1CFSB

Anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
213
structure length
213
Chain Sequence
b'QDQLQQSGAELVRPGASVKLSCKALGYIFTDYEIHWVKQTPVHGLEWIGGIHPGSSGTAYNQKFKGKATLTADKSSTTAFMELSSLTSEDSAVYYCTRKDYWGQGTLVTVSAAKTTAPSVYPLVPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN))
molecule tags Polyspecificity
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
total genus 37
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 1999-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfsB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfsB02
3HE7C 3ZHKA 4HS6A 1M7XA 1T66C 1ZA3B 2NXZD 1DSFL 5HGHB 4KUZH 4I18A 4LVHC 5TDPA 4OZIF 4L4TA 2VLJA 1QRND 3WXWH 3Q48A 4UQ2B 2ZNWA 3RNKB 4UQ3B 2M2DA 3UTTA 4WTZA 3CIQA 4RAUA 2CLZA 1PG7W 3VDCA 5DR5H 3IVKA 4KRPC 3F7VB 3FB5B 1F4XH 5E2VH 4ETYA 4XXDA 1GC1L 5F9AC 4PJ9C 4XPGH 3GJEA 3RKDC 3RDTD 2X4UA 2AK4A 5DT1L 3IDIB 2FO4B 3DXAA 2VDQH 4HPYH 2VLRE 25C8H 5D70H 1O7VA 1AGBA 4LPTA 1KTKE 2W38A 3EO9H 3FFCA 2GFBB 4X4ZA 4FQXC 5DD6B 2J1KA 4BUGA 4G42B 3MACH 1S78D 2DKSA 3QPXL 2I27N 3QA3A 1AP2B 4KY1L 5KG9B 4WHCA 2EKSB 1SVZA 3P4OB 5E99L 3IKCA 1RQ5A 1B3JA 4UUJB 1BHGA 2WWMC 2J6EH 1D5MA 1ZT4B 4U7MA 5ETUA 5FGBC 3ZKSD 5IMMA 1YUHA 5D7IB 4HFWA 2OR8A 3S5LG 1E6OH 4KK8C 2WUCL 4AEIH 4OFYA 1NGWA 4R0LB 4K9EC 4E41B 3NBNA 1PY4A 2E6QA 3FFCB 2HH0H 5JQ6H 4PJ5A 3VH8G 4UU9A 5GGQL 3RBSA 5DMIL 5ANME 1OTUC 5ENWA 2EO1A 1K6QL 5JUEL 5JOFB 4NM4H 1RZKC 5D7JB 1P7QA 4DAGL 4KQ3L 1CLZH 1NUDA 5F9WB 5J13B 5IVZB 4HMDA 3TO4A 4M5ZH 3SDYH 4S1DC 4X7TA 4Z7VE 4QEGA 5ICYA 3WIHH 1RPQA 2AEIT 4DZ8A 3WLBB 1OAQL 5D7JD 3KPTA 2VKWA 2BRRH 4R8WH 4UV7H 4AEHL 3RA7H 1U0QA 2FSEB 3MODL 1KNOB 4P5MA 4QLRA 4HIXH 3H9SA 4KDTC 4W4OA 5CIPB 3GMNB 4JFDD 6FABH 4WI5A 2YBRB 1CTOA 4AG4L 2ZSWB 4TUJA 3QRGL 4OAWB 3SDDC 4Z7VB 4L4TE 3DX8A 2A83A 2HT2C 1FHGA 1TJIH 5F7MC 1UVQA 3KLSA 4JY5L 3EAKA 4YHIB 1G7LB 2UZXB 4Y5VA 5J9PB 4P4KC 1HHIB 3CGTA 3T0AA 3DMMC 5E8OA 4BFIB 4PGBB 1CQKA 4OFKA 4Y16B 1YQVL 4YH6A 1ROWA 4KKAC 3V0AC 3ZYOA 3BQUB 1EO5A 3UAJD 1XH3A 4MA7H 3DGCR 2NY3D 2JB5H 4O58L 1EVTC 3MMEA 2B4CC 3V6OC 5JW3H 3VH8B 2EEDA 5IESL 5E2TL 3B5TA 3GSUA 3ZTNH 4I2XB 4X8JB 3KDMB 2GYSA 5JZ7C 1U8PA 1BVKB 3SCMB 4XP5H 3MRJB 2X4SA 4R96B 3V5HA 2UUDK 3NCEB 4OD1L 5B38G 3BIBX 2NY3B 4HXAL 3L3JB 4RAHA 5E4EB 3TO4B 4YAQA 3U4AA 3TP4A 1P7KB 3AU1A 4WHYH 1U6AH 2RHEA 1U92B 4FMKA 1N5AB 4NN6B 1H8OA 1ONQA 5EO9B 3GIZL 2IPKB 4CN1A 1FAIL 4LAJH 1WGOA 4XZUA 3TO4D 1F6FB 4PRBB 4D94A 5I73B 1I8LA 1XEDA 1CD1A 5F21B 5FB8A 4MJ6A 1T20B 3T3PE 4QCIB 4J23A 1HHJA 3BO8B 3TJHD 3GMPB 1S7TA 2EKSA 4E41E 1FIGL 4YO0B 4JQIH 4LCCB 3V6FA 4XTRC 4RQQA 5F1NB 3AFLA 1TJGL 5TE7L 3TC9A 4OF0A 1RURL 1D6VL 4FG6C 2QQNL 1U8KB 1K8DB 3EGSB 3MRCA 3MV9A 3QQ3A 4K8RD 3RVVD 2VLME 4LVOC 1OWWA 4G9FD 1ETZA 1YEIH 1I7RB 3RZCC 5T3XH 35C8L 4RMQA 4PGEB 3QXUA 2XPGA 4JZOB 1N7ML 4ZTPL 1MHHB 2GSIB 3BRFA 3O2WL 3MV9D 1FG9C 2APWA 2UWEE 4O2EA 2D7PA 4YR6A 3E8UH 3GMOB 3QZWG 1RJZA 4M48H 4O02L 4PJXF 3WIIH 3BO8A 4PD4K 4Y19A 1K5NB 1QFWL 4PJDB 4PRDB 3VFMB 1QTYT 4DEPC 1NFKA 1DBMH 3RGVD 3IJYA 1NFIB 1S7VB 3MQIA 2X09A 5I9QB 1MPAL 1R3KA 4NC1C 3F58H 5EULV 5AYQA 2Q86A 2YEZA 1CFSA 2YA1A 4KJWC 5AUMA 3BKCH 2APFA 3B5HA 3QBTB 3TA3D 4X6DA 4OFVA 3OPZL 3PF2A 5T33H 1T5WA 4CW1A 2VSCA 4LPYA 4RMRA 5D1ZD 1P9MA 3T3MF 2Q7YA 5E8EB 4NQCB 1CU4H 4RIRA 5HGDA 4CMMB 5D1ZC 5DYOA 2IG2L 3K4AA 1FNGB 2YUZA 5HPOA 4YUEL 3RTQC 2R0ZH 1XGRA 1MRDH 4MAYB 4LDLB 5HHXH 1RUAH 1LO3H 2JELL 1RULL 4XGZA 4NQCD 3MGOB 4BSVB 3D69B 1J18A 1I7UB 1KN4H 4G3YH 1E28B 1ZLWK 5GIRA 3BPCA 4X6CA 4KVCH 5FA3A 4NO2A 4OZGA 1ONQB 1BAFL 2KH2B 3OR6A 1C5DB 3PWPE 1GJIA 3G04A 4NNYB 4XVSH 5FA4A 4P3CL 4MQXD 5C0AB 1OPGH 3WSQL 2HKFL 2FZ3B 3L5HA 2XN9D 2VC2L 5DS8B 1C08A 1G7HB 1I1AC 1NL0L 4LBEA 5GGVL 1P2CB 4LL9A 4MMXC 1JWMB 5JNYA 3Q6GH 4O2EB 4LLYB 5B3JF 4U31A 1IEAB 3WLWD 4AH2B 3ZT6A 1G7MB 1I8KB 1J1OH 2WBJD 3MLSH 1YEFH 1EIBA 2XN9B 5HHOD 2Y5TA 4KKCC 4J3TA 3WFCL 2G5BB 3CXHJ 2I9TB 4TSAL 4HS8H 4PJEA 5IGXH 3H9HB 2J8OA 4ZXBD 2BNQA 4CRPA 3DROA 1FSKB 4PLKD 4JFHE 2XA3A 1X6NA 3VFNB 3FT4A 3IJSB 2R1XB 1EZVX 2PO6C 2WBJB 4J3VA 5HJ3B 3KYKH 4QOKE 3U0TA 1CGYA 3TZVC 2LABA 3MBEB 3L5IA 1JPTL 5DDHA 4R2GB 4LCIH 1G6VK 1UZ8B 2ADIB 2GSGB 2PO6A 5DC9B 3X14A 3NABL 4KHTL 4TPRL 5A3IC 3VRIB 3H3PL 3RY6C 5HHPA 3PV6B 3CFEB 3FQTA 3RWCB 5L88H 4HH9B 3V0VB 1YEKL 4GG6F 1HYSD 2IWGA 1S7RB 4RNRB 2B39A 4H20L 1I7UA 1CE1L 3OR7B 4M4RA 5FV2A 1I3RA 4KRPB 4G7YL 4J4PA 1MFCL 2F54B 3O9WA 4RRPA 4HWBH 4ZODA 5KSAC 1UGNA 2ESVD 3T08A 4U1LB 5SWSD 1N2RB 3WJLC 4FXLA 3D2UA 3EDFA 2IFFH 5IM7B 2IANE 5BZWB 2PKDA 2MQCA 3VFTA 1KIRA 4WGWB 5JPMA 2P7TA 1TCRB 1ZT7A 3ZYJA 4KV5E 4MQXC 3PV6A 1MVUB 3I02A 3IDYC 2QSCL 4ZNEA 2C4FU 3RFZC 1BF8A 1OTSC 5JIPA 2X4RB 3ALPA 1KIUA 3QIUB 5CZXC 1CIUA 1MRCL 5H35B 1HDMA 1R3HB 1W72L 3FKUS 1KB5L 1SYVA 1MREL 2NTFA 3QR2A 2IMNA 5EA0L 2NZ9C 2ICWB 2LVEA 3ZE2E 2H45A 4MDJA 1B6DA 2Z8VC 3SY0B 4WW2C 5IBUG 5JXED 1S7QA 4OCRH 1JI2A 1KLGB 1QSEB 1EHLH 1CZ8L 2COQA 4GRLC 5EFIA 5CZVH 2HT2D 3ARDD 3FN9A 5HHOA 2BOBA 4WU5A 4Y4FD 2GT9B 5H8DA 5T1KA 4YDLB 5A2JH 2JJSA 4Y5XC 2A74A 1WBYB 2GTZB 2RFXB 1D5BB 1RK1A 5FECA 4XMPH 3VMOA 3C08H 4IRZH 3D3VA 1JZ6A 1N0LA 2D2OA 4Y4FB 5GS1B 2WUBH 3ILPA 5J12B 15C8L 4JAMB 4U6VL 3U1SH 1CXKA 2WK2A 3BD4A 1FE8L 3LS4L 3ARPA 4ELMA 3WS3A 4M7KL 4JPWL 2F8XC 4ZXBA 3S34L 4L8SC 4ZDHB 43CAA 5K9JH 2EZ0D 5CILH 2DJ4A 1I1CA 4K94C 3ZHDA 3OXSA 1I1FB 4ZQKA 4W6YB 4TTGA 1QO3A 4MD4A 1CICD 3CFCH 3HNTH 2HN7A 1U92A 5C0FA 2QR0A 4JJ5A 2AV1A 4ODXA 3GUTA 4OJFH 2BSSA 2OI9C 1FJ1B 3WO3B 1NCTA 1GGYA 4YHML 2XA8L 3QNYB 3S6CA 4FXKA 1DN0A 3EJZD 1FCCA 4ZD3L 1AXTH 3V5KB 1PDKA 5E94B 3D18B 2DM4A 3DI2B 4MJ6B 5CUSH 1I1FA 3TCXA 4FFVC 1A6VH 4FABH 3SKNA 3DURA 4U3CA 3RKDD 3G6JA 2E7LC 2VDPH 4X6DF 4Y4KC 4XNYH 2Z4QB 3TN0C 2ENSA 5IIEA 1JRHL 2GHWB 3MRHB 2EECA 1ZT1A 3VXSE 1AR2A 1R5VA 2OMNA 3MFFB 3V4VH 3IDIA 4GSDH 2J8HA 1N3NA 1RZKL 3ARRA 3VXMA 4X99A 3NPSB 1JVKA 4N0FB 3DHJA 2R4SH 1T3FA 5CD5D 4JZOA 3C5JA 2O5XH 4K2UL 4S1RH 3ZE0F 1UKTA 3LHPH 1S3KL 3U0PB 3GBLA 4XCYB 4F2MB 1JZ5A 3TYFB 2P5WD 1J0IA 2JJWA 3HMXH 5I18H 5DGQA 1P9MC 1BBDH 4UQ3A 3TNNB 5GRUL 4LLYA 3HS0B 3FRPG 2NX5E 3QDGB 1NANI 4MB4A 1QSZA 5E5MB 5EIIB 1T20A 3QNXB 2YMXL 4ONFH 4XPHH 4FQCL 1OP5H 2ZUTA 2W0LA 2ARJQ 4C54A 3CSPA 1B90A 2A77L 4IIQB 1PG7X 4S11A 2KL6A 4EVNB 2I5YL 5LXGL 3TZVB 4G6AD 3BP5A 4ACPA 2QR0B 1T2QH 2WMPA 4LCWB 4OQTH 3RU8H 5L9DL 2C3VA 1KB5B 3VXRE 3VA2C 4N0YL 3KPRB 3UJTH 1U3JA 5F1IB 5ID1B 5KVDH 1I9IH 3OAZH 1JNLL 2A6IB 4JPKH 1QFWM 4MJ4A 5MEPB 4LF3A 8FABB 1QBAA 5IHLB 4ZFGL 1LE9A 1MFAL 3LEVL 5DJZA 1X4YA 3S36L 4YC2B 3EUUA 4KMTL 2I24N 3QI9B 2Y25A 3MLUL 1T03L 2NLJB 2D7TH 1JNHA 2K9UA 3RVUC 1BFOB 3I3EA 5HHME 2UY6A 3S7GA 5JORA 1MJ7H 2CRZA 3LN5A 2DQDL 3JV5A 5TF1L 1MF2H 2X6MA 2CR6A 5DRNB 3O45B 4PJHF 1BD2E 3MO1A 5J1TC 1TZGL 4HV8B 4PJEB 4WO4B 3TEUA 5SX4H 5MENB 3MRPB 4Z76B 3A6CL 1CFBA 3CVIL 4NKIH 4NPYB 1KTDA 4MD5B 1VESA 4OB5L 3ULVL 2AK4D 1NBVL 2GITB 3HPJA 1X5HA 1QKZH 3VXUD 3LRSB 1EX0A 1PLGL 3JXAA 4WO4D 3FOMA 3WHXB 1ZEAL 3WD5L 1G9MC 1FV1B 1K9TA 2W9LA 4B41A 2XWBB 4PJXE 1WUNT 5IBTL 5EC2A 5FO8A 2AK4B 4OZHB 1A2YA 3FN0H 5BW7C 4X4MA 2VH5H 3BN9D 1UWXH 4KJPD 4Z5RB 4IS6A 4NO2B 4OZGB 3CSYB 4UB0H 5EU6B 4HZAA 4I0PA 3HC0B 1J5OH 4POZC 3P2TA 4XC1H 2IFGA 3RUGB 4BFGA 3OAUH 4JPIB 1FLRH 5DJXB 4LPCA 2E6JA 4UNUA 3T2QA 2Y4SA 3C5SA 4WUKH 1GVIA 4J4PC 2ZPKH 3S37X 2F19L 4RWHA 4OBRA 3ZKMC 4I13B 5GJTL 1A7OL 3KPMA 3W9DA 2RFXA 3WNNA 1EHXA 5I17B 3E6HB 5B38B 3VFTB 4PR5B 4PJIB 1YC8A 1DQMH 3KPNA 3O41A 2E7MA 2EDDA 1I1AB 5IB1B 3VE0B 3IDMB 3TT3L 5F3HA 4ZAKC 3PABA 4QRPA 2DQUL 3BZFA 1JTPA 3EZ8A 1D9KB 3U79A 5B39A 3WXVL 4TVPH 1IQDB 1GIGL 1P53A 3QJHA 4PGBA 2NTFB 1L7IL 2XZCH 5IMKB 3NMEA 1I1AD 4K71B 2YKLL 3B4NA 4M1CD 1SY6A 3GMRB 4GBXC 5D8JL 4BQCA 3VFWB 2FL5A 2NY2B 4X98A 3BDYH 1P4IL 43CAB 4WCYL 4KC3B 1V05A 1DQJB 5DDHB 4GBXA 1RZGB 3GKWH 3FO2B 1IJ9A 4JDTH 2NXYB 5K59F 1O0VA 1QFUL 2VE6A 3MJ9A 3LKNA 1JZ2A 1JFQL 1T1WB 2AV1B 3BKMH 3VI4E 5HGAB 3UYRL 3RWDA 4LCUA 3BEVB 2VAJA 1FGVH 2F74B 5GRXG 2VZSA 3RVXD 4WFFD 3IU3B 4N0UA 5AUMB 4XAKE 5J6HB 3ZSSA 1AR1C 1T22B 3N50A 1CDGA 1AP2A 2AK1L 4W68A 3HC0A 1S7WB 1JPFA 3HAEG 3GB7A 1NAMA 1OGTA 1H3XA 3CUPB 4B53A 4KHXL 5HGBA 3KLDA 5SV4A 1MAJA 1X5GA 5HVFB 3IDNA 1BEYH 5AWNH 4POUB 3NPSC 3RVUD 2WP3T 4UT6L 1MQKH 1FGNL 4ZFOB 2W9EL 2VQUA 2YD2A 3SJVB 4L3EB 2NNAB 4TYUA 2PF6A 2EDBA 4LDEB 3CXDH 2G60H 3VFVA 1MY5A 5FM4A 4JM4L 4ERSL 5DQDL 5I0DA 3VFSB 4X4ME 3OBAA 1IKNC 4L3ED 3OXRB 5I1JL 3HC4L 4HG4K 3EYSL 5BQ7A 2O5YL 1TDQA 2HVJB 2PXYB 4AIZA 4YHLH 4XNZC 3TA3A 2R9HD 3X3FL 2Y1VA 2UZYB 5C0FB 5EDXA 2H8PA 3BVNA 3I85A 3FAXA 5IBLC 4F7MB 4GS7C 4Q9RH 5ALCL 4LAQH 4IBLT 3LH2L 1QR1B 3BKYL 3FFCE 3AC0A 4HKZA 4R9HA 2NX5D 3S3SA 4JM2C 1QR4A 3HI1A 3ZE2F 4FZEL 5IEKA 4S1SH 5INDB 4NRXA 5MHSD 1E0OB 1BZ9B 1MAML 1Q9KB 2RJMA 4KZEL 3RY5A 1DEEA 1NCAL 2EYRA 2Y36L 2NX5B 1OQXA 1RZ7H 2ZOKA 4NUGL 1T04B 3GSNH 3V7MA 2J4WL 3BH9A 3BSZL 4X8XA 4GRWB 1UWGH 4WFED 4F15C 3UDWA 5ID0B 1I7ZB 2ORBH 3MRMA 1WWAX 1ETZB 3BP7A 2P45B 2HWZH 3FO9A 4RGMB 4UDTA 5D96C 2XTJB 4E0RB 5C6TH 3FB8A 2RCSH 1MCEA 1N64L 4TUKH 4RWYH 5I2IB 4Z78A 2NY0D 1PYWA 2AJVL 1NAKH 1DN2A 3HB3C 4YX2L 5KVFH 5D2LB 1K8IB 5FHAH 5LVEA 1JUFA 5IFHH 2VDOH 4ODVL 5JW4M 5JIIA 2XTJD 1NAML 1YEGH 3P11H 1U8IA 5DHVB 3R1GL 5E8DL 1R24B 4PRBA 4KZDH 1LK3L 3O3AB 3SKJL 1G9EA 4QHMB 4EN3D 4BH7A 2NY0B 1UCTA 2V2TA 3PWPB 1VB9A 5E6ZA 3NZHL 5B8CA 1QLRA 1MNUH 3PHOA 4ZUWB 3BP7B 2YPVL 1XIWB 5FKAA 3ROLA 1MCPH 4CVXB 3UPAA 2HT4C 2Z31C 4CN4A 1I9JL 3RWDB 4O51A 3TH3T 3JSSA 4HAFA 4LKXB 4RCAA 3MXWL 3D25A 1ZLSL 2OJZH 5IK3A 4OLWH 1HN1A 2GQHA 4UNVA 1BZQK 1FZOB 5D1QA 5FUCC 2OK0H 4JN1H 4HWBA 3FQNA 2AEPL 2E7CA 4I2XE 5C0BD 4AQ1B 5EFIB 3P77A 3JWNC 1RUPL 1UZ6F 3WO4B 5IVZA 1DL7H 2H32B 3B5GA 5ISZB 5L8KB 3AMLA 4OUUB 2ERJC 3LN5B 5EBMA 4YHOH 1MH5B 1A5FH 3WL9A 1CFVH 2NY7H 1AFVL 4P59H 3VWJB 5HDBF 3WKMH 5C0BA 2YPLE 3BPCB 4TUOB 1SM3L 2K3TA 1WBZA 2IADB 5D6DC 2AJUL 3RL2A 4GAJH 2PTTB 1F4XL 5E2VL 3AU1B 4HKJA 1SHMA 3OGCB 4MX7A 5LBSL 4YHYB 5J1AB 3OAYK 4OM0L 1MJUL 4HZLA 5F1IA 1UENA 3CX2A 5I1DB 1LO5B 2I07B 4ELMB 4I48A 1JGLL 1VGKA 4Z7WE 3AY4A 3T0EA 4AENB 1BFSA 4WHDA 1E4WH 4EXKA 5FEBA 4D9QE 5EWIL 1IGFL 5FGBA 5D7LE 1EEQA 1WWBX 2IBZX 5J57B 4HQQL 2AJZB 1AIFA 1XCTB 3KXFD 4RZCB 5FYLL 5ESAA 1S9XA 4AIZB 5BOPA 3C9NB 2I9TA 4JKPL 4YZFF 5EBLB 3SE9L 5K9KA 4XNQB 1JNNL 4LARL 1RIHH 4PJGF 4GRLD 3RWIB 3TH4T 4KRLB 3MRCB 3BPNB 4IMLA 5FYJL 3ZTJH 1OAXL 3I50L 3QG6A 4TVPE 3L3DB 5HVHC 2KZ1B 4ONOA 4ZDHA 4IHOA 4LLAA 1YMME 1JYNA 1I3GH 5EOCJ 1EO8L 1U42A 1KLGA 2QHRL 3DRQB 1OGTB 2HLAB 1PEWA 3ZO0A 3JVGA 5C0AA 1RD6A 3T65A 1WV7T 4LHUB 2OSLB 4OM1L 3MR9A 4M1DH 1H3WM 3HFML 5EUKB 5DJ8A 1UH4A 4WUUB 4F7EA 3HE6D 5DLML 3EYVA 1CLZL 4HAGA 2IANB 1A0QH 1ADQH 3H9SD 2ZCLL 3GRWL 4HJ0C 1BGXL 2Y5TB 4G6KL 3B2VH 4R26H 5HY9A 5CJXC 4NKMB 4KDTA 3LKSB 1F5WA 3ARUA 5BOZG 4OFDA 3RVTD 4S0TD 4WWID 5J1SC 2P43B 5E8EA 1M6OB 4NNPH 5DD5L 2Q7YB 3NIDF 4JFFD 2CIKB 3LSOA 4AIOA 1P4LB 5E03A 5GRZA 3FO1B 5I8KH 4NWTH 3EOBB 3E6FA 1S5IL 1X44A 3HPLA 1P5UA 2YC1A 5L6YL 3MFFA 2R0WL 1A6ZB 5C08E 1QSFD 5GXBB 3SGDH 4WI2A 3WDHA 3AM8C 1L7TH 4JFFB 4BKLA 4BSVA 3PABB 3P9WB 3CZJA 1LK2B 2W1NA 2BK8A 3PXJA 2EDKA 4LVHB 4OZ4A 1T6VN 1Q72L 3KPRE 4LHQB 3SDCB 3TBTB 4PREA 5J0BA 4V1DE 1JP5A 4UV4H 3TGXA 3V5KA 4TULH 5I1IH 2HTKD 3MRBB 4NP4H 1GGBL 1PZ5B 2DICA 4UBDD 4MVBC 1WZKA 4XP9H 3RNQA 2DJUA 3TO2B 3WUWA 3PHQB 1VKXB 2EIEA 3MV01 4ETQA 4O58H 2W0PA 3RPIB 2P44B 5D1XA 3QCVH 3SBWA 2CPCA 4AT6A 1A2YB 1XF5B 1QBBA 2VE6B 4M02A 4HUVA 4WRLA 5BO1L 3OJDA 3MLRL 5FXCH 5HYEA 1HEZB 1CD9B 1YY8B 1Z0MA 4YXLH 1LE5B 1KSRA 1DBBH 4K8RL 2A0LC 4X6CE 3TBTA 3P3YA 2VAAB 1H3GA 1O5DT 1UJ3C 5D5MB 4UOW0 1B2WL 2NTSP 4MNQA 4G8GE 1JZ3A 1FVDB 4NKDA 1MJ8H 5DEFA 5F7NC 4Y4HC 4Z95L 4P5KB 4P48A 2YN5A 2YWYA 4JO1H 3GIZH 2VLLB 5DC0A 1AE6L 3QNZB 1BLNB 3QEQE 3O0RL 3ARGB 4M93C 3WYRA 5CCKH 3DYMA 1TTGA 4NFBA 1RZIA 2ADFL 3TV3L 3OZ9L 1GGUA 3QDAA 3BH9B 3LIZL 4R0LC 4BQ9A 1NGXB 2PR4L 4LSDA 2ARJA 4S1DD 4X4YB 4EBQH 5HDLA 2Y07L 4HPOL 3ARGD 3GMMA 3QB7C 3GSWB 4PBXA 3MCG1 4IMKC 2Z92B 5JHLL 3EYUL 4LBEB 3O9WB 2E9BA 3FO0L 3MRRA 5KS9A 3VD9A 1F4YL 5JOPE 1XGPB 4I0KA 1HH6A 1M7IB 1GAFH 2EYTB 2JE8A 1MHPL 2X9WA 5D5ME 1AD9A 5H94B 1S8DB 1R3KB 5I1GH 1CGXA 3PL6C 4HUUA 3VXOB 3R0NA 2V2TB 3QIUA 5I30L 4F58L 3BGFB 3DX7B 4ZUSA 5IVXA 1CVSC 4ZUUB 3M17A 2W0FB 2VLRA 4PTUB 1RJLA 4K23L 1CLYH 3KYNB 2Z31A 1LMKA 2DD8H 1UC6A 3W5MA 3D25B 3BKCL 2XACC 1LO4L 1FZOA 3EOYG 3UTPD 5BJTB 3KR3H 3MFGB 4Z7QF 1BWMA 4LLVA 3RUGE 2X1PA 3OB0H 5C0JA 1QLRB 5I8OH 3HE7B 4JE4B 4X6BA 4YGVA 5EU6E 2NYYC 4U6HB 4PJFF 2IC2A 2R0ZL 5HVHB 1HOCA 1MOEA 1MRDL 4IOSD 4PP2A 4GBXD 1ZGLA 1RZJC 2LQRA 4RGNC 3GMQB 4ZS7H 4C56B 1X5YA 4OV6F 4OTXH 3RHWF 4XWGH 4XVJL 1C08B 1G7HA 3SJVE 5C0AE 4J8RA 4AL8H 4DTGH 1TETL 5A2LH 4ODUA 2XWTB 1TCRA 2ILLA 5DK0A 5CD3A 1RZJL 4XVSL 2H3NA 4QHKI 3MLPA 2IH3A 2XWJA 2XZAL 3PGCB 1KGCE 2HKFH 2HT3C 5FUZH 3VJ6A 4KKLC 1MFDL 5E4EC 4F7TA 3WEXA 4C4KT 3EGSA 4NC2B 5DRNA 3I2CL 3Q6GL 1PEZA 5TDOA 5GGTL 4NHCL 1KJ2A 2VZ1A 3MLXH 3MLSL 4HIIA 2MCG1 2FECI 3MXVL 1GGCH 1GPOL 3VG9B 3BN9C 3S96B 2A1WH 2DJSA 4NO3B 4OD3H 4FG6D 3MUJA 4HX1A 1Q9OB 5KVEL 3UC0H 4TNWF 3AB0B 3X14B 4X7CC 5CP3A 5LCVH 2ED9A 5AYUL 3BZEA 2O5ZH 3V8OA 1RU9H 4LSVH 4DGYH 4JG1L 4XPAH 1GGIH 4UINL 4G8IB 1CR9L 2HG5A 4XMKH 1PJ9A 2BCKA 4TPRH 4NJAL 4PLJD 3SKMB 5T3ZH 3RZCB 1QNZH 4OLEA 4QNPE 5KSAA 3O4OC 3TBWA 5CLWA 1XGYH 5J7CC 5J13C 2R1XA 1EO7A 1IEBA 3IFPA 1CE1H 1G9MH 2VLRD 5D7SL 1F3JB 2G75B 3RZCD 4MJIE 4TSBL 2EYSB 1KLUB 1ZSDB 5E95B 3EIFA 1LD9B 1IL1B 1JWSA 4W4OC 4Y2DB 1KCSH 4P4KA 4M8VA 5DMKA 1YECL 3GBML 1H0DA 3IXAB 4IEFB 2W65B 4F8TA 4MWFA 5I1EH 3E2HB 3P9LA 5FK9B 4JFDB 1HHHA 1E27A 3GBNL 3ARSA 3O3BA 1QRNA 1G7QA 1D6EB 4P2YA 5HHVL 2D3VA 5EORL 1MRCH 3UTZA 2ATPB 4U6TA 4F57L 4A6YH 1RHFA 1W72H 4I77L 5E08H 3V4UH 4YDIH 2HFGL 4OGAC 3PV7A 2D4FA 3CSBA 4XHJD 3SO3C 4NOBA 5F7KC 5HHQA 3C5ZD 3FN3A 3HPLB 4HJJL 3Q6FA 4CMMA 3O6KL 4OCRL 5HYJB 3IXAA 2APVA 5F9DC 5SWZE 3QFDB 4G9FA 1F8TH 4XP1H 1UM5L 1AO7E 4O9HH 1KG0A 5KJRH 2QQQA 4RQQB 3W82A 4R4NC 4HIIB 4X7TB 2A38A 4UZGA 4YJZL 3DX6B 4Q58C 4XHQA 5ICZB 1XZ0B 1MCQA 2VDRL 3QISA 3D85B 4KVNH 3SCMC 3GFUA 4HGKC 4X83A 4JGMA 1TXKA 4QHUA 4IJ3C 1RMFH 2OS7A 3PL6B 1FE8H 3QUML 4DCQB 3IAPA 4OZHE 2AJXL 4JFDE 5D2LE 1FRGL 2AEQH 4OCWL 3QQNA 4IRSA 3ZKQD 3ARBC 3FQTB 3SO5A 1A6WL 5ISZA 3BZFB 3K2UH 5CEZH 1AC6A 5DVNA 2BP3A 4X80L 1XF4A 4KV5F 3STLB 1UWEH 5EU7E 1CCZA 4LLUA 1A14H 1Q0YH 5IBLD 4LGPB 5I1AB 4PG2A 4Y5YA 3X3GL 4RMWA 1DFBL 2NR6C 4R2GC 4KY1H 3RUGA 5CWSB 1CDUA 1OAUL 4Y7MA 4I3GA 2PN5A 2GJZA 4KGJA 3N1PC 1FFQA 3S9DB 4OQTA 4R7NA 2V2WA 4UT9L 4HGWA 2B0SH 4Z7NF 2O26U 1WAAE 1BQHG 1HHIA 2XFXA 3V8CA 1XGQA 2QBWA 3Q3GA 1ITCA 5I8CB 3QIWC 2OYPA 4NGHL 5F7YC 2P5WA 5JO5B 5JHDE 1GZPA 2HH0L 1UADC 1YYMH 4F9PC 5JQ6L 2M26A 2OMBA 1CWVA 4HF5L 4JKLA 1JF6A 1NSNH 3MOBL 2M8XA 4IMLB 1FFRA 5JUEH 4PBVC 4XP6L 3DECA 3V5DA 1KXQE 5E94A 4F8QA 4I3RL 2GAZB 4K3JH 4KAQL 3CVHH 5FF6B 5GSRA 4RZCA 3MCLH 1BVZA 2XQBL 3UPRA 4LCYA 2VDKL 2Z0BA 3HC3H 1IL1A 1JWSB 4HK0A 4Y2DA 1CLOL 3GSOB 2R1WB 4P5TA 5I0ZA 3MOQA 5F96L 2CDGB 5E70A 3MV11 5CEZD 4PJEE 2BNQE 4PLOB 4XHJC 3QFJB 1V3JA 2FH8A 4L4VD 2HJLB 2XRAH 3I84A 2X1WL 2C3HA 2X2YA 4MAYD 4P2OD 4LLUB 4G7VL 1FL3A 4JPIA 2A77H 6FABL 1M71A 1JWUB 4XBPA 5LXGH 2FNBA 4EKXA 2HVKB 3CFDB 1EEZB 4FFVD 5JOEA 3T4AB 3RX8A 3U6RA 4N0YH 4WTWA 2GSIA 4YPGB 1GHFH 4GRLA 1Q8MA 1TJIL 4P2OB 4JY5H 1JNLH 5CEYA 5AZ2L 1I1AA 5IB1A 5IQ7H 2P49B 4ZFGH 4GO6B 4DKEH 2WLYA 1MFEH 4Y19B 1KPVA 4KMTH 4ZS6C 3KPPA 4NT6B 4IM8A 4N1CA 3Q1SH 1NDGA 3KPSD 1DANT 4PRPD 3QUKB 2BHYA 2O61A 1FNAA 2J8UF 5CFHA 4DN3H 3NCFB 4FN0A 3SPVB 3QPQC 2JB5L 1MF2L 5E8NA 3P0YL 5HHOB 3SDAC 1IQWH 3OJVC 4U1JB 5KTEH 3NH7H 5KZCD 2WM0A 3QUYB 3DVIA 2D7OA 4JHAH 1YMHA 2BOCA 2DQJL 4XBGA 3S88L 3E3QC 3O6ML 3CVIH 4DKAA 3MCKB 2QV2A 2OZ4H 2YRZA 4OKVA 2GAZA 4FS0A 2XQYK 5LAXA 5KSVA 3THMH 1EEYA 4F7PB 4JG0H 4XVTL 3F7VA 3FB5A 1WC7B 5T5FH 3FL7A 2I25N 5F7EH 2OI9B 5JA8B 2CSPA 4EN3C 2AJYH 2MQ3A 1ZEAH 3WD5H 5DSCB 5CGYD 5I2IA 1PG7L 1JYXA 1RK0B 4X9HA 5DUPH 3SE3C 1S7UA 3MRNA 4G80B 1OLZA 2EDNA 3QXWA 3KLAB 3LN4A 3C6LB 4KROC 1CL7H 1OT2A 5F93C 2HJFB 3F12B 3L95B 3LKPB 2Q76A 1LWRA 1FLRL 1GOFA 2EYSA 4R90L 1Q9KA 1D6VH 3PP3H 3S37L 3SDAD 2VZVA 4M62H 2BVOA 4CBPA 1BQSA 1BQLH 4PRIA 5F9JB 3GNMH 1UXWB 1IC7H 4JM2A 5FKPA 1OTUD 3MROA 5FIEA 35C8H 3D3VE 4S0SD 1F6AA 4ELME 4MNQB 2DI8A 4UOW1 3W39B 4MB3A 1EA9C 2CH8A 3IXTA 4AM0A 3DVGB 3QIUD 4AIXA 3G9AB 3IDJB 4MNHA 5HI4D 1GIGH 3EDKA 4KDVA 2PW1A 3OKLB 3AREC 4MCZB 5IEHB 1KV3A 2BXZA 3L3OA 2BSRA 4X6BB 4YGVB 4YHIA 2APTA 2EH8H 5IIEB 4JRWA 3N06B 2IAMC 3HG1A 4WCYH 2LU4A 3HS0A 1FDLH 4WW2B 3AREA 5DVMA 3ZT5A 5HDOA 3ARDB 2CJUL 2O61B 4FNLL 5DJCB 4G6MH 4DZ8B 3OKDA 1VEMA 3QO1A 2IAMA 5KOVC 2A9NH 1T7ZA 5DURB 4M6AA 1CU4L 1HYSC 3LKOB 3HG1D 4PJAF 4J7RA 4ODBD 4DQOH 2ZNXA 3F7YA 2BVYA 3JWDC 3L1OL 4N1EA 3MRIA 2FZ3A 1ZVHA 1RUAL 5CAYB 5C8JA 2VUOA 3WNLA 5D93C 3QIBC 4XI5C 4HFUL 1QSEE 4OI8A 1NCCH 2VISA 4PJ9B 1XGTB 2YXMA 1KELH 4FXGA 2DLTA 1EUTA 4IOFD 2X4RA 4K07A 5T3XD 3ULVD 1BIHA 1X5ZA 1YEEH 1GZPB 1Q1JL 2HYMA 1YNKL 4I9WE 3L3DA 5FUOH 5BXFB 2DWEA 4YBQD 4ZO9A 3ARFC 1MIMH 2E7BA 3CDCA 4RFEB 5DJAA 1N5YL 3LKPA 2UZIH 2XXCB 4QOKD 4NBYB 4ERSH 5HHQB 2NY5L 3DTXB 3VXSD 2WZPD 4PJ7A 4LASH 3IDGA 1BZ9A 3WFCH 5BRZB 4OGXH 5GS0H 4UT7L 4P2QB 4HS8L 2DM3A 1CXIA 2AKRB 1Z9LA 5EUOF 3CXHK 4HH9A 5A16A 4X4XB 4A6YB 1NDMA 2HFFA 5SWSA 4BYHA 1WC7A 4NZTL 5INCA 3VXSB 3X3FH 5IMKA 3MGTB 4LEXH 1CDCA 2DWDA 3L3HA 4GMTL 1R3LB 2C4XA 4PRHE 4P2QD 1BWWA 4PPTA 1J1PH 1AJ7L 5GSVB 4ONGH 5CEZE 3VXRA 3WHXA 2J8UB 4LLDA 1W8OA 2IEPA 5B3JE 4KTEH 3QIWD 3MBXL 3D3VB 1MEXH 5L0QC 4F37F 4LFHG 4ZAKB 1U3HA 2C3GA 5IROA 3LRHA 4LSUH 1PGRB 3W2DH 3LAFA 4HFWB 5GGUB 4HULB 1KEML 1MCOL 1NUFA 2A9ML 2ZSVB 5I1LB 5BVPH 1J1XL 4WWKC 3PE9A 3STLA 2YD3A 4YFDB 2J4WH 3DYPA 3QG7H 1GSMA 3QDGD 3S4SA 4MA8L 2R0KL 5B3NA 2IQAB 12E8H 4U49A 3BZEB 3N9GH 1INEL 4KKBC 3HZYA 3TZVD 5EU7C 5GGRB 4Q9BA 4BZ1H 1ES0B 1FYTB 3GJFA 2PW2B 3MGOA 2VLLA 1QACA 3LRSA 4IRJC 4XXCA 3M45A 3V0VA 3NFPB 3T1FA 4CNIA 4HIJA 3U46B 2JJVA 1HQ4B 1XGUB 3U82B 1QRKA 4JFXB 1DLFH 1JI1A 5GQBA 5IWLC 3DVNB 3K1KC 1AH1A 5DZOA 4KUCF 3QJHB 2C1PA 1FO0H 3UPCA 5GHWH 5ITBL 3C6LC 1REIA 5DFTA 4KI5D 4YC2C 1FN4B 3A6OA 2D7MA 3MNWB 5IVNA 5CZVL 5IWLA 3K4ZA 3LV3A 4QRRE 2FCBA 1F90L 3SE4C 3C6LA 4G9DA 4GG6E 3MXWH 3CFKA 4D0CA 5HGGS 5JDSB 2X7LA 1KCRH 3DSFH 4EIGB 3A0OA 43C9B 3N1FC 4ZOEA 3WFEH 4X9GA 3KPMB 3W9DB 4NHUA 3BWAA 5KANG 5KSAD 4QHMA 3B9VA 4XX1E 2WUBL 4W81A 1L9NA 5F6HI 1H8SA 4OCSL 3QHZL 1IBGL 4GW5B 2HLFD 4HHAA 4WFFE 5E7FA 1X6LA 1KFAL 4LHJB 3UBXB 3HLAB 5FHBL 3CDGA 2Y9RT 2X70B 4JY4B 4MX7B 5BVJB 2EDLA 3P73B 4JB9H 5B39B 2DL2A 4KRNA 3WKML 4XP4L 4EN3A 2VUYA 5JXAH 3G04B 4NNYA 2FD6H 5IT2L 3Q5OA 4XBPB 2NZ9D 3BUYB 3WIHA 1NANH 5JA9A 1A22B 1FFNB 3EOBA 4J4PD 4KFZC 5ESAB 3X11A 2HRLA 2NPLX 1CGVA 5TFSH 5TGBA 4ZS6D 3D2UD 3DIFA 3FB6B 5IKCA 4PJ8A 4FZ8H 5HYJE 1T4KA 3KWWA 3VFGL 4NRYA 4FQIH 3MNZB 1YY9C 2VXVH 4YHMH 2I9LB 2H2PD 2VYRE 4ZD3H 1QQDA 4JO3H 4H1LG 4JZJC 4L3EE 4OF7A 4P23C 4RBPH 5D7JC 5HY9B 5IV2A 4ONHB 1RIHL 2OP4H 5F3BA 4HKJB 1U41A 3WS6C 4YHKH 3QIBB 2VR9A 3FJTA 2F5BL 5DHYA 4RAVA 3LEXB 1X4ZA 5LJYH 4QT5B 5E2UL 4FABL 1IGTA 1D9KD 3GHBL 4F33A 2YZ8A 3OXSB 3T2NH 1EO8H 3RDTC 3BRDA 2GITA 3HPJB 1V3KA 2EDOA 2YA0A 3DGGB 3FO1A 4GXUM 5IMOB 1HCFX 4RRPG 3V4VL 5I1HL 2DDQH 3ZL4L 5CINH 3QUYC 3SDXF 1ZMYA 4UIMA 2WBWB 1LE5A 2V9RA 4LVNB 4XNUL 5I74B 3G6AB 1J8HB 3SDDB 3BD3A 2R15A 3HMWL 32C2B 2DLFH 5ECJE 2VB5A 3B2VL 5IFJA 5B4MD 1F3JA 4XMLH 4UTAL 3LKOA 1BBDL 1U95B 2IH3B 4KJPC 4QXTA 4U1IB 1KEGH 4QRRA 4P2OA 2HMID 3LQAH 5ESVB 2ED8A 5JMRA 1HSBA 2OSLA 2P8MA 2V17H 4YEEA 4WUUE 2VXTH 3GMPA 5FYJD 4W4NA 4WY7L 1MCFA 4OQTL 5EBWB 2X10A 5FAAA 5ITFA 4GKNB 1PYWB 1EUUA 2M1KA 3W81A 2R8SH 1MI5B 4K55A 1G0XA 4QRTB 1IQDA 1A3QA 5L0QB 1EJOL 3ET9F 4G43A 3SJVD 4P5MB 2J88H 4X6DE 5D6CA 4MZ2A 1OOAA 2ZUUA 1IEBB 4ZG1A 1A6UH 1XMWA 1A4KB 3EYFA 3MRKA 1AIFB 3LSOB 4NQCE 1MI5D 1KYOK 4UV4L 5ICYB 1WBYA 3L9RB 4L1HA 2L7UA 4NRYB 1G9NL 4LDOB 1KPUA 3QCTL 4GRWH 9CGTA 2FLBT 3PIQB 1P7QD 2Z35B 5IMOA 3U0WL 3HUJE 4L3AA 2E3VA 2ICWJ 3BESR 3ARDA 1OL0A 4CADB 3C60A 4CVUA 1ND0A 4FFYH 3CSYA 4WI7A 4PJBF 1S7UB 3ARDC 4GQPH 5BO1H 4IRJB 4HXBL 1WICA 1QKZL 1Q9WB 1MCNA 2CK0H 4NWUH 4ZUTA 1RI8A 2PYFA 4EIZC 4M3JA 5C6PB 1B2WH 4FQXA 4OT1H 2ADIA 2GSGA 2C1OA 4GW1B 1DLHB 4ZFOL 5M7QA 3R0MA 3ULVF 1E27B 5MP6H 3K1DA 2X5PA 1FZKA 3D0LB 1E4JA 3FN0L 4WHTA 4JM2B 4OCNC 5C0EA 2ZG1A 3U9PL 4JDZA 4PJ8B 1V7MH 1F11B 2R1YA 4JRXD 2ZZUT 3ZLQC 4E42B 1MCJA 3BGMB 2VDLL 2AI0L 4XCYA 4F2MA 3OTTA 5EUOA 3O4LE 4NJ9L 4LSPH 3PQYA 4M7LL 3A6BL 4U6YB 2AS5M 3VGAB 3VGEA 3BXNA 4I8DA 5I19H 1NC2A 5DMYA 3CFJB 3ZDXF 3KPQB 2EZ0C 5I9QC 1DQML 1MHEA 1DEEB 3ARFB 5HHPB 2B4CH 4H26B 2CKBL 1K5NA 1C16A 1FV1A 3QIUC 4YWGH 3UO1L 4BK5A 3PQYD 4EUPB 5E5UB 3DX8B 2ZOLB 2WQRA 1J0KA 2P8LB 4GOSA 3NIFF 1KT2A 2X05A 5FK9A 3CJJA 2BMKB 3DETD 4WJ5A 5IG7A 3E0GA 2DQHH 2BERA 1KIPA 5CMAA 5ID1A 4JFPA 5D8JH 4L29A 5DD3L 4RA3A 4PRAA 3LZFH 2WWMD 4Q9QL 1DQDL 3PQYB 2MQ0A 4MNGE 1WWWX 5AG8A 1TFHA 2IQ9H 32C2A 2BSTB 2EIZB 1LO0L 3ULSB 1JPGA 2CLRB 5GSRB 4M6OH 1MVUA 3I02B 1T1ZA 3NACH 3REVB 4MAYA 4YFEA 1WEJH 3MRQB 1I9RL 1A7RL 3LB6C 4X8JA 4Z7UF 5IF0A 3KR3L 3KYOA 5MERB 2C1PB 1IC5L 4OZGE 3VU2A 3HAEB 1MIEH 3IU4L 4ZNEE 3IFLL 4F7TB 3O6FC 4WW2A 1R5IA 4JR9L 3SY0A 3V6BR 5GRVL 5IB3B 1C5DA 3SQOH 1KN2H 3LD8B 4WNQA 3BMWA 2VZOA 3WO4C 5DD0L 4UDUB 4Z5RA 2AK1H 3RWGA 1N5AA 4PTTA 2A6JB 3O2DA 4K3DH 3WFDL 2X4OB 4ZUVA 5C2UB 4YK4C 2OTUB 1HXYA 3GI9L 5DFWH 3T65B 4AL8L 4NQEE 4YXHH 2VITB 2VQ1A 4MXWH 5I74C 5BQ7B 1CT8A 1JZ7A 3E6HA 5B38A 4KUCD 1BJMA 2UYLA 3MV7B 4FP8H 4YHYC 3OKDB 2G60L 5ICXB 3IU3A 2QHLA 1XIWA 1NKOA 5FKAB 3ROLB 3AAZB 2IPTH 5KSBE 3F65A 2ARWA 3RKPA 3KXFB 1V7NL 5I16A 4KK5C 5I1JH 1RVFL 2OTUA 4B7LA 3MLXL 2CK2A 5K59E 5BV7B 4HC1H 4JANB 4N8VG 4U1HA 4K9EL 5E6IA 1J0HA 1PY9A 2KQNA 2X89A 3VRIA 2GT9A 2Y6SD 3MA7B 5KVEH 4Y4KB 3H9SE 5L7XH 4MMZC 2W60A 4CGTA 4JVUA 2ZG3A 1X7QA 1DQLH 1EFXB 4JHWL 3LH2H 2C3WA 5FCUL 4ZOCA 1JGVH 5ISZE 3JWOC 1FC2D 2BNRE 4GKZA 4S10A 1KB5A 1KJ2B 4X5WB 3EOTL 3TCLA 2F74A 5IP4A 4S1SL 3L5XL 1QLFA 2ED7A 4RGOH 4WUUD 4PJGA 4R3SB 3F7YB 1MUJA 1MAMH 4LKCA 1T7WA 4YNYA 3K0WA 2QL1A 1Z5LB 1AKJB 3QHFH 1XGYL 4O4YH 1HHJB 4PV9A 1AQKH 2V6HA 3VXNA 4QYOA 4YQXL 4OZIA 4BFEA 4TSBH 3U7WH 4M1CC 2HWZL 7FABH 2XTLA 3RL2B 3R06A 1CFTB 2Z91A 4QY8A 3IB4A 2XKNB 3QO0A 1A7PL 5I1EL 3JTTA 2OL3L 2A6JA 1EHNA 1T21A 4K7PH 3C5ZA 6CGTA 1S7SB 3AM8A 3MV8B 4GKNA 2BZDA 5LWYH 2VDOL 1AY1L 4X5XB 4ONHA 1BIIB 3TBVB 1U91A 1QSFB 2YA2A 3QJFB 1YMHB 3DRTA 1R3IL 2CGRL 2JJUA 1WT5A 3V4UL 2DQCH 3FHQA 4MNQE 4RMVA 2G75A 3EDEA 5GGRY 3MJGX 2FH6A 3OJMB 4WV1A 4UUJA 5EU4A 4UILL 4HCRH 3MV8D 2W92A 1AO7B 2P5EB 3ESUF 4J6RL 5C0EB 3BHBA 4HJJH 3N0PB 1FORH 1DR9A 2NW2B 4QHNB 4P2QA 1INDH 3CX5J 3U9UA 5IB2A 1HKLL 2NY1D 1UJ3A 1XR8A 2VL5B 3WE6A 3T4YB 2D31B 1C1EL 1JGUL 2AEPH 3RGVC 4L9LC 3GI8H 4TQEL 3P0GB 3ARXA 2DIJA 4AM0B 3SHSA 4HWZB 2EE3A 1X4XA 3P4NA 3RGVA 4OCLC 2R23A 4KVNL 3IVKB 4NRXB 3U46A 3W11C 4HLZH 1AFVH 3EJYC 1RMFL 3ZKND 3SN6N 2X89D 1MCIA 3T0WA 5ACLA 4J3OC 2Z8SA 3GM0A 4R2GD 4R7DA 3VG9C 4NDMA 2BY1A 1J10A 4N5EC 4OI9A 2WLZA 5F3BB 4Z7UB 2Y06L 3TZVA 2VXSH 3CLEL 1ZHKB 2B8OT 2V2XB 2R69H 3CSGA 3RWHB 1UYWL 2DQFA 2ICCA 4FTVD 2AXGB 4HBCL 5FGSA 5DA4A 5IHBA 1YY9D 1I85C 4G43B 4ODHH 3PGCA 1IGFH 3DBXA 4PYHA 4V1DD 1F4AA 1UH3A 2YPKB 2BNRB 2Z8RA 3VFUA 1CD1B 4JKPH 1NFIA 1S7VA 4LARH 2IBGA 1OAUH 4N9GB 3S4SG 2F54D 4WV1B 4YFLF 1X7QB 1T0MB 2ESVB 4BELD 3VXRD 3MGAA 4EUPA 1W0VB 2DLHA 3F7QA 1QHOA 3HI6L 2OR9L 1U8NB 5EU6A 4M7LT 4F7MA 3WN5B 4FFZL 3AROA 2VWEC 4K71C 1HINL 3NOIA 3L5WA 3UTPE 4M61A 2ITDA 1VDGA 4IOFC 4QXUL 1ORSB 4NGHH 1QQDB 1U95A 1P6FA 3FMGL 5GJSH 3RTQA 2K7QA 4DOHE 4E9LA 3MSPA 4P57B 5I17A 1JWUA 1DJSA 1BQUA 5TH2B 3PHQA 1VKXA 4MA1C 5DWUH 1YDPB 1KENH 3MRJA 1MHCA 3OKEB 3HFMH 2Y7QA 2ZSWA 4YZFE 3MV7A 1A0QL 1ADQL 1BD2D 1XF5A 5EZOH 1XT5A 3BW9B 1Q9LA 1BGXH 1MRFH 3CVHL 3P30H 3VGBA 5T5NG 2VDKH 2OL3A 4WDIB 1KPVB 5LGKA 5J3HC 1T1WA 2FBJL 1D5XB 2XG5A 1ZA3A 1U8MB 3LCYA 1J8HE 3I6GB 2R1YB 1PKOA 3HE7D 3PWLB 4PP1C 5E8OB 3G9VA 3CFDA 1B4JL 4QT5A 1EGJH 3NFSH 1Z3GH 4ODTL 3TVMC 1F4WH 4XB7A 1BOYA 1CD0A 1QD0A 3S35X 2DAVA 5EN2A 3H7BA 4PJBE 4C56E 1A6TB 5KVGL 1KCLA 2JKXA 5E9DD 5KS9B 1JK8B 4Q0XL 4Y0GA 4HMEA 3ROOB 1Q94A 3KJ4B 4PLKC 5CLTA 5KSUA 2OTWA 4Y1AB 2X4SB 3JWDL 2R1WA 4P5TB 1DBKH 1S9VB 1HZHH 1CBVL 2FR4A 1NGXA 5BV7H 3STZB 3MO1B 1FG2A 1WAAF 5DJ0A 4DKEL 3E1F1 3OGOE 2D9QB 3TBSB 4KK6C 3F6LA 2C9AA 4EVNA 1IE5A 4YBLB 1U8OA 2BSSB 4L3CA 4OI7A 3DWTA 1T83C 1KJ2L 2GI7A 4NP4L 3AAZA 1GGBH 3NAAH 4Y1AD 3TJEH 4P2RA 5E8PA 1CG9B 2VXQL 1KJ3H 1ZHNB 2Q8AL 5IOPB 3O8XB 3RWEB 1U3HB 1IAIH 4PGJA 4BJLA 4AEEA 1W72A 1ZA6B 1WFOA 4QXWA 1DZBA 3NH7L 1XGQB 3N1MC 4OIIH 3GJFB 3TH2T 5FM5O 2GCYB 3ARGA 3ECBB 2YN3A 4DUVA 5GS2H 3L7FB 3MUY1 5C2BH 1AXIB 2YD8A 4RX4D 1MI5A 4X7EC 3RY4A 4M6NL 1T1YB 2R9HC 5EPMB 5DTFB 1MJ8L 3PWJB 5L2KA 4Y4HD 3O2VL 2HLAA 3TBYB 4XBEH 1F6AB 1HKFA 4PRHD 1JUFB 4O2FA 1PG7H 5C0IB 1T22A 3QWOA 5DUPL 2VIRB 1JTTA 4G8FA 5T1LD 2NY4C 3D9AH 4FQLH 4YE4L 1E4XH 2B1AL 1AO7A 3QA3B 3U36B 1BVKA 4X7SH 3OZ9H 5CJ8A 1MWAA 4L8CB 2CIIB 3O45A 3EDJA 1JHKH 2PR4H 3ZKNC 5D96B 2E7LA 4U2YA 5D2NA 3LKRB 1T1YA 2IBZY 4Y2DD 2FR4B 2VXUL 2R2HA 4MNHB 5DJ0B 3PHSA 4PJFA 1BBJA 2VLKB 3FO0H 4G8EB 4DW2L 3RWFA 4DVBA 5BVJA 4IRSD 5TE4L 1F2QA 4XWOD 3BX7C 3BOVA 1I4FB 4I4WA 1GAFL 2ZJSL 1NCUA 5D2LA 4JFEE 4XH2A 1UQSB 1IGJB 3WUWG 2MPAL 4OLXL 3I9GH 5JOFA 2BC4B 5AZEH 5ETUB 3CK0H 3JUYA 5C0CB 2EH7L 5BV7C 1YYLH 1C5BL 5MENE 3B8SA 4A2MA 5GZOC 1K4DB 1PKQB 2VSDA 5F3HB 2CRMA 5DI8B 2IJ0C 4Z6AT 5HYJD 3CVHB 2DD8L 3QUZA 5DEGA 3FQUB 1NC4D 3T4YA 1HI6A 2BJML 1HILB 5HTSA 4ZFFA 4NO0D 5BS0D 1XFPA 5GSVA 2E27L 4PRAB 4AEIL 3PJSB 3KPSA 2E7HA 4PRPA 5DD1L 1UB5B 5DRZA 3H9ZA 4XXCC 2EC9T 4ALAH 1JRHI 1V3MA 5FYKE 3ULUL 4JY6B 5SX5H 4OLUH 1OP5K 3OG6B 2XZQH 1CTNA 1F45A 4JZNB 2GTWA 4PJCE 2MHAB 5ANMB 5FGCB 2P8LA 2X4NA 1NEZB 5KW9H 3PNWB 4NC0B 4U0RB 5JPNA 2GKIA 1J7VR 2B2XL 3ZYZA 4LCWE 2CUIA 3PL6D 1CS6A 4XVJH 4XWGL 3ZSTA 3L5WB 1PZUB 4M7JL 4G5ZL 1AGEB 1W0YT 4MA1B 5F89A 3FHAA 3JTTB 5MHSE 3TWCH 5INCB 3VXSA 5IB3A 1OLLA 4IDLA 4GG6A 1JCKA 2FB4H 1NJ9A 5JHDA 4U33A 5IUSA 3ZKMD 1LP9B 3MODH 3HZKB 4TRPL 1CDBA 1EPFA 2Z93A 5BRZA 5B39G 1MIML 3BZDA 1VGKB 5I15H 1S7TB 2D03L 4PY8J 3AXLB 2D7NA 4I2XA 2C7UA 2C4FT 1HSAA 1YEHH 4LCUB 3ZMRA 3BIKA 1KCVH 4GW4A 4P3DB 2X9YA 4NDMB 5ADPH 4YDJA 3TVMB 4LASL 2EDYA 5FYJE 1QR1A 4HUUB 3VXOA 3BDXA 3BQUA 1M7DB 3PDDA 4O5LL 1FFOB 2FX8H 2Q8BH 3DVGA 3QIWA 1WCQA 4C58B 2BVTA 2HJKB 5BW7A 4ODUB 1YJDH 1NAMB 1UQSA 4P4RB 3N1QC 4D9QD 1XCQB 2O5ZL 5D7LD 5FO9B 4P5TC 1RU9L 4LSVL 5DRZB 3AXLA 5BZWA 5CBAB 2AQ3A 4MA7L 3MRQA 1U3ZA 1KJVB 3FT3A 4HT1L 5JW3L 4P2CG 4YIQA 4YBLC 1UWXK 4NSKB 1NC4A 3ZTNL 4XCFL 1QNZL 5TDOB 2NY2D 4KTEL 4MXVE 1JYWA 2R29H 5D7LB 4N0RA 1ZWIB 4XP5L 2CXGA 4JAMA 4QOKA 1A1MA 3W9EA 3NFNA 4HLZG 4AMKL 3PGFL 3INUH 3DYOA 5D7SH 2FO4A 2DQGH 1MFBH 3EYOB 3MRBA 3QG7L 4LHUA 4Q6IA 3TYFA 3QXVA 5JHDB 5I1DA 5F9OH 3BDBA 3T77B 3IRZA 2FHCA 1FAIH 5EU4B 3MBEA 1H5BB 3UTSA 4ODSL 3CUPA 4M7ZB 3QDJE 4RGND 2VERN 12E8L 4B0MM 3D5OF 1F00I 3MA9H 2RIKA 4NKQB 1FYHB 1HWHB 4PP1D 5AAMA 3HAEH 3SGEI 1NGPH 1M05B 4NM8L 1N0XL 3RVXC 2XYCA 4F57H 2D31A 2VR5A 1TQBC 3IXTB 2VLKE 5HYFA 1EBPA 3R06B 1I7ZA 2VQTA 1FL3B 2Y6SC 5EO1B 2QQNH 5I6XC 4P2OC 3EDDA 3MREA 3RL1B 1CXEA 4Y19D 3S4SB 4RDQF 4TOYL 5CIPH 2P24A 3MNVA 4OIAA 2AEWA 1MFNA 3KPSB 4PRPB 5T3XL 3FT2A 5D93B 1DLHA 1IGCH 1RUMH 4Z0BL 1RHHB 3O3DB 5E24E 1ACYH 1YN7B 1FNGA 4NZRL 5J56B 4JO2L 5TDNB 4ZO7A 3A67H 3DSFL 2B1HH 4GG8A 3PWUA 4JDVB 2D0HA 4C4KO 1A1OA 5KZCB 4WUUA 5GRVK 4F7EB 4PJ5E 1IM3B 5C0GB 1QFWH 3L7FA 1RAMA 1DBML 3S3PA 1B0RA 1SEBA 2DBJA 4LLWA 1RJYB 4CADA 4NN7B 1MPAH 4PGDA 3X17A 1SMAA 1LILA 4QRPD 5D7IF 4P4KD 5IV2B 5IR1B 3QUMH 1HH9A 4J8RB 1QHPA 1JN6B 2AJXH 1XGRB 4JPVL 4OCWH 4MS8C 3OPZH 1CDJA 5T33L 1RHHA 2OQJB 3O3DA 4ORGB 2V5MA 4R96A 1KYOJ 3C2AH 3BPNC 3CDYA 4OGYH 1UA6L 3IF1A 4QRPB 4P4KB 4KRMB 4E5XA 2KBGA 1RIUL 5MI0C 3GUTB 1M1SA 3HI5H 1R5WB 1Q0YL 1I8IA 3C6LD 3EOAA 1V8HA 4S2SA 4D3CH 5I1KH 1ZLUH 3K80A 5HGHA 4HGMA 1OGAA 5DJAB 4FZ8L 3L6FA 2WSKA 4QF1A 4G3YL 4ZNCD 2FGWL 3G5ZA 2DWDB 2F58L 2QQKL 3H8NA 1D5IH 4PREB 2Y23A 4OZHF 4J3SA 2VDNL 5FO9A 5F6IC 4LSQL 2X4TB 1MHEB 4H8WC 3RGHA 3RWEA 4APQD 2R56L 5E2UH 5D72L 3HA0A 3FONA 1ZS8A 3ARTA 3UZVB 3U4BH 2CDGA 5T1KD 1U3HC 3QH3B 4YXKH 1P7HL 1IKFH 5HD8D 1ND0B 2DDQL 3ZL4H 5T1DL 5DJ6A 1P4BH 3AGVA 5HD8C 4OLYL 3ZDZE 5ICZA 1ZTXH 4ODWB 2DI9A 1WBXA 4KAQH 2YRPA 3S97C 5T1KB 2MCPH 2Z93B 4J3XA 3VW3L 3NA9L 4AEFA 3LB6D 3MJ8A 5DURD 5GGSB 5F96H 5FOJA 4XMLL 2HJFA 3HNVL 3L95A 3HG1B 4L8DA 1SY6H 1UCBH 4PYGA 1BVLB 1T5XA 1A6ZA 2ZCKL 1Q0XH 3VI3E 2PW2A 3LQAL 1U2HA 1GYAA 4KHTH 5TPWL 2XRAL 3D39B 3MRHA 5C0BB 1M7DA 4HUMB 2L7JA 2FWOA 1IKNA 1YEKH 4DGVL 2F53A 4HJGA 5ISZD 1G7PB 3ETBF 2X4UB 1G0DA 1Q9OA 1V5JA 3VXUA 4PJ9D 2FX7L 4Z7NE 5E8NB 1TNMA 3VWJD 3T0DA 4PGCB 4OCXL 1V3LA 2R8SL 2E8ZA 3HNSH 1VPOH 3NA4A 5E6YA 3FT2B 3MPCA 4U7SA 3BJ91 2BDNL 1UM6L 2GJZB 4LNVA 4EUPG 1WITA 5C92A 5J89A 4WDIA 4Q6YA 4JJ5B 3UZEA 1UJ3B 4NYLA 3C9NA 1DBJL 5C0CE 2KZWA 5F89B 3RTQD 3V6OE 1WZ1H 2KPNA 3ULVC 4XPTL 2NXZC 1G9NH 5EC2B 5FO8B 1HQRA 2ZUWA 5ACZB 3TF7C 1JHTB 3U0WH 3CDGB 1EGJA 1IQWL 4TTDC 2BY2A 3MRDB 5C07D 1MREH 5I71C 3AB0C 3P73A 5EH1A 2GUOA 4LLQB 4KPHL 4U1KB 1DQQA 4PB0H 1KULA 1P2CA 2DQJH 3S88H 4HS3A 4OKDA 2IPUG 3RTQB 4PJEF 3I6KA 1QSFA 4BQ8A 2AABH 2MNUA 3THML 4CJ1A 1PFCA 3GHEH 5ERWA 3QDJB 2CK0L 3O3UN 2W0KA 5I6XB 4YEFA 4EQ3A 2AJYL 3MV9E 3QO0B 4B7IA 2ITCB 4ETQB 3UCRA 3VGHA 3WKNA 4E41A 1SYSB 1GRWA 1ZHKA 4U0QB 2VRAA 3D3VD 1N59A 3OJ2C 3QDJD 4ZAKD 3U9PH 3SGDI 1XF3A 1F3RB 3VH8A 3HE6B 1DN0B 4OF3A 1G6RB 4U6VH 3ARED 5IEKB 3LS4H 1E4XI 2XKUA 5KANI 1N26A 1JYVA 4IDJH 1LP9F 1E4KA 4PJBB 5CZKA 4BSJA 4EQ2A 4PIRF 4CVXA 4H5SA 1WIOA 2JIXD 1S7RA 4NN7C 2YC1B 4RNRA 4LIQE 2XFXB 2CRYA 5CILL 2VR4A 4Y1AA 5E6ID 2MTPA 2WQ8A 4N0CD 3RAJH 3ISWA 4XRCA 2QKIB 3DUUA 5EBGA 3ZYIA 1VADA 4N0CC 1FYTD 4M6MH 5D7KE 5JO5A 1HHGB 3HUJF 1F42A 3DRQA 2P46B 3KYMA 3P4NB 3FCTA 1JHTA 2YXFA 3GO1H 5E6IB 3LZFL 4Q9QH 1FCGA 3MRKB 1OCWH 1ACZA 1KOAA 1F3DJ 2FX9H 4U1IA 3BPLB 1A6PA 2AQ2A 2J6EL 4RX4A 5GGSY 1FDLL 3MRFA 1LQSR 5DJYA 4JN2A 4FNLH 1U58A 4QHKJ 5HYJA 4G6ML 4HK0B 1PSKL 4GRMA 1UACH 4K7PY 1E6OL 5GZND 2YK1H 2QADB 5E5MA 5EIIA 3QEQB 1A7RH 3G6AA 2A9NL 5JZ7D 4L3EA 1F13A 4QWWD 1G1YA 1KCKA 1YNLL 4Y5YB 5DK2B 1IC5H 4K3GA 5KSAB 3IU4H 1BOGB 5BXFA 3V6OA 4UAOB 2W0FA 4GSDL 3M1BB 2QADD 4EI5B 4NM4L 2R4SL 2F8VA 2LTQB 3D85A 4P9ML 2P1YA 2O5XL 4ZUTB 1A6TA 3VWKC 4XZUB 2CDFB 5DD0H 4LF3B 3WV0A 2BFVH 5C07A 1S3KH 1OF2B 3SBWC 1S8DA 4D9RE 2RR3A 1KIRB 4R6UA 5CGMA 3F62A 5FGCE 4XNQA 1W2KT 5EU3A 2Q6WB 5L8JB 4GLRH 5C9KA 2GEEA 3QEUB 1IM3A 1RUKH 4MAUH 3MRMB 2EDTA 4R8WL 4YXHL 3DSNA 1WISA 4E42A 1DUZA 1J9CT 3TBSA 1A3RL 2YMXH 1LEGA 2W07A 4HIXL 4XPHL 1ZGLM 3QZWA 4FQCH 5D1XC 3U7YL 3RIFK 2VZ3A 3S35L 2FJFA 1T1XA 1X3DA 3D2UB 5IM7A 2I5YH 1XCQA 3OKKB 4JQVA 1QBLL 1RFDL 2NY5H 1A7NL 1TQBB 5D7JA 3TFKD 3CZFA 3AUVA 1D7FA 1X5IA 4JPKL 4TVPD 1F58H 5DK3A 4EDXA 4N5UA 4MCYA 3TIDA 2R2CA 1I9EA 1OGAD 1LDPH 4LSRL 4PJAE 5CJXA 3ZE1E 3I6GA 4JCMA 4X6EA 1T0PB 4GMTH 1B0WA 4DN4H 2SEBB 1IAMA 3AVEA 3G6DH 4NQDA 4V2CB 1M71B 1IRAY 3CDFA 5D9SB 3O11A 5FO7A 3VGAC 1AJ7H 1JGVL 3H6JA 3QG6B 4XCCL 4ZSOE 1PX3A 2EE2A 2YBRA 1S9YB 4JEGB 1OP3H 4GAGL 4MQSB 1T1ZB 2IAMD 4KK6D 1UB5A 4NQCA 3BXNB 5KAQG 3H42H 5F7DA 4QO1A 4HJ0D 4LVEA 4CJ0A 2FIKB 3KNBA 4PJ7B 3NIGE 1TQCC 4OD1H 4JLRA 1K4CA 4HUWB 2NXZB 1JHLL 3ULVH 1J1XH 5C3TA 1CFSB 4DFIA 3OB0K 4F9PA 1AXSA 5F8QC 5JORB 3N85L 4R7DB 2XY2A 4JRYD 2C26A 3FQRA 1KT2B 2XZZA 5D9SA 5ELIA 2G9HA 1A7QL 4H8WL 5EOQH 3TN0D 4LNRB 4HEPG 3W39A 1INEH 3MRRB 1G7PA 2CUHA 1HXYB 1JPFB 4OGAD 5ADOL 3ARFA 4BZ1L 5KSBF 1L6XA 5EO0A 1NGQH 5D7IE 3V52L 3LEXA 1PVHA 4C56D 4WIQA 1WZLA 5KSVB 3RPIA 5CSGA 3TN0B 4P46C 3BYTA 3SE8L 4K7FA 5I8EB 2GJJA 3EHBD 4M1GL 2JB6A 1ZWIA 2CQVA 1CXHA 3P4LA 3GSNA 1FO0L 2EDXA 1YEIL 3O3EB 3U30B 5F1SA 3LKNB 4HKXA 3TA3C 1G84A 1U8JB 3GEWB 3STZA 3TT1L 1TJHH 4ZTPH 3TT3H 1FORL 5F72S 2VDMH 4K94L 1U8HA 1FL6A 5K9OB 4OZ4B 4P5KA 2Y5EA 3CCHB 3QXAA 3WNOA 3IDXH 1NMCC 4M48L 1C1EH 3WFEL 4EI5A 2OCFD 4LRIC 1L7IH 4MSWB 2XZCL 1WLHA 4KKBD 3Q5YA 2DMCA 1TCMA 1VEPA 4PY8I 1OAKL 3IFNH 1FFPA 1P4IH 4FMFA 5DUMH 1UB6A 2EYTA 3F58L 4OKVB 4JFFE 4NFDA 5DO2C 1N3NB 3R4DA 3VE0A 1HK6A 1IAOB 5IROC 1U8MA 5A3ID 4AK1A 1I7RA 3NCJL 4IMKA 4XP4H 3VD4A 3MNZA 2YRLA 4MJIB 5C0DA 3DMMB 1OB1A 2FD6L 2CDEB 3JTSB 4XNXH 3CCHA 4NNXA 3BKJL 3KVQA 1LP9A 1P84J 4KROB 4OFIA 4YUEH 3WUZA 5CIPA 2X7LB 3C8KB 2DS4A 1YNTB 3ES6A 3NN8A 5IQ9B 4JRXB 1ZLVH 2JELH 3MLYH 4GAFB 2LU3A 4HBCH 3DMMD 3VRJA 5T1MB 2Q87A 2KKQA 1IT9L 1HWGB 2GJ6B 4ODHL 3RX5A 4KKCD 2DL9A 4FQIL 2A6DB 2VXVL 1I3VA 3DXAE 2FEEL 4YO0A 4CVZB 1BEYL 5AWNL 3VFOB 2NZIA 4LIQH 1VGEL 2X70A 3VMPA 3KYNA 3ARFD 4XXDB 2ZUXA 1SYVB 1OPGL 2ZG2A 1NCDL 3QULB 2R2EB 1KPRA 2VC2H 3MYJB 4O2CB 3UJIH 5DJZB 4JRYA 1M4KA 5EC1A 4FFZH 3FAWA 3T2NL 3MA7A 4M9PA 3U0TB 4JM4H 5HI5C 3L7EB 4G9DB 3LKQA 3FMGH 4HG4J 4AY0A 1K85A 3VG0L 5DWUL 5T3ZD 1B4RA 2EICA 2YZ1A 1XR8B 1YPZE 1D5MB 1JPSL 1ZT4A 3W0WA 2OTWB 5T1LA 3FONB 4DFHA 3G5YA 4APQA 5IK3B 5DSCA 1MCDA 1ZXQA 5ITFB 3P30L 5DEFB 4G42A 5ALCH 3SDXB 1OB1B 4LAQL 3BFOA 3MLVH 3C5ZC 1T5WB 4PJHB 4IHOB 4QXGL 2W91A 3HCVA 4UI2A 1KJMA 5F9WC 3JWOL 4Z7VA 5IVXF 4HGWB 1AQDA 3OL2A 3O6FB 4BQBA 1F4WL 3PWVB 3I6LD 5C7XH 4WY7H 4HD9A 4EI6A 5F1KC 1R0AH 1NFDB 3DO7A 4DEPB 3ESVF 1VFAB 1UXWA 4L8BA 4FRWA 2OM5A 3SCMD 3LEYH 4HX1B 3RJDA 2EE9A 1T7XA 1DBAL 2CUMA 4FQXD 5BV7L 1LHZA 1CVRA 1LO5A 2I07A 3H9YA 3MV7D 1DSFH 4GG6B 2DB8A 4KKNA 2RCSL 5MEOA 4PY7B 1VSCA 5C08A 3JV4B 2BHZA 1RUQL 1QA9B 5KVFL 2EDJA 3FTGB 2BCKB 3VXPA 3VJ6B 3WLBA 5E6IC 4ODVH 2DMKA 4P46D 3ULUF 1OW0A 1NAMH 1YEGL 4POZD 1URLA 1FZKB 3HZMB 1KIPB 5CMAB 2F15A 3SKJH 5KAQF 3B8YA 4GW5A 4NQSA 4QY8B 4OIIL 3NCCB 4X4XA 4I3SL 2JCCE 1CGWA 1IC1A 1ZV5A 3RIAF 3B9KA 2QADC 5JIHA 4XI5D 3LY6A 8FABA 4P46B 5CGTA 1LE9B 3HE6A 1FPTL 1IGTB 2HTLC 4R4ND 4PJFB 3L3IA 4HPYL 4PJ5B 2PYEE 2P7TB 5KVMC 4Y5YC 4DJMA 4HK3J 3S98A 3MRIB 3U30C 1WWCA 1A9BB 3VXPB 3TA3B 1FH5H 3C6SA 4K3EH 3QPXH 3OKOB 2ZWLT 2V5YA 5IJVA 3GSNB 3MUHL 1CGSH 4NQED 1VENA 5E99H 3EO1A 2J12B 3V5HB 1U36A 3MV9B 3QNXA 5CJBA 1IGML 1ZK9A 3U9UB 5E1AB 4G9FE 3VGFA 4NJ9H 1QP1A 4LSPL 5I1CH 1II4E 2WUCH 2CMRL 3KYMB 4I4WB 2X44D 3QUMA 5KBNC 2AJUH 5L2KB 3PDGA 1UZ8A 2PO6B 1FVEA 3L3GA 3HTLX 2ZCHH 1N6QH 3OKLA 1KBGH 2DYPB 1TMCB 2ZUQC 4DW2H 4R7NB 2X9XA 3B9EA 3BWAB 4GFTB 4OM0H 1I1YB 1NUNB 1NBYB 3HNTL 1TIUA 4PRNB 5C9JA 4DAGH 3MLTA 1H0DB 4WWKA 1K2DB 2MHAA 4WFEE 3C87A 2XOTA 5L2JA 3F5WA 5AZEL 3GSQA 3QDGE 4L9LA 1DQDH 5F9JA 5FYLH 1L6ZA 1K8DA 4N0UE 3F6IA 2UWEA 4OD2B 1JNNH 1AO7D 4ZPVB 4Y19E 2A73B 5J1AA 3NACL 1OAXH 2NY1B 1MWAH 1OWRM 3EYFB 4XPFL 1RIVL 5FF6A 3C60D 1CFNB 4DKFH 3AS3A 3ILQD 5JW5A 4AG4H 5DJ8B 3CFBB 3DUHA 5DD1H 3Q0HA 4LGSB 4Z8FL 3ECBA 2YUXA 2DQEH 3QDJA 1XAUA 4OLUL 2IH1B 4HKBB 5GIRB 3FQXB 3GGWB 4GG8B 4OF6A 2AP2A 3C60B 3IJYB 3KAAA 3MBED 3CU1A 3LDBB 4YAQB 4QRRD 4X7FC 5I8CA 3WFDH 4O2CA 3DX6A 1OARL 2VAAA 3KPLB 1B0RB 3P4MA 2ZCLH 3GRWH 2C3VB 4E0RA 1FFOA 3DX9B 1DEDA 2AXJA 4P99A 3MJ9H 1GC1C 4QRSB 4KWUA 3KLHD 5EZLB 4MXWL 5HI3D 3CFJA 5FV1L 4EXPX 1OSPL 4ONFL 3MUZ1 4Z7UE 1JV5B 1HSAB 1DDHB 4GKSB 3WEXB 4YDKH 5HI5D 4FP8L 5IESH 3BT2L 5C0JB 4OUOA 1A4JA 1J05B 4DVRH 1M05A 3PWPA 2GK0A 4LRNL 3DIFB 2FDBP 1TTUA 3RU8L 5LQBH 2QQLL 2FLRT 1LGVA 3SE3A 1YEDB 2W9DH 5TE6H 3UTZB 3UJTL 4BK4A 3BIAX 2BNRD 3C09B 4JFHD 4XAWH 2WIIB 4ZFZA 5FYLD 1AGFB 1U6AL 2HTLD 3FRUB 2DTML 3QEGH 3DPBA 1FC1A 4ZTOL 3VXRB 4OFYD 4QTIH 1TPXC 4OBSA 4IOIB 5L7XL 1AQDB 1BJ1H 1Q9WA 2GJ6A 2HVKA 1JGEA 2H41A 2ATKA 4L8SB 3VGDA 2GCYA 4JHWH 1MJ7L 5FYKU 3UTSB 3E6FB 4JDVA 1KIQB 1ITBB 4F3FA 3QAZC 3U36A 3VXQB 4PJCF 1SBSL 2I9LA 2UUDH 3T1WA 1FSKC 3OKMA 1RURH 1YZZA 5HHNA 4RGOL 4NOFA 4OV5A 1XF3B 3UTSD 4P2RE 4OB5H 3JV0A 1U8OB 5E9DE 1CFQA 2DQTH 3TIEB 2JF1A 4FFWD 1EAPB 1EK3A 3MBEC 3UP1A 1XH3B 2VLJE 1J87A 1FYTA 3BUYA 5DRWB 2DYPA 2IGFL 4YFLI 3TYGH 3MR9B 2VABB 4LLMA 5SX5K 2BC4A 4BH7B 5CJOH 1FZJA 3LKRA 4JFEB 1T5XB 5IHZA 2VH5L 4D2NA 2FATL 5AAWA 3HMXA 3MROB 4FXGB 4NQSB 5IFAL 5GZNC 1CK0L 2EE6A 4JGUA 5E9DB 5CCKL 3HN3A 4XC1L 5ESQA 5TQ0L 2FIRT 2ADFH 1G6RL 3L5JA 3ZDYE 4P9HC 2UWEB 3V2AR 1N0XH 4XC3H 3LIZH 2ZPKL 2F19H 3MRLA 1R3IH 3VXME 4JFED 2EDWA 3QUZC 1N4XL 3GSUB 1MCBA 4EBQL 5JR1H 3MX0A 1HCVA 3HUJA 4U0RC 4ZXBC 1ZSDA 3RVTC 1WTGT 3QXDA 4L8SA 2DQUH 4ELMF 4LEOB 1ZS8B 4D9LH 2WWKO 1BZ7B 5HHXL 4FA8A 1RUML 5D2NE 2Q86B 4Z0BH 3WXVH 4NZRH 3V6FB 5DGRA 2MMXA 4NT6A 1U3HD 2H6PA 4IIQC 1AGFA 3FRUA 4PJFE 5BS0E 2AXHA 3O3BB 5I1GL 4X6EB 4TQEH 2ZUQB 5JTWA 4MGXA 3V4PL 3C5JB 4OZFH 1BAFH 3OGCA 2FBOJ 1YEJL 1QPXA 1ZHNA 4KK8D 4P3CH 1P1ZA 3LQMA 3P0VH 4K23H 4OGZA 1CLYL 4JREC 1BX2B 4QRUB 3MOAL 3B3IA 5T1MA 1NL0H 1O7SA 3BISA 3CFKB 4D0CB 4JKKA 3SGKA 2QJDA 5HDQL 1R5WA 2BVUA 3QDGA 1A9BA 2NW2A 5FYJU 5DXWA 1XCTA 1YC7A 1KCUH 4XPBH 2F54E 4HW6A 5GS1C 3SKOA 2Q1EA 5J12C 1FO0A 3O4LA 2EEBA 2I60H 2QEJA 1FN4A 2Y06H 1YEFL 3CLEH 2VXSL 4F37K 4KKAD 1C12A 4JFQB 2DWEB 5I1LA 5MENA 4OD2A 3UROR 1CYGA 1YN6A 3QNYA 2H2SC 4CMHC 2XNAA 4TSAH 3SDCC 3MRGB 4PJGB 4R3SA 1LK2A 1LNUB 2ZUSA 1I3RB 4IS6B 4X98B 5D2NC 4ZS7L 3H7BB 4OLVH 4KHXH 2AERT 5DUBA 5HHMB 4CW1B 3LRGA 3VRLF 4YHZL 2VABA 1FGNH 2WP3O 3VMNA 4YBQC 4EDXB 2HLFC 4DTGL 4FQQA 2Z4QA 3QI9A 4LCIL 5FUCE 1D5IL 4LK4A 4C57C 5GGSA 4W6XB 2OR9H 5C09E 5FM5M 2VO5A 2P5WB 3DI3B 4LPVA 4PUBL 5HHMD 5JPNB 1J86A 5FUZL 5HI4C 1HINH 3EZJB 1QVOB 3QUXD 3KXFE 3C2SA 5D72H 4CVZA 1MCWW 1H3PL 4N8PA 4ODWA 3QI9D 2AJSL 2WBJA 1X5AA 3ORJA 4NKMA 5GJSL 4OSUH 1HEZA 4I5BA 4RIRB 1ZE3C 4C55A 3L6FB 5GGTH 2CLVA 1AGDA 1IKFL 3N1GC 4G7YH 1NJ9B 3EYSH 1MFCH 4YLQT 4U1GB 3KS0H 4QTHB 2FIKA 3KNBB 5EUOE 2A73A 3KPNB 1JV5A 4GKSA 3PQYE 3J8F7 4PRNA 2CO6B 5C9JB 4LCWD 2IFFL 5DMJB 4Q6IC 3BHBB 4OIBA 3FQWB 5CSBA 3KPRD 2MCPL 2GTZA 2VJXA 2UYLB 1BJ8A 3QQ4B 1HIMH 1QLEL 5K93A 3R8BB 5AYUH 1U8NA 1JTOA 2GK2A 4DGYL 2DLIA 5TJWK 4NZUL 3VXUB 3KPRA 1Z3GL 2BRQA 3FRPA 1NBZB 4K7PX 4U3HA 3VA6A 4NJAH 4V1DA 2JIXA 3OQ3B 5IJKA 1D5ZB 1NLBL 4U1SB 2DIAA 4F33B 5J6HA 2JCCF 3OG4B 2AGJH 3HZYB 3BH8B 3QAZB 5DVOA 5IFJB 3L3GB 1FVEB 4UTBH 1G1CA 4JO4H 3O2DL 1K3ZA 4PJHA 2EXYC 1RZ7L 1FNSH 3ES6B 3NN8B 1AHWA 3IF1B 4FTVA 2XN9A 1XGPA 5EU6D 5FYLE 3EO0B 1UXSB 5K33A 4WTZG 2ORBL 1VPOL 1EXUB 3DARA 1I8MB 5E2WL 3C08L 4IRZL 4KUZL 5C6TL 5HVGB 5HHNB 5H37H 2ZSVA 4RWYL 3SKMA 1WF5A 1DUZB 3B9KB 1WCBA 1NAKL 1QLFB 5FHAL 3OR7A 4LP4A 4WEMB 2EIDA 5EZJA 4PJXB 3BQUC 2V5RA 5EO9A 3P11L 4LLDB 2JJTA 1ZVSA 4M7KH 4A6YL 5IHUL 2H1PH 4I77H 4KMQA 5LAXB 5E08L 3Q2CA 1KGCD 1I3UA 4QRUA 3PWNB 2V2WB 1EJ6A 2HFGH 2VLMD 3B9KD 3CFEA 4PJ8C 5EO0B 3HR6A 4XPGL 1PX4A 4PJDA 3L3JA 1WIPA 1MCPL 3LN9A 4P2RD 4QHLB 2W60B 3QIBD 1N8ZB 1QSVA 1I9JH 4ORZC 3M07A 5D2LF 3O6KH 2VDQL 4NO5A 5JOPD 2MFNA 2WIIA 4ZFZB 1Q9LB 2OJZL 4WO4C 3O2VH 5HYSB 4NNXB 4JN1L 3G5YB 3MACL 3E3QE 2Q3AA 3PJSA 1FIEA 3JVGC 5DJXA 2NXYD 4OJFL 2N56A 4P2RB 4EJ1C 1MCKA 5TH2A 4BQ6A 1MELA 3U0PA 2XA8H 5IQ9A 3RZWA 4YE4H 4CDGC 2B1AH 2HKHH 2HRPL 2ENYA 4LCCA 4NQXA 5CUSL 2LAGB 4HUKB 3GZKA 4NRZA 1SM3H 4NO5B 1DCLA 1IILE 2C1OB 5ILTL 4NO0A 3WJJC 5BS0A 4LCCC 4XNYL 3QUXC 4HEME 1NFDA 2YD4A 3QQ9D 1A6WH 4LOUD 5LBSH 4GS7B 4W6WB 5DMIH 5TE4H 4MD0B 3PP4L 1RZKH 1KTDB 4MD5A 4LLWB 2WW8A 4KQ3H 1I1RA 4NQDE 1AKJA 4UIKH 5EUOB 1EMTH 3I9GL 2VLJB 1DUYB 4MXQD 3MRFB 4HQQH 4ZSOA 1TZIB 3OKOA 4P2QE 3ARQA 1J11A 3JV4A 4OZIB 1CE6B 1OAQH 4UNTA 3CH1A 4AH2A 2LE9A 4JRXA 5GZOD 3ZE1F 1YUHB 2BY0A 5CBAA 4Z18A 4UV7L 4AEHH 1OCWL 1FO0B 3RA7L 3QDHA 1GH7A 2YUWA 3OKNB 1ZHLB 2XN9E 2VLJD 1XGUA 1JZ4A 4XCEA 4QHLA 2WINB 3TPUB 2HFEB 2SEBA 3O3EA 3JTSA 2DKMA 1NBQA 1OM3H 1I75A 1NMAH 2ATPA 1PSKH 1UACL 4L9LB 3RWHA 3FOLB 4WW1A 4XCNA 3V6ZB 3GSVB 5DQJA 4MDJB 4ALAL 1T2QL 3OR6B 2CKBB 2NW3A 5DTFA 2MWCA 1D5ZA 1NCWH 1OF2A 4WU7A 1I9IL 3REWB 2X41A 1NSNL 3MOBH 3MCKA 1WJ3A 4PJAB 5AD0B 4NQUA 1EEZA 4M1DL 3B83A 4R97B 5SWZD 3S36H 3P77B 3E2HC 4H88H 5DLMH 1KLUA 3RP1A 4HSQA 4XWOC 1Z2KA 3FOMB 2O93L 1T0MA 3NZ8B 3KWWB 4K3JL 3SKNB 3G5XA 1T03H 1YQVH 5F7FA 2J5LC 4X6FA 1IC4H 3MCLL 4M7JH 2HJLA 1G7MA 3HC3L 3SKOB 4Z9KB 4U1GC 3X13B 2FB4L 1NDGB 4MJIA 2BSTA 2EIZA 3ULSA 1PBYA 5DD5H 2X1OA 1OQOA 4N8VB 5C09D 5BJTA 2FHBA 4HUXA 4LQFL 4JM2D 2IMMA 3TBVA 3U7YH 2D03H 4NKIL 3T0BA 4HXAH 3JV6B 4UMGA 2R0WH 4TNVF 2IALA 1L7TL 1SBBA 1X5KA 5DVLA 5DVKA 1R5IB 3IYLW 2ESVE 3WN5C 3GJFK 5AZ2H 2F5AL 5IQ7L 2NY6B 4B5EA 4C59B 4CN6A 3NCBB 1NCNA 5I66B 1MFEL 4LSRH 4PJIF 1U8HB 5IBTH 3VCLA 3RWIA 4AYFA 4PJGE 2XPGB 3FQRB 1ED3B 3JUZA 3UDWC 2FGZA 2YPLA 4JQXC 4TULL 5I1IL 5L8LB 3Q1SL 3PWPD 4LQ1A 1P84K 4HH8A 5KN5B 5DQJB 3G5VA 2WBJC 4DN4L 1CGUA 2BOCB 4XBGB 2DN7A 4JQIL 2G2RB 2NY6D 4HUWA 5C6WH 1TJGH 5TE7H 1G6RA 3KLAA 3LN4B 5F44A 1LO2H 4PY7A 5GJTH 4XCFH 3QCVL 4Z7WB 3D0LA 1U8LA 1OAYH 3IS1X 4JHAL 2BNUA 1TENA 2EDEA 1X5JA 3O6MH 1E4KC 4CNIB 3KPOB 4K8RH 2P8PA 4U6XB 5C0DB 2D0FA 2IADA 2PYEB 3O2WH 1G7QB 3M8OL 4DGIL 2A6IA 1MCCA 4C56A 4U3XA 4Y16A 5GGVY 2R2HB 2IBBA 4HC1A 1U91B 1ZHBB 4LGRB 1AGEA 4O02H 5CHNA 5F7EL 3WIIL 2RAMA 4G8EA 4HMCA 2YKLH 1ZOXA 1JF1A 1A7QH 4PJDE 5EOQL 2GY7B 4D0DA 5HYQB 3FTGA 2AW2A 4FQJH 4WENB 4ZO8A 5I75B 1XR9B 2PYED 3TPKA 3KJ4C 3QDMD 5DEZA 4Q74A 1RJZB 3IDYB