3FOMA 1MOEA 4KVNL 4RGMB 4AEHH 1A9EA 4HWBA 3ZKQD 1OGAB 4G8IB 3RVXC 5HYJD 5DHYA 1S9YB 1N8ZA 2ICWB 1ODAA 5TE4H 3B43A 4C57C 4LLUA 4EDWL 1A47A 3O11B 4OSUH 4CJ1A 4JFXA 3SGJC 2BZDA 3O9WA 3V2AR 2DYPB 5HGDB 1FDLL 3VGAC 3OGOE 4KQ4L 1U8IA 2FECL 4AENA 1S9XA 2X70A 1ZHKA 3IFLH 4LCWB 1MI5D 3LN4B 3CX5K 1C12A 2I9TB 1N5AB 1JZ5A 3ARDB 4XP4H 2DL2A 4QHNB 3MV7A 4KC3B 2PCPA 5C0RH 2VWEE 4HC1L 4K8RD 3HLAB 1PLGH 1PKQA 4Y4FC 5CJQL 3PWVA 5D7LD 2NX5E 5IMLB 2BRRH 3OPZH 2D03H 4KVNH 5I71B 2ZCLL 4ZFZA 3T8XB 1SM3H 4Y2DD 2FEEL 3C9NB 3HAEA 1J0ZA 5DZLA 4AEIL 1DDHA 4NQVA 4Y5YC 3TO4D 1UWEL 3RVVC 1FDLH 3WN5A 3DJ9A 4HJGA 4F3FA 4BELD 4KQ4H 2Z8WC 5IVXA 1JGVH 5K9JL 3PF2A 1XGPA 4WGVB 4JZNB 4Y19E 4QHMB 2WWKO 1CDIA 4NQTA 4HC1H 4RGND 2RJMA 1GGTA 4GLRH 1MCDA 1JGDA 2NTFA 1UVQA 2VO5A 4I0PA 5CJQH 3ARSA 2IAND 5D7JA 3WFBL 3FT2A 2ZCLH 4AZ8A 2AK4B 3BE1L 5EZIH 4CAGA 2QBWA 4AEIH 3MRPB 1UWEH 4ZO6A 3TVMA 5EULV 3IJHA 4HUWB 4X9IA 3FOMB 2JCCF 1A9EB 3VW3L 5DHYB 1N8ZB 1CDJA 2EDYA 4LLUB 4D9RE 1VEPA 5HHQA 1BFVL 4JFXB 1I1AD 3O9WB 3M8OL 1N64L 4LDEB 3NCJL 1C1EL 4QXWA 1U8IB 1XFPA 1LO3L 4AENB 2CLVA 2X70B 1ZHKB 3RIFF 4JRXE 1ZE3C 4J3SA 1B0WA 3TFKC 3TESA 3QUXC 1ZGLP 4RMTA 4AG4L 5SWSD 3B2VL 2PCPB 2HJLA 1UXWA 2NY6D 5L88H 2HTLD 2A74A 4ZO7A 1PKQB 4LHUA 1U8HA 3PWVB 4HQQL 3FMGL 3CIQA 4PJFE 4RSVA 4JKMA 3G6JE 3VW3H 2FL5A 2PN5A 3HAEB 4XZUB 1DDHB 1BFVH 4NQVB 4U6TA 2HMID 4FG6D 3OB0K 3CFKA 3G6DL 3M45A 4LCCC 5BJTA 3M8OH 1N64H 5FYJU 3NCJH 3WN5B 1C1EH 1N6QL 4HJGB 2OI9C 4F3FB 4ZFOA 1LO3H 3VA6A 3D2UD 1E4XL 1GXEA 4NOFA 4LLYA 5IVXB 2AQ3A 4JHZA 5E00A 3KG5A 2D7OA 1IZKA 3B2VH 2NY1B 1W72L 1XGUA 1S7WB 2LU3A 5DJZA 2V7NA 3V6BR 5IHZA 3QUMA 1KJMA 1JGDB 2NTFB 1UVQB 3HUJA 4I0PB 4IRJA 1MLCA 5F7NC 3FMGH 1WGOA 2P42B 5D7JB 1BJ1H 2WBWB 3VI4F 5B4MD 3FT2B 5D6CA 4Q9CA 1NH6A 3QG7L 4M6AA 1CU4L 3GHEL 1BQLH 1GRWA 5KAQF 1OL0A 2BC4A 3OB0H 2DQIL 1OGAE 2HN7A 4KK6D 4M5YL 3TVMB 3IJHB 3G6DH 2EDRA 5C0EA 2C1OA 3MQIA 1KTLA 5IF0A 1E4XH 3SGDI 3VE0A 5HHQB 5DMGD 1EEUA 5H2BA 4KJWD 4PRPB 2XTJD 5HYEA 3IETA 4MSWA 1W72H 4UILL 3QI9B 2X5PA 2CLVB 4KHTL 5I74C 3HMWL 2COQA 3GJFK 5C1MB 4HIJA 1UKQA 3BP6A 2HJLB 3QG7H 2F54A 1CU4H 1UXWB 3GHEH 4FNLH 4XT1C 3T0ED 1EHXA 1TQBC 2A74B 2DQIH 1U8HB 2IGFL 2QTEA 4LHUB 4M5YH 3RKDD 3I6KA 1TPXB 2FL5B 3ABZA 1IC4L 4GXVL 4JY4A 3H9ZA 3LVEA 3I6GB 4ODXA 4HMCA 1EVTC 3ROLA 3CFKB 3GMPB 5BJTB 4NQCD 5KAQG 4Y5XC 5JXED 1U3HD 4UILH 5F71A 4F9LA 3ZE0F 4MD4A 4LLYB 2VDRL 1MAKA 5ISZA 5IFHL 5F7EL 4KAQL 3GJFH 5DYOB 5E00B 5GSRA 3HMWH 4IRSA 5HYIA 1B2WL 1XGUB 4B7IA 5MI0C 2V7NB 5IHZB 2A0LC 3QUMB 3CXHK 1KJMB 1LP9A 2IGFH 2WBJD 3W11C 4IRJB 3ZE1F 4F7EA 1MLCB 1DANU 1VEOA 2C5DC 1YC8A 4N1EA 4YPGA 5D6CB 1NBQA 3GZKA 1NANI 4GXVH 2R1YB 4RISL 1HNGA 4XTRD 2CLRA 2BC4B 1J18A 2HN7B 3BH9B 1MWAA 1MCWW 1MELA 5ITFB 1OAQH 2C1OB 3SE9L 4MNGA 1KTLB 5ILTH 5IF0B 1CL7H 4WFFD 3L5IA 2VDRH 3VE0B 4KDVA 5F7EH 4DK6A 4KAQH 5GRYA 5H2BB 3W39A 3UCRA 4ONGL 3IETB 2VDNL 4MSWB 1MHPL 2R0ZL 1XR9A 3MV7E 4M48L 4I2XA 1A64A 4Y4HC 4XP9L 4LSVL 3NA4A 1ZLSL 2EDKA 3IDJA 4PBVC 5J1SC 2ERJB 2HKFL 3BP6B 4DJMA 2F54B 4RISH 3CLEL 1VACA 1DLHB 1VENA 3I6KB 4XCNA 4GBXC 4H1LH 1NMBL 1QG3A 4OM0L 3SE9H 1I1CA 4JY4B 1QR1A 5AUMA 1NAMB 2PXYA 4ODXB 2PW1A 3KPMA 3TN0C 3T65A 1NDMA 1NPUA 3ROLB 1RJCA 5IVXE 4UU9A 2VDNH 2Y4SA 1MHPH 4PPTA 5CGMA 2R0ZH 2WBKA 4MAYD 2E9BA 4FQHA 1CFVH 4MD4B 3EBAA 1DTUA 4XP9H 2XG4A 1WTGT 2B39A 3F58L 4XVUD 1SYVA 1IAMA 4IRSB 2P24A 1H8OA 4U7KA 1VPOL 3O8XD 4KK8C 1LP9B 3CLEH 4F7EB 2BVUA 4M7LL 3ARWA 1AQKH 1ETZA 2HLAA 3UTSE 3TF7C 4YPGB 4OM0H 4YXKL 2WV3A 1J8HA 2XQYK 3UJJH 4LPVA 1F42A 2V6HA 1JUFA 4AEFA 3SE3C 1MWAB 3WXWL 1QOKA 4MNGB 3ZHKA