1CFVL

Monoclonal antibody fragment fv4155 from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
DIELTQSPPSLPVSLGDQVSISCRSSQSLVSNNRRNYLHWYLQKPGQSPKLVIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVAAEDLGLYFCSQSSHVPLTFGSGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody fragment Fv4155 bound to two closely related steroid hormones: the structural basis of fine specificity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords MONOCLONAL ANTIBODY FV4155
total genus 24
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1997-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfvL00
3D3VE 1HE7A 1MI5A 4RSVA 3TJEH 1WFNA 2P5EA 4MS8C 3HG1D 5HVWA 3PABA 4GT7A 5I1HH 4FFVD 3VWKC 2HVJB 3QNZB 1FLTX 3KLHD 1FYHB 2Y07L 3IF1A 1G9EA 2BCKA 3HZVA 4FZEH 2CO7B 3PNWA 1EXUA 4AYFA 1TVBB 1ZLUH 3LN5B 3NCMA 1KXQE 4OZGB 3QQ3B 4PJ9C 1HNGA 2EDNA 4N0CC 3QPQD 4KZDH 1T0NA 1VADA 3UC0H 1Y0LA 3IDJB 4M48L 1RHHA 3WO4B 5IFAH 5HYSA 3F7VA 3V7AG 1AIFB 3STLB 1OAZH 2FX8H 4LPVA 2JCCF 2NLJB 2YSSA 3ARBD 4HLZG 3BIKA 5J6HB 2H2PC 3Q5TA 1KT2B 4MAYB 1A6AA 2IFFL 3I50L 3VJ6A 5K59F 3AXLB 3OXRB 3QUXD 4Z7VE 5KG9A 3GUTA 5C08E 1NMAL 3RHWF 4NYLB 5EZJB 3Q5YA 4JHAH 4LSPL 3WV0A 1YYMH 1J05B 1I1AA 3O8XC 1RFDH 5DFVC 3STBA 2JB5H 4MD4A 4P4KD 3UTZA 4OZHB 2G5BA 1HILA 3QJHB 2Z92A 4ZYKA 1AE6L 3MA9H 3OGOE 3MBEA 4PJAA 3PWNB 1X5HA 5MEND 3VGDA 1U92B 4RWHA 4XX1E 2AQ3A 1EEYB 4HWEH 3C5SA 4FQXA 5EOCL 4M8QA 4YHKL 3EAKA 2HAZA 1WITA 3MV7D 3FMGH 2UUDH 1SVCP 1OP9A 3EYQC 1MI5D 1XGQA 4YDKH 4I4WB 4KPHL 3WDJA 3QIBB 5DK3A 5IVXF 3VXSB 1KACB 5HGAA 1AJ7L 1YC8A 3V4VH 4ZS7H 2J4WH 4K94H 3FCTB 3LHPL 3NFPB 5DSCA 5T1KB 3S7GA 2EYSA 2J8OA 4PRAA 4IJ3C 1DEDA 3BZEB 3MBXL 5AZEH 4MA1B 3C5ZD 1IFHL 2O5ZL 3QEHB 3WXVL 3BHBB 3QIWC 1PY4A 3SDYL 1MQKH 3WIHH 3FFCD 4WHCA 4HF5L 3HR5B 1GGBL 2HRPL 3KHOA 4RAVB 3PHQA 4TPRH 3D18B 3JV6A 3O81A 3V52L 3E1F1 4NN7C 3DO7B 3SDDA 4U1KB 5A40E 3S88L 5ICZB 2DDQL 4PR5B 1ZLSL 2Z8RA 4C56A 1OSZB 3BH9A 2CIIB 4PJ7B 5L8KB 5E8OA 3L3IA 3ZE0E 2YRLA 4ZUVA 4P2RA 5BRZE 1S7UA 1WFTA 5IKCB 3GO1L 1FDLH 2Z91B 3DMMB 5FO8A 1HOCB 2BVUA 4MCYB 4L8BB 5IFJA 4NQCA 1V8HA 5GRVK 2EZ0C 5MP6H 4K2UH 3KG5A 5IR1A 4P3WA 4MD0A 5JPMB 1CXFA 1DBAH 3V4UL 5DWUH 3X3FH 4APQC 3SY0B 3EOBB 3GSNL 4N1HB 1HHHA 1K6QL 3RI5K 3TNNB 2ADFH 2N7BA 1CF8H 4IS6A 4W4OC 5K9KA 4PUBH 1AGCA 3U0WL 1MHPH 3U7AA 1ACYH 3PDGA 5CIPB 1G7JB 2UYLA 4OZFH 4H1LA 3SOBH 4YGAB 3SDCD 4XMPL 3MYJB 1FVCA 4G9FA 1X9QA 4OZGE 4PJXF 4OD2B 3CVHH 3SDDD 2XQYG 3BYYA 1MUJB 1S7XB 5I1GH 1U58B 2IAMC 4BSWB 1MRFL 3GM8A 3ARYA 1T7VA 3V5HA 3WDHA 4EBQH 1OSPH 4YFDB 2A0LD 3TN0D 3RGHA 4OUUB 1T0PB 2HFTA 4F37F 4NRXB 1MIEH 1UACH 5CZKA 1CFSA 2MMXA 5TQ0L 1W72H 1CFTA 3KYOB 5JA9A 1DVFB 1PEWA 4FTVD 4AMKL 1CT8B 2ZCKL 4R4FL 4JGMA 5IW6B 4PJ5D 2CLZA 3CH8A 4LLUA 5IBUB 5A16A 2EDDA 3RX7A 1I3RB 2UV3A 2PR4H 1XF2B 3TH3T 3T08A 1Q94A 5IMKA 4O2CB 5EULV 4DW2H 1XH3A 3O3AB 1U8NA 4G43A 3LVEA 3DV6A 4YDKL 2AAVA 3VE0A 2VISA 3INUH 3OTTA 1UM5L 1IKNA 4GXVL 4PY7A 2YD2A 1NGPL 2D9QB 3E2HB 3IDNB 5CEXA 2FWOB 1J1PH 3TJEL 3CSPA 1Z5LA 5GHWH 1ZAGA 1I1YA 1J10A 3B8YA 2OTPA 3QI9D 4OM1H 1KB9J 2XKSA 2GSGA 4OIIH 2APWA 4JJ5B 1KN4H 3DXAD 1UB6A 2HTKC 1T20A 3G5YA 4P2QA 4JFDA 4M7JH 4TUOA 3DTXB 3TBWA 1R5WB 3BPLB 1KLFA 2QQNL 4FFVC 3VWKD 4W81A 1IAMA 4MNGE 1KBGH 1M05B 1TXKA 5I1HL 3HFMH 2GT9B 2G75A 3RNKA 3W0WD 5CSGA 1E27A 4GS7B 5MERB 4WFHE 1QLRA 3MLWL 4DZBA 1NMCC 5EU6E 1RMFH 2Z4QB 1EV2E 5HJ3A 2F54A 3D87B 4CW1A 1DLHB 5D2NA 2IBBA 2IEPA 2Y5TA 4S1SH 1VFOA 4XCCL 3TCLB 3ZKMC 1WVZA 2P8MA 2XRAL 3IFPB 2Q7YA 3MNVA 4BELD 5IT2L 25C8L 3QPXL 2WWMD 4NKOB 3S96B 1ZHNB 4O51B 2E9IA 3HAEH 4AJ0A 1A9EA 3A6CH 3U9PH 4HKJA 1A1NA 4MD5A 1X5YA 2HFEA 3P9WB 1NBVL 4ODWA 1E4WL 1WICA 4ONHB 3SCMD 1AD0B 1T83C 5DJXB 5ICYA 2X1QA 4ZS6C 4PPTA 2FWOA 4X6CB 4PTUB 2ZG3A 4PREA 3EHBD 4R4ND 1FIEA 4RMWA 4PJIE 4WHTB 2NNAB 3HA0A 3SGDH 4EXKA 3QIUB 5GGUA 2VISB 4U6HA 1WZLA 2MHAA 4IHOB 2R0KH 3IJHB 2WMPA 4ORZC 3C2AL 3Q48A 5E5RB 5AG9A 3OJDB 2YWYA 4GBXB 4PJEB 3S37X 1CLOL 1CT8A 1X5FA 4L4TA 3SKMB 4TOYH 3I6KB 3STZB 1WWAX 2XZCL 5JLZA 1U93B 5C0IA 2W0KA 2XPGB 1IKFH 4OTXL 4U31A 2PYEE 4D0DA 2EDOA 1DQML 4V2CB 2V5MA 5DWUL 5T3XE 1X5IA 3V5HB 5JLZB 1S7RB 2W91A 1LEGA 3B9AA 2ED8A 5DLMH 2LU4A 4ONGL 5BZDB 3O2VL 4KI5E 1HXMB 2E7MA 5I1GL 4PV8B 3OJDA 4TULL 1K8IA 3VXOA 2CLVB 3OMZA 3QWOA 3O6FD 2P46B 3KYNB 3D9AL 1NBZA 5IESL 2R2BA 1KPVB 4PJBF 1QQDA 1N6QH 1KB5B 2E9JA 3L3OB 4K8RD 3ULVF 3TEUA 3UTTE 3ARRA 3HZYA 4H20H 5J6GB 3BW9B 1VGKA 3U0WH 2R4RL 5ACZA 2IANE 4QHKI 3ULSB 3W11C 1P6FA 1D7FA 4OCRL 5MHSE 5KAQF 5DEZA 1L7TL 3ULVC 4MSWA 1N7ML 4P3DA 1T7XA 4Z0BL 2MSPA 3OJ2C 4YWGL 1N2RA 4CNIA 3WS6C 3S3PA 5D5MA 5EZLA 3UTQA 1S7UB 5F44A 4M7LT 3RU8L 3VXRE 1MWAL 3AU1A 2A1WH 3I6GA 2ESVE 1OSZA 4I3SH 4IJ3B 4YHIA 4M43L 3S96A 3F6IA 5GRWA 3PP4H 3OJMB 1PLGH 5I1AA 4NFCA 2F53D 4LCWA 4WRLA 3HUJE 4J8RB 3MNVB 1FGNH 5E9DD 3D18A 3HN3A 4RCAA 2V17H 4XMPH 5CBEA 4APQD 2QBWA 1V7ML 5HHQA 3MRDA 2DAVA 4MNGB 3ELAT 1ACYL 1DLHA 5D2NB 2A74A 1FN4A 4F7EA 2SEBA 1KJ2L 3RPIB 4MJIB 1K6QH 1OD9A 4I13B 3BZEA 1FYTD 4G8FA 4JO4H 5C09A 2GT9A 4JKLA 3BESR 4PRNA 4F8TA 3V0WL 4KUCD 1EUUA 1F4HA 4JRYD 1ORSB 3KPMB 1LO0L 4NN6B 4LEOB 1HDMB 3SKJH 1NGQH 3KPSA 2AI0H 4JM2B 3LOWA 2AABL 5ALBL 5GRVL 1FAIL 5JQ6L 3DVNB 5F7FA 4NQSB 1FL6A 1PEZA 1OTSD 5IVZB 2G9HA 4PRHB 4HIXH 1TJIL 1GYAA 3C5SB 4WENB 4WW1B 5SX4I 4DGIL 3BT2L 2JK5A 5K9JL 3WNNA 1AI1L 2X6MA 3GK8L 3FO2B 2DLEA 1KN2H 1P9MC 3BIAX 3WNPA 5IMMB 5ISZA 4MVBC 3AMKA 2Z92B 4CN1A 2ATKA 3GI8H 1E28B 2O93L 4JN2A 1J1XH 3CDCA 5MI0C 3UTZB 5GRXG 3DV6B 1IAIL 5I30L 4P2RD 4WO4A 4JR9H 3BPNC 5A2LH 3RVXC 5CGYD 3N1PC 5JXAH 2H6PA 2C1PA 3TT1H 5JOPD 4Y4KD 3QHFH 3S37L 5IQ7L 1TMCB 3TZVC 3S35X 1MLBB 5IHUH 2IMMA 4X6EB 3I3EA 3O2DL 5HTSA 4F58H 4WW2A 2RCSL 3IXTB 4YDLC 2F54E 1IE5A 1KT2A 1ED3A 3QH3B 2IPTH 4GXVH 3W39B 1MHCA 3MLXH 4HWZA 1BOGB 4JFQA 2V2WA 1AIFA 3STLA 4L4TD 1ZLUK 2GSIB 4XCYA 2RFXA 2YPKB 1U58A 2HH0L 3KPNB 1MWAB 2DKSA 5FA4A 3LEYL 3G9AB 3IAPA 1NGZA 5C6WH 3C87A 1U36A 1BVLB 2R56H 1JF1A 3C5JB 1RJLA 1KENL 3FB6A 1MCFA 1JMXA 1BD2A 1MCWM 4LARL 1YJDC 4K71C 4XXCC 4UAOB 4HIXL 1FZOB 4QRUB 2P42B 1AC6A 5F3HB 3O2DA 3TBVA 5C2UB 2X4QB 3MC0A 5DT1L 4JY4B 3QFJB 3H42L 1SJVA 1IGML 2BVQB 2NW3A 4OT1H 2BVYA 1F3DJ 1CK0H 4NQUA 3RIAF 1GVIA 4HIJA 4L8BA 1XT5A 3GSRB 5E9DE 3NN8A 2FJFA 3HC4H 4NHCH 5IKCA 3U2SB 3NIGE 1BWWA 1QNZL 2VDQL 3TBTA 2KBGA 3QDGB 3DMMC 1UCTA 2CIIA 4PJ7A 3I85A 1CXKA 1NAKL 5HVHB 5GGRA 4WTXA 1T0MB 5TDOB 1I7UA 5HGBA 2VABA 3QRGH 3THML 4NN7B 1A64A 4XX1G 1DBAL 3ZDZF 3PP4L 3DRQB 4X6DF 2DYPD 4R4NC 2ITDB 3BMVA 3MYZA 3EYFA 4FQCL 4RAVA 5HD8C 2C7UB 5BO1L 5I1EL 2AI0L 6FABH 2RJMA 3VGBA 4HV8A 4HLJA 3VRJB 3ZHDA 4ETQA 4XWGH 3QZWB 2EE6A 5DMGC 1PY9A 2VAAB 1FLRL 5FUCC 4HUUB 1T5XA 4KGJA 2WZPD 3QHTC 5FYJU 3AY4A 2DIBA 1IC5L 4EUPA 5F7MC 4U49A 3M17A 1E4JA 3RP1A 5D93C 2A38A 1F4WH 3KWWA 1F4AA 2XG5A 2EDEA 4N0YL 5FOJA 3LRHA 4FZ8H 3WD5H 2VH5H 4X7DC 5E5MA 4N8CL 3T1FB 1UWEH 4ZUUB 5KVEH 2V17L 1T04A 2H26B 2OTWA 3QIWA 5EPMB 2XZAL 3O3DA 5FO9B 1I4FB 4M8QB 4NDMB 1AGDB 3B6SA 5FFLA 4MGXA 5F1NA 4HAFA 5CEZH 4P5TA 5DMIL 3FQNA 5JW3H 3KJ4B 1HYSD 3FFDA 4MJ6B 3WLBB 5I8CA 4KXZH 3B9KD 3NACH 5C0AE 1Y6KR 3E8UH 4XBGA 3MLTA 4JLRA 4LCWE 5EU6A 2EE2A 3X3GL 4LLDA 4AZ8A 4JREC 4OF0A 3VXSE 5JXED 3T04D 4G6JL 3OPZL 1XF4B 1FZMA 5BVPL 4CJ0A 1F2XK 4WW2F 1HSAB 2OR7A 5EU5A 5CAYB 3HC0A 4HUXA 2Q8AH 1IEBA 1JUFA 1OAUH 3CD4A 4OGAD 1KLUA 4QNPF 4WV1B 4MAYA 4ENED 2E27H 1YMHA 4UTBH 2GTZB 3C2AH 3REWB 5FECB 5FUOH 4Z7VA 4GRWF 4MAYC 4CDHA 3SQBA 4DKAA 1X5JA 3TFKD 5HDQL 2FDBP 4M48H 3NIDE 3S36L 2DJSA 1NC2A 3GSNA 4XC1H 1OP5K 5L88L 4HK0B 1F02I 5HSFA 2X4UA 3ZDYE 4JHAL 2YN5A 3ARWA 2VLKD 1PKOA 1NMAH 4J3XA 3RRQA 2GHWB 1YEGH 2X1XR 2AK4E 5JNYA 4A2LA 4I3RH 4LLVB 2RQ8A 3V6FB 3WIIL 1A5FH 2C4FT 5C9JB 1OOAA 1JYWA 2CH8A 1T5XB 4YPJA 3H3PL 2I5YL 3L5XH 1JZ7A 2YZ8A 4Z76B 3S8WA 3QZWA 1LE5B 5T1MB 3NGBC 4G5ZH 4TSBL 5D7IE 4MS8D 3SGDI 5MHSD 2DJUA 3NAAL 5EZOL 3ZE0F 4DJMA 3BP7B 1CDIA 3G5XA 5K9QI 1R5VB 2DQTH 1IAKA 4G6AD 2AJXH 3DPBA 5FUCE 2X4NA 4LNRB 5GRYA 4DGYL 2F8XC 4YGVB 1KYOK 1ADQA 4UIKH 5ENWA 5GGVL 1BLNA 4XC3L 4ODSL 3TLRA 1IKNC 2QTEA 2AEIT 2PXYC 1HHKA 2DM3A 2EICA 3M1BB 5HHNA 4RNRA 4LL9A 4HH9B 1D5XA 2D2OA 3TIDA 1B4RA 4HAGA 1VKXA 2BVQA 2NW3B 3HC3L 4ONOA 1MNUL 2E6QA 1D5BA 1S5IL 4OI9A 1KLGA 4GAYA 4S1RH 2X4TA 3HE7A 3PHOA 4EEEA 4OCWL 1CICA 1RIVL 4GKZA 4HZAA 3TA3D 2VNCA 1S9VB 1FZOA 4QRUA 3RVXD 5L88H 1JHLL 5TPWL 4LDEB 2GYSA 3GB7B 2C1OA 4KK9D 4LHUD 3ARDB 5DRNB 2BY1A 1NAMH 5T3ZH 3PV6A 1MFNA 4I77L 5D1ZC 4YNYA 1JGLL 3MCKB 1QNZH 5F93C 2YPKA 1TQBC 2FGWH 5IIEA 1R3LA 2A6DA 5HVFB 1EJ6A 4L1DA 43CAB 5JOFA 1K3IA 4IIQA 4UQ3B 4F80A 5GS3A 4KMTL 3S5LA 3V6BR 2NX5D 3RDTA 4Z7NE 3CSYA 3PV7A 3HNTH 4FNLL 4JRYA 5F9AC 5IB3A 1JZ8A 3BO8B 3HUJA 1OCWH 1BQSA 4YDVB 5FKAB 2BSSA 3MQIA 3KYKH 4Y1AD 1A7BA 3WBDA 2Z31B 4PJXB 4HMEA 4HIIA 2DQFB 5J13B 3K8LA 2FO4B 2WQRA 3KPLA 3FB8B 1J0IA 1GGIH 2DI7A 4UMGA 1RVFL 4O5LL 4CVXA 3QXDB 5C0CE 1QO3A 1QSVA 1JHTA 1SJEA 3BFOA 3GI8L 5EU7E 4TSBH 5EBGA 4LSSL 4XNQB 1FG2B 5GIRA 1YN6A 3SBWA 1XGUA 1ADQH 3TVMD 2XWJB 3FHQA 2YC1B 5FA3B 3FT4A 5D6DC 1CFVH 3DX7B 2AK4D 4S1DD 2ZSVA 2PW2B 1FL3B 1ZVHA 2X10A 5DJ0B 3DVNA 1INEH 1OL0A 4JDZA 4O58H 5IEKA 1DN0A 2ICEA 2VLKB 5JDJA 5AWNH 1OGTA 2D3VA 1IMHC 3RI5F 1CN4A 3P77A 3U82B 4U1JB 5I1IL 1NCBL 5BOPA 5A43C 3TBSA 1WLHA 5HD8D 1RZJH 5I8OL 1S9KC 2CKNA 2YA1A 3SJVB 4FQCH 4JY5L 3EO9L 5FAAA 1I7TA 2QKIB 2FLBT 4X5XB 1TCRA 3NPSB 3FFCE 3PDOA 3I02B 3DOSA 1AGBB 4FABH 2NY2B 4Y5XC 5EU4A 1EO7A 2HLAB 2VIRB 3RGVD 5F7KC 1ULVA 2BJMH 4OAWB 1QA9B 2E7LC 1BM3L 2C3VB 3OAUH 2NY1D 3MV9E 4UTAL 3HC4L 4NHCL 4O02L 4JFEA 5D7JD 1ZT4B 1YEIH 4L3AA 5KTEH 3GJEB 5ESAB 1KCKA 4YHIB 1F00I 2H45A 3VWJD 3R4DA 4KWUA 1ACZA 1WWWX 1S78C 3DROA 3U36B 4XAWL 4NZUH 4Y88A 1DSFH 3FO9B 3MRMB 1OD7A 4NC1C 2O5ZH 3MACL 4HUMB 5ICXB 5CEZL 2GJ6D 3QEGH 4TVSa 2DICA 3JWDC 3CSBA 1KJ2A 5HVHC 2VSDA 4OCSL 1D6EA 3VD7A 1B4JL 3IETA 4MZ3A 3RZCA 2A6IB 4TPRL 1CU4L 1RURL 3D85B 4X99B 3F5WB 4X7SH 4ZSOA 4WY7H 1YEKH 2NZIA 1VGKB 4HF5H 1GOHA 4EI6A 4KUCF 4MA3B 1S5HB 1MQKL 5E4EC 3WIHL 2FHCA 5KSBB 4ETYA 1RVFH 1N0XL 1KB5A 3L95B 4BQBA 4PJHF 4RGNC 4DCQA 2A73A 1NBZB 4DKEH 1RK0B 1IC7H 2FJHB 2V7HA 2F8OA 1NLBH 5E2TL 1XAUA 4G80A 1KCLA 5BZDA 5ESVB 4DK6A 3CFEB 2ATPA 1FJ1A 2NY5C 2OTUA 2XIDA 2MQ0A 1AE6H 3QUYD 4ONFL 4U6VH 3EYQD 5F88B 3DX8A 4Q2ZA 3D2UA 5JIIA 1BM3H 4LVNC 1NC4B 3GRWH 1ZT7A 4EI5B 4C54A 1RHFA 2B20A 1H8NA 1LD9B 4LNVA 3KNBA 3MZTA 3DX6B 2LE9A 1KN2L 4OV5B 1R3IH 1X5AA 4OCXL 2V7HB 4Z18A 5HYJA 3Q6FA 5LGJA 3C5ZC 5IV2A 1Z3GH 3IU4H 5HYEA 3EO9H 4Z95H 1QRNB 3MLVH 1H3VA 3UJTH 4GLRI 3DRTA 2VKWA 3HCVA 3GMLA 1RUMH 3SKNB 2ENSA 3TWCH 5DJ6B 1N6UA 4E0RA 3MV8D 1GXEA 1LDPL 3O2DH 1UT9A 4KTYA 4G6AC 5HI4D 1AGFB 1F2QA 5DC9B 3UTSB 1Z9LA 4X98A 4ONHA 4TTGA 4ZFFA 4YHYC 2IADB 4MQTB 1FO0B 3H7BB 4UDUA 1BFSA 5A2KH 2Y7QA 3VXUD 2AK1H 1X5LA 35C8L 2Q7NA 2EO9A 4WDIB 1PG7H 4Q9CA 4HCRA 5LBSL 2NY5H 4IDLA 4LIQE 4K7FB 4NQXA 1RZKC 3HMWH 4NQDE 2VIRA 1MAKA 4KVNL 1B0WA 5I1KL 3LEVL 2NY6B 1S3KH 5FHAH 4NC1E 3I02A 1RU9H 5HJ3B 1YPZA 1MVUB 1JGVL 5TDPA 4BK5A 1AFVL 1T1YB 1D9KD 3BISA 4ODTL 4OQTA 4EIGB 4ERSH 5L2KE 2R2HB 4YHNA 4P46A 2OCFD 1L7IH 5I16A 5IVXE 3UP1A 4JQXA 2QQKH 4UT6L 3SKJL 4JB9L 5FYLL 1X44A 5D6CB 1QSFB 3WLWC 3JWDL 2B5IB 4LIQH 3GSUB 2EYTB 1ZGLB 4Z0BH 5HHXH 5IMLB 2ICEB 1BFOA 4AK1A 3B5TA 3G04A 4H1LG 5IB5B 2PYED 4NZRH 1MJ7H 4JJ5A 4HIEA 1KIUA 1FSKC 2ZSVB 5B38A 1RULL 2OMBA 1U8PA 3RVTD 4QGYA 3VA2C 3P0VH 1GIGH 3QNYA 2A2QT 1Z5LB 1AH1A 2DQTL 4X5WB 5F71A 4MMZC 2ADJB 2FSEA 2X9YA 5I1JH 1FGNL 5IOPB 5JPNB 5HHOB 4QT5A 2QL1A 1NGQL 5C8JA 2VXVH 1G7IA 3OXSB 1R3KA 5JW5A 3FOLB 4JO3L 3T77A 3ULUD 1F3JB 3OR6A 2DJ4A 1XF2A 2GK0B 5D2LB 4K9EL 4XCFH 3NGBB 5LWYL 1RZFH 1TJHH 1C16B 5DEFB 4JN1H 3IU3A 5IB1A 3QJFA 3D1MC 2X89D 1HSBB 1S9XB 2R23A 2DTML 1A8JH 3ZDXF 2PW1A 1RZGA 2XKNB 4HPYH 1W0VA 3LMJL 3RDTD 3O9WA 4PJAF 3HTLX 5F9WC 5F1IB 1KNOA 5D70H 1K8DA 3VFRB 5FM4A 5E5UB 5IIEB 2HT2C 5E1HB 2VTFA 2JIXD 4AM0B 3PIQB 3T3ME 2EKSB 4ZNEA 3GBML 5F7DB 4Y19D 3KLDA 1NCDL 5EFIB 1FVCB 4G9FB 5DO2C 4P23D 1HKLL 4CAGA 4M4PA 2GEEA 1T5WA 4U6XB 3NABL 5LQBH 5GRUH 2HMIC 3JWNC 3MJ9A 1ZSDA 3V0VA 3U46A 5DRNA 3AS3A 1NKOA 2OBGA 4KKAC 3HNTL 4FNLH 5TDNB 4K3EL 4PRPA 4IS6B 2DLGA 3QG7H 4ZO9A 1S7SB 3BJ91 4M8VA 3SE4A 2JCCA 3HE7B 3PHOB 2F53E 5I18L 3LS5L 3CNKA 4OIAA 1O7VA 1VKXB 4NZTL 1A22B 2D31A 4OFKA 1V3MA 2WWMC 1ZHLA 2I24N 4WO4C 2ESVD 4MCYA 4U3HA 4RBPK 5ECJE 3GMNB 4UTBL 3VGFA 5BW7C 4WUUA 4TSAL 4LKXA 3TYFA 2DB8A 1UQSB 5GZNC 3O6FB 4FQXD 3BXNB 3C60B 5CD5D 5ICZA 1KTLB 1RU9L 1T1WA 4KUZH 3CVIL 4PJFA 1UFUA 4NO5A 5C3TA 1YNLH 2YBRA 4KFZC 2Y23A 4F3FA 1OGAB 3V52H 3MODL 3LIZH 2ADGB 2ZUQC 1QSEE 3IDYB 3JWDH 3C9NA 3UPRA 5K9QG 4R2GD 3V4PL 4FQLH 2NY5L 1DUZB 4ELMF 3GSXB 2IH3B 4TOYL 2IQ9L 4QOKD 3RL1B 4ZFOB 4UINL 3CDGA 2UZIL 1MI5E 3RVVD 3D5OF 1WFOA 4P2RE 5DJAA 1KEGL 4RGND 3TNMB 1SJHB 1QVOA 2OXHA 3S5LG 3BZ4B 5SWSE 4LLVA 1MJUL 2R2EB 1RZJC 3ZT6A 1NGWA 2UWEE 1JV5B 1HHJB 3QG6A 4JFDE 3ARBB 5TH2A 1Z6JT 3LDBB 3H9YA 3GBLA 4Y4FC 5DRZA 4OFVA 3TJHD 1PYWB 4HQQH 4X4ME 3RUGA 1HH6B 3V5DB 2OJZH 3BX7C 4YC2C 1Q0YL 5D2LF 2HT3D 3MRPB 4JJHA 1VA9A 4C58B 2HG5A 1Q0XH 1L6XA 2ZWLT 5BXFB 4HG4K 2YD3A 5D1XA 4HUVB 4DN4H 4NM8H 1KSRA 4MDIA 3L9RA 1YY8B 3O6FC 4P59L 4ZUSA 1R3IL 4OCXH 4XPFL 2KDGA 3HE6B 1G7HA 2GAZB 1JRHI 1FZMB 1JL8A 4U1LB 4X7TA 4YHLL 4EVNB 2G5BB 2VRAA 2GW5A 1VEPA 3QDJD 3KR3H 1U8JB 2DQDH 4TQEH 4OLWL 3MLVL 3TWCL 3V79C 4YE4L 5DRWA 4R3SB 3HE6A 1PZ5A 1G6RB 3T3MF 1T6VN 3Q6GL 4U0RC 4F7MA 2J7LA 2H9GA 4PGDA 1CWVA 3U7WH 5FXCH 1RUAH 3DUUB 4IRJA 5KSAC 4OLVL 4KKBC 1UM5H 1OW0C 1MHPL 3O6LH 4QXGL 4JHWH 4RIRB 4QOKE 2FX8L 1U95A 3BEVA 5DRZB 1IGJA 4X7CC 1B0RA 3GRWA 2Y36H 1CQYA 5DQDH 4KHTH 3CCHA 5E2TH 3QQ3A 2BXYA 1JGEB 4E42A 5IW1B 1PZUB 3LN5A 4NJ9H 1NAMA 4PB9H 2YRZA 4EN3D 3Q3GB 3CDGB 4G42B 1Z0MA 4OFIA 2APVA 4M1CC 3TZVB 1WAAA 4YLQT 5EC1B 1MVFA 2C7UA 5I9QB 1KPUB 5B3NA 4FXGB 3DRQA 1P5UA 1KJVA 4TVPE 3OF6A 4IM8A 5C08B 2ZSWA 4CMMB 3TC9A 3DURA 1EFXB 4WUKH 5FGRA 4F58L 5SWQB 3IXAA 4GRLC 5DJ2A 1DBMH 1LO3L 1QFHA 4IOFC 5AZ2H 1A21A 2LQRA 1B3JA 3MRFB 4NRYB 3A0OA 3ZYJA 4OZGF 3QDGA 3TBTB 3IDXL 4NO0A 1P1ZA 1MJUH 5JDSA 5C3LD 1MFBL 2R69H 5I6XB 5E4IA 3TT1L 3NN8B 3K7UA 4I18C 1GJIA 4XP6H 2PETA 2V9QA 1QR1B 4L3CA 2VXTH 4NZDA 4Y19E 5IROC 4BH8A 4JY4A 1LP9B 4FFZL 2QADB 3L1OL 3C09B 5E95B 3V4PH 3ZL4H 3I3DA 5CGYC 1EAPA 2OZ4A 2OR9L 4BYHA 3CLEH 1CL7I 1ZK9A 1OWRM 3KLAB 4ZFGH 3S88H 5CUSL 2XOTA 1RJLB 4MXVF 2MCPL 2EDLA 2X9XA 4A6YL 3PJSA 1JF1B 4M6OL 1H3TA 2YD9A 5T3XH 5E8EA 4I8DA 1T1XB 4PJ8B 4RAHA 5TFSL 1MWAA 2DS4A 5FA4B 2QEJA 4X6CF 1NEZA 1A1OA 3BKJH 3ECBB 4OLUH 3K2UH 3GEWB 4PGCB 1NCBH 4XB7A 1P84K 3V8OA 1W0VB 3IXTA 4ZNCD 4M5ZL 4PG2A 4HS6A 5GISH 4K7PL 2PUQT 1EJOH 4P23C 4AENB 5D7IF 2VC2H 4R8WH 3H8NA 3QSKB 5IB1B 5J89A 4DFHA 4ENEC 5DEFA 4MMXC 4U7KA 1CG9A 5CZXC 4IOIA 1NANH 3T2NH 4OF7A 5EU3B 2DL9A 1ZOXA 2F5BH 5JW5B 5DI8B 1I9EA 1Y6MR 2YPLB 4JN2B 2WIIB 1MCSA 3RA7L 1OM3L 1P84J 3BKMH 3BKCH 4H88H 1DZBA 4NQVB 3B9DA 4WO4D 1J8HA 3JWOH 4S0TD 4GW1B 1NFIA 3DXAA 5DEGA 2VDRH 3SDCB 3RBGA 3QDMB 1UM6L 3H9SD 4NP4H 5EN2A 4LP5A 5CEZE 4JQVA 4BJLA 1FL6B 5ISZE 5CD5C 2DQDL 1OCWL 2FBJL 3CCHB 1CR9L 1MJJB 1A7OH 5FUZH 5I30H 1HQRB 4BFEA 1VERA 4MJID 3KPSB 1GH7A 3PWPB 4WUUE 1ZGLA 1MHHA 1QSFA 3C6SB 2NY6C 4R2GC 4ZXBA 4HGWB 4LBEA 3HC3H 2NY3C 3ZSTA 3IGAA 4MXVE 4GMSH 3RPIA 5L9DH 1YEEH 1FYTA 4GW5A 5TDPB 2W1NA 2YXFA 4FQQB 2FB4H 3L5WB 3EZ8A 1BF8A 4FTVA 4MNGA 4XNUL 2V5RA 4NC0B 5D7LA 4PRPE 3U0TA 3GSQA 4KDTA 4KTEH 4D9QE 1JWUB 1NGXA 4JFOB 5I71B 1ZT1B 1MCQA 2ARJQ 4Y4FD 4MB3A 1MFDL 4QRRD 4BZ2H 4FA8A 2Q3ZA 5IVOA 3KYMB 4NM4L 4KTDH 2F53A 4LCWD 4A6YB 3ZKSD 4HHAB 5MEOB 1IAOA 4MWFB 3LEXB 3I6GB 5D1QD 5JHDB 1BEYL 3QT2A 4QTHA 4ZUSB 4LVHC 3ULUL 2FHBA 3DJ9A 5EZLB 3SDCC 1N2RB 5DVOA 4N0UA 1BFVL 1W72A 3QXVA 1OAKL 3SKOB 3MRNA 1R0AH 1ZWIA 2R29L 3TM6A 4O2EA 3WXWH 2DIAA 5DJ6A 3ULUF 3QDJA 1NGYB 1TETL 3NAAH 5EZOH 3TN0C 1SVZA 4P5TD 2AQ1A 3RL2B 4XCCH 1JYXA 3MJ7A 5CCKH 4KQ4L 5LGHH 5TH2B 1K5NB 2ZPKL 3TESA 5K93A 5CLWA 1LDSA 3AB0B 3CFBB 4G6MH 3VFVB 3FQTA 4CMHC 1YMMB 5FYLD 2PKDA 1JNNH 1VEOA 2NX5E 4YDIH 1VFBA 1P4BL 3C6LA 4PGEB 1HH9A 3VFUA 3MJ8B 1F58L 5DD0L 4ZG1A 2IH3A 1W72L 4Q2ZB 4JHZA 5E08H 4EDWH 3MRCA 1J87A 1XR9B 1U8IB 1T66C 3UPRB 1BZ7B 1JRHL 2AKRA 1F4YH 3CFIC 4M1DL 4F15B 1RUPL 2DWDA 1PDKA 5L7XL 1U9KA 2MPAH 2OL3B 1RUKL 3HS0A 4NO5B 4GBXA 4I18B 3HRZA 3BDYL 4PJEA 3FJTA 3TP4A 3D9AH 4PRPD 1MREL 2CD0A 2BRRH 2VDPH 1AY1L 2PTVA 4I0KA 1HINL 4EN3C 1MAJA 3QEQE 5A2IH 3FQRA 2Y06H 5CD3B 4NQCD 5E8PA 1DUYB 2E9WA 3GMRB 4GXUM 3D69B 4KV5E 4L4VB 4AIZB 2A6IA 2MKLC 3QUYA 1HHGA 5ANMA 2XZCH 2VDNH 4XHJC 1N64H 1OTUD 2R9HC 4HS8H 4QRTB 1I9IH 1AD0A 1JYVA 3RHWK 3F7YB 3GKZA 2APFA 1N4XL 4C83A 1UJ3B 4ODWB 5D6DA 4ZSOE 3ROOA 3GSOA 3O3EA 3QUZB 1MIEL 4OZ4A 5L2KB 1WEJH 3NFNA 3P4NB 3D48R 5L6YH 4O00A 3BPOB 4LGSB 2PXYD 4NFBA 1RJYA 1X4YA 1EJOL 2UY6A 3IS1X 2JJSC 2CMRL 3GBMH 3BKCL 2JTDA 3CFJA 2N4IA 1QOKA 3OG4B 3TGXA 5I76A 2NYYC 1CLYL 4NNYA 3N1GC 2P7TA 3UAJC 4QRPB 4WJ5A 3PIQA 1BVZA 3K46A 4XNXL 4TTDD 1UZ6F 4OAWA 5F7EL 4O02H 1WZ1L 3U7YH 1RURH 2CO6B 3LD8B 4GLRH 3D25A 5KZCD 2PYEB 1BWMA 3SE8L 1AGBA 2Z4QA 5DD5L 1F90H 2J3SA 2AK4A 1RZFL 3EGSA 3HB3D 3IU3B 3VMOA 5MERA 5C0RH 1EIBA 4J1UA 5E6YA 4M5ZH 2BFVL 1SY6A 2B2XL 2OR9H 4P5MA 4YK4C 5DMKB 5C07A 2OI9B 4FN0A 5EO9B 4LIQL 1IEAB 5D1ZD 3OR6B 2VOTA 5FYLH 1BBDL 3G5VA 4WFFE 1NCAL 4OD3H 1JWMA 2VL5A 1DN0B 1I3GL 4UNTA 2Y6SD 5C8JB 5C0ND 3VXMA 2IANB 2MCPH 4Y4HD 4PJDF 1T7YA 5DXWA 3DX7A 3HE6C 4MXQD 2W0FA 4C59B 3WL9A 4KJQC 1BBJB 3MRHA 4R90L 3BD3A 3NFSH 1MOEA 4M9OA 5LBSH 4XP1H 5F7LB 2P24A 4H25B 1UJ3C 3QXDA 5FV2A 1NMBL 4GKNA 3KPLB 1XH3B 3O3AA 1KXTB 3P9LB 4KU1A 4LVOC 4GQPH 4YPGB 4XP4H 5HHPA 3C6LC 3WJJA 4X4YB 4ODTH 5FYJD 2CLZB 4R26L 3D0LB 5C0DA 5E6IC 2UVFA 1JWSB 2OQJB 4YO0B 1DVFA 2G5RA 1S3KL 1XF3A 3CFKA 3UYRH 5K9OB 3WHXA 1G1YA 3LKPA 1CFSB 4ZQKA 4JZJB 1I8KA 3RWIA 3DHJA 4OSUL 2PYEA 3NCYP 4U7SA 5DFTA 2X09A 3REVA 3VI3F 3W11D 3MV8A 1IQWH 5EOTA 4Y2OA 4GS7C 1IJ9A 2AK1L 5FYKU 3G6DL 4XVJL 4X9GA 1Z3GL 5I76B 2EE3A 3QUXB 3PWPD 3ARTA 4GQ9H 4HS3B 3IAGC 2NY3D 2Y7QB 3S97C 1QPXA 3QNXB 1C5DA 1TVHB 4HSQA 3UC0L 4X4ZA 3ARDA 5DQ9A 3DX9A 1OAYL 1U8QB 2P45B 3MSPA 3GRWL 4KGLA 2XN9E 4X98B 3MLYH 3UTSA 2KL6A 3QIUD 2IPKA 1EUTA 4QRTA 4ZS7L 4YE4H 1GAFL 1AQDA 1KLGB 3D2UD 2W60A 2ICCA 3N1QC 5TQ2L 1U41A 4NQTA 2IJ0C 1LO0H 4G9FE 3FZUC 2H1PL 1AR1C 3UO1L 3E2HC 2Z91A 3DMMA 1R24B 2KPNA 5AD0A 5EO1A 4QCIB 5GS1C 4P2RB 3AREA 4KKLD 3ZDYF 4M6MH 1FZJA 4AY0A 3Q6FB 4YGVA 5I9QC 5LGJB 4BQCA 4F7TB 2EC8A 1CD1A 4OV5A 4AG4H 4I0PA 4OZIB 1Z9MA 2IPUG 3B3IA 3QDGE 5KVFL 1UA6H 3LD8C 1WWCA 4FRWA 2C5DC 2JB5L 4KQ4H 4OM0L 3PHQB 5ADOL 3ZTNL 4RA0C 4S1QL 1M1SA 2DBLL 4PB0H 4X5LA 4JZNB 2BSRB 2B4CL 3G6JF 3BHBA 4YDLB 1IL1B 3WO3B 3ROLB 1VFBB 3LKOB 2J5LB 2EYSB 3MO1A 2XTJB 2NMSA 5JR1H 1U0QA 1RK0A 2A73B 1YEDB 3FCTA 5IB4A 1NBQA 3QO0A 1G7LA 2VDLL 4ZO7A 3FL7A 4DK3A 1A4KB 4DVBB 4LEXL 3RWEB 4HKBA 4FQLL 1XCQB 1CYGA 3BPCA 3F5WA 1JN6A 4M1GL 3Q5OA 1U8OA 1D6EB 4UT9H 1N0LA 1D5ZB 1CLYH 2A83A 4XVTH 4XPBH 4HDIB 3BIBX 1AXSB 1KLUB 1SJXA 3MBXH 5AZEL 4QO1A 3RWFB 2KKQA 1MPAH 2A6KA 5H94A 5L2JA 4HZLA 5JHDA 1HSAA 3RDTC 3DROB 5HHVL 2ZP0T 3WS6A 4LCUA 4YHMH 3R8BB 3VG0L 3EOAA 3MBED 2HT2D 4OZHA 5J57B 1A6UH 5DC4B 2MFNA 5FGCB 8FABA 3LQMA 3IVKB 1FORH 3MLTB 4JLRB 2AXFA 3X3GH 4NNXA 4XHQA 4QTIL 4X4MA 1DQQA 5DUPL 4P4RB 5EBWB 3HG1A 4PG9B 1H5BB 3WFEL 3E3QC 1A3LL 2OS7A 2C3VA 2XXCB 4JPVL 1RJZA 1K2DA 2ZCHH 3ESUF 3NCEB 4KK6D 4GRLA 3WS3A 2HMID 4U6TA 5KS9F 3NZ8B 1CGSH 4FTVB 5E2VL 2AJSH 1A6AB 1KJMB 1H9VA 2AEQH 4O4YH 4HPOL 2E27L 1I3VA 2QKIA 4UV7L 1UWXH 1JK8B 5DLML 3QIWB 2NLJA 2ZPKH 3BP6A 5F96L 4C55A 5H2BA 7FABH 4YHOL 1YEFL 5SX5K 1A7QH 5I18H 1DBKL 5DVMA 1A9BB 3VRIA 5EA0H 5DD3L 2YK1L 5CBAB 4QTIH 5DUPH 2HN7A 1N26A 2LU7A 3OKOB 3MLSH 1A6WH 5IEKB 4M62H 5CZVL 5DJ0A 1UADC 3T2NL 4HPYL 3JV0A 3CIQA 4FHBD 3C09C 4LSUH 5GZND 3RIAK 2AJ3B 1H3GA 4R9HA 1FH5L 3JVGA 3LS4L 3NA4A 2YUVA 4OZIF 2VLJD 2EDYA 4HJGA 1NFIB 5DEGB 4DTGH 5JW3L 4Y16D 5ALCL 4PBVC 4NUJA 1CGYA 3UX9B 2Y06L 4GMTL 4ZTOH 3RTQD 3O8XD 4MYWB 4NJAH 5DFVD 1JGDA 2E7BA 5ADPL 1U8HA 4TN9A 3MRRA 3KPOB 3BP5A 3WN5A 2D7MA 4L1HA 4OB5H 5BV7H 3G5ZB 4OZFG 1I1RA 2AXJA 4XZUB 4AIOA 3HI1B 3NVQA 4M6AA 2NR6D 4UUJA 3OKNA 1BFVH 1UXWB 4UU9A 2JJTA 4K7PY 3O41A 1IC5H 4WTWA 5MEQB 3B4NA 4YDJB 3P0GB 3RDTB 5HHXL 3SGKA 3RWHB 1I9JL 1FE8H 5GS0L 3GNMH 4YHML 2W07A 5KSBE 4ZD3L 4NN6C 1OW0A 1SMOA 3VFGH 1T1XA 4IEFB 3ES6A 3MLZL 3RWGB 1KN4L 3V95A 3ARFB 4KJWC 4NWTH 5C0BE 2O61B 1OHQA 2X4SA 3M8OL 5IVNA 5DS8A 4JGUA 2OJEA 1A6PA 2OYPA 1NGZB 4RGNB 1EHAA 2PF6A 3R06A 4WWKB 3VGAC 4XCNA 1HCFX 1S5IH 3G6DH 4XVJH 4QHUB 5EUOB 4DQOH 2X4TB 1BOGA 1MJ8H 1LP9F 3TH4T 3L5JA 3AROA 3QH3A 1U3ZA 4LK4A 1DL7H 3PL6B 4WW2B 1MRDL 3WEXB 4ISVA 1L7IL 1MRCL 2I9LB 4LSTL 1JNLH 3JV5A 3RVUC 3FB7B 3CFDA 1HN1A 1QSEB 4PJAE 4FS0A 1DQJA 3DVFA 4HWBA 2RHEA 2VDMH 4U1HB 4ZOCA 4BFIB 1MFAH 3IJYA 3NH7L 2BHYA 3FT2B 3TFKC 4UZGA 2DF3A 3G5ZA 3QHZH 3ULVE 3EYOB 3QHFL 4YIQB 2BDNL 3QIUC 3I3BA 3L3DB 3FRPA 1IAKB 3VD9A 1U8HB 2GITB 3MXWL 3VI3E 1WQVT 2H2SC 1PAMA 2EDQA 3K2UL 1PQZA 3EO1B 1ORQA 2ZUUA 4S2SA 1ETZB 2DI8A 4WWKD 3LKNB 5J8OA 1P4LB 3UTSE 3DIFA 2ICWJ 4JFZL 5EC1A 4W6WB 2NW2A 4ORGB 1Q9LA 1NUGA 1RZ7L 4WW1A 1TZIB 2G60H 2NY2C 4B5EA 5C9JA 4Z7WA 4FQXC 1JGEA 2XZZA 4E42B 3P73B 4PUBL 4LCCA 4JM2A 1PSKH 4MXWL 2I60H 4POYA 4G9FD 2HN7B 5C6TL 4LEOA 3B2VH 4ZODA 4P9MH 3HPLA 4X6FB 2FEDC 3BEVB 5E2WL 1CTNA 2DD8H 2FX7L 1J12A 4KKCC 3BE1H 1Q9WB 1J8HE 4P2CG 3AGVA 1ZS8A 2YD7A 3QDME 3LQZA 3JWOL 3AM8C 4JPWL 4GUPB 2Z35A 3W9DA 4R97B 4HG4J 3H9HB 2YPVH 4JRXE 4Y2DA 1MLCB 1K2DB 4XAKE 5TE6L 1WT5C 1WJ3A 3QUMB 4LLWA 2GQHA 4P4RA 4Y2DC 4KQ3H 5GQBA 4TUKL 4JEGB 3VFNA 2RGSA 1YN7B 5ALBH 5EOQH 1WWBX 1A1MA 3OJVC 4PYGA 3S98A 2XQBL 4KI5D 1PKQE 3KPRB 1DSFL 4KK9C 1MPAL 4WFEE 3V0WH 4DKEL 5D5MB 3WHE0 4XVTL 1QKZL 4UT9L 1NQBA 5F1NB 5GGVY 5D8JL 2A83B 3NZHH 2O5YH 4MA7H 1WTLA 5ADOH 1DBML 1ZLVH 4KQ3L 2WNGA 1OP3K 1QFWI 1HIMH 1V7MH 5KTEL 1FIGL 3LPFA 3WJLA 4B41A 1A4KA 3ARBA 4X6DE 4W4NA 1JI2A 3B9KA 3KWWB 5IB4B 4YBHA 2R2BB 2FD6L 5GZOC 3T2PA 3KYNA 3PF2A 1FNFA 2V6HA 1TJGL 1AO7A 1KXVC 5SX4H 1A14L 1MH5B 1T4KB 3B83A 4QHLA 4LQ1A 2Q1EA 3ROLA 2EDHA 1E4XI 4HWNA 3RU8H 4MQXD 3ARGB 1LEGB 1J88A 2WWKO 1FFRA 3GMPB 3SDXA 1YEIL 3GSXA 4GW4B 4W68A 4XMLL 2A9NH 4PJ7E 3QQ4A 3HNSH 4C4KT 1INEL 3C9NB 3FQUA 2D4DA 2CDGB 4J12A 3PXHA 1BZ9B 4TUKH 1GHFH 1T1ZA 4G7YL 5T5FL 4OZIA 1KC5L 1CD1B 1EHXA 1SYVA 3O6FA 1TLKA 3IFNL 2IQAB 3I50H 4LKXB 3BE1L 3ILPB 2X70B 5H37G 3LH2L 3MA9L 2HH0H 3N50A 2Q87A 1ZHLB 1MHEA 4U1SB 2W60B 4PJGB 1PSKL 2WBJC 3BEWB 5E2WH 3FQWA 1U3HB 5E94B 1B2WL 2JCCB 4G8IB 4EDWL 5DD6B 5GS0C 2HKFL 2UUDK 5DD0H 4OLYH 1CICC 1H3XA 2ITCB 5M94B 3EBAA 2HA1A 4P4KB 5EIIA 5IG7A 1FFPA 2CDFA 1MFEL 1J8KA 1DL7L 2VXSH 3RGVC 4KMTH 1MAML 5C0BD 5LWYH 2B8OT 1MRCH 5BW7A 2Y9RT 1II4E 2V7NB 4KK5C 5HVGB 3ALWA 2MWCA 1PBYA 1T2XA 3R0MA 4XBPA 4L8CB 4AM0A 4JFFB 2XXMB 2V2WB 5IT2H 5JHLL 3SCMB 4J4PC 4YFLI 3MRQA 4K07A 5BQ7A 1S78D 2BRRL 2VDPL 4NWTL 4LFHG 1WCQA 2VR4A 3HLAA 3LKPB 3KXFD 5FYJH 3TPKA 2H3NA 1QBLL 5IHUL 4DZBB 1MY7A 5IM7A 2AV7B 1NSNH 1GIGL 5SX5H 4YZFF 2XZQH 3CXHJ 4JO1H 4Y5VA 1M7DB 1BEYH 1C5CL 1IQDB 1M05A 3GNML 1J0KA 3QUKB 4IRJD 1NCAH 3HFML 4YPGA 4FQ1H 5KN5B 3CXDH 3T77B 1R5WA 4PRHD 3V6OA 2LAAA 4MJ5A 4HKZA 1CE6B 4D9LH 3KPSD 2Q76A 3U6RA 5ISZB 1U91B 4JM2D 5B3JF 3RJQB 4JB9H 5IMMA 2FSEB 3ZE1F 4YJZL 2F5AL 3FO2A 1E4KA 5DD5H 3W0WB 4G6ML 5MENE 1MCPH 1UYWL 2ZNWA 4CADA 1NSNL 1KULA 4ERSL 3SBWC 4CADB 3F6LA 4R6UA 1ONQB 5DGQA 3W0WA 4OF8A 1S9WB 3GSWB 3MRJA 3AREC 3GBNH 2VL5B 2CMRH 4HKZB 4LHUB 4O9HL 3G5VB 3I2CH 5I74B 3DYOA 1FQ9C 5CHNB 4PRNB 4MA8L 2GFBB 3S4SB 4Z77A 3TYGH 1J18A 1I9IL 3CZJA 1FN4B 5D2LE 5BZWA 3HLAB 3BQUC 4OLYL 1UB5A 5BQ7B 5TF1L 5FM8A 2IAMA 1JPGA 3MOBL 3PDDA 1G9NH 5E56A 5TE4L 5C0AB 2NXZC 4PLJC 4ZAKB 3ULUE 1OT1A 3VXME 5KSAA 4FQHB 4K7FA 4XBEH 2HJKA 3ARGD 4XPTL 5AYUL 3WIFB 1OPGH 2X42A 4PJ5B 4CMHB 1MF2L 4LCWB 1CXEA 1HINH 2E5EA 1PJ9A 3CFJB 5C07E 2DLFH 3MRLA 4U33A 4LCIL 1G7JA 2UYLB 3TA3A 2EDWA 4YEEA 3B9VA 1T89A 1WIUA 3UTQB 1JJUA 1CVRA 2OZ4L 5F6IC 4UILL 2Q8AL 4QXTB 3H9ZA 5FK9B 1R5IA 1KCUL 1IAIM 5T5FH 4ZO8A 1YC7A 2FNBA 2EDRA 1A3LH 3TVMB 1G7QA 2HP4A 1R3JA 1G7QB 4WI8A 4WHYH 3S36H 2A9ML 3HCVB 4NQCB 4LPYA 5TGBA 4HPOH 2KQMA 1KJ3H 2JCCE 5EU6D 5HDBF 5D9SA 1OARL 4ZUWB 5H8DA 3SKUD 4KH2A 2YWZA 3IRZA 4EUPG 3KPRD 4R7NB 1MY5A 3MTRA 3T8XB 5SWZD 2WQ8A 3DARA 1RUPH 3P0VL 4I0CC 4KDWA 5IQ9A 4JM4L 1KG0A 1RSFA 1YJDH 1ZT7B 1H3PH 2DQJL 3SDXE 3VDAA 4ZAKA 1U6AL 1CVSC 2ERJC 4R7DA 3EKCA 3DX8B 4N8CH 4WIQA 3MV01 1HIML 1OGAE 1J1OL 3QXWA 4XMLH 5BS0B 5ITFB 4L8SB 4PJHE 5KVDL 3SDYH 3GKWH 4L4VE 1H15B 4LRNL 1FVEA 5AYQA 5DMIH 4KJQD 2VZOA 3UMTA 5INCA 4HUWA 2Z9TA 2FO1A 4F33A 1ZGLP 4O2FB 4XWGL 4RFEA 3RVWD 1NEZG 5I66B 2Q20A 2FX9L 3QPXH 4UNUA 2ZG2A 5JMOC 4MA3A 5IUSA 3BPNB 1I1AC 4WUKL 3VXRB 4MNHB 1I8IB 1HKFA 5JA8B 3TF7C 1T66D 2VQTA 5I0ZA 5KVFH 4RDQG 1U92A 2W65B 2HJFA 3KGRA 2GY5A 4FTVE 2F5AH 1G9NC 5ICXA 1UZ8A 1QLFA 2NY4D 2VLLA 3IDGA 4QWWC 3KHQA 3P11L 2NQCA 4LLMA 4J3VA 1A9EB 3N1FC 4NIKB 4Y8AA 5INDA 2YPLE 1M6OB 4K55A 1HILB 1T7ZA 2YA2A 4FQ1L 4RAUA 3OGCA 4NKOA 4OLWH 5A3IC 4IMLB 4UOW1 1EPFA 2P5WB 1QHPA 5DQJA 3QDJE 4JFEB 1XIWA 4RRPA 3O9WD 4S1SL 5KVGH 4OM0H 4XHJD 1CGXA 3KS0J 3GUTB 1MCJA 1WZMA 2HLAA 3VJ6B 4X8JA 4PJDE 2Y5TB 4ZUTA 3UZQA 3L5WA 3O45B 4X8XA 4N0UE 5KJRH 1SM3H 1RUAL 1FVDB 1B0GB 4OQTL 3AB0C 1E27B 4N0CD 4RMUA 1H0DA 3RA7H 3QA3B 1Q9WA 4OGYH 4NKQB 3SCMA 1DE4A 3HI6L 1NCWH 4ZPVB 1BD2D 4ZXBB 1GOFA 3ILQD 4L9LA 5CJQH 5DURD 2V7NA 2UWEB 4WFFD 4JFDB 3QEQA 1TPXB 1HQRA 1FCGA 5K59E 4P2QB 4OV6F 4YHLH 5B8CA 2X4RA 2YD8A 4LOUC 2A77H 3MGTA 4JRWA 1HYSC 4NT6B 1LO4L 3VXRD 5DD6A 2A6JA 4GQ9L 4GXUN 4F7CB 4Q6IB 4GW1A 3JTTB 3FQWB 3UJJL 1U8LB 1XGUB 4NCDA 4WGVB 5EIQA 2W9EL 4AH2A 4NQVA 3X11B 3NTCL 3CVHL 1PQZB 2WIIA 3EO1A 4Z7UA 4CVXB 5LJYH 1YZZA 2B7DT 1HCVA 1QFUH 3MMEB 4Z8FL 1CL7L 4HCRL 2Z31A 2MOVA 5B4MC 1CFQB 4R4FH 4BFIA 4FABL 3ARFD 5CJBA 3MA7A 1JTPA 3BO8A 4FFWC 3HZMB 3CC5A 4LRNH 2N1KA 4Q58C 5KSUA 1WBXA 2VO5A 2VXTL 3UZVB 2DM2A 4N5UA 4IIQB 1CBVL 3QCVL 5EB9A 3VGAB 4S1RL 4Y0GA 1FE8L 3HI6H 5T3XD 3SE9H 2HT3C 4BQ6A 4GOSA 5C0CD 2YEZB 2FJGB 5D72L 5L0QC 1H3PL 2JB6A 4DGIH 3MYJA 2X5PA 3QI9C 1CE1L 1NMCB 2H32H 1Q0XL 2ZUXA 5T1LA 3MFGB 5T1LB 4QHKJ 2GJ6B 1JNHB 3CXHK 3M8OH 5F7EH 1NBYB 3U7YL 2HTKD 2APTA 3ES6B 1YEKL 1Q9OB 3GSVB 4TSAH 2E6JA 4PBXA 5DZLA 1P69B 3IFLH 1MCOL 5LXGH 4RMTA 4BH8B 3IJSB 2YPLD 2OR8A 4Q9BA 3OR7B 4OZHE 1BQHA 3RWJA 1CDYA 3VFMB 5EC2A 3VMNA 1OF2A 4ODUB 3EOTL 3R8QA 2VLJB 4XP9L 4YBLC 4Y4KA 3T0EB 1A4JB 1JP5A 1L4IA 2N56A 4XVSH 5BCAA 4YAQB 1X5GA 4YXKH 5JDSB 3MA7B 3LHPH 4ZUVB 5FGSA 5ABDE 1C08A 1ZA6B 4WI6A 4NFDA 3G6AB 4AEFA 1A1MB 4LNRA 1VENA 1BHGA 3WN5B 4JKMA 2EZ0D 3JV6B 1CD9B 1RZKH 2ZSWB 3VW3L 4M4RA 1XFPA 3WFCL 2K1MA 43C9A 3UJJH 1CQKA 1FYTE 2PYFB 4JM2F 2YKLH 4Y2DB 4WFGD 3JWOC 4D0BB 2AV1B 1MFCL 3DSFH 5DUML 3QQ9C 3TZVA 5T1MA 1EZVX 3OHXA 4Q9QL 5TF1H 2D03L 3OAZH 5F89B 3SCMC 3LQZB 5BMFL 4Z5RA 3VD4A 3D3VA 3EJYC 1FNAA 4EDXA 3LDBC 2P5EE 4P46C 4KXZI 4GAGH 3L6FB 1QRKA 3CZFB 4JANA 4MA8H 1JNLL 5CZVH 5AWNL 3V2AR 4HS8L 2PTTB 3U0PB 5I8EB 5KOVC 1M71A 4K3EH 5F1SA 4ZPVA 3MLUL 3EZJB 1DE4B 1PKQB 3KPRE 2G60L 3MREA 2D0HA 4ZDHA 1G0YR 5D1QB 2DLFL 1JTTA 1YMHB 5BOZG 4JFZH 1EEZB 2AXHA 4JCMA 5FV1L 1T80A 4FP8H 1NL0H 3L3JB 3NZ8A 2D7TL 1X3DA 4U1NA 2VDOH 3C08H 5F7NC 4JZJC 3EW3B 4DGVH 1V3JA 5E2VH 2WUBH 4M1DH 1RJZB 4R3SA 43C9B 5FDWA 1KYOJ 1XIWB 5DJZB 5C6TH 3WXWL 4GAJH 5C2BL 5D7JA 4BH7B 3U48A 4LLDB 3VH8A 2R15A 3QEQD 4K7PX 5B39A 1I9JH 3BGMA 4JZOB 4Z9KB 4X7TB 3WN5C 3IJYB 4JKWA 3AAZA 5HYQA 2WANA 4QRQB 2XTJD 5DA0B 3CUPB 3IDGB 1QBAA 1CIUA 3AXLA 5I8CB 3PXJA 3WNLA 5B22A 4IOSD 2D7OA 4HX1B 2VLJA 2ZCLL 1ND0B 2PXYA 3O8XB 5JW4R 5D1XB 4HUVA 1CLZH 4IRSB 4KRPC 1AFVH 1AGDA 1MF2H 1JHKL 5IFAL 2Q3AA 4NKDA 3TBYA 5DUBA 4OB5L 4JY6A 3ULVD 1J5OH 4LSRH 5ADPH 2R1WA 1RUML 1AP2A 1D6VL 1XGRA 5D7IB 3RZWA 3ZE2E 4RMSA 2J5LC 2V9TA 5CEYA 4RFEB 1J0JA 4TSCL 1NLDH 3KPTA 5C0GA 1KCVH 3C8KB 4ZNEE 5C70A 2DTSA 5ITFA 4JAMB 5DJCA 2F54D 3OG6B 1KTDA 1NJ9A 5K33A 1N5YH 4PJ9B 3L3HB 1CR9H 4NPYB 1VPOL 3MNWB 3ARXA 5KSBF 5DK2B 3CVIH 4GAJL 4YDJA 5GGRB 2KQNA 1EK3A 2NXYC 4EN3A 2ID5A 5I1KH 2EDFA 4P2QD 5ILTL 5MI0B 3VFTA 5HI3C 1UM6H 1BD2E 4QYOA 1IC4L 1A7RL 3S6CA 4KRPB 4X6BA 2Q86B 5JHDD 2HT4D 3DETD 3IKCA 4WGWB 1R24A 4P9HC 3MOAH 5JOPE 3LEYH 2VQ1A 2DWEB 2FEDD 3CXDL 5ESQA 2R0ZL 3VA6A 3JTTA 1UEYA 2A9NL 1BQUA 1T2JA 1WV7T 1A6ZB 1E6JH 3IAQA 5IWLC 1CGTA 2NR6C 3QAZC 4XVUC 1EBPA 5KS9A 4MDJB 3E0GA 4WNQA 4FFWD 2XWBB 1BVLA 4TNVF 1ERNA 3CFCL 1ROWA 1UKSA 3OV6A 5I1EH 5EOTB 1UXSA 3GJFA 4WHYG 1A6TA 3F12A 3BP6B 4UIMB 3REVB 1Y6NR 4PRDA 1ED3B 4XT1C 2DTMH 1CLCA 2HKHH 1QEWB 2IF7A 2XKNA 1RZGB 2ZJSL 1EA9C 2XTJE 1OB1B 1RD6A 1QP1A 1RUQL 1P53A 2BNQA 2BSTB 2KZ1B 4OZFB 1W0WA 2FIRT 4MB5A 1CE1H 3WS3B 1A6WL 5C08D 4YR6A 5D2LA 2GK0A 1MCRA 4M3JA 4PS4H 1T21A 4JY5H 3U4EB 1DP0A 2P5WA 3DO3A 4EBQL 4WO4B 1CK0L 4J23A 3BZFA 4EUPH 1E28A 2ORBH 5INDB 1NMBH 3ARQA 4HUKB 4LCUB 4L4TE 3O4LB 1LO2L 4DKFH 1S9WA 1ZEAH 1N3NA 5HI4C 3SOBL 4X5WA 4CUCA 3ZKXB 5L2JB 2F58H 2AERT 2D0FA 4R90H 1JPSL 4R4BA 1BREA 3IDIB 3RGVA 1H5BC 2JKXA 4H26B 3O4LA 3CAFA 1P4IH 2VXQL 3OKEB 2Z8SA 1S7WB 4N0YH 5HGGS 3GSUA 5I75C 2GK2A 3K3QA 4L9LC 5D6CA 5C9KA 1HHIA 3PL6C 5D71L 5H35B 3GO1H 5C07B 1I8LA 1FG9C 3TO2A 5CKGA 3QQ9D 1F4XL 1ZLWH 5CJ8A 1W0WB 2BFVH 2DBLH 3LKRB 4K94L 2ADIB 4KVNH 4XXCA 5EOQL 5IEHB 3BZDA 2F15A 2BY3A 4KPHH 2R39A 1XCTB 3W9EB 5CBEB 3UJTL 4QRPA 4NQXB 4WJ5B 4XBPB 1O5DT 4XH2B 2GKIA 4P57A 4WDIA 5I73C 5IQ9B 3ALXA 1QSED 1VFUA 4XGZB 1RJYB 3B43A 4XP5H 2FIKA 4PB9L 4XPAL 5EIIB 5IG7B 4JQIH 3IDMA 2VLRA 3UYRL 4LSVL 1OAQL 5EZIH 1A6ZA 5DRXA 5EORH 5T33H 1NCTA 1FSKB 4P9ML 1AGFA 1JHLH 5TPWH 4G8IA 4L3EA 5KVGL 5MENA 4MVBD 4OCWH 3MGOA 1AQDB 1FC2D 4JHWL 3MLYL 5BVJA 5ITBL 3X13A 1R5IB 3ULUC 3U79A 1SM3L 1JYNA 4V1DE 3W81A 4KI5C 2X70A 4DN4L 3TZVD 3HB3C 4ODSH 4LF3B 2OM5A 3Q2CA 4P59H 3MRLB 1D5IH 2GJZB 2OSLA 3QXAA 2GUOA 1LQSR 3HMXA 5EWIH 3QUXA 1TZGL 3VFWA 1HXMA 4KRPD 5IGXL 1GPOL 4HWBL 3MFFA 1BFTA 1RUKH 5JQHC 3MNWA 1N8ZA 3WUZA 3W9EA 5C0AA 5JXEC 3OKDA 3HHRB 1NCUA 4WI7A 5C0NC 2BMKB 4JE4B 1DBBH 2FH8A 3A6BL 2X44D 5IEHA 4UBDD 3QISA 1XF3B 5DO2D 4JPIA 5E8DH 3AS1A 4MXQC 4PLKC 2R1YB 4NC2B 4PG2C 1JWSA 1QUNA 4Z7WE 1DR9A 5BJTB 5GZOD 3S37H 4X4XB 4NM8L 1AO7B 1PG7X 3H9SB 3LRGA 5IF0B 5D71H 4X4YA 4PJDA 4F7PB 3CFBA 2Z93A 4UIKL 2DQIL 3L95A 1INDH 3MV7A 5DTFA 1Z2KA 1S7WA 2AJVH 3OAUL 3RTQA 3SE3C 1ITBB 2VLMD 4XP1L 2AJXL 2NNAA 2OJZL 1NGYA 3QDJB 4JFEE 1EHLH 4PTUA 1H3UA 1NCNA 1KJ2B 3WL9B 4ZFZA 4D9RE 1JPFB 3BN3B 4MQSB 4BKLB 3CUPA 3L5XL 1TQCC 3BP4B 4URTB 5C92A 3S9DB 2IANA 3FONB 2AXGA 4NBZB 3KPRA 5GS0H 2VYRE 2HT4C 3OAYH 1WCBB 4CU6A 5DVNA 2WIMA 1Z9OA 5C7XL 2BOCA 5B39B 3FB5B 5JW4Q 4PLJD 4ZOBA 2X7LB 5CP7A 1I8LC 2FECL 4POZC 4RQQB 2FYYA 5D7JB 5EUOF 4JO4L 5DD3H 2WLZA 5F7HA 2EO1A 4LDOB 5EBMB 4R0LB 2BC4B 2BVOB 2WUCL 4P2QE 3LIZL 5GGTA 2X4PA 3H9HA 4KHXL 5KAQG 5FF6A 2NXYB 5IP4A 2DKUA 4U6YB 4QHNB 3RJDA 1I1FA 4EQ2A 1HQ4B 1PG7W 4XVUD 3K0WA 3U30C 1I7TB 4QEGA 5SWZB 1J86A 2R0KL 2XFXB 4X9BA 5ACLA 1W2KT 1UXSB 4LRIC 3MV9D 5HHOD 4LAQL 2P5WE 2IC2A 5I8KH 3I9GH 2JJWA 4L8DA 4XNMA 4MDJA 1MSPA 4I48B 3G5YB 1DEEB 5E9DB 4M3KB 5FCSH 5KANG 4UNVA 2FBJH 4G8GE 3D3VB 4YQXH 4Q97A 4JVPA 5C0FB 5DDHA 4B0MM 3TV3L 5E6IB 4ZAKD 3SDDC 3EDFA 2WINA 3A6CL 3LPWA 1OPGL 4LCIH 5ANMB 3LKNA 1MFCH 4M6NH 4U1SA 2EXWC 4X83A 1MCDA 3GMRA 3LQAC 3BKJL 4X0KB 2R0WL 3L3GB 3K4AA 3KJ4C 3QULA 1NFDA 2OP4H 3L3DA 3T09A 1LGVA 1GZPA 4R96A 4LPXA 5TE4H 4O2CA 3G6JB 5C09D 1MFAL 3T4AB 3WFDH 4N0FA 1UWGH 4YQXL 2XWTA 4U1HA 1ZMYA 2DQUH 1VACA 3RVWC 3PWJB 3IDUA 1PW3A 3JBG7 4Y4FB 3S36X 2DQEH 4Y4KB 4ISVB 5DK2A 2AQ2A 1TJHL 4Q74A 3N85L 3RY6A 3SGEI 1DQMH 3GZKA 3SHSA 1SEQH 2B4CH 1VGEH 4PGCA 3RY6C 5FCUL 3VXUB 3LZFL 4GW4A 4L4VD 4YHOH 3RKDD 1I85C 3WFHA 4WWKA 3K1DA 4Y5VC 1A7RH 4LQFL 1NANI 2CIKB 5T3ZD 3X14A 1C1EH 5DHVA 3C8KA 1MH5A 1T4KA 2FLRT 5E1AA 2GJ6A 1N59A 1SHMA 2C4XA 3B9KB 3H9SE 2JB6B 3BQUD 1AP2B 4M1CD 4OKVB 3TT3L 1TETH 1HHHB 4NQEE 2CRZA 4IRZL 4QKXB 5CILH 4N8VA 1RI8A 3F7QA 3VXUA 4WV1C 4FMFA 1RZ8A 3ARGC 5ID1A 1GSMA 1FCCA 5HHVH 2YA0A 4PRIE 1WBXB 4HX1A 5IFJB 5I17B 4RGOH 4PLNC 4OKDA 1FO0H 1SEBB 4JDVA 4UU9B 1P1ZB 3WUWB 4B7LA 5E8OB 3HPJB 1DBBL 1OVZA 2VITA 1SY6L 2P48B 4OM1L 1M7XA 4NP4L 5BV7L 3G08A 5E8DL 2EIZA 4PIRF 3QEUB 3T4AA 2NY1C 3IXAB 5AZ2L 4N68A 4NO0D 1KTKE 1J5OL 3GMQA 3FO0H 5JXAL 3DURB 3VD5A 4PJGE 3WUWG 3QFDB 5DJZA 4KRMB 1WC7B 5CJQL 1KJVB 1RIUL 2ESVA 2DQIH 1G7MB 3ME0A 2IWGA 3NTCH 1NAKH 5IGXH 1U8LA 4FQIL 2E9BA 2A6JB 5I73B 3H0TB 1FNEB 3IU4L 1D5IL 3KDMB 4GO6B 4OSUH 5DDHB 3VG9B 5L8JB 4ZS6D 3V6FA 1EFQA 2BNRA 5JMRA 5DD1L 5B8CB 2BHUA 4HGWA 5HY9A 4I48A 4QXUL 2VLME 1M71B 5F6HJ 3CX5J 1FHGA 3HPLB 2UWEA 3P30H 2B4CC 4P23A 3QWQB 4F57L 3CZFA 1JGUH 4JANB 3ALPA 4HXAL 5HYIA 2QSCL 1ZTXL 1DQTA 4GSDL 2JF1A 2VZTA 3U30B 2FGZA 2K7QA 1OAYH 5BRZB 3NIFF 5MP6L 1HK6A 3BJLA 4QXGH 5FM5M 4E41B 5I1LB 1OAQH 1FNEA 3KDMA 1N0XH 1BX2B 2NCMA 3O45A 3WMSA 5F9OL 4F7MB 5KJRL 3DXAB 3NCJL 4X8JB 3QR2A 5C86A 1MELA 1RZKL 2ESVB 2YHGA 4PJAB 4APQB 2V5SA 2VH5L 1H5BA 2W0PA 1XF4A 5SWSB 1ORQB 4G7YH 1A47A 1Q9KB 5DQJB 2ADFL 2VMFA 1YECL 2GITA 2EECA 4IDJL 4PGJA 1I1AD 4KK8D 4WI5A 4RQQA 2AABH 8FABB 4MD4B 3TN0B 1PX3A 3OGCB 1VCAA 2BOCB 3BH8B 1U42A 3C60D 3G08B 2RIKA 3ZKQD 3FN3A 3SEPA 5KG9B 1EEUA 1DQJB 3D0VA 4WFED 6CGTA 2DMCA 4KJPD 3MACH 3ZYOA 4MDIB 3ET9F 2I9LA 1VB9A 2B5IC 2FATL 2C4FU 2VZUA 3MRBB 4LGPB 4QWWD 3VFMA 5F7UA 5EUKB 4NDMA 1BQLH 1U8OB 4N9GA 2M26A 5D5ME 3QRGL 3WJLC 1CU4H 3HE7D 4QY8B 5FOBA 1REIA 3DGGB 3P9MB 1FPTL 2PO6D 3L7FB 3QO0B 1RK1A 5I66A 2LAGB 1U8KA 2K7PA 3RQ3A 5E2JA 4DEPB 3QI9A 2R2EA 3CU7A 4OZGA 5CLTA 5CJXA 2VC2L 1WSST 2V5TA 3DYMA 2QLVB 3C5ZA 1JF5A 3X14B 4M93C 5DJAB 1TNNA 1C1EL 1WFUA 4OD3L 4OBSA 4HJ0C 1V5JA 3PQYA 4K71B 2H2SD 2YN3A 3QIBC 1DUZA 5JUEH 4BSVB 3LZFH 5D7JC 2OL3L 3OKDB 1FDLL 5C0CA 1OGAA 2XACC 3QDHA 3E6FA 1X6LA 4YH6A 4U7MA 4A6YH 5MEQA 4HFWA 1A2YB 1C12A 1XR8A 1QLEL 3JTSA 5J06A 3SE4C 3OKNB 2OSLB 3QXAB 4R7NA 1NCCL 1E0OB 3N9GL 4Y1AE 5DJ2B 1RAMA 4ZUWA 4N0FB 3CH1B 3TPUA 2Q8BH 1JBJA 3GSRA 5BVJB 2R0WH 2G2RA 2WW8A 2I60L 4PJCA 1F4YL 3NPZB 4D8PA 1EVUA 5JOEA 5GS2D 3KR3L 4CDGC 2A77L 3S35L 12E8H 2X4QA 2F19H 4Z7VF 1E6JL 4JFDD 2WBKA 2BVTA 3WE6A 1IGCH 4FMKA 3UBXB 2JJUA 4UV4L 3ARPA 3DX9B 4PJBB 4ZXBD 1DEEA 1BD2B 3FFCB 3TA3B 5DVLA 1IZJA 3C5JA 3FOMB 1G7PB 2Z0BA 4HS3A 1IM9B 4L9LB 3I9GL 3KPNA 1NCDH 2ERJB 2M2DA 2MTPA 4HQQL 1IC4H 5E24E 3NMEA 4M7LH 5D7KE 4H8WH 3NH7H 3TT3H 3MXWH 4NQED 2X4OB 1UB5B 1XZ0B 2XTJC 1QG3A 1RZIA 4ZQKB 2BDNH 4B53A 2ADIA 4JKKA 4KMQA 2H9GB 3QUML 2IG2L 2OQJA 4X6EA 4YO0A 3O2VH 3DBXA 5CMAB 4Z77B 1PZ5B 4HGKC 1OP5H 3ULUH 1R3HB 1PVHA 5FDYA 5CHNA 3GHBL 5C0JB 2R0ZH 3CMGA 3SN6N 4GKNB 3BRFA 3KXFE 3ORJA 2XA8H 1G7IB 3EOAB 1BIIB 2CJUL 1B9ZA 4LDLB 3GSWA 2AXGB 3KLHC 4LLMB 4ELMB 3PE9A 4L29B 3BP4A 3IT8D 1QLFB 2A6KB 5H94B 3U7WL 3MJ6A 1AXSA 1HWGB 4I77H 4KUZL 2WBJB 3UROR 5GGVH 4K3JL 1BJMA 3GI9H 4MQXC 2NZ9C 2G9HB 1N3NB 4M00A 5J4MA 3WFDL 1JN6B 2IFGA 4ELMA 2OP4L 3U6RB 4M7KH 5JHLH 4GFTB 4U05A 4X6DA 5HGHB 1HHJA 3B5GA 2FZ3B 4PJDB 2H2PD 4DAGH 3BD4A 2ICWI 2I26N 1I7ZA 2PR4L 4I3RL 5BJTA 3UTTB 4P2YA 1AQKH 2ZOLA 5HI3D 4PJ7F 2J8UE 4CU8A 2SEBB 1YPZB 4W4OA 1L7TH 1NC4D 4WTZG 3VU2A 2X4OA 4OCRH 1LEIA 3D25B 4P46D 1EEQA 3SQOH 3MODH 3O4LD 1YNLL 1TZHA 3C08L 2YBRB 3EIFA 2EYRB 3JXAA 4NNYB 3VFWB 5F6HI 3DNKA 4I0PB 4OCNC 1G7PA 2EH8L 2DMBA 5C0EA 2HTLC 2GUOB 4ODHH 5JZ7D 4N1CA 3H7BA 4UDUB 3MLWH 1CTOA 4Z7NF 1FZJB 1KTRL 4YX2H 3GJFH 2P5ED 1XEDA 5KVDH 3AU1B 2PNDA 4WHDA 1KIRB 4C83B 5B8CC 1OTTC 4A2MA 3MRGA 1FP5A 5CKAA 1T7WA 4PJGA 3FKUS 3RAJL 4BSJA 4JREB 1GOGA 1SBSH 2G2RB 2DWEA 1JTOA 5F96H 4L3EB 1KPRA 5FK9A 1YNKH 1FGVL 2BNQD 3OKMA 3X12B 4YX2L 1KIRA 2IBZY 4QYOB 1F5WA 2VDRL 3V6OE 4UV7H 4M6OH 4DVRL 4YXHH 5CUSH 5C0EB 3DX6A 1K8IB 4M03A 4XP5L 4E5XA 3HRZB 3QIWD 4IRJC 4MQ7B 4Y16A 2I9TB 1CGSL 5F7DA 4LLAA 4FQHA 2YKLL 3EDKA 3KJ6H 4FZ8L 4PJCF 2VL4A 4NPYA 4J6RH 1XR9A 3HE7C 4BSVA 3L3HA 3QQ4B 5F88A 4D0DB 3PQYB 4KMLB 2NY0D 3RWIB 3GMPA 3SDXB 4YEFA 4ONFH 2PW1B 1IGYB 3ARGA 4KJYA 7CGTA 2DLIA 3QDGD 5GGRY 3S4SA 1C16A 4XPBL 4G8EB 1BVKA 1HWHB 1YMMA 3ZT7A 4NBYB 5CEYB 2FZ3A 3ZYIA 2DLHA 5H35A 3FRUB 1RK1B 4LGRB 5HGHA 3S34L 1GC1H 4LHUA 3LEVH 4HJ0D 4U6HB 2R1WB 3MJ7B 3MRIB 5KSVA 3RL2A 4ZSOB 3MRJB 1JZ4A 5CSBA 3EFFA 3IDYC 2VLJE 1P4IL 4N9GB 1BGXH 4IRSC 3RGVB 3SKOA 1ONQA 3V5KA 4IRSA 4PP2B 1BQLL 1ZGLM 4P2OB 4HKXA 4RWYL 1O7SA 2EDTA 1YPZF 3FO9A 1DQLL 4K9EC 1AD9A 3D0VB 1UVQA 3VFOA 3BKYL 5IHZA 4QRQA 1V7NL 1IAOB 4MWFA 5EG6C 4KROC 3J7HA 3QCVH 3DETC 1FV1B 5H37H 1JWMB 3SE9L 4LCCC 4HULB 2F8VA 2ED7A 3BUYB 3LSOB 2JELH 2VSCA 5C0JA 3VFSB 2A0LC 1AJ7H 3H42H 3QUKA 4YR6B 3U4EA 5FB8A 3ZTNH 4P5MB 3P40A 4WVRA 5DMKA 5EUOE 5FDWB 3TCLA 1A6VH 4YC2B 4WI4A 4J3OC 4JRYE 1FNGA 4F2MB 1KB9K 2FB4L 1LO3H 1CFBA 2MQ3A 5DFWH 1CL7H 3BOVA 1QYGH 4PY8J 2FHFA 5EOCH 1F45A 5D1QA 1XZ0A 4LKCA 4KI5F 3F58L 1KENH 3MRQB 1PKQA 1EVTC 4WEUD 1RY7B 3F12B 4OCMC 4N9OB 3T0VA 2IMNA 3RFZC 2YD6A 2MNUA 5J1AA 3U0PA 4GSDH 1ZTXH 1IM9A 4N5ED 2DD8L 1RZJL 3PWPA 2VLKA 2YMXL 4HW6A 3MLPA 1TPXC 4Z0XB 1XIWD 4UV4H 5C6PB 5KS9B 2Z31D 4P49A 3V6OC 2VN7A 4KDTC 5M95B 3Q1SL 3MV9A 4CVZB 4EDXB 2IG2H 1FFPB 2CDFB 3ROOB 1D9KB 2APBA 5FA3A 5D2NE 3OB8A 1T3FA 5F9JA 3AS2A 1GZQA 4NKMA 5FO7B 4PJCB 1FG2A 4XNQA 3IDNA 5GIRB 4FQIH 4HLZH 2HFGL 2D9CA 3GMLB 2E7HA 3DRTB 4ZFOL 4G43B 1MAMH 3SDAB 1BJ1H 2EIZB 1MFEH 3FT2A 4X9HA 4JFED 2DYPA 1I3RA 4PYHA 1NPUA 4JVWA 5F70A 1NAML 1U2HA 3F7PC 3HS0B 5JQ6H 1B88A 1A2YA 1C12B 1CIDA 1TJIH 1UCBL 4QOKA 2DWDB 4EI5A 3T0EA 4DOHE 3WYRA 2VE6A 3AFLA 1U8IA 1J1XL 3FAXA 2XT1B 4HFUH 4JR9L 4HEME 4P3CH 3G9VA 1MJ8L 4OGYL 1QR4A 3VFUB 4LSVH 1KJ2H 4CBPA 3MCKA 3C6LB 4PGEA 1NKRA 3PL6D 3GSVA 4Z7OF 4W70A 5LAXB 3NIGF 3JUYA 3QI9B 4LPCA 1KCSH 2IBGA 4JG0L 4UOW0 2CR6A 4S0SD 5D93B 1KELH 1UENA 3GB7A 3MX0A 2OXGA 4CVWA 1FIGH 5E6ZA 4BZ1H 3LV3A 1I3GH 3DGGA 5A3ID 1D6VH 3MLRH 3S34H 4LSRL 2CGRH 4NKDB 3TBYB 1D5BB 4V2BA 2AS5M 1ZWIB 3V0AC 4MLSA 4MNQE 4MJ4A 3MRBA 3CC5B 3JUZA 5I1CL 5KZCB 1HHKB 2ZCLH 4IOFD 4Z78A 2CLRB 1BLNB 4GG6E 2WK2A 2Y07H 2VZSA 2DDQH 3HI1A 3AAZB 5HYQB 4NCC2 3DVGA 3N1MC 1V3KA 2J4WL 3T0EE 4G8GD 3MMEA 3BH8A 2MKWA 4Y19A 1J0YA 5SWQA 2OI9C 1YEGL 2JJVA 2X4NB 4R96B 5GRUL 1EFXA 3VFNB 2XN9B 2J12B 5EH1A 4Z7UB 5BS0D 2NX5A 1A7QL 1OP3H 2QSVA 1KEML 2UY7A 2JJSA 4KDVA 3K8KA 3MNZA 4WFGE 4FQQA 3PDOB 4NT6A 1U3YA 2AEWA 3OBAA 1FYTB 3LKQA 4XMKH 3EFDH 4KJWD 3MREB 5CJ5A 2I5YH 1K4CB 3GMMA 5I19H 1NFDF 4GRMB 4JPVH 5T5NG 4PRID 1V3LA 4F8QA 1MHHB 1MCNA 4KKNA 4OBRA 5D96B 5B3JE 4HK3J 4GRMA 4JDZB 1YYLL 2OZ4H 4OD1L 4NWUH 5C7XH 5H2BB 4U2YA 3KJ6L 1KCUH 4YXHL 4Z6AT 5LKNA 5J3HD 4UBDC 1UWGL 4UILH 3NIFE 4POUB 3VXTA 2ED9A 3DUUA 4AIXA 4QHNA 4U6YA 4TSCH 4ZUTB 3KLSA 4ORGA 4R0LC 4HUXB 2PYFA 3DSFL 4D9RD 3MBEB 1SJEB 3CFCH 1SBBA 3QCUL 4PG9A 5C09E 4Q6YA 1MCBA 2X41A 3RKDC 4X9FA 2H32B 1LE9B 2R1XA 3J8F7 1UH4A 5DD1H 4PJXA 1WCBA 1I9RL 4JN1L 1C08B 3ZKND 2B1HL 1NBVH 2MJWA 3WUWA 3B5HA 1F13A 4NGHL 3FRPG 4M5YH 4BKLA 1AHWC 3LN4A 3CSYB 5D96C 3SGJA 5DMYA 1A4JA 2QQQA 1KCVL 4P5TB 2HJFB 2W65A 3DWTA 2HG5B 1BQHB 4XWOD 4UQ3A 1ZVSB 4IRZH 5E0QA 5DA4A 1NEZB 1P7KA 1XCQA 3ZKXC 1GGIL 4U1IB 4LVEA 5CCKL 3IDJA 3UTOA 4NN5C 2D7PA 4V1DA 4OKVA 4Y8DC 1YNTB 5TJWK 2XRAH 3HR6A 1IRAY 1ZANL 1XGPA 2WUBL 3PWPE 4F15C 1JNHA 2ARJB 3KYKL 2Z93B 4LCYB 4CVUA 3OX8A 5EWIL 2VKXA 2LVCA 3HNVL 3TYGL 1NL0L 4FP8L 3ARFA 2YUXA 4EUPB 4RGOL 1QVOB 1KCSL 3W0WE 4ZMAT 3TNMA 3W5MA 1TVBA 4L8SA 3ARUA 3PNWB 4LFHD 2XA8L 4PGBA 3O3BA 3I2CL 3HZVB 1N5YL 4BK4A 1YMME 1NDGB 1SYSA 1VGEL 25C8H 4HV8B 4PB0L 3VRJA 1CDJA 3RWHA 2DQEL 1C5CH 2ITDA 4LP4A 5I2IB 4OIIL 4LLYB 4RZCB 2ENYA 2EEAA 1S8DB 5HPMA 1MCIA 3HNVH 4JO1L 1VACB 3C60A 4AG4L 4JPKL 1J1PL 3QUMH 1CI5A 1G6RL 3AREB 5E99L 3UJIL 5EO1B 3V9FA 3QULB 5JHDE 4PFEA 2QQNH 4KZEH 3WLWD 5E03A 4P4KC 3ZTJG 2EIBA 3LS5H 3WHE1 4M7JL 4NUJB 1KPUA 1L9NA 1J0ZA 3KPSE 3LRSB 5FYJE 1CLZL 2W0LA 3QP3A 1J11A 1RJCA 4ACPA 4PRHE 2BXZA 3BAEL 4I3GA 1JZ5A 4Z76A 2IPKB 3L5HA 4WCYL 5F3HA 3U1SH 4LASH 3GIZH 1GL4B 1FBIL 3BQUB 1G0XA 3LQAL 2VLRB 4AEIH 5T3ZE 5IW1A 1K85A 4AL8H 4WI3A 2X4RB 1N6VA 3MR9A 1B2WH 3CMOL 3V0VB 1ZHKB 2FIKB 3EFDL 2GTWA 1T5WB 4U6XA 2HKFH 4XGZA 1IC7L 4RX4D 1TCMA 2E7CA 4OF3A 5IHBA 4P5KB 4XRCA 4WUUD 5B39G 2P47B 2X4UB 3NPSC 3RX5A 4FQJL 4UQ2A 4PJGF 4MHHG 2GSIA 3KXFB 4ZOAA 5SWZA 1M7IA 1K8DB 1MHCB 3ZDXE 2IAMB 3MROB 4QF1B 4Z7VB 2LABA 1I1FB 2GTZA 5E6ID 4P48A 4NUGH 5FF6B 4D3CH 1IEBB 1G6RA 1EO5A 3I6LD 3JVGC 1MLBA 4NWUL 5GISL 2GFBA 3ARDC 2BC4A 2BVOA 3VWJA 5FB8B 4RMQA 3MLSL 2VUOA 4NNXB 3DECA 4PJ8D 1JPTL 2CRYA 1F3JA 5GGTL 2DLTA 4BQ9A 3P9LA 3L1OH 8CGTA 1YUHB 3FB5A 5TFSH 3A67L 3QBTB 1EERB 3FONA 2I27N 4JQIL 4PS4L 3BN9C 4H26A 4K8RL 4QNPE 2KUTA 1UZ8B 1TTUA 1BBJA 3MXVH 3RWFA 4HKXB 1DQLH 4X7FC 5T3XL 1YDPA 4LMQE 5DF0A 3GK8H 2VJXA 3B6SB 5CINL 2ZCHL 1MEXL 5B38B 5IVZA 2COQA 4EIZC 4FFZH 5C1MB 5D1ZB 2AJVL 3QIBD 5IB5A 1PYWA 3CVHA 1OGAD 5ID0B 1E6OH 3UTPD 4U6VL 1YEJL 2EDBA 3A67H 3MV7B 5DTFB 3O11A 1G7LB 1JV5A 1AR1D 3P4MA 5F97E 2LFGA 2RR3A 1DBJH 1MFBH 3DLQR 2AJZB 3NZHL 2QADD 1M7DA 3MZGB 4HUWB 5INCB 4E41D 3LKOA 2BSED 4EKXA 1SJHA 5IM7B 1IFHH 2I25N 4Y7MA 2XA3A 4JZNA 2NTFB 1KEMH 3SJVD 4W6YB 2YUWA 4P9HH 1FPTH 2ZJSH 3HI5L 4Z8FH 5HHQB 4AQOA