1CFVL

Monoclonal antibody fragment fv4155 from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
DIELTQSPPSLPVSLGDQVSISCRSSQSLVSNNRRNYLHWYLQKPGQSPKLVIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVAAEDLGLYFCSQSSHVPLTFGSGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody fragment Fv4155 bound to two closely related steroid hormones: the structural basis of fine specificity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords MONOCLONAL ANTIBODY FV4155
total genus 24
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1997-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfvL00
3FT2A 4Y8AA 4LHJB 2X70A 4NUJA 1UB6A 2CIIB 4QXTB 4PYHA 5IHLB 2VMFA 2OP4H 5L7XL 4XXCA 4LAQH 1RZGA 1HXMA 3QDGA 4P2OD 4WGWB 5JXED 3EHBC 2X4NB 3MLSH 1OL0A 3GK8H 3HI1B 5F3BA 1I3UA 3N85H 4XTRC 3WBDA 2PTTA 5CJBA 2SEBA 3S3PA 5EBMB 5FHBH 2VLJE 4K7PX 3H9YA 1MEXH 4XHJC 2EEAA 4ZO9A 3VE0B 5E7BA 4H25A 1DQTA 3CCHB 1Z0MA 4U1MB 3NFNA 2ZOKA 3MREB 4BQBA 1OD7A 1SJVA 1CXEA 1G7PA 5DR5H 4A6YA 3ZTNH 3O6FA 1FFPB 2CH8A 4Y1AA 3AS3A 4XPGL 3LDBC 1T21B 1LP9E 2VC2H 3LIZH 3MLYL 4NQEB 5E8DH 4OCXH 1NPUA 1UZ8A 3MROA 2P8MB 2ZKHH 4WI9A 3QQ9D 2HKHL 1MCCA 5DT1H 5E94A 1HDMB 4YUEL 4TULH 1MF2L 5HHOB 3W11C 3FQUB 2F5BH 1D5IH 5D7LA 5CLWA 2Z8WC 4IOSD 4QOKE 5F7DB 1W72H 5IIEB 3QIWD 4RX4A 3I02B 3AB0C 5DVKA 4X6CF 1L7TL 1Q8MA 5EWIL 1DBMH 4XT1C 3R1GL 5T5NF 5BMFH 2HWZL 1WCQA 3FFDB 5GZOC 3ULUC 1PKQB 2EDYA 5JHLH 3FQUA 1E0OB 1AFVL 5HHMB 5ENWA 2APVA 3SGJA 2VAJA 1U8PB 5F9JB 1IE5A 3NVQA 4G8IB 4OD1H 1F3RB 3X13A 3H3KA 4JFDA 1ZGLP 3RKDC 1IARB 4WO4A 2GKIA 2BHYA 2Z8VC 3LN9A 5F89B 1T0NA 3SE8L 1TZHB 3HN3A 1CFBA 1UZ8B 4EDXA 1ACYH 1XZ0B 3RWEB 2DYPD 3CSYA 1JGVL 3IKKA 1IGML 1JNHB 4R4NC 1A7NL 2R8SL 1IM3A 4FABH 3RVTD 2HH0H 3K81A 5T1LD 4R96A 3DX6A 3T3ME 1N8ZB 5HHOA 1QQDA 2Z0BA 5F89A 4UT7H 1KLGA 2B1HL 2X2YA 3LCYA 3UTSD 4NYLA 4JFQB 3VG9C 1JFQL 5IVZA 4B7LA 4UTBL 1NCBH 1CE1L 2NXZD 2XKSA 3F7VA 5E5UB 3PHQB 3FO0H 3S36L 3ARBC 4AT6A 4YUEH 3WJJC 3SCMC 5E0QA 4JCLA 4WI4A 3TNNA 4ZYKA 4XVSH 4ZUTA 2WQ8A 4HUVB 5I1CH 4D9QE 4TVPL 4EKXA 5F44A 3NZ8A 2VE6B 1F13A 2XTJE 1KCRL 1E4XI 1KEGH 1NJ9B 3FL7A 5GSVA 2R56L 5I1IL 3BPOC 3PGDA 3C08L 3CDCA 3QZWA 2WBKA 4OGXH 1KXQE 3LV3B 1G9EA 2Q86B 5L2JA 3MA7B 2H45A 4R4FL 5GGUA 3S4SG 5L6YH 3MV9E 4JKLA 4D0DB 1Q9KA 2YOCA 4G7VH 2BERA 1ETZB 1INQB 4NCC2 4ENEC 5IEKA 5C0AA 4Y19E 4K71B 3CFIC 2DLIA 5HI4C 5KSAB 1JHLH 4YK4C 1UB6B 4QXTA 3HB3D 3HI6L 2HFEA 1EUTA 4Y4HA 4U1JA 3VXTA 3ARBA 4CU6A 2R8SH 4EUPG 4NIKB 4YAQA 1XH3B 1MCOL 3WUWB 2EKSB 1NEUA 1JZ3A 2B2XL 2F58L 3D3VD 2GFBB 5F7WC 4PGJA 4KKLD 2EE9A 2Z4QA 3BZ4B 4LQFH 1XIWA 5CIPA 4X98B 1U91B 5FGRA 1NMAH 3HZYA 1DQQB 5DO2C 4HPYH 4HZAA 3TBWA 4PB9H 4R97C 5HGDA 4LF3B 3BQUB 3QNZA 3KDMA 3FQNA 2A77L 3TIEA 2EH8H 1R3IH 4P9HL 4TVPH 3RKDD 1RZJL 3C60D 3M45A 2YD4A 1SYVB 2MKWA 2YR3A 5A40E 4TUOA 3K8KA 4RFEB 1CFVL 2X4TB 4PLOB 5C08D 4I2XA 3K46A 3QUZD 2OZ4A 1T03L 1V5JA 4ZFFA 3QWRA 4K7PY 4S0TD 3PWPE 5I16A 5EC2B 3FN0H 1RUQL 4LAJH 5EOQL 2B1AL 5GGTA 1KACB 1EGJA 4AH2B 5AWNL 25C8H 5DQDL 1FN4A 3GMMB 3K4DA 1OP5H 3U1SH 4NPYA 3HC4L 3MNZB 1JHLL 1ZT1B 3O9WD 4A2MA 2PXYD 3VMPA 4LNRA 4MAUH 7FABL 5EC1B 1NANH 1K6QL 1P5VA 4MYWB 1C7TA 2DIBA 3R06B 5JTWA 1QSED 5JOFA 2HJLB 4WNQA 1FCCA 4I0PB 2B2XH 1EHAA 1KCKA 2UY6A 5BOZG 2RB8A 1GSMA 2V2TA 1MRCH 1BP3B 4FQIH 2N1KA 5KSBF 3SJVD 2X05A 4FFWC 5IFJA 3ORJA 5LAXA 3TO4C 3H7LA 4EDXB 2GAZB 4KY1H 2WM0A 4NQCB 5DRXA 2E7BA 1UM4H 1FZMB 1REIA 5E6IA 3T1FA 3BIAX 4LKXB 4P5TD 1KIRB 2Z8RA 4X6DB 5BV7H 1IEBB 4NQVB 4WFFD 5E6ZA 2AXJA 4LBEB 1MI5D 3KLAA 2X1OA 3HI5H 4MWFB 4BFIA 4HAFA 4LLUA 4WI3A 1PKQA 3EGSB 1IRAY 4F7MA 3KYKL 4LKXA 4Z0BL 4P4RB 2VUOA 3I9GH 5FHAH 2Y4SA 4LBEA 1RPQA 4ODXB 5D7LE 4DKAA 1Z3GH 3DX7B 3PHOB 4X6CE 4ELMA 2MCG1 1DBBH 3LPGA 3TNMB 4RGOL 5EU4A 4NOFA 4CVUA 5J13B 3KPQA 1KJ2B 1H15A 1KN4H 2DQGL 1CF8H 1BEYL 1UCTA 1PY4A 1VFMA 3HE7A 2JCCB 5CZXD 5D93C 4HT1H 1UM6L 1HOCA 2MKLC 4ODWA 4S1QL 1PJ9A 1JGDB 4ZFGH 3MRFB 2ESVB 1WEJH 5L8KB 4NOBA 1BHGA 3ARFD 1DQLH 4FZ8H 1D5BB 4YHNA 5F7HA 4E41D 5J7CC 4MS8C 3HZKA 4YGAB 4OB5L 2R69L 3RWIB 4NC2B 1YEIL 3LOWA 3FFCA 3T0BA 5IUSA 1LDPH 2FHCA 3S37X 1EEYB 2UUDH 4WVRA 2VL5A 4IRSB 2YZ8A 2E7CA 3ZSTA 1WCBB 1PAMA 4S2SA 4NN6B 1SY6A 3GJFB 3OKEB 3DYOA 5DC0A 2NXYB 1HN1A 1TQCC 3IXTA 4YHLH 4W81A 5SWSB 3ZKMD 5DC9B 2Y07H 4PLJD 4H20H 5GIRB 2AK1H 3C2AH 1FG2A 3ARWA 5IB4B 1LK3H 2HT4D 2BVQB 4FFZL 5DJ6A 3P0YL 4QGTA 4GMSH 3VWKC 4WUUE 5DD1H 1Q9WB 1G6RA 4YWGL 3I3DA 4X8XA 1FVEB 2R29L 3QCVL 3ZE2F 4JPVL 5HGDB 5C07D 3WKNA 1CFTA 2R1YA 4ZD3L 4PFEA 5CJ8A 2MWCA 3EYQD 3MMEA 5IOPB 5IM7B 5JW4R 4AQ1B 2VQ1A 2MQ0A 2GJ6E 5CJQH 4KK5D 2B20A 4EUPB 3O2DH 2HVJB 4UMGA 1BD2E 5DHYA 2FO4A 4KHTH 1CU4L 1TZIB 5IW1B 3LD8B 1UKQA 4KDVA 4FNLH 1CGTA 3RNQA 4I18A 1I8IB 2VR9A 4OB5H 2FGWL 4JGJA 1AGCB 4U1NA 1T80A 4H88L 2X4OB 5I8KH 3GSUB 1LDPL 4G8FA 2ZOLB 4L3CB 5KAQG 2RCSH 1KJ2L 4LVNB 4LCYB 5IJKA 1KTLB 4D9RD 1WZKA 5A2FA 3V8CA 4UZGA 1ZHLA 2NY7H 4OZGA 4O00A 5FF6B 4RQQB 1KB5L 1FNFA 1FZJA 1OB1B 2DM7A 4HZLB 4RCAA 5K9KA 4H8WH 3BAEL 1I3GL 1WIOA 4M7ZB 3WIHA 2BNRD 1MHHB 5ESQB 1OM3L 4CN4A 5ADOH 3VD4A 2Y6SD 4CVZA 4OQTL 2X1QA 4I2XB 4UV7H 2OTWA 4HWNA 3V6ZA 1S9YB 4JY4B 4ONOA 3TBSA 1GYAA 1HINL 4JO4L 4NFCA 1FYHB 1MNUL 2FO4B 4X98A 4HIIB 2DICA 3AU1A 2O93L 2DTML 5DUML 5FDWA 4YHIB 3C6SB 4RFNB 1IAIH 4ORGA 5I1LA 2IFFH 1IGYB 1RVFH 3PWUB 4JFOB 2AXHA 5LBSL 4P2QD 5DDHA 5KVFL 1MHPH 1CLZL 1XR8B 3UTPE 1RIUL 1UENA 4HWZA 4WI2A 3ZMRA 2V5SA 5I1AA 1NMCB 1U95B 1XGPA 1YYMH 4E41E 2ADFL 5E8NA 3U0WL 1UXSA 3MUZ1 2GTWA 5EBLA 1C1EH 1INQA 1ETZA 1JYWA 4WUKL 1FNEB 4MD5A 4Z5RA 3F12B 4OZIA 5H94B 3QRGL 3BHBA 2XTLA 4MA8H 5CLTA 3U30C 2XA3A 5F7LB 4PRAB 5LAXB 4XPBH 4OFYA 2G60L 5DMKB 4OFYD 1J0JA 1T83C 3B5GA 3GMRA 5GRZA 3W0WD 2ZUWA 2PXYC 3N50A 1O0VA 5E7FA 4UBDC 1GJIA 2EZ0C 4K71C 1MFBL 5FKPA 4NBXB 4U7KA 3LV3A 3HAEB 4FZEH 1OM3H 5ADOL 4OCNC 4EVNB 3OKMB 4FQJL 5IFHH 2FECL 4PJBB 5B4MC 1XIWC 1TLKA 3SKNA 4AEIH 4C4KT 1DE4A 4PGZA 2CXGA 1WZ1L 4NUGH 4ETQA 3GMQA 3MQIA 4QRTA 4PP2A 3T0WA 2CLVB 5CKAA 1YNTA 3C5ZB 2ADGB 2LQRA 2XZAL 1WC7B 1VACA 3BRDA 3RX5A 4QTHA 4PJCB 3U4EB 1WF5A 3EFFB 3SDCC 4N8VB 5IB5B 1ND0B 1IEAA 4HFUH 4TQEH 5BVJB 4WUUB 3DX9B 4F9PA 2BVQA 2Y25A 3OKKA 1HWHB 3KXFA 2B4CL 5JHDD 1PFCA 2FJFA 5EIVA 1YDPA 4DJMA 5JHDA 1CD9B 5HD8D 3D0VA 2YUWA 1DBKH 4NKIL 1KIQB 2CK0H 1ZA6B 5JPMA 2BSED 4LFHD 4NZJA 3ECBB 2NPLX 4KROD 4KZDH 1IKFL 3TCXA 3IDXL 4I3GA 5C92A 2QADC 3MV7D 3O3BA 4XC3L 3QUXC 3P11L 3X12A 1ES0B 2AXFA 2YPLE 4LPYA 4ZNEE 3OKNB 1II4E 1B6DA 3BPLB 3GIZL 4ZDHB 1TZHA 5SX5K 4O02H 2VLMD 1QYGH 4Y19D 4EI5C 3ARFB 2FR4A 3MUGA 2DS4A 1IGTB 3ULSA 2WUCL 5A2IH 4XNYL 4XHJD 1EZVY 3DGGB 1R24A 4YDIH 1JF1B 3H8NA 3UC0H 2ITCA 1DLFH 2EZ0D 4JZNA 4FQXD 1QPXA 2HAZA 3BD4A 4ZTPH 5IFAH 5JORB 4FXKB 3IAPA 1CLCA 1B0WA 1GAFL 1NEZG 4NO0B 5DMIL 3CFKA 4HHAB 5DS8A 1HYRC 2C4FT 5CEYB 5IMMA 4U2YA 5B8CB 1XAUA 4HIEA 3GGWA 1NL0L 5DRWA 4PRHA 3DUUB 5LCVL 4NO3A 3QWRD 1N6QL 5IWLC 4UQ3B 5IVOA 2P8LB 4OGAC 5FYLL 1QHOA 4P57A 4LKCA 1BIIB 1GVIA 3V6BR 3ARBD 4P2RB 1YPZB 4DTGL 1BZQK 4M61B 3WFCH 4Y0GA 4H5SA 1K9TA 4XWGL 4OZIB 5H35A 2ZG1A 2BVTA 5DUPH 5F1KC 5F97E 4EJ1C 3NACL 4KZDL 4LMQI 4O2FA 3HMWH 3JWDC 4PP1C 4RDQF 2ZPKL 1MLBA 2V2XB 3TV3H 1MHCA 5J12C 4OSUL 2R0WL 3G6AB 4R4ND 3RZCB 3QNZB 2NY4D 4AM0A 4O02L 2DLFH 2DD8L 3T3PF 2P43B 4RGMC 3E6HB 2HMID 1FV1B 4K3DL 4F3FB 4YIQA 3ZE2E 1OY3B 4OLYH 5J9PA 5HHPB 1A3LH 3A0OA 1ZVHA 1FGNH 4I3RL 1XGRB 3MV11 3PHOA 4RZCA 1J5OL 1VESA 3RZWA 1LNUA 5CGTA 4ZTPL 4IHOB 1YECH 4UILH 4HPOL 4Z7UA 5F88A 3WFHA 4OFPA 4D0BA 4PY8J 3UTOA 2NZ9D 5IK3B 3GUTB 3FT2B 2NY3D 4NZRH 3V52H 4KK5C 5EU6B 3V7MA 2VXUH 1WWBX 4IHOA 3VWJA 3LS4L 4RQQA 3PWUA 4JFOA 3SKJL 4DVBA 1ZLWK 3GHEH 3N9GL 3WDJA 3TFKD 1O7VA 4M02A 5JW3L 4BK4A 5DJ2B 1T20B 1OCWH 2YD5A 1U3YA 4FMKA 1CGSH 4I77L 2D31B 1GGIL 4JRXE 4OM1L 4N0UA 2DIJA 3VGAC 4U6HB 5DUPL 1MFNA 3F58L 2EIEA 2ADJA 2V5YA 3NACH 4GW1A 3TYGH 4NM8L 2LTQB 3PQYE 3ARDD 3LKNA 1MCHA 3BDBA 4NGHL 1INDL 3QI9C 1UM5L 4CAGA 4PJCF 2OCFD 3DYMA 1PD6A 2HVJA 2AJVH 3MBXH 1I7UA 2P24A 3VI4E 1B3JA 1JI2A 1P69B 5T3XH 4BQ6A 2I25N 3WE6B 4D0DA 4GRWF 2V7NA 4HKXB 5IVXB 2WUBL 4OZHA 4OZFG 3IF1B 1JWMA 3EDFA 3IAQA 4OLYL 4MAYC 2A6IB 1Z9LA 2RR3A 3MYJB 4MNGA 2C9AA 5B38G 4CMMB 5ITBL 2G9HA 1G9NL 4R9HA 5JLZB 3V4PL 1XT5A 1I3RA 2ZUQB 2HKFH 1QQDB 2R2BA 2GJ6A 4G8GE 5HHQB 4UILL 3ZKMC 3BKJL 4HBCH 4KDTC 4AENA 3M1BB 3A67L 1W0VA 4LU5L 4PJAB 4NN5B 3OKYA 2E9IA 5CILL 3V52L 5C8JB 5KANG 1MFAH 1EHLL 1SEBA 4K3JH 4YXHH 4R3SA 5IB5A 3MCKA 1RZIB 5I8CA 2EXYC 1SHMA 3FQRA 3QQ4A 2FB4L 4ZTOH 4HKZA 1FJ1B 3S3SA 1FPTL 1UCBL 4X99A 3KR3L 3FQWA 1A7QH 1F2QA 1FHGA 4F37F 3ARDA 1S9VB 2XKNA 4N9GA 5D7JD 4M1DL 3O3EB 3IDGA 3WD5H 1XFPA 1ROWA 5C6TH 3GGWB 3QXAA 5I1DA 5FM5M 1A7BA 1IQDA 2X1WL 3KAAA 2P49B 2C3WA 5JQ6L 3K0WA 4NRXB 4BZYA 2XXCB 4DZBB 4LVEA 4J6RH 4GKSB 4XCNA 2BMKB 2QQKH 1LO2H 4HUUA 5F9DC 4XAWH 5IB3A 4ZAKB 4P2YA 1JTTA 2CUMA 2GJ6D 1N2RB 5GGRY 4OZIF 1YUHB 4DZBA 2BFVL 5MEPA 1ITBB 1CN4A 1CZ8H 2EDNA 1JMXA 4APQB 1T0NB 4G6KH 2Y7QB 3OXSA 1YN7A 3WFZA 3SDXA 4NO0D 5L7XH 3X14A 3KLDA 1WFTA 5B39G 4NO0A 3LH2H 4MX7B 5C07A 4M5ZH 3WYRA 4JKMA 1NMCC 1B2WL 5C6PB 4LEOA 4MJ6B 3ARDB 2VE6A 3TBYA 1WFOA 4KKCC 1JZ2A 1XF2A 1D9KA 1MCJA 3FZUC 2EECA 5ID1A 1EHLH 3BW9A 4Y19B 3ZKQD 1KSRA 1ZEAH 4NQUA 4H8WC 1G7JB 4QTIL 1KJ2A 5J6GA 4XCEA 3SGKA 2BVPA 4W6YB 3PG2A 3SBWA 2Z93B 1CBVH 4M7JH 1OAXL 2X7LB 3GBNL 3D39A 4HUUB 1UEMA 1V7NL 2VDLH 4X5XB 1K2DA 2QKIB 1AC0A 1ORSB 3QIUB 3WIHL 5BO1L 1E27A 1ZVSB 3KJ4C 1LK2B 2FNBA 1G7HA 1MLBB 1TTGA 2XWTB 4WCYH 5IBTH 4JDTL 3CVHL 3MUJA 3VFSA 5JHDB 4HKJA 4DN3H 5E8PA 4G80A 3LRGA 4KMTL 1H5BB 2FBJH 4U0QB 5C09D 4PG9A 1AI1H 2XA8L 3PABB 1BQHG 1T2JA 1UH2A 4LIQE 4FTVE 4JVUA 3RL1B 3S35L 3TIEB 2BNRA 2X4QB 1KYOJ 3HI1A 3BH8B 5F3BB 3MOAH 1JN6A 2BFVH 2R4SH 2X89D 4U3CA 2NMSA 5TE4L 1AHWC 4J3UA 15C8H 1S78D 4Z7WF 3RWJA 3ZE1E 2A6DB 1B90A 5E00A 1JYNA 1W0WA 3S9DB 2K3TA 1UFUA 3BEVB 4DOHB 2EDEA 4UIKH 2QQLL 4JZJA 4QT5A 4KJQC 1J05A 1U8NA 1M71A 3G04A 2YBRA 3MV01 2O61B 4HUWA 4R8WL 2EYSA 1A1NA 1KTDB 1G0DA 4CMMA 4MXVF 4N9GB 4XVTL 1C16B 2O5ZH 2GJJA 2FJGA 3KLAB 5EOTB 5I8OL 2R2HB 5F9WC 4FABL 1VEOA 2YD1A 3PWJB 4Z7OE 3U46A 4OZFH 1S7QB 2XY1A 1IAIM 1MF2H 4AL8L 5IQ9B 3BKCH 3GMNB 5EUOB 2FYYB 4LARL 5AAMA 2X4OA 1QKZL 1OSPH 1OAUL 5AYQA 3NN8B 2XN9D 2EXYD 3BIKA 3UTZB 3S36H 1VGKB 2NY1B 3QHFH 2X9XA 3VFWA 4ZOBA 2GITB 1DQQA 2DBLH 5JXEA 2NTSP 1S7SA 4Q9QL 4OLWH 1KXVC 3S37H 3H2WA 3EJJX 2YD6A 2A38A 3O3UN 5C0NC 4OD1L 2H9GA 1UB5B 2CR6A 4IS6B 3F62A 3F7VB 2R56H 4YHNB 5L8LB 5I0DA 4O9HH 3IDIB 1A3RL 4FQLL 4ETYA 3JV6A 4JRWA 1BWMA 3WIFB 1BZ7B 3HFMH 5C2UB 4HUVA 5B38A 4S1RL 4N68A 5ALBL 4IDJH 2EYRB 3ZYOA 5MEQA 4R96B 2KPNA 3MACH 5LXGL 5D1ZB 3F65A 5E56A 3SDCD 4EOWH 1F5WA 4NHCL 3WMSA 4YFDB 2PTUA 5D96C 1QSZA 3MRHB 1IT9H 4QXUH 2Q86A 5I8OH 1MCOH 3D85A 4RMTA 3QYCA 1IGCL 3I6LD 1I3RB 5IW6B 3OG4B 3WS6A 2BCKA 2IH3A 3N0PB 3RWHB 5IMLA 1Z9OA 2XOTA 4GAYB 4JFFD 4OZGF 1K85A 1VFBA 1A6ZA 2E27H 5LJYH 1CFTB 1MWAH 2R1YB 4M3JA 4HGMA 4Q7DA 3MJ7A 1PZUB 3MCLL 1QSFD 3QHFL 4JM2B 1I8LC 1NBVH 2EKSA 4EXKA 1DQJB 5GRUL 5ISZB 3FT4A 4JN2B 3BZDA 5GPRA 5T3ZL 3IU3A 1KCVH 1CDYA 3QDHA 3TYFB 2VDPL 3S37L 2BVOA 1XR8A 2BC4A 2V9TA 2Y5TB 1Q94B 1BJMA 2IPUG 2XWJA 2VZUA 1TVHA 2F74A 1R3HB 2FX9H 1KC5L 2GY5A 1TDQA 4QWWC 2VERN 3PQYD 2Y23A 1FNEA 4JLRB 2P42B 2D7TL 4M00A 2CO7B 2J6EA 4QCIB 1FC1A 2AI0H 2Z31A 3L3IB 1G7IA 25C8L 4JRYB 5I8EA 2ARJB 1ERNA 2ATPA 4FQPA 4PBWD 3U1SL 5IEHA 3CFDB 2H1PL 4MJ4A 4PJCA 3U4EA 3MNWB 4L4TD 4YO0A 3TN0C 1U93B 1ZSDA 2CRZA 5I19H 1CGXA 1D5ZA 3MA9H 4X4XA 4FA8A 4JM2F 4PJDE 1FDLH 2YMXL 3MOBH 5KZCB 4BJLA 3OGOE 3MODL 5BS0E 1DUZA 2DDQL 2H32H 1N64L 4PBXA 5I73B 3D39B 4HPYL 5ICYA 4MCYB 2ARJA 1F4XL 5F7EL 1G7QB 2IBBA 1MCIA 3TBTB 4DGIH 1PSKH 3Q3GB 2XWTA 1UACH 1VENA 4OGAD 3JSSA 4PJEF 3PL6D 1B0GB 3QEUA 3LQAH 1UM4L 4GW4A 4O4YL 3L3OB 4DKEL 1ADQA 3CFCL 1IZKA 2A73A 2YA1A 4Z77B 4LSTL 2VDPH 4PJ9B 2R0ZL 4JZOB 2FJFB 2D0HA 3MUGB 3HHRB 1NBYB 3SDYH 5CBEB 3WN5A 2AVGA 2R2EB 1DFBH 5DVNA 4HJGB 3O4LE 1IGJB 1IGIL 3VW3H 1NFDF 3RIFK 4HW6A 4J1UB 2WBWB 4RGOH 4Y5XC 5F8QC 3VFVA 4XPHL 3HAEH 1UADC 4HQQH 2YA2A 2WLZA 3VRIA 1NC4A 3D25B 2CXKA 1FAIH 5BV7C 5JW4Q 1C8PA 3DX8B 4BSVB 1PGRB 1UM6H 4YDJA 2E7HA 4GBXB 5ID0B 3DETD 1M4KA 5F1NA 3SKMB 1X6LA 3DI3B 3GKWH 3HPLA 5HVHB 4PJHF 2AV7A 3D2UD 5EU3B 3DLQR 3BP7A 4L4VD 2VLKA 3FQTA 3VH8A 1AC6A 3T4YB 5IHZB 3RGVA 1J8HE 4ZG1A 5CJXA 4XGZA 1OTTC 3QUMA 2MMXA 3BPNB 4KDWA 4K9EC 2JK5B 3VFOB 1ADQL 3IFOA 3STLB 5SWQB 5CSZB 4MA7H 3BO8B 3L3JB 4OZ4B 3C6LD 5HTSA 3KPTA 1TJIH 4PRNB 3LQAL 4X0KA 4DVRL 1D5BA 1SM3H 4L29B 2Y07L 3OJMB 2DI7A 4V1DA 5FHAL 2OMBA 1T1WA 2AK1L 3C2AL 1Z9MA 3ALWA 3K8MA 1A0QL 1MCQA 1XEDA 5CGYC 3GMOA 1MVUA 4HIJB 1DQDH 2AJZA 3JWOL 2MPAL 2IPKB 1S7TB 1NCDL 1CQYA 3C9NB 3TEUA 2CRYA 2X4SA 3O6MH 4HIXL 3D9AL 2ENSA 3L3GB 1HHIB 4WFGD 5ICXB 4QOKD 1I4FA 1JP5A 5JPNB 3FT4B 4JN2A 1P4BH 4X7SL 4HG4K 1AHWA 4XPHH 4ZFGL 3E1F1 1S9YA 3DV6A 1EZVX 3X11B 1NJ9A 5CUSL 3GI8H 4DAGL 2FEDD 4GRMB 5C09E 1V3LA 5CP3H 5KS9A 1KULA 1I3VA 4DGVH 2ERJC 5HHVL 3QEHB 4KHTL 4IRSD 5JQHC 1KCUH 2MHAA 5D7JA 4HF5H 1IEBA 1F11B 3EYUH 5C0AB 3K74B 1I7RA 3TT3H 2D0GA 3SY0B 1UH4A 1ZHNA 1JL8A 4GMTH 4CNIA 1FL5A 1N5AB 4H20L 4JQXA 1SBSL 2LU4A 2OZ4L 4I4WB 1ADQH 1P7KB 4DEPB 3I3EA 3D39E 1S7RA 3T09A 2IANA 4PJ5A 4LLYA 4BYHA 1HHJA 2NY7L 2VDOH 4XVUC 3BIBX 4DVRH 4U6XA 4LFHG 1DVFC 2FIKB 3GBMH 3IS1X 2R2EA 1S9KC 1SJEA 1IGTA 3DWTA 3ULSB 3V4UH 1UWGH 5ACZB 1IGJA 1U8QA 4HJ0C 1Q38A 3O6LL 4CN6A 2YHGA 1CLYL 2BNRE 3IDJB 1CDCA 1F4YH 3JWOH 5IM7A 4OGYH 3PWLB 4DQOH 2EDDA 1AR2A 5KW9L 2FL5B 4TTDC 4CVXA 3QEUB 3UAJD 4PGBA 3RVVD 1GOGA 4LLWA 1C16A 4LIQL 1NUFA 4OZFA 3VI3F 1RK1B 5DUMH 2X09A 2D9CA 1KJ3H 2AGJL 2HJLA 3VGGA 4I5BA 3ZHKA 5T5FL 5LBSH 4U3HA 2OL3L 3LN4A 4HUKB 1CXHA 3PV6B 4PYGA 2VLLA 3BP6B 1I9JL 4GG8B 1CLZH 5L2KD 2PCPB 4PJGA 1RQ5A 4GLRI 1UC6A 4YNYA 3TGXA 2R4RH 3ZT6A 4R90L 4IRZH 4M61A 5IBUB 4W70A 1YYML 4JFQA 3HPJA 2P8LA 4QRSA 3RNKB 4NQCE 4P3CL 3RIFF 3CX5K 1XF3B 1SBSH 4MGXA 1MRFH 3RZCC 4YHKL 1S78C 4TUJA 2J12B 5C0BE 5TQ2H 4PG9B 2Z92B 3G6JF 5DJYA 3VXSB 1AE6L 4OV5A 1GC1L 2PW2A 4BKLA 1BZ9A 1XH3A 3OR7B 1UWEL 5IIEA 4R4BB 4ODVL 5HHPA 1KF9B 2VR5A 4XGZB 4JY6B 3VFGL 1U8PA 5L0QC 2VAAA 3ARRA 4WEBL 1FIEA 3O4OC 1BD2B 3E6HA 5EZJA 4OTXL 3NA4A 3QQ3A 2W59A 3B5HA 2HT4C 1YN7B 1U42A 3RP1A 4CJ0A 5KVFH 3QJHB 1RU9H 2X42A 1OTTD 1WZ1H 4ZSOE 4LSPH 1NGYA 4WW1A 5EOCH 3JWNC 1RFDL 3VXSD 5LGKA 1LD9A 1I1YA 3VWJB 3VFMB 4UOJA 1P53A 3DPBA 4JFEE 4PJIA 3LN5A 3ZTNL 4BUGA 3TFKC 2EC9U 4MQTB 4NC1E 4N5ED 4C54A 4IRZL 2VC2L 4W4NA 5I76B 1CD8A 4PTUB 3BRFA 2JIXB 3TH4T 3Q2CA 1KGCD 5HYQB 3UYRH 1B4JH 5BVJA 1Q9LA 3KLHC 3V0WH 3HUJF 1GXEA 1D6EA 2Z91A 1FIGL 4XC3H 4D9LL 2E9WA 1N59A 3H7BB 1C08B 1Y6MR 3TBSB 5CHNA 1CICA 2W9EL 3TP4A 3L1OH 4LDEB 1P4LA 5HGGS 2F8OA 5C0EB 2YA0A 3NPSB 1AE6H 3F7QA 5EWIH 4HV8A 3QPXH 3BDYH 5F8RC 5I71B 5CEXA 4YE4H 2GYSA 1AFVH 1LQSR 3ZL4L 1I85A 2KUTA 1QP1A 3KPSE 4RRPG 4TSAL 3DMMA 1EX0A 2QTEA 5GISL 5IFAL 1JPGA 2WV3A 4TQEL 3MFFB 3SBWC 4H0HB 4DOHE 3IKCB 5D9SA 2GSGB 2H3NA 2D7MA 1XF1A 2CKBB 2Q76B 3DVNB 4G8IA 1MJUH 2FH8A 1IAKA 1U93A 1ZSDB 3VFPB 3ISWA 4G9DB 1QLFA 4NKIH 2ADJB 1NL0H 4F15B 3VXUD 5C1MB 5J06A 1W2KT 4MZ2A 4WWKA 1KPUB 1F97A 1JPTH 3PWPA 3HG1B 3T0XA 2NW3B 3MRNB 4OLVL 3OKOB 3IDXH 2R23A 1EHNA 1MH5B 2OTUA 3MTRA 4P3WA 4GG6B 1E6OL 5E70A 3IYLW 4QOKB 4MJIB 4UNTA 5EU5A 3GIZH 3O3EA 2IPKA 2JCCF 5HVGB 2RIKA 3KG5A 3O4LA 5GJSL 3QT2A 4RGND 3TBWB 3QFJB 4KUCD 3O4LD 1MAKA 5IJVA 4L1HA 3FKUS 5CEZH 3C5JB 4G6FD 3T04D 3UTSA 1CDHA 1FNHA 4POYA 3DSNA 3TA3D 2DF3A 4PRDB 5EBGA 1VFAB 5SWSE 2DLFL 3G04B 2X4TA 2OTWB 4HAGA 1R3JB 5INCB 2Q20A 3IJYA 5ETUB 5I1EH 1FYTE 2NNAA 2V6HA 4HCRA 2BVEA 5EORH 3KPOB 2HP4A 4FQQA 4PTTA 3OAYK 4U1MA 4WU5B 4B0MM 4ELME 3ETBF 5BS0D 2J1KA 3HE6A 3MO1B 4LPUA 1JI1A 5BS0A 1UKSA 4M43H 1AD9B 4HPOH 4JO2H 3PP4L 4PJEB 4JE4B 1YY9C 2VLRD 5DZNA 2AW2A 3F8UB 4U6TA 3C87A 4LNRB 5J9PB 5K9OA 4GBXA 1KB5B 5EUOA 4PUBH 5E08H 5HI5D 2FH6A 4GBXD 1CDIA 2FATL 4NN7C 2NY4C 3MJ6A 4F33B 1FP5A 4KRPD 4L5FH 4YC2C 2IG2H 3MRFA 5DEFA 2QQQA 5HHOD 4TSCL 5KSBE 1WISA 2N7BA 1K4CB 1DDHA 4MD0A 1HSAB 3QH3A 4XRCA 2PYEE 2APTA 3D2UB 3QG6A 2NY5L 3BISA 2Q8BH 1G7QA 4PRNA 4ZUSB 1UB5A 3D85B 3ZDZE 2NY6B 5F72S 3IETB 1QSFA 4CJ1A 3B9EA 4M6MH 3RGVC 2ICEA 5D71L 1KXTB 5CEZE 2NYYD 4GAGH 3MV8B 3Q1SH 1XIWD 3CMGA 3VFRA 1QRKA 3VG0H 3VCLB 5IEHB 2YD7A 5I74C 1PG7H 4DK6A 4Z7WE 5C0ND 1YECL 3KLHD 3INUH 3QG7L 1P9MC 1WIUA 5HYJB 5TFSL 1DANT 2B5IB 1FO0L 1OOAA 1JN6B 1NCCH 3SOBH 3RWEA 2XQYK 4NZRL 1N7ML 1IC4H 1I4FB 4FP8H 2GFBA 4W4OC 4XBGB 3BOVA 4NQEA 3U2SA 3O6KH 3QQ3B 2XZCH 6CGTA 1BBDH 4CKVX 5DZOA 3PDDA 2O5XL 3MMEB 4B5EA 1AIFA 3I6GB 2GT9A 3HC3L 2APBA 3HNSH 3HKFA 1JNJA 1GPOH 1H3PL 3C09B 5D5MB 2YRZA 1N26A 4OAWB 5C0DB 5E1AA 4EEEA 5HYFA 4Y4HD 5FB8A 2HTLD 2UVEA 3VXNA 1GGIH 1NC4D 4WI6A 3W9EA 5HPMA 1QVOB 3VFMA 2FECI 4NHUA 2Y72A 4U1LA 4UI2A 4JZJB 4QT5B 4Z95H 2NXYC 1MOEA 5DHVH 3RWIA 1A7RL 1NH6A 4NGHH 3MGTA 2K9UA 4BH7B 1QACA 2HFFB 3CK0L 3MV7B 4JY4A 2AJVL 4MA3A 5IHUH 3V0VB 4RMWA 1QVOA 4FS0A 4LSVH 2M1KA 4N8VA 1A47A 2CGRH 5C0JA 4MLIA 1DUZB 1JYVA 3OX8B 1FFOB 2W91A 4K8RC 3FRPG 5I16B 3SCMA 4LCUA 2I60L 3UXFA 2VNCA 4NBZB 3SKOB 2PCPA 5INCA 4LCIH 1F90H 3QHZH 3AREB 3EDJA 4RRPA 3PHSA 4FHBD 3QXVA 1KLUA 1MIMH 4NCDA 3NIGE 4V1DD 3RKPA 3G6JE 4E42B 1NCAH 1X5IA 1BAFL 3L5HA 1J05B 2Y06L 3ALPA 3V6OC 3SDAC 4Z7NE 4CUCA 3KYKH 4GLRH 2JJWA 3IDNA 1YY8B 4PGBB 1CDGA 2BHUA 5GGSY 2D03L 3RWCB 3UDWC 2PNDA 1QFWL 4XCNB 1BBDL 3QAZB 3FT3A 4L9LA 3VFUB 2J8HA 4Y5VA 5TE6H 2B7DT 5I74B 3RTQB 3OR7A 4JPIB 4PJGB 3C6LB 1AP2B 3UCRA 5FYJH 3LKNB 5CP7B 4K8RH 4ODSH 1DN0B 4J8RB 1BJ8A 3MLWL 1XGTA 5C6TL 3D2UA 3QCUH 5F7UA 2KQNA 5F9JA 4Z95L 1BOYA 1J0YA 1WSST 2BOBB 1ZHBB 4MQSB 5IJKC 4ELMF 4Z5RB 1NMBH 2ICEB 1H3TA 1R5WA 1AGFA 3LEYH 5HHOE 3DECA 1NGPH 2I5YH 4GS7B 1YEJH 1QFOA 5LQBL 2ZSVB 4X7FC 5IBTL 3FO1B 5EO1A 4WFFE 2DQDL 1X5JA 4G6AC 3BT2L 4AENB 3RWHA 4ZSOA 1MIML 3DARA 4O2CB 4NQSB 4PJGF 2DWDA 4M48L 1NCAL 1BZ7A 5HGHB 4ONGL 4Z8FH 1SEQL 3S35H 3HUJA 4LEOB 5FYKU 4MD5B 5LGJB 1EFXA 1O5DT 5IVNA 3MC0A 2ED9A 3RJDA 4UINL 2D03H 3NTCH 3TT1L 2XKNB 5F9WB 5CD3A 2A74A 3O0RH 3RY4A 1YMMB 3W2DH 5TPWH 1ZHBA 2BNRB 2X4QA 1IKNC 3G6JA 1QHPA 1CFSA 4X4YB 1DVFD 2F8VA 3EOAB 1DVFA 2AV1A 4LPTA 1KT2A 3NGBB 4XCFH 1LE5A 5BO1H 3EO9L 4LRNH 4Y16B 5HYIA 3WFDH 2BY0A 5EFIB 5F1IA 2APFA 5BJTB 3GMPB 4O2CA 5LGHH 3FN3A 1OGAA 4DVBB 5KVGL 2X1XR 1NEZA 5CS7A 1A6UL 3GMOB 5J12B 2P7TA 4U7SA 1OAKH 3EJZD 1U3JA 5ENWB 1HHGA 3BXNB 3GSNB 3K2UL 3DUUA 3HUJE 4YLQT 1LEKB 5DJ0A 2PYED 3VGDA 5AD0B 3JV5A 3K8LA 3CDFA 3VRIB 1PX3A 2FEEI 4TUKL 3W39B 3L7FA 2RGSA 4K3EH 2XPGA 4WUUD 5E9DA 4RISH 1LE9B 2YPKB 3N85L 4FQHB 3U48A 3N1MC 2IQAB 1FZOA 4QHNA 3BD3A 1I8IA 4YHPA 5KSVB 1QLFB 2O61A 1E4WH 1FC2D 3ZZ1A 1G1CA 5EZLB 4GRLD 3E8UH 4RA0C 3G6AA 5HGAA 4WW1B 2AAVA 4PJIF 2C1PA 3G5VB 2IBGA 3B3IA 2ZUXA 3QEGL 3FO2A 5BV7B 5CZVH 4P49A 5DR5L 4RSVA 2CDEA 3AS2A 4NO5B 2P5WB 1PKOA 3R8QA 5KVDH 1Z6JT 2GSIB 2W0PA 5TDPA 4U31A 4AL8H 1HSBB 4ZPVB 4PD4J 5DHVA 3QIUD 3EO9H 1NFIA 3K2MC 2EDJA 5JIKA 4PJEE 4Z7UB 2OR7A 3QA3A 4L4VB 5FFLA 5TDPB 4X9GA 5KVGH 5IW1A 2JB6B 3QI9B 1FVDB 4UAOC 1X5XA 5C09A 4Y1AD 2NZ9C 2NCMA 4G6JL 1AXTL 1ONQA 1RJLA 4KQ3L 4M62L 1Z5LB 1YUHA 4LEXL 5MEPB 3K2UH 3VWKD 3PL6C 2C1OA 5D1XD 4CVWA 2NX5E 5BMFL 3T4YA 4PJIB 3MCLH 4KJPD 4RAVB 4PP1D 2JE8A 4Z9KB 5BRZE 1RUKL 1RHHA 3NFPB 3QDGD 3RX8A 4RISL 7CGTA 3UBXB 4TSBH 1T3FB 3W82A 2ZUQC 2YK1L 1WFNA 5F7MC 3MLRH 4BSVA 3OL2A 1GHFL 5BZWA 4LCWE 4R7DB 1E4WL 1IJ9A 1I7RB 1EEZA 3RY5A 4JJ5A 1XR9B 4N0UE 3I50H 1GZQA 1U8LA 3IRZA 4JQXC 1B9ZA 1MFCL 4P2QA 1ULVA 4ZAKD 4YBLB 1U92B 4CRPA 4E9LA 4I2XE 5A43C 2X41A 1IC1A 4LKCB 3QEGH 3LDBB 3CDGA 4Y2OA 4N0RA 5CZVL 3NZHL 3DYPA 5SWSA 4KRPB 2ADIA 5DEZA 1IGCH 3P4OA 2DQCH 2YC1A 1G0YR 1YQVH 4KUZL 4UT7L 1QO3A 2DB8A 3DVGA 1T89C 5CZXC 1IM9B 1D3CA 1JFQH 3ET9F 1CE1H 1OHQA 1N64H 4HWZB 4HX1A 2WAHA 3SQOL 1F4XH 3MRLA 4H0IA 1A22B 4OD2B 1NBVL 4WNQB 1I1CA 1SY6L 1MLCB 5F71A 2R2CA 4XVSL 1AXTH 1YNTB 4DGIL 4OKVB 1CWVA 2LVEA 1DLHA 4E0RA 4Y8DC 5KJRL 4HKZB 3BN9D 3DSFL 1Q0YL 4HLZH 3VFTA 3WCYA 1MRDH 5DJXA 1GIGL 3TA3A 3BMVA 5C0CD 2DQUL 2QADD 4MCYA 1MUJA 4YDIL 3MNVA 4R6UA 3S98A 1DLFL 1AGEA 3L3JA 1F6LL 2FX9L 4OZ4A 4APQC 2WP3T 1SJEB 3PNWB 4FQ1L 3KYOA 1HXYB 5IK3A 2YK1H 2C3VA 2D7TH 4UAOB 3SDYL 4JJHA 1DFBL 3WHE1 2ARWA 1GCFA 2Z31B 1M7IB 4FQXA 5C8JA 2A6JA 1WZLA 4NZTH 3WUWG 5LCVH 1XZ0A 2BDNH 4JO3L 1BM3H 3PF2A 4Q6YA 1NSNL 3QNYA 4BQ9A 3QULA 1FFPA 5DO2D 3N1QC 4Y4FB 5F7EH 5IMOB 3RWCA 1J0IA 4FQQB 4NC1C 1DDHB 4MD0B 1CS6A 4L4TA 5JOEA 4NRYA 4MQXC 5AZ2L 1SJXA 3QXDA 3CD4A 3QDJB 3MRPB 1JNLL 3MV7E 2EDFA 3CDYA 4M1GH 3TN0A 3UTPD 2KDGA 5JPMB 1SY6H 4POZC 3VD9A 2A77H 4M5YL 5K9OB 2VDQL 5FGBA 4ERSL 2VN7A 3ZYJA 5KJRH 1RI8A 3RDTC 1Q1JL 2R0ZH 5IJVB 2QLVB 3ULUD 3PJSA 4JG1H 1M7IA 3RNKA 5IV2A 4JFPA 1VACB 1QUNA 4U1IB 1J5OH 3O8XB 1Q9KB 1T03H 3DUSB 4GKOA 4F57H 3JV6B 1KTKE 4HWEL 4PGDA 2NY2B 3CLEH 3UTSE 4OIIH 1CL7H 2FRGP 1JPSL 3UJJH 3VXMB 3T2NH 4PG2C 2GJ6B 1XCQA 3BJLA 1JV5A 2WINA 1N5YL 1UJ3B 5FGBC 4FTVD 4L4TB 4TVPE 1T0MA 3ZE1F 5C0DA 1HHGB 2JB5H 4H1LA 1H3XA 3QWOB 4ZUTB 4JO3H 1K6QH 3CFEA 3P30H 2Q8AH 3PDOA 1JWSA 3QEQD 4JFXB 3VWJD 4OCRL 1H0DB 1TVBA 2ZNXA 1WCBA 1JYXA 3FTGB 2AV7B 5EU3A 5DRZA 2CJUL 35C8H 2H2PC 1M05B 4KVNH 5FM4A 2IBZY 5ESVB 4FQIL 1FLRH 3HRPA 5KBNC 4HIIA 3HLAB 2ILLA 2W60A 2APXA 2CKNA 4LSDA 1RMFL 3MUHL 3NABH 3BPCA 3VFOA 4F37K 1MCPL 4ALAH 4KY1L 2WWKO 5D6DC 1E27B 5IF0A 4P46B 1B0RA 2VISA 1FSKC 4KU1A 4GW1B 4WDIA 5C07E 4JZNB 5DLMH 5DURB 3C8HA 5ISZD 1E6JL 2DIAA 3SJVA 3QSKB 4NKMB 1CR9L 6FABL 2QHRH 1P6AB 2WUBH 2C7UA 2PXYB 5FOJA 4JG1L 4PJ7A 5DYOA 2EXWC 1A2YB 3DV4B 4JDZA 2VDOL 1AGDA 2MPAH 3LRSA 4ELMB 4EQ2A 2ZSWA 5E6ID 4X6BA 4F57L 2H6PA 1T3FA 1L0YA 3RPIB 1LK2A 1K4CA 4WJ5A 1CXKA 4HV8B 4LU5H 2R1WB 4MB4A 3L3IA 1I1FA 4FQCL 4K2UL 4KROB 3GI8L 1UZ6F 1W72B 2OXGA 3MPCA 5DD5L 2BVUA 3TPKA 2YD9A 3KPMA 5F3HB 4C55A 4JPIA 4ZXBB 4S1QH 4HGWB 1KUMA 1LE5B 4JANB 3EYQC 5FECA 4LNVA 3VXOA 4G3YH 1NFKA 4C83B 2MJWA 5MI0B 2P4AB 4ZOEA 4JRXD 2FHBA 3U83A 1N3NA 4HUMB 3JXAA 3L5XL 5DK0A 1PZ5A 2J88L 4YIQB 1G9MC 4R90H 3PGCA 4V1DB 3WJLA 3VD5A 4OUUA 2PO6A 3S36X 2ZUYA 1OAQH 1G7IB 4KK9C 5I1GH 3GSVA 2XZQL 1ZLUH 1T83A 1RV6X 2VIRB 5A16B 1LEIA 4YHKH 1UWGL 2DQIH 1T1YA 4APQD 1MI5A 2VLJB 3N1PC 4FXGB 4GMSL 1A14L 3SEPA 3QFJA 1TQBB 5E1AB 3GBLA 2A83B 4OGYL 1FNSL 1MFDH 1BBJA 3K4AA 1S9XA 4XTRD 3CC5A 4QHLA 5F9OL 2RFXA 5BCAA 3MRRB 3ARGA 3EOBA 5IB2B 4Z7VA 3MZTA 3PWPB 4HMCA 5ANMA 5I1DB 4EVNA 4K2UH 3NAAH 1NC4B 5ADPL 3KDMB 2Z35B 3WHXA 4BSJA 5B38B 3DXAA 4LLMA 4JDVA 4P2CG 5DUBA 4JRXA 1PBYA 1R24B 3CJJA 5FUZL 4QRQA 1CFQA 4LCUB 1NLDL 5INDA 1YEDA 4ZODA 3VXPA 3VCLA 4JFDE 3EYOA 4MJIE 2OR9L 1QBAA 5T3XE 5IF0B 2I9TA 3OKDB 1LP9F 3JWDH 4MVBC 5D7SH 5D4QA 2LAAA 4MB5A 1KJVA 4N0FB 1U6AL 3OKLA 1HSAA 3DRQB 3AFLA 4XCCH 5J1TC 3QO0A 4ODHL 1A4JA 2WWMD 5CWSA 1QFPA 2H26B 3GMMA 1FN4B 3T0EE 3F5WB 4NWUH 1AO7E 1H0DA 4KMTH 4LSUH 4ZUUB 4F7EB 1A1MA 3GJEB 3TZVD 2FYYA 3CSBA 3O45B 4WWKC 1I3GH 4DUVA 1XF5A 2FL5A 3HLAA 3L1OL 4KKBC 4IDLA 4CL7A 2DJUA 1VFOA 2BRRL 3RVUD 2F19L 5HYQA 4UV7L 1ND0A 3KVQA 5I1HH 2F53B 4KHXL 1FORL 1S7SB 5I15L 3IDMB 4LSPL 4AJ0A 3QZWB 2X4NA 5HXMA 4JKPL 5D96B 3RUGB 4LHQB 2AEPL 4P0DA 1AD0B 1UG9A 5C08B 3UDWA 4OF0A 3FO2B 1RIUH 4QRUA 2AABH 2GTZA 2FHFA 4W6WB 1CVSC 2WZPD 4ZUWA 1CICC 4WFHD 3FTGA 4XH2B 2AJZB 1A6VL 4JQVA 2V17L 1HKLL 3AY4A 5EOTA 3MCG1 3VH8G 4L8DB 5C0GB 4OCXL 1DBJL 1MREL 2EIBA 3DX6B 4YR6A 1WFUA 5GJSH 4XNQA 1E4KA 1HHKA 1IGFH 5DT1L 4RGNE 3TJHD 1CICD 5IB4A 1S5HA 5C0GA 1MWAA 1N4XL 1MCKA 2EC8A 1ZT1A 1EK3A 2DBLL 4XB8A 4NJAL 1FL6B 1QLRB 4PJAE 4F7TA 2XG5A 5DRWB 1DBML 1FGVH 4AEIL 3TJEH 5FHBL 4KHXH 2CD0A 4J3TA 3W0WA 2HJFA 2VLME 1BVKB 1S7VA 4ZFOB 4L3AA 5T1MB 3MRBB 1G9NC 3DXAB 4OJFL 4O9HL 2VDRL 4Y16A 1RAMA 1NCWL 4LOUC 3QXAB 1NGQL 1OT1A 3V6OA 2VJXA 4ZS6D 3U9UA 1NAMH 3HB3C 3ULUL 4NKOB 2B4CH 4IDJL 4IMKA 2OBGA 2CO6B 3P77A 1IAMA 3WFBH 2Q7NA 3DGGA 4UNVA 1MFEL 1SVCP 1IQWL 1K4DB 3QIUA 4KKBD 1JWUA 1R3LB 1GC1C 1D5ZB 3VXUA 4I0CC 3SE9H 4IRJB 5DFTA 2FATH 4NO2A 2X4PA 4QXUL 2DLGA 4QF1B 3RZCA 1KNOB 4M8QB 1A7NH 1P84J 3EOBB 1LILA 5CBEA 3NCEB 3SDCA 2DQFA 1OPGH 5CEZL 1JGUH 2DN7A 3DVIA 3ELAT 5D93B 5GGVY 1IKNA 5DMGC 1DBJH 4NYLB 4YH6A 1EEUA 1OAYH 4M6NL 1S8DA 2ESVD 1AGFB 4M3KB 4NZUL 1HHHA 3MLUL 3WIIL 3X3FL 4XMPL 3MBEC 1L0XA 1GZPB 1UXWA 4M6ML 1N0LA 3CDGB 5A16A 4O51A 4GKZB 5FK9B 3Q3GA 4WO4C 2ZCLL 1U8KA 2DI8A 5ETUA 5GS3A 5GRUH 5A1AA 4KK6C 3CX5J 3GMNA 4X6DA 3TN0D 1MUJB 2DYPB 5JW4M 4X7EC 1WBXA 3DMMD 2Y36L 2Q7YA 1F11A 3QDMA 1F6FB 3QJHA 1U3ZA 2VKWA 5TFSH 2R1XB 2NY2D 1FO0H 1FVCA 5D1ZC 4GSDL 4R2GB 4OI9A 1OWRM 1QRNB 4NO3B 4FQXB 1N0XL 4I13B 1A9BA 2AQ1A 3O9WC 4ODUB 4U6HA 2Z35A 4NM4L 4L5FL 3WHXB 1HYSC 1G0XA 2HRLA 2E7MA 5JDJA 5BZWB 5HVHC 3CMOL 4JLRA 5K9QG 5T33H 3TNNB 3BXNA 4NDMA 4NSKA 5C0AE 1U8JA 1DL7H 5AD0A 2J8UF 1MVFA 3OKNA 4HK3N 2EYRA 2Q6WA 5MEQB 5GQBA 3ILPB 3FO0L 4PJ7E 4JFFA 5IW3A 3IF1A 4G6MH 2DI9A 3KPLB 3HR5A 4J3XA 1IAOB 1OAYL 2E9BA 5BJTA 5D7IE 4J3OC 3GSRA 3HC0A 4PJHA 4HSQA 4U1HA 3MJ8B 3T2PA 4XXDA 2I60H 2P8PB 3ESVF 4O4YH 2C1PB 3MXVL 3C08H 5EPMA 1CGYA 4IIQA 4PGCA 1N7MH 5GZOD 3NPZB 3RGHA 3VDBA 2FLBT 1R3IL 4P9HH 4ZXBC 1YMMA 3PGCB 3FN9A 5I8CB 3C6LC 5H37H 2R9HD 5E2VH 1HYSD 3I6GA 3GMQB 3HC3H 2H2PD 4XXCC 1NFDA 4PRAA 3RVWD 1EJOL 4AY0A 1UT9A 4WTXA 1R6VA 1N0XH 3GHBL 2OXHA 5FECB 3H9HB 2W9DH 4WV1B 2PYEB 3RPKA 5EOQH 5B4MD 4KFZC 2CIIA 1WZMA 1WWCA 1FZOB 2NXYD 2FD6H 4G8EA 4FTVA 1FAIL 4MNGB 3VFVB 5JW3H 5T33L 3FQNB 4UQ2A 4LMQE 4PBVC 3CK0H 2P5EB 2XICA 4MAUL 1LHZA 3V5KA 3TVMA 1DUYA 4HGKC 3A6BL 1AJ7L 4QHKJ 3OQ3B 4JM4L 4JPKH 4K9EL 3B2UD 2QSQA 4FQXC 5KS9F 2P24B 3LMJL 4CNIB 2Y6SC 5IBUG 3T2QA 1E28B 1UM5H 4HHAA 3QBTB 4PGEA 3IFLL 1WBYA 5D6DA 1VHPA 2QJDA 1SMOA 3SCMD 4KKNA 4LVHB 2IQAA 1Y6NR 3IJYB 1YEJL 5I1JL 5F88B 1MHEB 3WFHB 3PUCA 4MSWA 4EZMA 1CXIA 4NNXA 4ORZC 3H9HA 1G9NH 3C8KB 4R0LC 1T04B 1LNUB 3KGRA 5GRWA 2HKFL 1A0QH 2ZUVA 4L8CA 5C70A 2DKMA 1S7VB 4ZFOA 1L9MA 5E5RB 2ZNWA 3RVTC 5DQDH 1NCDH 3BGFB 3HC4H 3GJEA 1A1MB 1MSPA 1GGUA 5IMLB 1VKXB 2M26A 4PY7A 4ISVB 3FB7B 5I30H 2W9DL 5KTEH 1T89A 1YN6A 2EDXA 3MA7A 1F58L 4JFYB 2ICCA 4ZXBD 5D1XB 1CF8L 1LWRA 1WBZA 4Y2DA 5JA8B 5M7QA 3T4AB 3FOLB 5EU7E 2AJSH 4URTB 5DMJB 1A9EA 5ERWB 2OL3A 5HYEA 4M1DH 3SDDB 5BS0B 3A6BH 2UZIH 4XPTH 2ZUTA 3QP3A 4JFDB 4JPKL 1GGBH 1MJ7L 1DQLL 4PJFF 3DHJA 2MHAB 3NCBB 4L8SB 3LMJH 3O8XA 5DD3L 5LQBH 1EO5A 4TNVF 4X6CA 1YEIH 3FFCB 4X8JB 3K4ZA 4KGLA 1NC2A 4WY7H 4WIQA 3VXUE 1KG0B 2R0KL 4ZUWB 1NC2D 3TBVB 5MERA 1OSZB 1YEHH 4ONGH 4XP1H 4O51B 1XGYL 1J1PH 5FK9A 5B22A 4A6YH 4YHLL 4OFKA 3QUYC 1UGNA 1F6AB 4JN1H 3QIWB 3TC9A 5H35B 4U6XB 1NGWA 3L3HA 4YGVA 5B3JE 1BD2A 5I1KH 3LH2L 1MCDA 2HYMA 3SO5A 3B8YA 4MJIA 1I7TA 2R1XA 1NDMB 1SJHB 4R4BA 3KNBB 1TCMA 4KKCD 5C9JA 3ARFC 2R29H 4YDJB 1G6VK 1QO3B 3DVGB 3ARGD 3GSVB 2AJXH 3MBED 4Q9BA 2CRMA 5FV1L 2ADGA 4LCWA 4P5MB 4NQDA 4RDQG 1KJ3L 5SV3A 3C60B 3WO4C 1BPVA 2AJSL 2ZCKH 4QXGH 1EEZB 4M7JL 1OQXA 4PR5A 1DSFL 3MJ9L 4AIOA 1V7NH 5C0FA 3DO3A 3PL6B 1ODAA 2HT2C 3DV6B 4WHCA 5DJ6B 1KIQA 4XPTL 1PG7W 4GRWE 2NX5A 1KIUA 3GSXB 5F7DA 4GKNA 2YXMA 4MD4B 3S35X 3UMTA 1HKFA 1W0VB 5IR1B 3GSQB 1MRFL 3OXRA 4MHHI 1K8DB 2V2TB 2R0KH 4MS8D 3D39D 4IRJA 1T1XB 5EO0A 2R1WA 4IRJD 3O45A 3ES6A 5SX4I 3VDCA 1J1PL 2JCCE 4BFEA 5J3HD 4NP4H 3O6FC 3IXAA 1KB5H 2HFFA 3SE3C 3GO1L 4YWGH 5FYJE 5GGQL 5D2LA 2FEEL 4Y1AB 5E5MB 3KYMA 2C4XA 5TE4H 1QPPA 2V7HB 4N5EC 4HWBL 3VXOB 1N6VA 5IROC 4XP6H 1KJVB 4N0FA 5DQ9A 2VXVH 1D6VH 4YDKL 5BVPL 3DXAD 3FMGL 3FB8A 1RJZA 1PQZB 1O7SA 4D9RE 4QRSB 5C0FB 4F7CB 1QA9B 2IH1A 3OGCB 3L3OA 2DMBA 2DLTA 2ITDA 1VFAA 3HA0A 1D5MB 4XVTH 2BSSB 1MFCH 4OLZL 4PGDB 3VMOA 1QSEB 1RVFL 1WTGT 3L6FB 3MBEB 4ZFZA 1UYWL 5L2KA 2ZCKL 3NIGF 3SPVB 4P5TC 2I26N 3MJ7B 2FWOA 3IDGB 2ITDB 4JY5H 4JFHD 5EZIL 5JW4N 1X9QA 5DJ0B 1LEKA 3QDAA 4AH2A 4BQ8A 4YXLL 3FQXA 3QWQB 4OKDA 5FUCC 4X4XB 1QFUH 3L7FB 4HD9A 1OSPL 4EUPH 3QXTA 4KTYA 5H94A 3MRMA 3C60C 3P9WB 2XRAL 1G6RB 3MCKB 2PYEA 2G60H 4MJ2A 2W9EH 2P44B 4F33A 2QSTA 2F54B 5T1DH 2AERT 3HZVA 1XGQA 2ZG2A 3GM8A 5IVXF 3O9WB 3O3BB 3QPXL 4NRZA 1Q0YH 3RHWF 2VR4A 4GAYA 4JG0H 1UQSB 1HE7A 1V3JA 2DQUH 5FKAB 1HQRB 4X6CB 4LF3A 3CLFL 4XP6L 5DGRA 1YJDH 2P5WA 5AYUH 1PKQE 3MLTB 4X6BB 4DUWA 1Q0XL 2P8PA 3QEQE 3IFNL 2R0LL 2PR4H 4R26H 2VABA 4KAQH 4HXBL 4NN5C 4S1DC 1TNNA 3S5LB 4K3HA 1NQBA 5E2JA 3NZ8B 2DL2A 1MIEL 4ZUUA 3B4NA 1C1EL 2XN9B 1UH3A 2X70B 3SQOH 5IHBA 4ZNEA 4MX7A 3P73B 4HLJA 2NY5C 2BZDA 3ZDZF 4Y4KB 5CKGA 5JZ7D 3BWAB 2ORBL 4GG6A 1H8OA 2E27L 5KS9E 3LAFA 1DLHB 3GSNA 4E0RB 4LPWA 4PV9A 5DXWA 3RL2A 1IEHA 3VWKA 4IOIB 1EAPB 4AIZB 4MVBD 1ZE3C 3HS0A 3ZYIA 4BELD 3V5KB 5KVEL 3EDDA 2VTFA 3U7WL 3D87B 4G8FB 3QEHA 3VXTB 1P7QA 1K8IB 3REWB 1XF4B 4XP5L 2VLRE 1FG9C 4J3SA 4HEME 5D72L 5GRXG 1EDQA 2WUCH 3STZB 2BJMH 3VGFA 4L8BB 1A6AA 1W0WB 4S1SL 3KWWA 2XZAH 4WHDA 2I9LB 4IJ3B 2I9TB 2VZSA 1VCAA 4MMXC 2PW1B 4LQ1A 3VRLE 5TH2A 3W9DA 3CLEL 4JHWL 1CL7L 3CPLA 3FJTA 1GZPA 1NKOA 4XPFH 5D7JC 5LKNA 4PUBL 3MRKA 3SJVE 3EZJB 4KDTA 3AVEA 4MNHA 4U1SA 3U79A 2DMKA 5DUBB 5T1LB 3ARGB 3LPFA 3RDTA 1A1OA 2DDQH 1IAII 2PYFB 3G5YB 4OCYL 5CGYD 1HNFA 3RDTD 3D85D 3P11H 1ZT4B 1HH9B 4JREC 2Z31D 2VITA 1H3GA 3D3VE 3G9AB 4TNWF 4XWGH 5D8JH 3MRMB 2NXZC 5CJOH 2Q8BL 4M5YH 2A6KB 1ZGLA 1J1XH 5FYLD 1QG3A 1NBZA 2XNAA 4HZLA 4YX2L 2AK4B 5K9KB 2A9NH 2XI9A 5GGSA 4Q2ZB 2FX7H 3PHQA 4OSUH 4XC1L 4MB3A 3ZO0A 3HNTL 4KTEH 3BW9B 4Y19A 1E6JH 3IXAB 1M1SA 2XIDA 1CLOL 4X9IA 1MAML 4G42B 3UZEA 1B0RB 2EIZB 3JUZA 1JTPA 4AMKH 3UJJL 1Q94A 1FGNL 4FP8L 1RZ8A 3D69B 4GUPA 4MNQA 2B39A 3D0VB 1AXIB 3FB8B 2JB5L 1R3JA 2BRQA 2X4RB 1N6QH 3T0AA 3GMLA 5E6IB 4TN9A 1RD6A 3DO7B 3AROA 3L9RB 2BNQA 43CAA 5JXAL 1AP2A 2YC1B 4XPFL 5GS2D 4MCZB 4NQED 3WHE0 4HJJL 32C2A 2C3XA 5HBBA 5EU6D 1ZGLB 1JGEA 3X12B 4JY6A 3DETC 2VZ3A 3QEQA 4OQ1A 1I75A 1CL7I 2FCBA 4YJZL 4G3YL 2FWOB 2GK2A 2VISB 1X5YA 2FGZA 3QUYB 1FQ9C 2I07A 4XNMA 5D8JL 5M94B 1A3QA 5FKPB 5DMYA 4NWTH 4I0KA 5FO9B 1FAKT 3TBTA 2Q7YB 5MEND 3TCLB 4KI5E 3RAJL 1FZMA 5C71A 4NM8H 6FABH 5KSBB 3CNKA 4KWUA 5DK2A 4H0GA 2JF1A 5TDNB 3P4OB 2N7AA 4YHOL 4PR5B 1F90L 3RWGB 3RGVD 1A5FH 3ZYZA 1IFHH 4Z7UF 4NRXA 1CLOH 1HSBA 1S7UA 4LL9A 4D8PA 5HDBE 2IGFH 5GS0H 2VXQL 3MRIA 2ICES 4QEGA 2K7QA 4U1LB 3HCVA 4FQCH 5FO7B 5DJYB 4AMKL 3GSOB 3ARXA 2GW5A 3UTQA 3NPSC 1K3IA 1TVBB 1LO0H 4JAMB 1BQLL 5ILTL 2O26U 1H9VA 3EJYD 1T6VN 3THML 4X7SH 3OF6A 1NGZB 4GBXC 4WI8A 4F7TB 3T0DA 3QCTH 5JXEC 4YBLC 3KS0J 4J4PD 1I8KA 3EYVB 2BSTB 2E9JA 4NKQB 4JFZH 3ULVD 2YPVH 4OM1H 2J8UA 5GGTL 3LKSA 1A7PH 5HPOA 3P77B 3O9WA 3QDGE 2J88H 4H26B 1FPTH 1ITCA 2YSSA 3DROA 3OZ9H 4AG4L 2WANA 3BI9X 3OB8A 4C57C 4LCWD 5E8OA 5EDXA 2G9HB 4F15C 2D0FA 3CPLB 3KPOA 3SE4C 4BFBD 4UTAL 1AQKH 1RUAH 1JF1A 3LY6A 2EDWA 3IDYB 3EOTH 3PWNB 1FVCB 5D2LE 2Z9TA 3MRGB 5CCKL 2NR6D 4UT9H 5KSAA 4XCCL 1CCZA 4EN3D 4UDTA 2FJHA 2PO6D 3UO1L 3MRQA 1KENL 1QD0A 3D25A 3OJDA 5CEYA 3H3BC 3CH8A 3PWNA 4LK4A 3REVA 3QAZC 3NCJL 4GUPB 1RIHH 3VG9B 3BEWB 5DC4B 2IGFL 3O4LB 5GS0L 3GNMH 5DD6A 2ED7A 3QA3B 1AXSB 3PIQA 5B39B 4I0PA 1MVUB 1HILA 1MWAB 1VERA 5GRJH 5HJ3B 4POUB 1J87A 1BD2D 1P9MA 1YZZA 2XPGB 4GRLC 3BN9C 3BH8A 3NTCL 4LVOC 5FUZH 2F54A 4KJYA 3THMH 1RIVL 4F80A 3QR2A 2CIKA 1WAAF 3O3DA 2UZXB 4NQDE 5DRZB 5JUEL 1EXUA 4JHZA 1SVZA 4OUUB 4Z7QF 4P4KA 3CVHB 2UUDK 4WU5A 5FGCE 4N0YH 4Z18A 4QLRA 5TE7H 1Z0NA 4PIRF 3MLYH 4XCFL 5E8DL 5JW5B 4H25B 2WIMA 4M93C 3W0WE 2LFGA 3VXMA 1U9KA 1VPOH 3VH8B 1MHCB 5CMAA 5D1QC 5J4MA 4V2CB 1OAXH 3UP1A 4U6YA 2D7OA 4X6FA 2QQKL 1G9ML 3HZVB 5HYJD 3DXAE 1OTSC 1IM9D 3WIHH 4BH8B 2AK4E 2IAND 2EO1A 4PJ5D 4H5SB 3STBA 2ADIB 4YPJA 1OGAD 4XP9H 3LB6D 4G6KL 1KPRB 3V7AE 3CUPA 1T7WA 4ODVH 4FTVB 5J0BA 3ILQC 4LLMB 1EMTH 3G5XA 2V7HA 4PJFB 3WE6A 3R0MA 3BSZL 4HLZG 4PLKC 1KPUA 1OP9A 1G7PB 3IT8D 5E9DE 4R97B 15C8L 1Q9OA 3HG1A 2O5YL 1I9IL 1NFDB 2AABL 1TVHB 4LGRB 1K8IA 5TQ0L 4WHTB 4IM8A 1OW0A 4Y4KC 2XQBH 1CTOA 2IANB 4PJ5B 5JUEH 3GJFA 3LKRB 4LLQA 1QOKA 1VADB 1Y0LA 3QNYB 2YRPA 4Q6IB 2VDLL 1MFEH 3QPQC 3BWAA 3TVMC 2OJEB 4W6XB 1NGXA 4WGVB 5DSCA 4WCYL 1IZJA 4JDTH 1UA6L 4A6YB 5GJTL 1UWXK 3ULVH 2GUOA 1RZKL 1OPGL 1X3DA 4LDLB 5DTFB 1CXFA 4BKLB 3TZVA 4FFWD 3HE7B 1CGVA 4M6NH 2Q6WB 1J0HA 4M4RA 5IW6A 2PETA 3CZJA 5I1CL 3X3FH 2R4SL 3TA3B 3RTQA 4WW2A 2HLAA 4BH7A 2YEZA 4QHLB 3AREC 5HGBA 5D1XA 3ZTJG 5DJCB 2VDRH 3U0TA 4XVJL 2LV4A 3ZL4H 3W81A 1DEEA 1HNGA 3O2VL 1OP3H 3RFZC 4OLWL 5GISH 4X9HA 2QQLH 3HPJB 3BSZH 5I9QB 5HDQL 1NAML 3QIBD 4QRTB 2BOBA 3EO1A 1SQ2N 3M8OH 4JAMA 2VIRA 3MYZA 1C5DB 1LO3L 4XHQA 1MJUL 4Y16D 2R15A 3UBXI 2H2SC 2XG4A 4L3ED 5CBAB 1ZK9A 2J5LB 2QSCH 3I50L 4FFVD 2WK2A 2I27N 1KLUB 4OIAA 5FYLE 3H0TA 5C0CB 1OTUD 5IKCB 1I1RA 2C5DC 4XNUH 3BMWA 2XWJB 1S9VA 4S1RH 3WNMA 3PDOB 1HWGB 1GOHA 1VGKA 4Z7VE 4G9FB 2DQCL 4KVCH 1YQVL 4KUZH 1JGUL 2GT9B 2P7TB 1RULL 5IMKA 4RWYH 5JDSA 1FBIH 3IDJA 1MJ8H 2VAAB 3CXHJ 3KHQA 4QXWA 3RTQC 4UUJB 4NZUH 3WIIH 3X17A 3MJ9A 1TPXC 3FZUD 1EFXB 2VWEC 4RMQA 2P5WE 4GH7B 4MDJA 1AY1H 1JRHL 3W39A 2D2OA 3KNBA 4G6ML 3RQ3A 1W72A 3W0WB 5HHNA 1G6RL 5GIRA 4QHMB 5HHXH 5H2BB 3EYOB 4U6VH 1ZANH 1MCWW 3KYNB 2XT1B 3PGFH 1QA9A 3DSFH 3VXSE 2J7LA 5I1LB 2HA1A 5D6CB 3G08B 4KV5E 5DA4A 2AJ3B 1YMHB 1T0PB 1U8NB 1IL1B 5CSBA 3LRSB 4QNPF 1OVZA 3WS3B 4UNUA 3MNVB 4MQ7A 4NQXB 2BY1A 4JFFE 4ENED 5GHWH 4QGYA 3HE7C 5ALBH 1IL1A 2J6EL 5EN2B 5T3ZD 5EUOE 3SE8H 3GSNL 4PLKD 2COQA 5IT2H 3MLTA 1KC5H 1ZLSH 4NZTL 1ACYL 1J88A 2CR3A 1DL7L 4AEHL 4N0UB 4Z7UE 3HAEG 2IG2L 4KK9D 3L5WA 2X4UB 1YC8A 3EOYG 4XP4H 4EDWL 4P9ML 1T0MB 5KN5B 1VEMA 4WTZG 2VLRA 2B1HH 4C56B 1MRCL 1LGVA 3BP4B 4H1LH 5CAYB 4DGYH 5HYSB 4NQCD 4NT6A 1A6AB 2J4WH 2YUVA 3ULUE 2NY5H 3MOBL 2HFGH 3I2CH 4QRPE 4DCQA 4JM4H 1ZLVH 4HS6A 1HXYA 4QHNB 1OTUC 1JRHH 4PJ7F 4R0LB 3BJ91 2YZ1A 3NGBC 3RWGA 1P7QD 3DGCR 3UJTL 4NJ9L 2BVPB 3DURA 1QFWM 1PYWB 4J12A 1X5HA 1CYGA 4N8VG 4JDZB 4WFEE 5D70H 1KOAA 3I6KB 1M71B 5T1MA 1JUFB 4TVPD 3IVKA 3MRNA 4PJBF 5I1JH 4IOFD 4UB0L 4KRNA 3KJ4B 1QRND 2E7LA 3M07A 3H9ZA 3MRGA 4R4FH 1QNZL 4WJ5B 1KJMB 2PKDA 4KK8D 1H5BC 1ZTXL 1JPSH 1E4KC 1RJYB 3WEXA 5L0QB 3HE6C 4YEFA 4IMLB 4X5LA 2HLFC 4HXAH 3GSNH 3VW3L 1BX2A 2H1PH 2YEZB 3TN0B 1FVDA 5C09B 4L8SC 4PRDA 2YMXH 3KPLA 4G6FB 5I1AB 4XP4L 1OLLA 4P3DB 4GG6E 5IVZB 3CFEB 3F7PC 35C8L 1DANU 3I85A 2NY6C 2IADA 3VFWB 5GRVK 4HIHA 1VFUA 1HHHB 3VMNA 1UACL 2OI9B 4XNZC 3RNQB 1IBGL 4IIQB 2KQMA 3NN8A 2P46B 1M7XA 2YXFA 1F3JA 3S34L 3CFKB 2JLLA 2VZOA 1ZT7A 3HUJB 5I17B 5DQJA 3MV9D 3HZMA 2YWZA 2PO6B 2B5IC 4Z7OF 1RZJH 3SHSA 4DWHA 2VSCA 4OM0L 2GIYA 4AM0B 3KPSB 3SGDI 3FQWB 5DZLA 4XAKD 2CMRH 1XGYH 4P57B 4MJ6A 3JWOC 4OUOA 4KI1A 2A1WL 2GJZA 4I3SH 5FYKL 3V4VL 3ARUA 5FA3A 4RIRA 2NTFA 1H5BA 1A1OB 1DQML 3MLPA 3S96A 3PWVB 5KTEL 5ANMB 1EA9C 2WP3O 3B6SA 5TE6L 1YN6B 1X4XA 2RFXB 2WIIA 4HXAL 1NLBH 1U36A 1V7MH 4OD2A 5FKAA 1ZS8B 5GGVL 3WXVH 4ODTL 1QBLL 3MLWH 1C08A 1HCFX 1MCEA 3QCUL 4Y2DD 1X5FA 2PTTB 1XIWB 4LPCA 3JV4A 3PQYB 4MQXD 5DD3H 4KGJA 2DQHH 2MCPL 1I1AB 1CT8A 2CUIA 3RY6A 4R7DA 3HE6B 4TNVK 3LEYL 4YHYC 3MXWH 2CUHA 4HF5L 4KRPC 1MPAL 3K3QA 2A73B 1YEHL 2VYRE 4Z77A 1XF2B 4N90D 2BY3A 4B7IA 3WJJA 2MQCA 1FNGA 5ISZA 1N5AA 4JN1L 2V2WB 1BQHA 3U7YL 1BIHA 2L0DA 5SWZA 4P2OA 1JPST 5DRNB 4CW1B 5C0RL 2OJEA 4PJFA 3DO7A 5TDNA 1M7DA 1G7LA 5BRZB 2EEDA 2SEBB 4KKAC 3SQBA 1I7TB 2NX5B 5HI5C 4XBEL 3QH3B 4XRCB 43C9B 1A6TA 4JO4H 3QFJD 4Q6IC 5FYKH 3V4VH 1MNUH 4F7PA 5F9OH 4I0PD 1HILB 2F5AH 1OLZA 1TTUA 1NKRA 4HWBH 5AZEH 1HH9A 4MJID 4RA3A 3TT1H 4R2GC 1MHHA 1KBGH 5E2WL 5CUSH 4EN3C 4DAGH 3ULVE 3A6CH 3RU8L 4B41A 4D3CH 1S7WB 2WBJB 1KT2B 4O2EB 5EU7C 5E5MA 4MNGE 4DK3A 3LKOA 1IEAB 4P4KD 4O5LL 1J11A 1WEJL 2AGJH 4OZIE 3S88H 2IQ9H 2HLFD 1UYWH 3TA3C 4JHBA 4KQ4H 1RJYA 1K2DB 4ELKB 3PIQB 5B39A 2XZZA 1J18A 2R4RL 3GSQA 4UT6L 4KK8C 5LGHL 4JY5L 4FOMA 1U91A 4HUXA 4Y7MA 3QIWA 4RX4D 4J4PC 3B3IB 4HDIB 3GI9L 4KJYB 3QNXB 2B0SH 1TQBC 4GO6B 1IM9A 3M1BA 3IS0X 1IQDB 4L8BA 4ZAKC 4LSUL 5HGHA 3MRJA 3EGSA 3CU7A 3L7EA 1PYWA 3Q6FB 5DF0A 4KV5F 1T66C 1JBJA 1I1AC 4FFZH 3DNKA 1CVRA 1F3DJ 2FBOJ 4K3EL 5IFHL 2BRRH 4PJXF 1D6EB 2Z91B 3OTTA 2F19H 5DD1L 3IVKB 1E28A 1TJGL 3FMGH 3IDNB 3S6CA 2G2RA 5JNYB 2A74B 1HIML 4K7PL 5I15H 4L29A 3BFOA 2Y7QA 5LWYL 1BECA 2XKUA 2HJKA 5MEOB 2OJZH 3QG6B 4BK5A 5TDOB 1EERB 3BH9B 5DD0L 1PG7X 2N56A 4CGTA 5HJ3A 4AZ8A 3N1FC 3A6CL 2CDGA 2QR0A 3NFNB 3U36A 4WHYG 1JHTB 1A1NB 5GSVB 4TOYH 1AD0A 2R0LH 4N1CA 2X5PA 1J1OH 1JPFA 3O2WH 1F4AA 4Z0XA 3FCTB 5BW7A 2G5BB 1IC7H 1ED3A 1S5IH 5BOPA 3ESUF 4FNLL 1EEYA 2H9GB 3NIFE 4P2RE 4XVUD 4FQ2L 1E4JA 1FFNA 1WK0A 2GQHA 2JB6A 1D9KC 1XCTA 5HYJE 4WHYH 3IAGC 2WSKA 3DHMA 4AIXA 4I48B 3E3QE 5D2LB 1ZS8A 2LU7A 2V2WA 1YPZE 1ED3B 1ZHKA 3X3GL 3TWCH 4EI6A 1PEZA 3ARBB 2B0SL 4N0CD 4KQ3H 4M62H 3HNVL 1QYGL 3MV8E 3PNWA 4J2XA 4Z76A 4C59B 1INEH 5GZNC 3KPNB 1FIGH 2Y9RT 4Q97A 4G80B 5IB2A 2AQ3A 3BUYB 3L3KA 3WS3A 3U7WH 3J7HA 4WEBH 3UC0L 1W0YT 4NJAH 1LO5A 2VLKE 4LASH 2DM4A 3GFUA 4OTXH 5LVEA 2PTVA 1NUGA 5HHQA 4WUUA 5E9DD 2ED8A 4JFFB 3ARPA 4F7EA 1GGCH 1HIMH 3V5HB 1RU9L 1NAKL 1FH5H 5LWYH 4R26L 2QEJA 4JRYA 4HXBH 1YEEL 3EDEA 3UYPA 4PJBA 1WQVT 3GZKA 1VDGA 3DVFA 1IAIL 1F02I 3GUTA 1DE4B 3ULUH 3CSYB 4I18C 4OD3H 1MHPL 3UJIL 2VH5H 1AGDB 2IANE 4PJ5E 1WITA 3O2WL 4PJ8C 4DTGH 3WN5B 2DQEL 2ESVE 4X6EB 5GSRA 4PJ8D 4HBQA 3T3PE 4LLWB 3SDXE 3VXRA 1U2HA 4HUXB 2HRPL 2PW1A 2W07A 4WUKH 5ITFB 32C2B 4OCYH 2IAMC 4J3WA 1JGLL 3MGOA 4XNXH 1T21A 2PW2B 4D9LH 4RMRA 2C1OB 1E6OH 5GZND 2VDML 3X3GH 5I2IB 5GRVL 3Q6GL 2NY1C 4XMPH 2NY0B 1RZFL 2XTJD 3ARSA 1TETL 3WLBA 1INEL 3KYMB 1GIGH 2ZCLH 1CI5A 2FX7L 2P5EA 1A3LL 2X9WA 2ESVA 4OLEA 4HCRL 5JHDE 4PJDF 5GGRA 4LASL 3QUMB 3SKUD 43C9A 3VA2C 3DIFA 4Z7WA 3JUYA 4YHIA 4F7PB 1RURL 3QISA 3ILQD 4PJBE 4OF6A 4PJ9D 3QUMH 5DYOB 4Q2ZA 1F45A 4L4TE 1TITA 1MQKL 3R0NA 1I9RL 1QSEA 1C12B 3SKJH 5ESQA 2FIKA 1BM3L 1T7YA 4P2OB 4ZPTB 4OLVH 4ODUA 4OF8A 2BK8A 5D7IA 4P46A 5F1OB 1OCWL 1EXUB 4HEPG 4C58B 5E08L 2CK0L 1B88A 3GRWH 2Q3AA 2HFTA 4JGMA 2ICWJ 3CX2A 3F58H 1R5VA 5A3ID 1F4WL 4XAKE 4N1EA 1CK0H 4KRLB 1JZ6A 5D1QB 2WWMC 1JGLH 3OXSB 5FO8A 2JIXD 5CD5C 1KTLA 2NLJB 2OQJB 5DA0B 3MRCB 4XWOC 3MBXL 1FL6A 1BF2A 1T1ZA 2P5ED 1NBQA 2DWEA 2DM3A 3HNTH 1J86A 2B8OT 1T1WB 1W8OA 1HH6B 2VZ1A 1MCBA 4I8DA 1NDGB 3O41B 1ZOXA 3WSQL 5F9AC 1KPVB 3CXDH 3BN3B 5EUKB 4M1CC 1JVKA 4HIEB 2KBGA 3SY0A 4RIRB 5C0CA 1XCTB 4YZFF 1JUFA 2HVKA 3V4PH 1XGUA 1URLA 1HHIA 1OTSD 1DP0A 5ICXA 3B9DA 2AV1B 5F7YC 5LG1A 3SDAD 4KJWD 1YA5A 5C7XL 4DN4L 4MJ5B 4HH9A 5D2LF 2VXQH 3PGDB 3LSOB 4PJAF 2VDKL 3MSPA 1IC4L 4MNQD 4RAUB 3L95A 4KRMB 4UOW1 4HJJH 3QWOA 5FDWB 1MFAL 5JW5A 3SDDD 1BQLH 4XCYB 4G43B 1FFRA 1CGWA 1QSFB 1T4KA 1WBZB 5FYJD 4NQDB 4J23A 2EO9A 2GI7A 4MAYA 3FFCD 2DAVA 3VJ6B 2CJUH 5EU6A 2JJUA 1EO7A 2JIXA 4XCYA 3WNLA 1IAKB 4NWTL 3JV0A 3WD5L 3WDHA 3BZEA 4BUHA 4HIJA 5FCUH 1KV3A 3OZ9L 4AG4H 4HK3J 4IOIA 3WL9B 1Q72H 5HYSA 2H8PB 4M6AA 4PPTA 2IPTH 4O2EA 5TF1H 2R0WH 1J8HD 3WXWH 2NNAB 4K3GA 1AQKL 1RUAL 1MH5A 1M7DB 1PG7L 5BRZA 1CQKA 3EOTL 4PS4H 1A8JH 2X40A 4K3DH 3VDAA 3P3YA 4X0KB 5BRZD 4KTDL 2QHRL 3DUSA 1D5MA 3JTTA 3CXDL 1JPFB 5EIQA 1NCCL 3SOBL 5HD8C 5CWSB 2UV3A 1K4DA 4LRIC 2ZP0T 3WNOA 3CZFB 4W68A 3VFPA 3NOIA 4UV4L 5JMOC 4PRBA 2NR6C 3V79C 4YHMH 5J8OA 4M5ZL 2GSGA 2H3NB 3DX7A 1EAPA 2E5EA 2YD8A 5MHSE 5EB9A 3U46B 2VDKH 3EO0A 3DTXA 5F7NC 1U8HB 5GRJL 2LABA 3P40A 4OKVA 2UYLA 4XZUB 4LP4A 1BFVH 4OCWH 5JO5A 1EGJL 1RIVH 3FO9B 3CXHK 4KKLC 1G7MB 4MDIA 4X80L 4PD4K 3UTZA 1A4JB 1HDMA 3RUGA 3FAXA 4XMKH 1JZ8A 1YPZF 3LD8C 1YEKL 3MRRA 4DKDC 1KB5A 5FAAA 2NLJA 1P4IH 2OQJA 4D94A 2UZIL 5D9SB 5TE7L 5L9DH 2BNUA 2UWEE 2VXSH 4Q0XH 1GGBL 2F74B 3TYGL 5HVFB 5CCKH 5E24E 2YUZA 1NBYA 1INDH 1BOGA 3O6FB 1FV1A 2D3VA 4F7CA 5E6YA 1KENH 4L4VA 4DN3L 5B8CC 5IFJB 3O8XD 4XMLL 3RWDA 4LLDB 4OZFB 4GRWB 2ZZUT 2Y1VA 1NGPL 2I5YL 3CFDA 5KSAC 1JIBA 1FYTB 1OGTB 4A6YL 2MFNA 3GNML 1K8DA 3LS5L 4UIMA 5CP7A 1KCSH 3VFSB 3MLZH 1K5NA 3K7UA 1J12A 4UV4H 5ESVA 1JHKL 5I1KL 3VGHA 2HTKC 3BKJH 4HBCL 1CFNB 1G7JA 1N2RA 2FDBP 3MLSL 1SEQH 2PUQT 2NW2B 12E8H 5F21B 1OWWA 3GB7B 4QHUB 4JHAL 2HT3C 5IOPA 3NCMA 3TVMB 1QBBA 3HMXA 4UINH 4QCIA 5CIPH 4Y4FD 4YPGB 2JJTA 3JTSA 4YXHL 1VA9A 5EU4B 5BW7C 3P4LA 1U41A 3IJHB 5EH1A 5TQ0H 4ZXBA 1F3JB 3W2DL 4JR9L 5J1AA 4BM7A 3DRTB 4U1HB 1UCBH 3H3PH 5MERB 4PJXB 4RGNC 4YBHA 4P5KB 4TRPL 4PY7B 5ICZA 3B9KD 4PP2B 1DSFH 1A6WL 3MJ9H 2Z31C 3F7YB 2GHWB 1RZ7L 3I75B 3B9KA 1ZHKB 3L95B 1G9MH 2H6PB 2BVOB 1TMCB 2VXSL 4Q0XL 2A0LD 4JREB 5K59F 1X4YA 4GS7C 3QUXD 4ODHH 2BC4B 4DEPC 3MV8A 5TH2B 3KYAA 4Z7QE 3NMEA 4J6RL 3JTTB 3GSXA 5JIIA 1MY5A 1F2XK 4KPHL 2KZ1B 1JMZA 2NW3A 3KPMB 5F3HA 4ZS7H 4G9FE 3RVXC 4OV5B 5HYJA 3LKQB 1ZA3B 3MFGB 3DURB 3QQ9C 5E8EA 4WW2F 5ID1B 4LLYB 5GGQH 2UWEA 1HEZB 4X8JA 2W0FA 3R1GH 1FORH 1I8LA 3MGAA 3R06A 2DLEA 4OAWA 4ZO6A 3CVIL 2Q76A 3FB6A 3MOQA 5HDOA 8FABB 1OF2B 5HDLA 1KEMH 3W11D 3WO4B 1RZIA 2DYPA 4JHAH 3ARYA 1KNOA 4GKNB 2NY2C 2AK4A 4MD4A 3SDCB 3MACL 3TO2A 1E4XL 5HY9B 1TPXB 1ZEAL 5E2TL 3RA7H 2W65B 2D7NA 1MCFA 4DCQB 3H3PL 2R2BB 4LRNL 1IGMH 4PJ9C 1RK1A 5I8EB 3E2HC 4K94L 5DSCB 3WIFA 5E1HB 5TGBA 5JZ7C 3ULVL 3VXMD 2A9MH 3G5YA 3U82B 2ZSVA 1RZ7H 5DK3A 5EZIH 5F93C 2VLLB 4DKFH 1CG9B 1T22A 3ZT5A 2W0LA 4L8CB 3L5WB 1RZGB 1L7TH 1I7UB 4GXUM 2BXYA 2XRAH 2QQNL 1JWUB 1AY1L 4P59H 3OJ2C 2QR0B 4KPHH 3U36B 2NY1D 2QBWA 2F54E 4TUKH 4FFYL 1JV5B 2WINB 5FYJU 4JZJC 5T3ZH 1Q9OB 3RVWC 2D7QA 1BQSA 4LEXH 3OV6A 4HMEA 4Y5YA 4GJTB