1CFTA

Anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated d-peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Polyspecificity
molecule keywords PROTEIN (IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN))
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
total genus 47
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1999-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cftA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cftA01
1MRDH 5C9JB 3P0YH 3LV3B 3DX7B 1RJLB 3O6LL 1LP9F 4YHKH 5E4IA 2NY6B 4JN1L 3NH7H 2R0WH 4URTB 2Z35B 2P5EE 2CDGB 4XCYA 1EGJL 1S5IL 5JDSA 3P2TA 5EPMA 2R2CA 4P0DA 1F6LL 2Q76B 1AXTH 5JQ6L 1S5HA 3DURA 5L8KB 1OP3K 1QFPA 5D6DA 5IFJA 1L9NA 5MENB 5JMOC 4JM4H 3TC9A 1NGYA 2XXMB 4RRPA 3IFPA 1EFXD 3LRHA 1KCKA 4JRYE 5SWZD 3DYOA 4P9MH 1F58L 5CIPB 4YFEA 1LGVA 4I3RH 4P5MA 1CWVA 1T21A 4YDVB 3RJQB 4NM4H 5HYQB 4WUUE 4PRHB 5FKPA 1A7PH 5DVNA 1PX3A 1Q94B 3QNZA 3S88L 1BX2A 2W9LA 3NBNA 3HLAB 4JY6B 5EB9A 2RR3A 2YA0A 1RZIB 4P3CH 2A9MH 1UM4L 2ILLA 4OBRA 3KWWB 5ICXB 5IIEB 5TF0A 4K9EH 5DJZA 2D31B 4Y5YA 2FZ3A 3P4NA 4U6HA 5DHVA 3HPJB 2UWEB 4NKIH 4PJGA 3LS5L 3C9NB 4FQIH 3TBYB 4NRYB 5CBAA 4OZFG 3LKOB 4NOFA 1NDGA 4I0PD 4FQXA 1K5NB 2FX8L 2VLRA 4M02A 3OB0K 3ARGC 4XB8A 1QOKA 5F7MC 3ZKMC 2BJMH 1RZKC 4HLJA 2DKSA 4LCYB 3WJJA 5I15L 2FRGP 5B8CA 1F8TL 5CP3H 2R8SH 1ORQA 3VG9B 2WIMA 3B43A 2BFVH 5DHYB 1R5VA 2J5LB 1KBGL 3W0WE 3QBTB 1GC1H 2MFNA 5AD0B 2WINB 3Q0HA 1A64A 1XIWA 1ORSA 2GT9B 3T4YA 3U48A 2ZCHH 3AREB 2EDNA 1MRCH 1U92B 4PJHB 1SHMA 1FPTH 3IDIA 2AEIT 4AT6A 1BOGA 4V2CB 3SDCD 4RX4A 2FHFA 1A47A 4X6EA 2VQ1A 1IM9A 3BKJH 4NKDA 2X9WA 1YYML 1VKXB 1OAZH 2ZOLB 1YEEL 4P4RB 4XVSH 4TNVF 3RTQA 4KJWD 1ZOXA 3M45A 3DROB 5DA0B 5E8DL 5DWUH 4RIRB 2EE6A 4G8EB 3TBWA 4NUJA 2FR4B 3FQRA 3VFRA 4L4TD 5BZDB 3LZFL 1UZ8A 1PZ5A 4JFXA 1BFSA 4HFUL 1Z9SA 5D1XD 2H2PC 3V5DB 5HGAB 4ORZC 4DFIA 5C09D 5I30L 5SV4A 4IJ3B 3CFJB 5E9DD 2JJSC 1YDPB 2NXYC 4XVTH 1QSZA 5F9DC 4PLOB 1UXSB 2OL3L 2R39A 3MCKB 5TDPB 4M62H 4PV9A 7FABH 5H94A 4ETYA 5J57B 1LD9A 5CWSA 1P9MA 1TIUA 1ZKAA 4Q97A 2ESVD 2HVJA 3MOBL 4P2RE 3HUJF 2IFFH 4P23B 1G9MH 2V5YA 1OAXL 3VXMB 1NDMB 4LOUD 5K9OA 2X4PB 3OSKA 2GCYA 1VACB 1QSEE 3ULUE 2E7LA 3BKCH 4HS3B 3DYPA 4PG2C 5EOCJ 3BH9A 1C16A 3QXDB 3U4EB 2CDEA 1BGXH 3QCUH 3X13A 1T4KA 2N4IA 5C0CB 2AJ3B 5J13B 1A2YB 5M95B 1JGUH 3VXTA 4UTAH 3FONB 1NL0H 3SDXB 4I3GA 5D1ZB 5CBEA 3RZCC 2MNUA 5C6PB 3GSXB 3X14B 3TIEA 4YXKH 5EC1A 2NMSA 5MEPA 3BQUB 3NCCB 3U82B 1MAMH 3GJFK 1XGYL 1T22B 4PBVC 4RQQB 3W5NA 1KPVA 1TJIH 2A2QT 3MXWL 5CZVL 3AS0A 3EW3B 1CCZA 1RUMH 2DMCA 4U0QB 2I9LA 2XPGA 4GLRI 4Z7UE 3QXWA 4NBYB 5I1IH 3BFOA 3NCYS 4CW1B 2BNRA 3LAFA 4JR9L 3HE7C 4L4VD 1VFOA 1A6PA 4JPWH 1NCUA 2P46B 3NGBB 2NY0B 3QPXH 4FOMA 5E8PB 1Z0MA 2A74B 3WHE0 2NX5E 3MTRA 5L0QC 1UYWL 1H8OA 1E4WH 4XHJD 3HMXL 5IFAH 5CD3A 2OR7A 4XMPL 4QXUH 4UT6H 4C83A 3LOWA 1P69B 2DI8A 4MA1C 1N0XL 1PKOA 5DUPL 1MI5E 2EDEA 4NFCA 1MLCA 4I18B 2YXFA 3EJZC 3T0EB 4L5FH 4WHYG 3FB5B 5JOFA 5KVGL 3OKNA 1QA9B 2Z31B 5CLTA 2VIRA 3RUGB 3OF6A 3K8LA 1QPXA 5GIRA 3EYQD 4P9HH 1LK3H 1J1XL 4D8PA 5D5MB 3MLRH 4J1UB 3VD3A 4X7SH 2R0ZL 5KTEL 3G5YA 1VFBB 1HHGB 3O4LA 4UZGA 4GH7B 5EDXA 2XNAB 3ARBC 3GMOB 3N85H 2WNGA 35C8L 3ZL4H 4HH9A 4U1GC 3KPRA 3SGJC 3ESVF 1WFUA 1S9XB 1D5XB 4D3CH 3EFDL 3MRFB 5C0JA 4PJ8D 3U7YL 1WF5A 3QI9D 2AKRA 2FX9H 4GAYB 1MELA 4XPBL 4NC0B 3V5KB 4NQDA 2DDQL 3QXAB 4Y2DB 1I8MA 5JIKA 4ONHB 1UH4A 1XF3A 4HDIA 1ADQH 3S35X 5DRNA 3V4UL 4KI5E 4Y4KB 2DWDA 4WWKB 2WM0A 4PREA 2VZ1A 5C8JB 4CADA 4YHYC 5DS8A 1AGBA 4HSQA 3OGCA 1YYLH 2P7TA 3F62A 1D5ZB 3JV0A 1ED3A 5TQ2H 4JFPB 2XZQL 4MVBD 4GXUN 3KHQA 1DQLH 4MD5B 5KS9B 3T1FA 1FNHA 3W9DB 3RAJL 1FYTA 5IW3A 3GMMB 3VDAA 4ZFZA 2L4OA 4YHLH 3D25B 2ADJA 2ARWA 2X7LB 3MLXH 4FQ2H 2IALA 1F11B 1IM3A 3H9ZA 5HGDB 4CBPA 1YEKH 2QSTA 5DA4A 3UJTH 4HKXA 1E6JH 3CK0L 1BQUA 3WV0A 4E5XA 2V7NB 4U1LB 2DJ4A 4JDZA 4ZD3H 4JHAL 5GGVL 4I4WB 3GNML 3R1GH 5DJ6B 4RBPH 1IILE 5ISZA 5INCB 4J4PD 4ETQB 3O3BB 3D9AH 5F7LB 5GJTL 4DWHA 4Q6IC 2P44B 5KSVA 2Y5TB 4NPYB 3QUMH 4WHTA 2EDYA 4KZDH 3GSNH 4ODXB 4JHWL 2O61B 1LO5B 1E0OB 1MUJA 2QQKL 5D7LA 5D96B 1MCWM 1LWRA 1A4JB 1X4XA 3D69B 1J11A 5IW6B 3BSZL 1S78C 2CKBA 3VGDA 5SWSD 5KVMC 3BZ4B 4PGEA 2OI9B 3IDNB 2GJ6E 3QZWA 1U58B 1FLRL 1II4E 3ARGA 1QQDB 3QEHA 3VWKB 1RIUL 5FYKE 1J0IA 3LPGA 4WW2A 2FB4H 3QUZD 1ZVSA 4H88L 5I1CH 4QF1A 4JZOA 4OF5A 4AL8H 2JELL 1U9KA 5J6GA 1FVCA 4JJ5A 4X4YB 3IDXH 1SMOA 1HKLH 3BDBA 3T4AB 4XTRD 3PQYD 5A3ID 1KEGL 4JAMB 2YWYA 2HYMA 4WI7A 5C3TA 3OKMA 1PY4A 3PGFL 3B8YA 3SKOB 4Z7UF 5IB1A 3HI5H 4WU5B 3NAAL 3OR6A 5EU7C 4MQTB 2ATKA 4MXVE 4FFZL 1PG7L 4U6TA 2CXGA 2H41A 1DQJA 3QRFM 4JFED 5JHDA 4OFKA 2H26B 2VLKA 5C0FB 4OCRL 1UM6H 1SEQL 5FUZL 3UROR 2DL2A 1A3LH 1ZLVH 1EAJA 1EO5A 4PPTA 2Q8AL 4PS4H 4WTXA 1FZMB 4WFFD 5JW3H 2PO6B 1ZLSL 4WI2A 4DUXA 2J8UE 2PYFA 1A6TA 1EMTH 4P48A 1I7TB 4WFED 2ENYA 4G6ML 4CDHA 1XZ0B 4OCMC 5D2LE 2AJYL 3MV8D 3IFOA 1DBAL 5FYKH 2O93L 5DK2B 4M7KH 1AKJD 3L7FB 2JJSA 4R4NC 2R69H 1IBGH 4R6UA 1NGXA 4L29A 1OGTA 4X4XB 4M5YH 1G7LA 2R56H 1OT2A 1NJ9B 5TFSL 4R7DB 4G8GE 5B4MC 4QRPA 2C1PA 4NJAL 3FQWB 1YJDC 4OF3A 1NEZA 2L0DA 2W9EL 2X6MA 1X4YA 4NQXB 2IJ0C 1CFSA 4PG2A 4PR5B 4LNVA 4WI5A 4H1LG 4LSSH 4ZOCA 4F7MB 2BSTA 5A2KH 4UQ3A 4OZ4A 3WIIL 1VERA 4LKCB 1Q9OA 2CLZB 3WLWD 2IPTH 5I74B 3V8CA 1GGCL 2NTFA 4KUZH 5LJYH 2R0LH 1TPXC 5KVDL 3VH8A 3VMOA 1WBXB 2HT4D 1UA6H 1JHLL 4M00A 1DEDA 5M7QA 4MJ2A 4LIQL 3RZCA 2G75B 3F6LA 4KI5F 3IB4A 2AJUL 5DD0L 4M9OA 5I19L 4EN3B 1EHLL 5CLWA 2HA1A 2BY0A 3UJJH 1REIA 2D4DA 5DLMH 4OGXL 4ZODA 2OJEB 3IDGB 4PJEA 4OLZH 1RZGB 1R24A 3CFBB 1UQSA 2UZIH 1HN1A 1VSCA 4XX1E 4EVNB 4XNZB 5KAQF 4WI8A 4D0DB 3FAWA 4NQUA 1EA9C 3HE7A 2J4WH 1KB9K 4KK8D 4UI2A 2IH1B 3DGGB 4HX1B 4GQ9H 1NQBA 1PQZB 4OJFL 4YUEL 2FSEB 2PKDA 1IKNC 3HI6H 1D5MA 3MNVB 5I1KL 1QRKA 4NRXB 2FO4A 1KIUA 4NDMB 1CU4L 1CGYA 4Y5VB 1P1ZA 1EAPA 2I07A 2WQRA 4G9FA 3TCLA 3WNPA 3QUYD 4XHQA 2XKNA 5FGCB 5B22A 4YHML 4LNRA 1FG2B 4JB9L 4HWEH 1HQRB 5GS1A 1N26A 5J56B 3KLAA 1GZQB 2ZPKL 4AMKL 1X5HA 5IROC 4JFFB 1FFNA 1DUZA 3HZMA 3HG1D 2XA3A 4N0UE 5IQ7H 2VDQH 3D6GA 3L3DA 2HFFB 1CIDA 1R5IA 3PXHA 4O2FB 4F8TA 4I77L 4XP4H 4R90H 4QWWD 1KLGB 4EIGB 3S34L 4PJ5B 4ZG1A 5JORA 4AM0A 1T0MA 1HYRC 3ARBA 3X3GH 4JRXA 3QIWC 3VU2A 1EUTA 3QIBA 2BXYA 4HIEA 4S0TD 3SGJA 3BDXA 4BSVA 5EU6B 1WCBA 4XNQB 3BP6A 4HZLA 4PRIA 5EZLA 5IEHA 1OGAB 3D0LA 4Y8AA 3KYMB 2UY6A 2VXQH 4JM2B 4Q9CA 3P73B 1AXSA 2IANA 3GM0A 4LHUA 3IRPX 1HZHH 1FSKC 5DVKA 4MXVF 3LKNB 1CXHA 3TYFB 3FZUD 3PJSB 5EC2B 4NN6B 5E1HB 4ZFFB 3KPMB 2PYEA 3LDBC 2IH3B 3QUKA 4JKWA 4Z7VA 1T2QL 1MIEH 1NBVH 2EXWD 4XNYL 1A6WH 1DBKL 3DX8A 3HRZA 1F3DJ 3QJHB 3RHWF 1QO3B 2XWJB 4DVBA 3RNKA 3V4VH 3MRNB 4KZEL 1G6RH 4FTVA 1JNNH 3TGXA 3DO7B 4PBWD 1N8ZB 2FH6A 1FFOA 3E2HB 3QJFA 4X6FB 5D93B 4JHZA 2V9RA 1NBZB 2J8UF 2RFXB 1U8OB 3A6BH 3G6DL 3GSWB 5CEZL 5DMKB 5FO7B 2QTEA 1BZ9B 2ERJC 4NNPH 3MJ8B 1T1YA 4R2GB 4Y1AE 4JFHD 4JFDD 2P5EB 4PJ7F 1W72H 5FUCC 1S9WA 4PY8I 4FXLA 1UJ3C 5IM7A 4MAYC 3HAEG 4M61B 4GS7C 1RUPH 2ATPA 3GB7A 4DKEH 1DBML 3CPLA 4NQEE 5HI3C 3SDCC 1FBIH 4CVUA 4PRNB 2BSSB 2YUXA 1KJ2L 4M6MH 4X99B 4I48A 4UINH 1YY9D 4TUKH 4KJWC 1X6NA 2BHYA 2Q8BL 4UOJA 4XBPA 2AERT 4BH8A 3BP4B 3CXDL 2YPLE 1MCHA 1CLCA 1FN4A 3K2UL 4Q6IA 2PCPA 1WBYA 3PDGA 1EEZB 5D8JH 3MBXH 5EN2A 3MRCB 4PJBA 2XIDA 4GRMA 3F7RA 4HIIB 4LAQL 5D1XC 4WUUB 2H8PB 5BOPA 4UU9A 1F02I 4PJCA 5GXBB 4KJPD 4K8RD 4Y5XB 5LWYH 3UTTE 1TXKA 1RD6A 4RWHA 3BDYL 1S3KH 1C5DA 5EIQA 4MCYB 5FYLL 2AK4B 1UADC 3P40A 3F7VA 3PWPE 5DVOA 2QR0A 4R7NA 5GGUA 2Q6WA 1E4KA 4M5ZH 3S36H 1YUHA 2VABA 1NMBL 5GGRB 3O6LH 4LOUC 2P8LB 43CAA 1G1YA 4XVJL 2V2WB 3QDMA 4MHHI 5IBLD 1KIQB 3S4SG 1YEHL 4V1DD 1S5IH 2HVKA 3ECBB 4O9HL 4U33A 3JV6B 3E6FB 5GRVK 4AENB 2F54A 1W0WB 2VDKL 5JQ6H 4MWFA 1QRND 4Y19D 2COQA 4MXQD 3JBG7 4UUJA 1YMMD 3W0WB 4GFTB 3G5ZA 4X8JB 1HHKA 3EGSB 1Z0NA 1CE1L 5BZWB 2PTVA 1GXEA 4LASL 4J8RA 3PNWB 5F88B 5KOVC 3HCVA 2XYCA 2BSRA 5GISH 1EXUB 4BH7B 1N6QL 3GO1L 4NQCE 4O2EA 3AAZA 4M48L 3S88H 2ARJA 3DVGB 5GJSL 4L3EE 2R0KL 4NC1E 1A1OA 5LQBL 3I2CL 5D7IE 3MRBA 3OHXB 1UM4H 1HOCB 3TF7C 1T20B 1AGEA 3AUVA 4N1CA 5IW1A 3MRDA 5FHBH 5TE4L 4QHNB 3BKYL 3BPOC 5CGTA 3TPUB 2IC2A 1A1MA 3LS5H 2A9NL 3ESUF 2CDFB 2AAVA 4HUUB 2IAMA 4HMEA 3FO9A 3VXRA 2IG2H 1Q9KA 4LCCB 1KSRA 2FX8H 1G7PB 5SWQB 2QQQA 1JZ4A 3V0VA 1BEYL 1I1YA 3TH4T 4OD1L 4TUJB 3S37L 5I15H 1TLKA 1F8TH 2QADD 5DURD 4Y4HD 4X6DA 1HEZA 2ZUQC 4QXWA 1UT9A 2JB6A 1KBGH 4U6VL 3EYQC 3TESA 4LEOB 3DYMA 5EOTA 3MA7B 2R9HD 5E5MA 3GRWL 1QSEB 3PWNB 3O8XB 3SDAB 3HNSL 2FIKA 3OKLB 2R2HA 3U6RA 1G7IA 3KPSE 4GKOA 3RWHB 4AK1A 1EBPA 1DANT 1YYMH 1YEEH 2J7LA 2VKWA 5T1LA 3MNZA 1K6QL 4PTUB 5FCUH 3GUTB 5E8DH 5CJOL 2NNAA 3UYOD 4PJ8C 3WCYA 1RZJC 2H32H 3FRUA 2AJVL 2VRAA 3WS6A 1UH3A 3X12B 1INEL 1Z9LA 3LZFH 2F19L 5GGRY 2MPAL 2WBJD 2DMBA 3H7BB 3ZTJG 4HV8B 1IKNA 1GZPB 1WIOA 4HFUH 4IRSD 4HUVA 4Q9QH 1XCQA 3QRGL 1QR1B 1SJEB 4O51B 3WNKA 1MCPL 3GSQA 2YKLH 5TF1L 4OLUL 4H26B 5J11C 3UTSE 2X2YA 2EECA 1SQ2N 3CLEH 2YZ8A 3OKDA 5E00A 4YHPA 1CGUA 1J1OL 1PYWB 2BRQA 1QLRA 4NUGH 4Z7UB 2PR4L 1R3KA 3IXAB 1QHOA 2W60A 2ZUVA 3C5JA 5AG8A 4XNMA 4L8BA 2IBBA 1TQBB 3KG5A 4Y4FD 4MVBC 5DJ8B 4CRPA 2YPKB 3LEVL 4QRRE 4LSUL 3MOBH 2NY6D 1BIHA 2NX5B 4JVWA 5HHME 1BQHA 2JIXA 5CEYB 2HJLB 5T3XH 3K1KC 4RFEB 3H3PL 4KXZH 1MI5B 2KL6A 3G04B 4G6JL 5DJAA 3KJ6L 2VAAB 5DT1L 3QIWA 4LVNB 4DZBB 4HC1A 2A83A 3HI1B 4ELMA 3FHAA 4C56A 5MEND 1TZGL 5F6IC 3MUHL 1G1CA 4P3DA 5BVJB 5MEOA 1ZSDB 4J4PC 4PGCA 4LLWA 2X4SA 1RZFL 1I7RB 1PDKA 3RWIB 1G9NC 1MH5B 5GS3A 3KLHC 1KCSL 3I84A 2DLTA 1XGYH 2MOVA 1IMHC 1BD2E 3L95A 5C0DA 3BWAA 4AH2B 3MXWH 5CZVH 5FO9A 5ESVA 3FHQA 1MHHB 3QUZC 1CF8H 3T8XB 3TA3C 4AYFA 3MJ9A 3LD8C 3VXNA 4OZGA 3T0DA 3ARZA 4JR9H 1R6VA 3M17B 1NKRA 3MV7A 3N0PB 2HFTA 2ZG3A 1X3DA 4DFHA 2ZG2A 3G08B 3N1QC 4XTRC 5A3IC 5TDOB 1M7IB 5A16A 4OF8A 3SKNB 3GSNB 1UYWH 2EEAA 3HMXH 1RULL 1UJ3A 3BPCB 4MAYA 1MHEA 1U8MB 4XMPH 3DMMD 3ALPA 3L9RB 3VFPB 4HS6B 5ENWA 1N0XH 4G43A 3KVQA 5KVFH 5C0BD 1WIPA 3RBGA 1KFAL 1W8OA 5MI0C 2NY5C 1FL6A 3U9PL 4TOYL 5KVGH 3D1MC 1S7TB 2NY3B 1INDL 1RJCA 2YN5A 4L4TA 5IJVA 4X7EC 2PTTA 1J1XH 4U6YA 2V2TA 4UOW1 5F93C 3QQ3B 2FO1A 5C0IA 2R0ZH 1HI6A 5KTEH 5D1XA 3REWB 3H9SD 4C57C 4GRLB 4U1NB 2V9TA 4KY1L 3ZHLA 3PP3K 4PRPD 5F89A 5DC4B 2GUOA 2MHAA 2X10A 1KC5L 2QKIA 3HTLX 4GAGL 5ACZA 35C8H 5D1QB 5DD1L 2Y9RT 1OD9A 3NACL 3EFDH 4IMLB 5L9DL 3U7YH 3IJYB 4QO1A 4XPBH 2F58L 1F3DH 2DDQH 5B3NA 3PGDB 3C87A 4PJDA 3CFKA 4H1LH 4NRZB 5FDWA 3Q6FA 3DXAA 4KMQA 5FKAB 1S9VB 3UMTA 1NLDL 1WLHA 2GJ6B 1ND0B 3V4UH 3HS0A 4X8XA 1DDHB 2B39A 5MHSD 4YAQA 4NSKB 1OAUL 4NZDA 3FQNA 4QXGL 3WLWC 5EUKA 3IF1B 4PJ9B 1JUFA 2YD6A 4JN2A 3NPSC 2IWGA 2HT4C 1IAMA 2XZQH 5JMRA 4ZPVA 1IAOB 1OSZB 3MROB 3RAJH 2EDJA 2D2OA 1T7WA 1ERNA 3LPWA 1S7VB 1BVKA 2P45B 3C8KA 4NHUB 4DEPB 1I9IL 2APBA 4WDIB 2AQ2A 5C0CD 1AR2A 3CK0H 2FJFB 1HNFA 3O11A 3FTGB 1JK8A 3RNQB 5E2TL 4EKXA 2W38A 5JLZA 2CRMA 4JHAH 3BVNB 1ITCA 3MXVH 1BFVL 1MWAL 2CR6A 5DJYB 3GNMH 5D1ZD 4YDJA 4F2MB 5J1AA 2ZUXA 2CKBL 4KROB 4L4VA 2DQCL 1Y6MR 2B8OT 5E7BA 4H8WC 3SO5A 3BQUD 3P3YA 2J8UB 1RZKL 4LLYA 1DSFL 3QG6A 4JHWH 5D2LB 3TBSB 1YPZA 2QQKH 3EO9L 5IF0B 3U0TB 3GMNA 3BSZH 1U6AL 3HHRB 4PJXF 3QUYC 5T33L 3SKMA 1FLRH 1H3XA 4KJQD 1R3LB 2HT3C 2W07A 1RIUH 1A6AB 3OB8A 3FB7A 1LDSA 5KANG 4H88H 2BVOA 3CLFL 4JFZL 5ILTL 2ZSVB 4NO2B 4ZAKD 3WNNA 2JELH 1UCBL 1S7RB 3NCFB 4G8GB 3IKKA 3BIKA 2DM2A 2YN3A 1U3HB 4ZUUB 2NY0D 1CGVA 1KEGH 1I75A 3JZ7A 4FXKA 3LEXA 2X1XR 4ERSL 3WHXB 4QWWC 3PGFH 2APFA 4WFGD 2VZ3A 2XICA 3ILPB 4FFZH 1PG7H 4EDWL 5EOQL 3VD7A 4UV4L 2HG5B 3U7WL 5H35B 4OCRH 5BRZA 1SEQH 2G5BB 4PJ8A 2OJZL 1FCGA 1LHZA 2Q8AH 2H9GB 3QB7C 1F4WL 3I75B 2D9QB 3N06B 2LAAA 5EWIL 4BZYA 3K74B 4BFEA 1ZLSH 3CC5A 4LIQE 3TBTB 4MSWA 2PW1A 2A6KB 4J2XA 1RZ8B 1EDQA 3FZUC 2W65A 2VO5A 4G6MH 5HD8C 1YN7B 2AJYH 1DBAH 2EXWC 2O26U 2Z8RA 4O2CB 1KB5L 5F3BB 1T5WB 1JF6A 2EYSA 3VE0A 2AJZB 2Q7YB 2DQUL 4OZFB 5IMKB 5TFSH 3VFMB 5DD6A 4HPOH 5C0EA 4YK4C 3HAEH 1X5FA 4DCQB 1IEBA 2JLLA 5J7CC 2HFEB 1LE5A 5L2KE 1X6LA 4NJAH 1YEDB 4HUWB 5GQBA 4Y4KD 3LKSB 4WWKD 1N59A 1VGKB 2W9EH 5EA0H 2UYLB 1M6OB 2JB5L 5FOBA 3IFNL 4X6BA 5GSVA 5I1AA 2X4QB 2XN9D 3PWVA 1FNLA 3BH8A 2BMKA 3WIIH 4QRSA 4PRDA 2WV3A 1G6RB 5D7KD 3WFCL 3EYUH 3DV6B 1GGCH 2RHEA 2BVTA 3QP3A 4N0UB 4H5SB 5KVDH 1K4DA 1PLGL 3P9WB 1JHLH 3MA9L 2C3VB 3CAFA 4LIQH 4HQQL 5MEQB 2X4OB 1RFDL 5DD0H 2AJUH 5I19H 3MJ7B 1Q9LA 1EHLH 2UUDH 2IQ9L 2YRZA 3CX5K 3IU3B 3MRRB 4M7ZB 5EO0A 5HJ3A 1SVCP 4OFPA 1U8HA 4QXTB 5HVHC 1W72B 4OGXH 4POUB 2N1KA 2W91A 4BK5A 1FLTX 1TVBB 1IAIM 3VXPA 1P4IL 4M4RA 5SWSA 5E95B 9CGTA 4YZFF 2VUOA 4LLVA 1VESA 1UH2A 1UZ6E 4K8RC 5D72L 3O9WD 1J18A 1P84K 5C92A 3QUZA 1G7HA 3WBDA 3TA3A 4LGRB 1Z5LB 3KXFE 5IQ9A 2Y36L 2FL5B 4MNGB 2FGWL 5K9KB 3NN8B 1ZT1B 3STZA 2XG5A 3PQYA 5FGRA 4NN5B 4DGVH 4OJFH 4YUEH 2ZUWA 5I1KH 2CMRL 1BPVA 4Z7WA 1CU4H 1XF2A 1EZVY 5EO9A 4DKFL 5DVMA 1XGPB 5KG9A 3ZSTA 5I0ZA 1JZ8A 4KGJA 4XPHL 3RGHA 4YHMH 4O58L 1QBLL 4JB9H 4LKXB 4MB3A 4UIKL 5C0AE 2XTJE 4RGMC 1P7QD 2J88L 2ZPKH 4KUCF 1QSFD 3QO0A 4MXQC 1LEGB 4WGVB 3ARDB 5IB3B 2GK0A 4KHTL 4K94C 4Y1AB 5DEGB 3EOAA 1AQKL 1N6UA 5CEZE 1JTPA 4PJFF 3L3GB 5CJXC 3WS3B 1V8HA 3BD5A 3HPLA 4I77H 3NFNA 4NO5A 4GW5B 4CAGA 4NQEB 1OTUD 1XH3B 1PSKL 4PTTB 3MV8A 4Z0BL 3UTPD 3MGTB 4Z6AT 1AKJA 1LNUB 2VXVL 3FB8A 4KQ3L 5F21B 5F7WC 3IU4L 3C08L 2LVCA 1M05A 5DSCA 3CU1A 4HK0B 5ELIA 3BIBX 3HZKA 1G7JA 4TULL 1AP2A 2YPLB 1ULVA 4UT9L 3O4OC 4K3DL 5B38G 3VFTA 2DQFB 2AEQL 5FV1L 1WBZA 4YHZL 3ZTNL 3MFFA 2OXHA 4GW1B 5I75B 3IRZA 4AIZB 2FBJL 5BXFB 1T2QH 1HSBB 4CN6A 2V6HA 1Q0XL 5IMMA 1DBKH 5HHQB 3UTTB 3GHEL 3EDFA 5IMLB 3H3KA 4IS6B 3LQZA 3KYOB 4KZEH 1OWWA 3AU1B 3QNXA 4CU8A 3ELAT 3RVWD 3OJ2C 1IZKA 4Y4HC 3R06A 3EYVB 3PWPB 3G6DH 2CIKA 3WUWG 2C5DC 5CEZH 3G6AA 4LPCA 3FJTA 5C0ND 1YMHA 2R9HC 2CK0L 3JWDC 3KNBB 5F1SA 3KPLA 1UM5L 3V52L 2AV1B 3A0OA 4ZUWB 1DBMH 2D7QA 1K4CA 4B5EA 1D6EA 5TE6L 4KHXL 4L1DA 1ZGLA 1KJ2H 4G9DB 3AY4C 3PHQA 3VH8G 3ZTJH 2VDOL 2Q8BH 1N5AA 3CDGA 4N9GA 3CXDH 1PKQE 2WIIB 2FBOJ 3RDTD 3K2UH 1NCNA 4GBXD 3AS3A 4X9FA 1G6VK 2HJKB 5BS0D 2AV7A 1F97A 1FZOB 2WBJC 5HYSA 2BNQD 4IRSC 5E08L 5IMOB 1BBDL 3UTQB 4MJIE 3J7HA 1QEWB 1J0YA 4LAQH 4AEIH 3G6JF 4X7TA 2O5XL 1JI1A 4LDLB 4ZPTA 4NQCB 3ULSA 1S7UA 4L9DA 4L3EB 1X7QA 2F53E 5D7IB 4K55A 3MV9B 2FLRT 1T80A 3BDYH 4PJGE 4TTDD 4ZUSA 1ZGLM 1YECL 4G3YL 2D03L 3ZKQD 5FYLH 5BO1L 2DQJL 1NKOA 1H8NA 2H32B 3H0TB 4Y4FC 4I2XE 4WFHE 3JWOL 43C9A 1CD9B 3UJIL 3HG1A 4HUNB 3STLB 1RK0A 5K93A 2NY6C 1X44A 1CFTB 1NMBH 2YBRB 1TCRA 1UZ6F 5DMGD 2F8OA 4IDJL 1T1ZB 4GG6A 4XVJH 1DBBL 4JKMA 3QAZC 5HPMB 4HGWB 1YEHH 2QLVB 5I1GL 4E42A 3GSRA 4P2CG 4O9HH 2P8MB 2ZUUA 2BY3A 4LLUA 3L3KB 3PL6D 5F6HJ 2I9TA 1GGUA 1J8HD 2OL3B 5INDA 3L5HA 3K4AA 5SX4I 1VADB 1T5XB 4YEFA 5HGBA 5DR5L 4E0RB 1X5KA 3TWCL 3HC3L 5ECJE 3FFDB 1IGTA 3QH3A 4PJIF 1H0DB 2XXCB 1CE1H 4G80A 4M03A 2VNCA 3BW9A 4FQHB 3FT3B 2NW3A 4MQXC 2RBLA 1VGEL 2Y7QB 2EH7L 1N6QH 3T65A 3GO1H 4DGYL 4M48H 4N90E 5EU6D 5GJSH 1YJDL 2R0KH 2E3VA 3DBXB 2EDKA 5GHWL 5LQBH 3I2CH 4N8VA 1R5WB 3ZKSD 3VGEA 4YFDB 2VSDA 3LRGA 4U1HB 5TE4H 4L3CB 2R23B 2DWEA 2EICA 3EHBD 1U8IA 1BVLB 3V8OA 2A9NH 2Z0BA 2OYPA 3RWGA 4XT1C 1ZTXL 2ICES 1IL1A 3TVMB 5C0GB 1E28A 5DYOA 1JGEA 4XCEB 3UTSB 1C1EL 4FQCL 1OHQA 4J3XA 5IHZA 1I3GL 1ZWIA 3QUXB 1BEYH 4GKNA 5E94A 3CMOL 3EO1B 3MGOA 4OD1H 1A9EB 4BZ2L 3S37H 3E6HA 4GSDL 3CFCL 2MQCA 3PWLB 4QRRB 3VXUE 5EBMA 2E8ZA 5HHMB 1SEBB 2HJFA 3AREC 3QIUB 1LDPL 3GRWH 1IKFL 4OKVA 3QFDB 1CD1B 3MODL 4JLRA 4KXZI 3HNSH 1QP1A 3G5VA 5I8EA 3PV6A 2CRYA 1BF8A 5L8JB 1I8LA 1SY6L 1M71A 4EEEA 3CDYA 3TJHC 3L3OB 1NUNB 5CJOH 2RQ8A 1AJ7L 4F7PB 2AJVH 2WWKO 1H15B 4CU7A 1HK6A 1FFQA 1OF2B 2P5WA 1RK1A 5F1OB 3RIAK 2F19H 5EUOA 6CGTA 1XF4A 4QY8B 3BMWA 1BD2B 4UQ2A 2EEDA 3QDJE 1MCPH 4IJ3C 5HDLA 5TF1H 1LEIA 4OLUH 1BFOB 1JHTA 4UB0L 1CDCA 2ZWLT 4V1DA 1N3NB 3T04D 1HH6B 1J1OH 2GSIA 2PR4H 4D9LL 1ZGLP 1UKQA 2AS5M 2AK4D 4GW4B 1QRNA 4Y19A 4U1IA 5H2BA 2NY7L 1YMMA 1HSAA 3RWDA 3LEVH 3GMQB 4LSUH 3RVTD 3L5JA 4H1LB 4HJGA 1LILA 1HIML 3KPPB 4HC1L 1MCSA 5H37G 5CJXA 2MKWA 3BMVA 5FB8B 1BJ1H 3LIZL 2NY1B 4PLNC 4PJGF 4DUWA 3WO4B 3B83A 4WWID 3KJ6H 4WY7L 5DT1H 1D6VL 3HFML 3UXFA 4WO4B 5D1ZC 3W0WD 1U91B 1OD7A 4N0YL 3IKCA 1X5LA 3O2DL 4KV5E 2F74A 1XGRB 3B9KB 3O4LE 4X9IA 1T83C 3O6FD 3BQUC 5TJWK 2BOCB 1RZFH 4PBXA 1I8IA 3INUL 3M1BB 1A7BA 2YA2A 1XR8A 1KCSH 1PW3A 3MJ9L 3QWOB 1JWSB 1FV1A 5E8EA 5KZCD 4NQVA 3T1WA 1IGCL 5ADOL 4HJ0D 2NPLX 3TO4B 3K2MC 4EUPA 4XP9L 4KJQC 4NQDE 3VI3E 1FFRA 2RIKA 2VR4A 2JK5A 5BQ7B 3ULVC 4ZAKC 2X4NA 1L7IL 4K23L 2VLJD 2UVEA 4PRBA 2OZ4A 4ZYKA 3VJ6A 5GS0D 2C3XA 3GI8L 5SV3A 4KRPB 2NY0C 3DVNA 1EJ6A 1CXKA 2X70A 1I7ZA 4Z7OE 4QTHA 3CCHA 1TENA 2Y6SD 3TV3L 3U2SB 5ICYB 4K7PH 1T7ZA 3DJ9A 2MQ0A 1RULH 5IESH 1MCLA 1NFDA 1VPOL 4I18C 1FVEB 4WNQA 1NANH 1JF5A 3QHZL 4U2ZA 3AY4A 5E4EB 1KFAH 3KPNB 1M7XA 3LKQA 1KN2L 1BLNA 4GKSB 3U9PH 1C7TA 1INDH 3ULUD 3OAZK 3AB0B 4RZCA 1NC2A 2ADGB 1T66D 5DUML 5FECA 3U9UA 4XI5D 3TNMB 5CUSL 3D48R 3MREB 1I7UB 2NLJA 2EKSA 1ZLUH 3D3VE 3VFOA 4Z7QE 4KY1H 4HT1L 3VFVB 3BP7A 2ZJSL 4R4BA 1BZ7A 5ISZE 2GAZB 2C4XA 3SQBA 3MPCA 1KC5H 3T3PE 4GAGH 4JVUA 5DD1H 1F6FB 3GSOA 3D2UD 4PV8B 4BSJA 2O5YL 3NACH 1J5OL 2XKSA 5L9DH 2J8OA 2E9IA 2F58H 4Y4FA 4MCZB 3LV3A 3DX7A 4OM0L 5ERWA 1RJLA 4TQEL 5HBBA 5GGTA 1OPGH 1F6AB 2CDGA 1CICB 4Y4KC 1I4FA 3MC0A 4WWKC 5F1KC 4WRLA 2DQTL 4JKLA 2CGRL 2EXYD 4HKJB 3ZE1F 2PN5A 4HUKB 1DZBA 3RWCA 4QT5A 3C6LB 3DX6B 1KNOB 3ZMRA 5A2FA 4HMDA 1F4XL 2CUIA 1UWXH 4QXGH 5CGMA 2YRPA 2WBKA 5MENA 5CZXD 1A3QA 5HHNB 1UG9A 5IKCB 1SBBA 1X5ZA 1RJYA 3HAEB 2Q87A 3OMZA 3OAZH 5CIPA 2QSQA 2O5ZL 5I0DA 4YDVA 2OP4L 1K2DA 5HYQA 3OJVC 4PRHA 1I9IH 4AEEA 4LQFH 3SQOL 4NGHL 4L1HA 3SJVE 3HLAA 4JY6A 1P7HL 4GXVL 5GGVY 1SJXA 3QDGE 1RZIA 5E2TH 4GG8B 2DOCA 1KTDB 4J23A 1BFVH 1MWAH 3KWWA 1CDYA 1I1AD 5ICXA 5KSAB 2VZOA 1ZHBA 2CKBH 1LMKA 2D31A 3S96B 2DQCH 1LK2A 2UWEA 3FFCB 3RGVB 5ETUB 3C9NA 4NRYA 4FFVD 4GRWF 1RZKH 3LKOA 4KK5D 1DSFH 4KPHL 5CP7B 1K5NA 4ELKB 2OI9C 3FQUA 3L5XL 4LLAA 3EO9H 1CG9B 3WFBL 3IDJB 1U6AH 2HN7B 5T33H 3H42L 4JPIB 4KV5F 5CMAA 3CUPA 1KIPB 2X4TA 1NUDA 2R1XA 3KJ4B 2Y4SA 4UNTA 5FF6B 3DHJA 4FQQB 5FDYA 3WIFB 3CLFH 4JFZH 3VRIB 3EBAA 5ILTH 5FEBA 1UCBH 5HDBF 5AD0A 4MNQE 2GT9A 5L2KB 4LCWE 1T7VA 3S4SB 1FNGA 3AREA 3QNYB 4PJAE 5DO2D 4R0LB 1B0RA 1U92A 3W81A 2A0LD 1WZLA 3VI3F 4MA3B 3ZDXE 2E7CA 2JJUA 5L7XL 1OY3B 4QOKE 1OTUC 1RZJL 1HHIB 1G7QB 4ZXBB 2ZOLA 5HVWA 4B41A 4P4RA 1DLFL 4EDWH 2WUBL 2D4FA 5EOQH 2YPVL 1FJ1A 4UV4H 4OFVA 4RIRA 1DLHB 1T1WB 1KIRB 4G8EA 1MAKA 3U7WH 5D7SL 3WFEL 2FR4A 1MJUL 2OJZH 5BZDA 2FH8A 3BZEA 1F4WH 1QR4A 5EWIH 1OSPH 2G9HB 3OV6A 4WUKL 5T3ZH 1RY7B 3V5DA 3R0MA 3CFJA 4L8CB 3U0PB 1EPFA 1YDPA 1IGIL 1KB5H 3SGDI 1EO8L 1EFQA 1UXSA 3W5MA 1IAIL 5TDPA 3KXFB 3RVWC 3LHPL 3UZQA 3TIDB 2VLRD 4PB0L 3T08A 5HPOA 4LHQB 1T0NB 2H45A 2XQYG 4JREC 4Z7QF 3ZT5A 5FGSA 2X4PA 1K8DB 3QEQD 1VACA 5C0NC 3QEUB 1LO3L 2DQEL 3T3PF 4GMTL 5L6YL 3BT2L 3DV4B 2YWZA 5I71B 2JB5H 5I6XB 3IFNH 3EJJX 4NO3A 4EOWL 5C0CA 2AJ3A 2K1MA 4XC3H 5C0AB 2XTJB 3X11B 4ZOBA 1XIWD 3FONA 4OLEA 4Z76B 1WZ1L 3SDXA 3WFCH 4D9RD 5D1ZA 4DK6A 1WZMA 1GHFL 3QHFL 1PLGH 1P4BL 3MA9H 1FAIH 3GSXA 3X14A 4HQQH 3RDTC 1RFDH 2CO6B 1T83A 3BO8B 4GBXC 5E7FA 1DQTA 3BQUA 3HZYB 2VERN 2IQ9H 3RVUC 4XAWL 3MRQB 5JXAL 4RQQA 3BD3A 4HJJH 3L3HB 5A2LH 2OTUB 1BQLL 1P4IH 1ZT4B 2AXFB 2AEWA 3MYJB 4XNZC 1AC0A 4M7JL 2XFXB 2Y5EA 5D72H 5DQJB 2YD8A 3NIDE 1UB5B 1JZ3A 1JYWA 4HEME 4PGDA 4OZHE 4TTDC 4QEGA 4ZAKA 2Y36H 2WWKT 4X6CE 4WW1B 4G8IA 2FGWH 1ONQB 1ITBB 4KJYA 4Z7VE 2A74A 3MRGB 4ESKA 4HMCA 3JTTB 4KRLB 3IDUA 3DI3B 2R2BB 5ANME 2CMRH 1CTOA 4KKBD 5DMGC 4FTVE 1FFPB 3CH1B 3SO3B 3SEPA 4DKFH 2DI7A 4LVHB 4XPHH 5D2NC 4CNIA 3SKJL 1FNAA 4PLJD 3VFSB 4TTGA 3FQTB 4O58H 4I18A 4JZJB 5ID1A 3VI4E 3Q1SL 4P9ML 4UIKH 4LSQL 2HLFC 2FLBT 4RFNB 2J88H 3FB5A 3PL6C 4I3RL 1QA9A 1U3HD 3RUGA 5C7XH 2QSCL 1G7MB 1OTTD 4KHTH 5D5MA 3JTSB 1AQKH 4J1UA 5DEFA 5EORL 1LO4L 1JV5B 3VXSE 1HHGA 2DYPB 3E0GA 3S3SA 3MMEB 1S5HB 2EIDA 3LQMA 2DBJA 2XNAA 1A4KB 2KQMA 2ZUYA 3GMOA 3N1MC 4CMMA 1PSKH 2ZUTA 3MUGB 4Z0BH 3B5GA 1A6ZA 5GS2H 3IFPB 2VXVH 1S9XA 4OF0A 1G84A 3EDJA 2C9AA 3MRFA 3IU4H 3C08H 3RBSA 2R2EB 5JO5B 1RIVL 1NLBL 4M8QB 3V5KA 2BRRL 3HR5B 1ZLWK 1PKQB 4JM2C 3ZDXF 2VR5A 4UT9H 3BYYA 5J9PB 5FKPB 3GI9H 3QXAA 4K3DH 5EU5B 2BJML 3EHBC 3OTTA 2H2SD 4JO2L 4ONHA 4NN6C 4MJIB 1T1XB 2AEQH 2R8SL 4Y4KA 4YHZH 1NCDL 4WWKA 3ZTNH 2QHRH 2FBJH 4U1JB 1EK3A 5C8JA 1Q0XH 2F53B 4NNYA 4XGZA 2XN9A 3FRPG 3GHEH 4MA7L 3E2HC 1FYHB 3P4NB 3ZSSA 5T5NG 5D93C 5J0BA 3P4LA 3UTZA 3C5SB 1D5ZA 4PJGB 4ENED 5CHNB 2YD3A 1HXYB 2BC4B 4JFPA 4WTZA 5CBAB 2Y1VA 4XBGB 5KS9A 4MD5A 4I2XB 3MO1B 3PDOB 4BQCA 1NDGB 4FQXB 4LPUA 4R2GC 1GVIA 1IE5A 1ZANL 5EU7E 1F11A 4ISVB 1MCRA 5E2UL 3WMSA 4HG4J 1U8QB 1UM5H 3V52H 1IGYB 2V7NA 4U1LA 3RIFF 2ORBL 1CE6B 3OF6D 5TE6H 2YD7A 1FDLL 4KHXH 4B0MM 4M9PA 1TZIB 5DJ6A 1RJZA 4JFOA 5INCA 2VDOH 3O3BA 1BOGB 1B4RA 4KDTC 4NPYA 4HWBA 3RL1B 1KPUB 4QCIA 2VQ1B 3KPRD 4ODXA 2O61A 1LO5A 5DJ0B 4YR6A 3D69A 3RTQB 5E08H 1BBDH 5IW6A 4P46B 3BZ4A 2EO9A 4WI6A 5I8CB 3IDNA 2BHZA 1U58A 3GHBL 4YWGL 2O5XH 1QQDA 3LQAC 3TBWB 1CDUA 4Y5XC 1XMWA 5DEZA 1PZ5B 4FQLL 2IFFL 5GGSY 3AM8C 1A22B 1O0VA 4EBQL 4ALAL 4RMTA 1K9TA 5H37H 1YECH 4YDLC 4LLQA 4G3YH 2D03H 2UZXB 4UNUA 1HHJB 2DQJH 3T4AA 3JWOH 4JAMA 3UJIH 4U3XA 3FAXA 1N5YL 1J8KA 3OGOE 3RVTC 2RAMA 4UAOC 2LAGB 4LPWA 1QACA 5IK3B 1CT8B 3SKOA 3EKCA 2AJXL 3DX9B 3IXTB 1DVFB 4IDJH 4S1DC 3RPIA 3JV4A 1DBBH 4NFBA 4PV9B 3ZKXB 1LD9B 3ZT7A 4X6DE 3JWNC 3IAPA 1JPTL 4X6CF 5I1GH 3L3IB 4MMXC 5BVPH 2H26A 4N5UA 4YXKL 5C0FA 1YY8B 2C7UB 4Z7VF 4N0FB 1P6FA 3F7QA 1TQCB 3VXUB 4LMQE 4CGTA 2PO6A 4F3FA 3HMWL 3EDKA 5TPWL 1C16B 2AXHA 4N8PA 5DR5H 1HWGB 4OGAD 3TWCH 1T4KB 5I17B 1INQA 1I7TA 3HC3H 3UTOA 3BOVA 3KR3L 1XZ0A 3MFGB 2VMFA 4V2BA 5B21A 2E9JA 2IADB 2CPCA 5DK2A 1AO7E 3OAUL 1CLYL 4PD4J 3V5HB 4HJ0C 3S36X 1JNHB 1VGEH 2EH7H 3DHMA 4DGYH 4XXDB 4X4XA 3TIEB 1WQVT 1CGXA 1YJDH 1NJ9A 5MEPB 5GHWH 5B39A 3ARFB 2DKMA 2OR9L 4AEHL 4R7DA 1JRHL 2I24N 4QXUL 5GS0C 3FQWA 4FG6C 4LRIC 3TH3T 1XGTB 2BK8A 2X44D 1IEAB 2XPGB 2Y6SC 1WVZA 1ZTXH 4MJ5B 3QDJB 1ZHLB 1SYSA 5F72S 2IFGA 4F7MA 1C1EH 3BZFA 4L5FL 1W2KT 4MHHG 4FQCH 4LKCA 1I3GH 2CLZA 3MZTA 4FNLL 1LK3L 3GKWL 3CMOH 4G6FB 4YX2L 1WBXA 3IJHB 5SWZE 3SDDB 2R1YB 2CUHA 1BIIB 3RDTA 5I16B 3ULUC 4GBXA 2WZPD 1T66C 2FJGB 5CSGA 5JHDD 4K8RL 3SDAC 1LDPH 2OJEA 3IDGA 1U8JB 4XI5C 2VLKD 1IKFH 1RZGA 2M8XA 3CFBA 3V7MA 4D3CL 3MODH 2DM7A 3MSPA 3T3ME 4EVNA 1I8KA 4L9LC 3NPZB 3OKNB 3ARRA 4JDTL 2VIRB 3KLSA 4I9WD 5IVXE 4YBHA 1SY6H 2V5TA 3WKNA 1NBYB 3TZVB 4NO0B 1H3UA 3FO1A 1AJ7H 2VR9A 2Y25A 3DGGA 4PP1D 4JJHA 4HX1A 4OIBA 5EZJA 1PQZA 3BESR 2FSEA 3MNVA 4NRXA 4HEPG 2NXYD 2DIAA 5T3ZD 4NDMA 5GSRA 4HH9B 5IHBA 4OV6F 2DTML 5TQ2L 3JUYA 2YK1L 2AKRB 3BJ91 1FG2A 2E9BA 2EXYC 5D2NA 5GGQL 4OZGE 4UB0H 1HQRA 3MV9D 4XH2A 4K94L 1XGQB 4QRPD 1SVZA 2DB8A 1H9VA 3UZEA 1GZQA 4D9LH 4P2OB 4BQ9A 1TQBC 2KZ1B 3K1DA 4JFFA 3PL6A 5CZXC 5DRNB 3OX8A 2NY7H 2HFFA 5JHLL 1CL7L 4HHAB 3NZHL 4W6WB 1MCKA 4A2LA 3IDMB 1NC4B 2IMNA 4HC1H 1KLGA 1N4XL 1ACZA 3OGCB 1T2JA 3IJSB 2PXYB 4PJ5A 4J3VA 5EZIL 3RZWA 3LIZH 3W39B 2HLAA 1YEIL 2LE9A 2C3WA 4LVNC 3T1FB 3U36B 5TE7L 3CD4A 3BHBA 4WY7H 5EU6A 4L4TE 2B4CC 3P4OB 1I1AC 4OCLC 1OGAA 2IALB 4QHKJ 3KYMA 4KKLD 4N0YH 4JM2A 3P73A 2WWMD 4ZDHA 3O2DH 3V6OC 4K7FA 1YZZA 1D5IL 2IGFL 4R97B 3LKNA 4X6DF 3TYFA 4E5XB 3WNOA 3BPNB 4FFVC 4JDZB 5EC2A 5C09E 3UZVB 3QCTL 4KK5C 2XG4A 3GBNL 3INUH 4BSWB 5E9DE 3D3VB 3MJ9H 2HTLD 3AC0A 4JANA 4RDQG 8FABB 3HE7D 5ISZB 1IGCH 2OZ4L 2XY1A 5ADOH 2XWJA 2GW5A 2W1NA 2NXZB 4XP9H 2A77L 1N8ZA 1GGBL 4X6FA 4N8VG 4EI6A 4PJDE 2VQUA 4DTGL 1MWAB 2ESVE 2RFXA 1U8OA 5C07B 3GSWA 3QULA 5DMKA 5FO7A 1L7IH 3HI5L 4K23H 1BZ9A 1AD9B 3GI8H 3MJ8A 2ICWB 4YJZL 4OUUB 2P5EA 3ARGB 1F3JB 4HCRA 5DO2C 3TV3H 1ZVSB 4M61A 1RHHB 1X5IA 5LGHL 4QF1B 4RA3A 3EJZD 3L5WB 5GRYA 2BSSA 2VAJA 5ADPL 4NJ9L 1VPOH 1BM3L 4X99A 5EH1A 1V3KA 2ICEB 4N5ED 3G5XA 5CP3A 1JNLL 3QHZH 1WICA 1EMTL 4G7VL 1F45A 3BP4A 1OVZA 3QIUD 4M7KL 1EEZA 4KDTA 3IAQA 4NWUL 1M7DA 4JRXD 4KK6D 3MRCA 3QIBD 2R69L 4NCDA 1H3PH 4HIIA 3PP4L 3GMRB 5DUMH 4G42B 5C6TL 2EEBA 4WUUA 3HA0A 5CUSH 2BNUB 2H8PA 4NFDA 4BUGA 4PRID 4ZUVB 3SJVB 4HT1H 4I13B 5D1QC 2ZJSH 3QDGB 2IAND 4Y5XA 4LHUD 3CFEB 3U1SL 4L4VE 4RGND 4CN1A 3EYOB 2DLHA 3AM8A 4ZSOE 1XCTA 1UXWB 5ESAB 4KVNL 4MCYA 3UPRA 2WUCH 4OQ1A 1WK0A 2AK4A 1WZKA 2O5YH 3OAYK 1J5OH 1CQKA 2PYED 2IPUG 2ICWI 1F90H 4XPGL 1JYXA 4TN9A 2EDWA 1YPZE 4LF3B 5H8DA 3B5TA 2DS4A 4ELMF 4OM0H 5GGRA 2GY5A 4TQEH 4MX7A 1T89C 4OGZA 3QCVL 2V2WA 3B9DA 3GJEB 2XWBB 1OGTB 2VDPH 1KIQA 4KUZL 3ECBA 2DQTH 2CGRH 4LHJB 2W0PA 3E6FA 3ZT6A 4J3TA 4TNWK 4AENA 1MOEA 1W0WA 5E8NB 1KB5B 4F15B 3UJJL 4PJ9C 1K85A 1F4XH 3KDMB 3WUWB 4PFEA 2N56A 3W0WA 2BY1A 3LKRB 4MNQB 4X8JA 4RCAA 4LCWB 3EGSA 1Y18B 4PJAB 2BSTB 3EIFA 4OI9A 4OZGF 1UB6B 4JG0H 2WSKA 5BZWA 2E7HA 2O5ZH 2NY1D 3PNWA 5F88A 1CZ8L 4Y0GA 2OP4H 4QOKB 4OCSL 4OF6A 4BH7A 3VH8B 4RMWA 3QSKB 1KCUL 3QDAA 3VD5A 4X5XA 3SQOH 4Z7NE 4NGHH 2J12B 3DVGA 3RY6A 4WO4D 1QVOB 3C2SA 1W8NA 2XZZA 3DO3A 3OHXA 1T20A 1IFHL 1MVFA 1PZUB 2F9BT 5F1IB 3OAYH 2VLJA 1UQSB 1A9BB 5EBLA 4HUUA 2FHCA 4LCCA 4KPHH 2YD4A 1FHGA 3TO4D 4KKBC 3L5XH 2CSPA 1CK0L 2ZCLL 1G7PA 3WFBH 5SWQA 4TUOB 4OSUL 1QKZL 2X40A 2VDQL 4TUJA 4G6AC 1WUNT 4MB4A 3EO0A 5TDNB 1X9QA 2PNDA 5FHAL 5I73C 1F4YH 3QDMD 5KAQG 5L0QB 4NBXB 1U3HC 3N50A 2EDDA 4LEOA 4IOIB 2XKNB 3MA7A 1OTTC 1QSEA 4LNRB 4MA1B 2Z91B 3PWNA 3O8XA 1U3YA 2F54D 3SDAA 1IC1A 3CSPA 4MD4B 5L7XH 4LPVA 4PJDF 1V7ML 5A2IH 1RZJH 3RWHA 1RURL 5I1LB 4GUPB 1IGJB 4L9LA 1FFNB 1DUZB 5D7JB 2Z9TA 3O3UN 2QL1A 4ODBD 2WUBH 1P2CB 3MOQA 1BF2A 5D7SH 3WFEH 4I0CC 3X12A 4LBEB 5HHPB 3B5HA 3VWJB 4U1KB 5AAMA 1A6WL 3VXQA 3WJLC 4AM0B 1GZPA 3ARBB 4WUKH 1YN6A 2H2SC 4Y2OA 5JNYA 1QR1A 4LPYA 2HKHL 5F7NC 3STBA 4D0CB 1WWBX 1ZHKB 4BSVB 3TEUA 3BP6B 2GJZB 5IEHB 2ARJQ 3BAEL 2AJSL 3Q6GL 1WITA 4P2QD 4Z7UA 3UBXG 3IXAA 1IGIH 4WU7B 1AXSB 1EO8H 1KYOK 1HCVA 4OZHB 1IAIH 4ENEC 2IAMD 3T77B 3PQYE 3VFUB 5DQ9B 3LHPH 1WWWX 2VLME 4X6CB 4TVSa 5DJ8A 4EIZC 2P24B 5IR1B 4PB0H 1PG7X 2NX5A 3DX8B 2CD0A 5IV2B 5ANMB 2ZSWB 5CEYA 2LU3A 4YHYB 2HJLA 1L6ZA 3TO2B 3ARUA 4RFEA 1LO3H 4FTVB 1ADQA 4GMTH 2K9UA 5L6YH 1NFIB 3EAKA 4X5WA 4JFEE 1MI5A 1E4XL 2VAAA 4EOWH 4K71B 2XZCL 2CJUL 4DZBA 1DQQB 1YPZF 3D85B 4WFFE 3MBXL 4D9QE 1CIUA 1WZ1H 1G9NH 3SE8L 5BVJA 1L0YA 4GT7A 1GHFH 3QHFH 1OAQL 5IM7B 3C2AL 1P4BH 1MY5A 4WFEE 3V6OA 3HUJE 3IFLL 3CPLB 4M7ZC 5L8LB 1MH5A 2UZYB 3VXSB 3MV8E 4A6YL 4MB5A 1PG7W 4XAWH 2VN7A 4I48B 1BQSA 5JXAH 2R29L 4YPGB 3DUHA 2VC2L 4AH2A 1R0AL 3ARXA 1BQLH 4BH8B 4M7JH 1WT5C 1MHHA 2PCPB 3T8XA 3GMPA 5EN2B 1KT2A 1R3HB 1NMCC 3FFCD 4XCNA 5DF0A 5A43C 2W9DH 1I3VA 3G08A 5TDOA 4NN5C 2E7MA 3KPTA 2F8XC 3EZ8A 2ICCA 4Z7NF 1M7IA 1AQDB 3SKNA 5DMJB 3BPCA 15C8H 3GSVB 5ALBL 1U8MA 5M94B 1C5DB 3L9RA 2NY5H 3CX2A 1OP5K 3VFPA 3DUSB 4WI9A 1MCCA 1NAML 3SKJH 3F7VB 4OZIA 2QR0B 1CDIA 5BV7C 3Q1SH 4JFQA 4LSQH 2JIXD 3F5WB 1IC7L 2OS7A 5DUBB 1S7TA 5L2KD 4XPFL 2BVQB 2XT1B 2QSCH 5GISL 5T5NF 3IS1X 2BCKB 5I1JL 5KN5A 4OGAC 3I6LD 3QIWD 3QQ3A 3BRFA 2VXTH 5EORH 3VDBA 1LO4H 1DN0B 3EJYC 4C56D 4U1NA 5FUOL 4XX1G 1YA5A 4MWFB 4BKLB 1A7QH 5FHBL 4UUJB 4U4BA 5D1QA 3FO2B 5CSZA 1MQ8A 1HHKB 2E8YA 3IJYA 1RIVH 4FFWD 1NLBH 2IG2L 3ZYOA 2BRRH 4J8RB 1AFVL 3BYTA 3PGDA 4ONFL 4NRZA 4K3HA 2BSRB 3FB6A 1T89A 2ITDB 4JO2H 4F37F 5DJCA 1MFBL 1S9VA 5FKAA 3QEQA 4WW2C 5GRVL 2GJ6A 1ND0A 4JO4L 1LO2L 3QQ9D 1TDQA 1NCDH 4G8FA 4HD9A 5F9JB 2ADIB 3I3BA 3MV7D 1OP3H 1N0LA 5CGYD 2V7HB 4NSKA 4HIXL 3KXFD 4MA7H 1JP5A 2AXGB 4PJ9A 1EUUA 3HG1E 4BFIB 3K7UA 3VA6A 4MAYD 1OSZA 3FT2A 3MROA 5HI3D 3P9LB 2DICA 2VH5L 4QHUB 4I5BB 1ZANH 4LGPB 3ARTA 4MDIB 1CTNA 4NHUA 5E2UH 5HHVL 5FCUL 4RMVA 4WDIA 2W59A 1YNTB 2H1PL 4RGOL 2VZSA 4X6DB 5DJ2A 1BZQK 1TPXB 2ED7A 3FTGA 2ORBH 2XWTB 2X05A 1FDLH 4Z7WF 5DJYA 5EOTB 4Q9QL 1R3JB 5JOEA 3P9MB 1CDHA 2YKLL 4PP1C 3KAAA 2FIKB 2KKQA 3I3DA 4IIQB 2R2HB 1O5DT 1G7IB 1IVLA 3CLEL 3GFUA 4NUGL 2EDTA 3OB0H 3TBSA 5D2LA 2H3NB 3CGTA 1CLZL 2X89A 5IF0A 5T1LB 4Y88A 1AO7B 4PGZA 4YH6A 3GHBH 1R3LA 2HFGL 4HF5L 3LB6D 4NC1C 4YWGH 1A6AA 2AQ1A 5HGHB 3CDFA 4FQLH 3THML 4EBQH 2ZSVA 3DXAD 3W82A 4ALAH 3OJMB 1S7RA 5T3XL 3BXNB 2DN7A 4JFHE 3C09C 1U3HA 4JFDE 3S3PA 3N9GL 5F1NB 3EDDA 2EH8L 3HKFA 1N5YH 2HTKD 3OKDB 1HXMA 3RI5K 1MLBB 1R3KB 4ODHL 3T0XA 3C5JB 3F58L 1CFBA 2AJXH 4JY4B 4XNMB 5AUMA 4JPKL 5HHOB 5JOPD 2MTPA 1JPTH 2HG5A 4LMQI 4B7LA 1AD0B 1EFXB 5DRZA 4MA8L 2E5EA 5H35A 3OL2A 3RP1A 2G5BA 4OT1L 5SWZB 1ZT7B 1J9CT 1U93A 2AEPL 2H9GA 3I75A 4KKLC 2WWMC 1KJVA 1LEKA 4XRCB 3TBTA 3HMWH 5TPWH 2A6KA 3WJLA 1HE7A 2DYPD 1RZ8A 3DETD 3FN0L 1CF8L 3KR3H 3Q5YA 1KLFA 3P11H 4NIKB 2HTLC 3OAUH 4O2CA 4X4ME 1B3JA 1CLYH 2E6PA 1T5WA 5F3BA 5IVXB 2JCCB 2LQRA 3RWFB 4PGCB 4BFGA 1JYNA 3QFJD 3BEWB 1JBJA 2Q7YA 3MLTB 1WTGT 4NP4L 4OZFA 5IMKA 4OQTL 2OR9H 3VFMA 4AEHH 5DZNA 1JRHH 4DCQA 5HXMA 3LDBB 4I0PB 5HTSA 1U8PB 1MHPL 1T2XA 1YEDA 5DQDH 5KVFL 4F7CA 5FO9B 4X9HA 5GS1C 3LKSA 4V1DE 1VGKA 4HLZG 4GOSA 3AS1A 1UEMA 2OTWB 1XT5A 2CUMA 1GGIL 2F53D 2X4QA 1UVQB 1AHWC 1CD8A 4OZGB 1P5VA 4XPTL 3MRIA 1QRNE 2IBZX 4Y19E 1FIEA 4CVZB 4N5EC 4FNLH 3REVB 3UYRL 2MWCA 3TT3L 1YMME 5I66B 2ERJB 3DV6A 3GKWH 4S0SD 4YX2H 5IEKA 1DQML 4H5SA 1VCAA 2C3VA 5MEQA 2X4OA 1UJ3B 3GJFH 3MJ7A 4LLDB 4GS7B 4XPAL 3QIUC 3MLYL 3SDCB 3Q3GA 1DEEB 4KK6C 1JMZA 3QIBC 4QXTA 4ZFOA 4H25B 1W72A 2GHWB 4K8RH 5C2UB 2G2RB 2QQLL 4UNVA 4FP8L 3VD9A 1TVBA 5BRZD 3E3QC 3SCMD 1WCQA 1OWRM 3OG4B 5IVZB 1CN4A 4JDTH 2QJDA 1WT5A 2W0KA 2DLEA 2DL9A 4L4TB 4RGNC 5IJVB 4GG6F 3O3EB 1FCCA 4M8VA 1HHHA 1Z5LA 2VUYA 2F5BL 3S5LG 2FL5A 4MNGA 3PWJB 2L7JA 2RB8A 5K9KA 5D1XB 1A0QL 1FL3B 1ZT1A 4EZMA 4BZ1H 3NOIA 4XMLL 5C09B 3ARYA 5F89B 3C60B 3S37X 3UEZA 5FM8A 3QISA 5E9DB 2JJVA 5FIEA 4UTBL 5T1KB 1XGPA 4J12A 2DTMH 5IUSA 1T3FB 1SBSL 5CILL 1YC7A 2YK1H 5I1HH 3HR6A 1I1FB 5GGQH 3T2OA 2GI7A 4K94H 5J12B 3KPOB 4PJDB 3CFKB 4CJ1A 2ESVB 2EIBA 1CD0A 3Q6FB 4RFOL 3ZHDA 1I85C 4RDQF 4WJ5A 1FP5A 3PUCA 5AYUL 1LEGA 2KZWA 3ARDA 5CJ8A 3K8KA 4Y1AA 2BY2A 5DEGA 5JHLH 1CL7H 3NZHH 3L3GA 3WS3A 1NFDE 3MXVL 4UIMB 4JZNB 3P0VL 2NY1C 4GW5A 1N4XH 5FV2A 5EUKB 1JUFB 1EGJA 5EZIH 3MGTA 1J12A 1YEIH 1J0ZA 3VGAB 2GTWA 4FHBD 4JQXA 3O3AA 4YLQT 4C4KO 4WO4C 1X5YA 1IC4L 4BQ8A 2DIJA 2FX7L 3PIQB 4HK0A 5TE7H 3V9FA 1WWAX 1JGVL 3FO0L 3KLHD 3PHSA 1MF2L 1FZJB 1BVKB 4J3SA 5I8KL 1A6VL 1GH7A 4EUPH 2AXJA 3KYKL 4W81A 1D5IH 2DQFA 2IGFH 5IOPB 3CXHK 1ZHNB 4GAJL 3QCTH 3GBNH 5FM4A 3TA3D 1RUQL 4AIZA 3I6KB 5BXFA 3IDYC 1B2WL 3TO4C 1HSBA 2OZ4H 3UTTA 5IMLA 2YR3A 4IS6A 4L4VB 1FORL 1E4KC 3KYOA 1MCFA 3AU1A 2A77H 4ODSH 4ZSOB 2XY2A 3BPOB 1GGBH 3BGFC 3O2VL 4HCRL 4PIRF 4H0IA 4LLYB 4UV7L 3IYLW 3PWPA 4DTGH 3JWDH 3CVHA 2KDGA 1YPZB 3GMNB 1KJ3L 12E8L 2EE9A 5IGXL 1JTTA 2FYYB 3QDJD 3KNBA 3MZGB 1G0YR 5DC9B 5CKGA 1U8KB 3MCLL 5FK9A 1L7TL 4ZUWA 3PGCA 5LGHH 4NQSB 3ZHKA 1AH1A 1DFBL 4R3SB 2ZUQB 3WIHA 3EUUA 3GGWB 3RX7A 5ADPH 1WAAE 2I27N 4G6FD 4NJ9H 1BM3H 5EFIA 4G9DA 3LN5A 5E4EC 4LCUB 1JNLH 4FXKB 4G7VH 5E8OB 3SDDD 3QA3A 2L7UA 2WIIA 4OIIL 2OQJB 4HAFA 4HAGA 1AC6A 4HW6A 2HJKA 3LQAL 4LL9A 1LP9B 2Z92B 4WTWA 1FZOA 4NWUH 5HI4D 5JUEL 2YS4A 5MP6L 4PJ7E 3PP4H 5C6TH 1QEWA 1E27B 1HDMA 4F7TB 4FXGB 5LAXA 4NQCA 3ZDYE 3ZYZA 4L3EA 5DGRA 3QI9B 2B2XL 5F96L 5IVNA 4P5KA 4HPOL 5D7IA 4TSBH 5SX5K 3MV9A 3PE9A 3U1SH 5LG1A 4WENB 2JJTC 4K7PX 4NO0D 2PW1B 2IAMC 4KVNH 2H32A 2W65B 3H0TA 5EA0L 1J0JA 1NAKH 3RWEB 2DI9A 4XPGH 3STLA 3SE3C 2DJUA 5FA4B 2Q20A 3QG7L 4LSTL 4NBZB 1SM3L 2YBRA 2P47B 2PTUA 2YOCA 3QCVH 1X4ZA 2VL4A 3NCBB 3EYUL 5HPMA 4IM8A 1BJ8A 3BGMB 4HGWA 4S2SB 5C0BE 1J1PL 5EZOL 3C6LC 3PWUB 3WDIA 4L4JA 4FMKA 3D39D 5ABDE 2P8MA 4P2OD 3QPQD 3L3KA 5F9OL 5CIPH 5I1EL 2OL3A 5JIIA 1DJSA 1VADA 3DRQB 3TT1L 1TNNA 1T5XA 4LSDA 1N59B 2FATL 4E0RA 3L3JB 1NC4D 3QEGL 3ISWA 4JQVC 3H9SE 3FFDA 4M6OL 1H0DA 4YQXL 3PWVB 4M43L 4PRPE 3FQXB 4QRSB 1A6UL 1CZ8H 2ED8A 5E2VL 4U7MA 2D0HA 4FQHA 2NY4D 3FT3A 4OCSH 3GBLA 1A3RL 5F6IB 1K8IB 2Y7QA 3EOBB 1K4DB 1KCUH 5TGBA 5GS0L 3WS6C 5HYJD 1HQ4A 3DBXA 3KYAA 4DGVL 2EE3A 1R5WA 1HILB 4NNXB 3RWJB 5EO0B 3AMKA 1RUKL 5HJ3B 1NFDF 1IFHH 4U1HA 4DN3L 4PG9A 4ODWA 3NFPA 5T5FL 3HZVA 1SJVA 1BVLA 5HYEA 4JCMA 2HT3D 3MR9A 4QLRA 1GGYA 5MHSE 5C0GA 3QUZB 1G7HB 4JRWA 3S8WA 3GBML 1CK0H 2NXZD 2ZCLH 3LD8B 1AHWA 5IQ9B 4OSUH 1QKZH 4XAKD 3SY0A 3EO1A 3KJ4C 1A9EA 1IAII 2UVFA 4KTEL 5C07D 1A7OL 3WDHA 3PQYB 3B6SA 2RGSA 4LVEA 2VKXA 4K2UL 5FHAH 3ZE2E 4QRRA 3JUZA 3PWLA 5IB4A 1XF2B 4FZEL 5EO9B 3C6SB 2E6QA 5KG9B 3QIUA 2CH8A 4R0LC 2EDOA 5K9JL 3LN9A 4KRMB 4QRUA 3R8BB 4E41D 3BN9C 1CD1A 1CVRA 3I02B 1MCWW 4JFEB 2D7PA 4K07A 5MI0B 2H6PB 3QO0B 6FABL 1V7MH 3MRLB 1RURH 1QD0A 1MCJA 1CFQB 1ETZB 5A40E 3IETB 4PY7B 2VQTA 4NZUL 5D70L 3U83A 1T7YA 4NT6A 1YQ2A 4FFWC 4F7PA 5HD8D 2ZOKB 3HUJB 4UBDD 1EVUA 1XGUB 5EBWB 3KGRA 3MV8B 3I6GB 1AKJB 4QY8A 3CSBA 3E8UH 1BD2A 1WAAF 1QSVA 2HKHH 3GDBA 5F7UA 3U4BH 1BFOA 3QQ9C 1F2XK 4HULB 3DECA 5J89A 3BAEH 3Q6GH 2AJSH 5CGYC 4YEEA 1HH6A 4XP6H 1CGTA 4HKBB 4OAWB 5HSFA 4YHIA 4G7YL 2YD2A 4GW4A 1KPRB 3WXVL 2C3HA 1I85A 1WGOA 1WBZB 2D0GA 2EDBA 2LABA 5E24E 3MBED 5E99L 3GMQA 1AIFB 3ZDYF 3KPPA 4CKVX 5CS7A 3CZFB 5C70A 4WFGE 3P4MA 5I71C 1TTFA 2UWEF 2B4CL 5HY9A 5I8OL 5I6XC 3AXLB 3NZ8B 3NPSB 5DTFB 1E4XH 4OCWL 4QYOB 1WFTA 2XZCH 4JRYB 2CIKB 4XP5H 2CJUH 2CR3A 4WO4A 1NCCL 1U91A 3TN0D 4GJTB 2AGJL 3SE8H 4HFWB 1DP0A 2EZ0D 4AEIL 3W9EB 1XGRA 4W6XB 3B9KA 1OAQH 3C2AH 5JW4R 2BOCA 3UC0H 3IFLH 3OKKA 3PHOA 4WHDA 1D6EB 1E6OL 3M1BA 3WXWL 1ZGLB 4A6YH 4QHKI 2N7BA 1JWSA 3QO1B 4MXWL 2A73B 2R29H 3WUZA 1M1SA 3TO4A 3VCLB 2A1WL 2VC2H 1R0AH 4ODUB 3LB6C 4OM1L 3NVQA 2P5WD 3RRQA 2KQNA 4FN0A 5JQHC 2YRLA 1KULA 2AV7B 3IAGC 4OGYH 5DD3L 5F3HA 3WFHB 3TNNB 1BWWA 3FL7A 4X7TB 3OKEB 1GOFA 3QUYB 3U4AA 2I5YL 3U46B 4EI5D 2OBGA 2HTKC 3WKML 3U2SA 5DZLA 2XN9E 3SO3C 3L7EB 4NZTL 4KKNA 5ALBH 4LVHC 3TBVB 5I18L 1VHPA 2FEDC 1FVEA 2CLVA 1C5BL 4JZJC 4POZD 1NAMH 3CMGA 2NY2D 3VGHA 3HG1B 2GSGB 5F7DB 1YEGH 4M93B 3KPNA 3MJGX 4NZRL 3RL2A 1IC7H 1LO0L 2ZP0T 2VN4A 4GKSA 2NYYD 4NM8L 1A7RL 4LDOB 4XPFH 1U41A 2ADGA 1S9KC 2ID5A 5I1JH 3DETC 5E0QA 3MREA 3LN4A 4MJ6A 1I7UA 4CMHB 2NW2A 3W11D 2HWZL 1AY1L 4DKAA 5FUOH 3VFVA 2APTA 2ITCB 4TVPD 1NUGA 2GAZA 5D7JD 3ZE2F 3ET9F 4C4KT 4HG4K 4P2QA 3ARPA 5HGBB 2JJTA 2DTSA 4JO3L 4PGBB 5JIPA 3OR7B 4HLZH 4F58L 5T1DL 4MCZA 1AFVH 3VFWA 1FIGH 3SE3A 4ONFH 5CZKA 1OAYL 4RAUA 3SDXF 1NSNL 1CVSC 1F6AA 2Z93B 1CICA 3MLVL 4AEFA 1MFBH 1FGVL 1KGCE 3GIVB 1S7XB 4JO4H 1LO2H 3U30B 1QFWM 4N8VB 3WL9B 4RMSA 5MERB 1RVFL 3C6LA 3DX6A 2C26A 4P2RB 1QSFE 4GKZA 4YK4B 4HIXH 4X5LA 2OX5A 3F7YB 4J6RL 4WHCA 3BGAA 1JWMB 5HHNA 4U0RB 3RWGB 3RFZC 4JFDB 1IL1B 1PGRB 4U2YA 3HAEA 1JGEB 5GRXG 1D9KB 5T3XE 4HXAL 4N8CL 4JQVA 4WEMB 2VH5H 3U79A 1A14L 3ULVF 3UTPE 4POYA 4U7SA 4CDGC 5F9WC 1FH5L 1F4AA 5HHVH 4Z95L 2H1PH 4ORGA 4RGOH 3SCMC 4TSAL 4GG8A 1NC2D 1AGDB 1KTDA 4Y16B 4F80A 3MV11 5KSAA 3HNTH 3MUZ1 3WDJA 2HKFL 1U3JA 4RMQA 5HVHB 2IPKB 3S96A 3HNVH 3FFCA 4JLRB 3RGVA 3G5VB 2D3VA 3VXSD 3GJFB 1XF5A 1YEFL 5CP7A 4P46C 1LE9B 3RUGF 4ELKA 1CLZH 1CG9A 3IDJA 1B6UA 2HN7A 1OT1A 4JPIA 3ZO0A 1KIPA 2HFGH 1VFAB 2A6JB 3ARVA 4HF5H 3WEXA 2RJMA 1EX0A 2VYRE 1IAKB 5FF6A 4FQQA 3WIFA 3DTXB 4Z77B 2HRLA 1N2RB 4PD4K 5KSUA 3THMH 1YNKL 1XF4B 1JRHI 3H9HB 3MNWB 5L2KA 3N9GH 1DE4B 3S4SA 5L2JB 3O45B 4R0LA 4V1DB 2JJWA 2EH8H 2B0SL 4RNRB 4MA3A 2VTFA 1DVFC 3ZKND 3QHTC 4ODHH 2Z4QA 5EOCL 3F58H 4PJXE 1HHIA 1NGQL 4RGMB 1G7QA 1NBQA 4ZXBA 4JPKH 4Y19B 4RRPG 4U1IB 3N1FC 3EYFB 1DLHA 1MCQA 1T1WA 2DQHL 5BMFL 3LKPB 4MA8H 2FHBA 3RX5A 1NGWB 4OT1H 5F7HA 5BS0E 4PRHD 2AEPH 2BNQE 2G9HA 1TJHL 4MQXD 4OUOA 5AZEL 2UV3A 3VFNB 3KYNB 4JKPL 1PVHA 5GRZA 5EBGA 2J8HA 3HE6B 4AIXA 3FN0H 4U1MA 3CVIL 1X5JA 5IB5B 4L8CA 2CO7B 3U0PA 4MQ7B 4KDVA 3OPZL 2VDRL 4Z9KB 4RAHA 5CJQL 3KXFA 3WE6B 3QUMB 4EDXB 5JTWA 3BRGC 4NP4H 4K7PL 3TIDA 4OQTH 4OD3L 4QRTB 4RSVA 1T0NA 2PUQT 4F33B 5IESL 4FQPA 5LCVH 1T04B 1K8DA 2ADFL 4WV1B 5TH2B 1MHPH 3QEUA 2FDBP 5D2NE 3DV4A 4HWUA 4U3HA 4TNVK 2LVEA 3KPQB 2LTQC 2QADB 4Y4HB 1GGIH 5I2IB 2JK5B 4D94A 2Z8SA 5C0AA 4XPTH 3SHSA 1J8HE 4Z76A 3ARED 3UYRH 3TT3H 2X70B 4ZFOL 3CCHB 3V95A 1DQMH 3SDDC 4XWOC 2YD9A 4YNYB 4PP2A 3PXJA 5DDHB 1CL7I 5DK0A 3BO8A 3DLQR 4XPAH 3HZYA 1F2QA 3MLYH 1NFDB 5HI4C 3WO3B 3BE1L 2MMXA 3MRQA 1D5BB 1V3JA 3GZKA 3L3HA 1I9EA 5HI5C 3TJHD 2QQLH 4JGJA 4FP8H 2OTUA 3TLRA 1ZT4A 1DQDL 5EU6E 3MYJA 1U8NB 4Q6YA 3WLBB 2XFXA 1BLNB 1WISA 5DQJA 1U95B 1UB5A 4RZCB 1JPSH 1MJ8L 1OPGL 2WBJB 5EO1A 4QHLB 4YIQB 5AYQA 1A7NL 4IRSB 2F5BH 3IS0X 3QWQB 1FE8L 4WW1A 3ROOB 2VDML 1ONQA 1A0QH 1JPGB 4YO0B 2EKSB 4XMLH 3MRGA 4TSCL 3JTTA 4KQ4L 1X5AA 2VITA 5BV7L 5JPMB 3UBXB 4XZUB 1FFPA 4QKXB 5IWLA 4UTBH 1UJTA 2I60L 3PF2A 2F8VA 3PABB 1PEZA 1J87A 1SBSH 5CILH 4YZFE 3VFSA 2RCSL 2AW2A 4P23D 3NIGE 2XTLA 4JZJA 4Y4FB 2EE2A 3VXMD 1OM3L 5GGSA 5ERWB 4P2OC 1RMFH 3QPQC 1KG0A 2GKIA 4HIJA 5FM5O 4RFOH 1FVDB 2FD6L 5D71H 3QYCA 5AYUH 1I4FB 4FA8A 2Y06L 2R1WB 3K4DA 1G7MA 3GMLB 4LQFL 3FCTA 3QAZB 3JTSA 1KF9B 3PP3H 1JV5A 2DYPA 4QT5B 3RWCB 1ZA3B 2PXYC 3MMEA 3P0VH 2D7TL 1A4KA 4LSPL 5HHOD 1MIML 1U3ZA 5ID0B 2NY4C 4HKZB 3MUGA 3NFSH 4P99A 3VRLE 1QUNA 1RJYB 1IC4H 2R2EA 1TJGL 5JO5A 2FX7H 4M8QA 3QFJA 3HR5A 1JGVH 1PKQA 3FO0H 5I9QB 1MF2H 3DNKA 1K2DB 5J9PA 4S10A 1JGDB 1Z6JT 1Q8MA 5I8KH 1A6VH 1TVHB 4R97C 5EU5A 4QGYA 3RX8A 3BPNC 4PJ7B 3UBXI 3KYKH 4MJIA 4D2NA 1TNMA 1T1XA 4PJFE 1OW0A 4N0CD 4Q0XL 3SDYH 1F42A 2ZG1A 5FOJA 4GAJH 1O7SA 1RUQH 4KKCD 1B2WH 4U1JA 1IQWL 2EDHA 3CVHL 3VG0L 3ULVD 2F53A 2NXZC 4KAQL 4YC2B 1U42A 2AK4E 1ZHBB 4QRQB 1JN6A 4MAUL 1LK2B 1FORH 3C5SA 4GMSL 3WHE1 5CHNA 1EEYB 1HXYA 2BC4A 2IBGA 5EU4B 3O2VH 4HCRH 4HUXB 4UV7H 3CZJA 4XBGA 4QHMB 4I2XA 3MO1A 3PDOA 4JPVL 1H3GA 1UFUA 2J3SA 4NN7C 3FQUB 2QV2A 4M7LL 4OI7A 3WIHL 1XR9B 4X7DC 1NFKA 3O2WH 1KJ3H 3DMMB 4PB9L 12E8H 2EDQA 5IGXH 4ISVA 3VRJA 5CMAB 3CUPB 2X4TB 4LU5L 1JMXA 1U8QA 2R1XB 3MCLH 5C0BB 1IGYA 3T0ED 4Q2ZA 2OSLB 1L7TH 2MJWA 2HH0L 2Z31D 2GTZB 1CE6A 3K81A 1DFBH 4ZNEE 5C6WH 2EIZB 3SCMA 1A1NB 4LEXL 1TZIA 4LP4A 1OSPL 3U7AA 1IQDB 2R4SL 1FNGB 5T3ZL 2WQ8A 1B0RB 3V6FB 3D5OF 4OV5B 4UOW0 1JNJA 5ITFB 4OIIH 4YHNB 1KENL 3RL1A 1KPUA 3P0GB 4UBDC 3VD4A 3H9SB 3LQAH 1WWCA 4L8SB 2FJHA 1TZHB 4PRPB 5JUEH 5DJ0A 3GRWA 5MP6H 5JIHA 4P46A 4N0RA 1ZVHA 5I8CA 1FJ1B 1FO0A 1QFHA 4OCNC 1MJJB 1UKSA 4ODTL 2B2XH 3Q48A 5F96H 3BZEB 1QBMH 1GPOL 4Y2DD 2VLJE 4ZO6A 2VWEC 4UILL 5CINH 3T0WA 2DQIL 1HHJA 3RKDD 3C60D 3MBEC 5DFVC 5C71A 3QG7H 4JO1L 4LSTH 4XC3L 5ESQB 5IK3A 1CT8A 4P59H 1SM3H 5T1KD 2E6JA 3DX9A 1JWUB 4JM2F 3IXTA 1DVFA 3X17A 4U6XB 3G6JE 1VDGA 1RU9L 4JDVB 1CDBA 1BJ1J 2VISB 1HH9B 1J1PH 1P4LB 3L3IA 1FAIL 5EZOH 5T1MA 4F15C 1YY8A 3ES6B 2C7UA 4L8DB 5E1AB 1O7VA 4N0FA 1AI1L 2PW2B 5F9OH 5I1EH 1KTLB 5D6CB 3TN0C 3VXUA 2OTPA 3MLWL 2EDRA 4HJJL 2EZ0C 3TT1H 2HMID 2FATH 4APQB 3QEGH 5I17A 4NO3B 4Z5RB 5JXEA 3IVKB 1WV7T 1I8LC 3KS0H 1B9ZA 1MCOL 3NIGF 4M6OH 4YQXH 2XZAH 4Z78B 4M43H 2IADA 1IGFH 5TQ0H 1A6UH 5E2VH 3F6IA 3V5HA 2DBLL 1A3RH 1JNHA 3W2DL 5GS0H 4XXDA 1Z3GL 4E9LA 1CXLA 1CFNB 3ARFA 1GJIA 1B0GB 1C12B 4R96B 1RUKH 5ICZB 3HC0B 4DN3H 2CKNA 1H5BB 32C2B 3QZWG 3LRSA 3VWKD 5T5FH 1XGTA 1CXEA 5FAAA 3P77A 1IEAA 2Y07L 3UO1L 3VRLF 4EI5C 4PJIE 1OLLA 3QDJA 4MJ5A 1G0DA 4Q9BA 1ZHLA 4A6YB 1L4IA 1JZ5A 4K3JL 2IPUK 4PGDB 3GEWB 3GBMH 5C7XL 4ZAKB 4HIHB 2IQAB 4G8IB 4POZC 2XA8L 2NY2C 1VEPA 3ULUH 4KJYB 4KTEH 4FABL 1A7OH 2V2XB 3IJHA 2B1AL 3GK8H 5CKAA 3SDDA 4K2UH 4RA0C 2R1YA 1URLA 1UWEH 2NYYC 1BIIA 4FZEH 3UCRA 5I16A 4P57B 1SJHB 2FJGA 5JPNB 4CNIB 1Q9WA 1U8JA 5K9JH 2X4UB 2VDNL 5ID1B 4LDEB 3W11C 4LRNL 1E4XI 4OCXL 3G9AB 2PO6D 3OWEA 5D7JC 5E2JA 6FABH 4OLYL 1IT9L 3GI9L 1NAMB 5C08E 3MCG1 5DJXA 1NBYA 4ZUTA 3V6OE 4DUVA 5IG7B 1QFUL 3TZVA 5DEFB 4NO0A 4NZUH 5D70H 3VWJC 1FZKB 1TMCB 2QHRL 3A6OA 4CMMB 5IB2A 1A6ZB 4RBPK 4WI3A 4ZS7L 3VFGH 3V6BR 4HBCL 3HC4L 1WC7B 1XGQA 4Q74A 3D39A 25C8H 5FYLE 1SYVB 5A1AA 3EOYG 4P2OA 4P5TB 5DI8B 2XACC 4G7YH 1NEZG 4P3WA 3WXVH 2C1OB 4HHAA 2EYTB 5KVEH 5E99H 3IDMA 2DAVA 1NC4A 1S9YA 5E6IB 4NNYB 1Q0YL 1ZVYA 4XGZB 4FQJL 2A6IB 5FYJD 2XN9B 4NKOB 3IJSA 2PXYA 3TCXA 4OZIE 3UTZB 3W39A 2B4CH 5I8OH 4MGXA 1KTRL 4K71C 3MX0A 5EIIB 1EJOL 4EN3D 3U36A 4MNHB 3DIFB 2YD5A 4OCWH 5HYJA 5LXGL 1NCCH 3RVUD 3CFIC 3P4OA 1QNZL 1WEJL 3RQ3A 5I1DB 2AGJH 2BVYA 2BXZA 1ZMYA 2WLYA 1PFCA 2DQGL 2WP3O 2ICWJ 1E6OH 1CXFA 4BSWA 5DRXB 3WXWH 3D3VA 1ZLVK 1MNUH 4MXWH 8FABA 1RJZB 4KDWA 3O9WB 4JFOB 4LFHD 3ULUF 2A1WH 3S5LB 5F8RC 2P8PB 4OM1H 4MDJA 3QQ4A 2VLRE 4QCIB 1MWAA 5C07A 2W0LA 1AGCB 1BJMA 3OZ9L 4CN4A 4YR6B 2QEJA 5DD3H 2XRAL 1AD9A 3QEQE 1GOGA 2ICWA 1B0WA 4OUUA 5F7FA 4YDKL 1F3JA 2I5YH 5BVPL 3WKMH 5D9SA 1RHHA 3ZKNC 2HLFD 4E41A 5J06A 5AZ2L 1FRGL 4NZTH 4JFFD 3L5WA 1JYVA 4JCLA 1P7QB 5I18H 5GZOD 1U8LA 1W0VA 4LLQB 1QSFB 2ICEA 4MD0B 4D9RE 1C5BH 2VLMD 5BJTB 1QFWL 1NCAL 4CVXA 4NZRH 1RSFA 1LO0H 3CFDB 4PJ5D 5KOMC 3LS4L 5EU3B 1AXIB 3RPIB 1AGFB 3JWOC 1A7RH 4NM8H 3JV4B 3MRMB 3LSOB 3KPSB 3GMRA 4G42A 1Y6NR 3QR2A 5DHVH 3RHWK 2BNUA 1KCRL 2HWZH 1AY1H 4FRWA 1OGAD 4ZUVA 4KTDL 3SJVA 1DN2A 4JM2D 2OK0L 4YGVB 3QDGA 3B8SA 4D9QD 3CFEA 5E6ZA 4LHUG 4F3FB 3EYOA 1NGZA 5ESAA 1UXWA 5B38A 3B3IA 2GEEA 4JO3H