1CFVL

Monoclonal antibody fragment fv4155 from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
DIELTQSPPSLPVSLGDQVSISCRSSQSLVSNNRRNYLHWYLQKPGQSPKLVIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVAAEDLGLYFCSQSSHVPLTFGSGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY FV4155
publication title Antibody fragment Fv4155 bound to two closely related steroid hormones: the structural basis of fine specificity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 24
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1997-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfvL00
5ICXB 1UKQA 1JMZA 3O6KH 4RMQA 5DEFA 5KOVC 1BLNB 2DI9A 2DQJL 3HI1A 5C6WH 3KPPA 1A5FH 4PJXF 4MAYC 4GS7C 2CMRL 4QRSB 1FH5H 1NDGB 5BXFA 3L3IA 2HTKC 4GRWH 3IXAA 4XAKE 4HQQL 4U7SA 1DLHA 4GKNB 2MJWA 1RURL 1PG7X 4M9PA 3ULUD 4UDUB 3OAYK 3VWJC 5GS0C 5DRZB 3H9ZA 1R3KA 5KSBF 2EC8A 4MX7B 1MCKA 5SV3A 5IG7A 3LKOB 1HH6B 3U9UA 1BGXH 3C5JB 4LLWA 3WHE1 3LRSB 3PXJA 3V6FA 4DWHA 4NZRL 5T1DH 1RK0B 4NKMA 4P5MB 2DN7A 1IC1A 2BVTA 5IEKA 2P7TA 1FBIL 4E41D 3H9YA 5CIPB 1MFEH 1E0OB 1T4KB 2LVCA 2K9UA 4NNYB 4YXHH 3O8XB 5AWNL 1A6AA 4HF5L 1S9WA 2DD8H 5MERA 5D5MF 4P46A 4AH2B 3RVUC 1U36A 2FSEA 2HWZL 2D9CA 3QSKB 4OM1H 5EB9A 4XBEH 3KLHD 4X7EC 4XAWH 1U8IA 1CLOH 1D5XB 4RGNB 4Z7WA 2X4NA 3MFFB 5CBAB 5CMAB 2X1PA 5KVFH 4OCYH 3U0PB 1Y0LB 5K9JH 5EH1A 1GH7A 2J5LB 2FATL 2FBJH 4J4PC 4WHCA 5DHVA 4PB9H 1ZGLA 1U8NB 2ED8A 5D93C 5EBLB 4QRTA 5KTEH 5DC0A 4YHYB 4JN1L 2P8LA 3TESA 1CLZH 5SWQB 5I1KH 1QLRA 5EC1B 4NKOB 4RFOH 5KVMC 3UTPE 5E2VH 4X8XA 4HXAL 4J8RA 4XVJH 3N0PB 3DECA 4MCZA 3OJVC 5D72H 4U1NB 3FAXA 2YD9A 3H7BA 1YMMB 3FQUA 3MRHA 4HS3B 4JB9H 1J8HE 5CEYA 3DSFL 3WJJA 5KBNC 2B4CL 2FX7H 1J12A 3DXAA 4XC3H 4XAKD 4U6YB 3JWOL 4PTUA 4JZJA 5TFSL 2CRYA 3CUPA 2HT3D 3VDBA 2D31A 2EDWA 4G42B 4OF7A 4WVRA 1IC5H 5GS1B 4FFVD 1SEBA 2P5EE 3GGWA 1SJHA 4P46D 1D5MB 3J8F7 1TTUA 3I75A 2F19H 5TDOB 1QSED 3BFOA 1KJ3H 4KJPD 5J6GB 2VXSH 2HFTA 3LEVL 4X6CF 1U8KA 2XACC 5FA4B 3TIDA 5I73C 4I5BA 2UWEA 4LHUD 2EKSB 1XAUA 1I9IL 3WIFB 2ZG1A 2F8VA 3IFLH 4FZ8H 1ZS8A 2FX9L 1A21A 2AXFB 1F6AA 3VFNA 5D7LE 3MA7B 3GUTA 1ODAA 5CJOH 4U3XA 1WTGT 5EBMA 1NL0H 2Y23A 4NN5B 3F12A 3MNVA 4PIRF 3WDHA 2V5MA 4UTBH 3QUXD 4DGIL 5IBUB 3EDJA 3BN9D 4LDOB 2E6QA 4ZD3L 2P24A 5KOMC 7CGTA 3Q3GA 1X7QB 4QCIA 3TT3L 3ULUC 1NAMB 3T0EB 3AREA 2NR6D 1U8HA 3K4ZA 3MBEC 5HDQL 4OQ1A 3GMRB 3GO1H 4EI6A 2VKWA 1U0QA 4URTB 1PDKA 4FOMA 3UTPD 4LSSL 4P2OC 3V5KA 4QXWA 4XCYB 3DROA 4Q9QL 2H6PB 3QUMA 5IKCB 4NPYB 1VFAB 4QRPB 1CLYL 5A2JH 1UB6B 3BUYB 3N85L 5DJ6B 5AZ2L 5IBLD 5KSAA 1J8HD 3T0VA 3RWEA 5JLZA 3P77B 3G5VB 5HVWA 3FN0L 5FKPB 1CDCA 2CMRH 3MYJA 3RHWK 4XGZB 4X4YB 4I18B 4HQQH 2XY2A 2HJFA 2E7CA 3HN3A 1U8LB 5LG1A 3KLHC 2P5ED 2WV3A 1ORQA 2LV4A 3LRGA 5CBEA 35C8L 3HI6H 4OUUA 3QDJA 1NCAH 4CNIA 2DMCA 2R1XB 1BQSA 3GDBA 1DANU 3TNNB 1F13A 1XGUA 1YQVL 1FYTE 3SOBL 3LKRA 3AS3A 4XNUL 4YDJB 2AJVL 3W0WE 1NGQL 4NZRH 5KSUB 1MHCB 3S4SG 4LHQB 3QZWB 1FBIH 1AXIB 3GHBL 4HIJB 4JHZA 3UC0H 3CD4A 3ZE2F 2Z31D 3G5XA 3VFWA 5D7LD 2LTQC 5JIIA 3L3KA 4JANB 4HF5H 4HAFA 3ELAT 3QO1B 4M61A 2QEJA 4UINL 3FQWA 2Q6WB 3ZLQC 2J12B 3UTZA 4D9QE 4F7PB 4Y0GA 4QHLA 2AJZA 3F6LA 3AY4C 1IJ9A 1EHXA 1IGYB 1T1ZA 2H9GB 1I1YB 1ZHLA 1T04B 3N1QC 4ZMAT 5GSRB 3W0WA 3U0TB 3TH3T 2AW2A 5I1DB 2FATH 4OJFL 5BZDA 1MHPL 1T7WA 3UCRA 2UUDK 1RFDH 4JN1H 4ZDHA 4U1HA 4GKSB 5TE7H 4WENB 2DJ4A 1P7QB 4KJPC 4HZAA 1L0XA 4K3JL 1EERB 3QB7C 4KAQL 2I27N 3QBTB 2VDPH 2VN4A 2W07A 3W9DA 1HYRC 2VLKE 5MEOA 3ZE0E 3HB3D 3WXWL 1D5ZB 2A1WL 2MFNA 1A7QL 3MGTA 5TH2A 3SKNB 3MGOB 4BKLB 2FYYB 4MZ3A 3WEXB 1T5WA 4FS0A 1OAKH 3KPRE 4BFIB 3BT2H 3DI3B 3MV01 3Q5TA 3BQUA 4XXCA 3JWOH 4WFGE 3V4UH 1VEMA 3LQAH 4X7TB 4APQB 2AEQH 4LVHB 2VR4A 4DGVL 4Q9BA 5E2WL 3FHAA 3QUXC 4KZEL 5KVGH 3BN9C 4KVNH 2VLKA 1VA9A 3TJHC 3E1F1 3RVXC 2JCCA 2YD5A 3UTTB 1FYTD 3ZO0A 1F2QA 4G8IB 1T6WA 1EBAA 1G7MA 2Q76A 4OB5H 4WI2A 5FECA 2M8XA 5I15H 3KPRA 4HLJA 3ALXA 3C6SB 2ZPKL 5D2NE 2YZ8A 5TQ2L 4PV9B 1I9IH 2BJML 3MLVL 2WQRA 4UT7L 4NOBA 3VXQA 5D1QC 3OQ3B 3HAEA 3MUHL 3CNKA 3R0NA 4Y5YB 3EHBC 3MLYL 4AM0A 4D9QD 3WIHA 1B0GB 2IBZX 4YWGL 3MUGA 2ITCA 1VKXA 1HXYB 1G9ML 3AAZB 4KRNA 1G7JB 4LDLB 3WHXA 1MHEB 2GQHA 2FH6A 1NJ9A 4DGIH 2ZSVA 5D96B 3CVHB 4F7EB 4KHTL 3QEGL 2PYEA 4IIQB 5J0BA 2APFA 5D2NA 1ORSA 4OZFA 3RTQB 3BQUD 2V9QA 2XKSA 3TGXA 4HEME 3KYMB 5HDQH 2APVA 5D7IF 4CAGA 5FO8B 4JFEB 4Y8AA 1V05A 1LK2B 3BESR 4MD5A 4QHNA 1AKJB 4X6EB 5HYJE 2O5XL 4FQIH 4LSSH 4U6XA 3U82B 3BH8A 1P69B 1XR8B 3Q6FB 3U9PL 3BRFA 1WWAX 2EXYC 4S0TD 2VQ1B 3MR9B 1KYOK 1V8HA 1K9TA 2QQNH 4OFYA 4PGZA 4UZGA 1U3JA 1K8IB 5BV7L 1YNTA 1HOCB 3N85H 4N9GA 3QFJB 3QEUA 2DQIL 1A1NA 1A47A 3IKCB 2Z31C 4NQTA 4HUVA 1Q94A 5FUCE 2D4FA 3FN0H 3MUY1 1DUZA 4UQ3A 3PNWB 4OLEA 2ILLA 3MRIB 3O6LH 2DDQL 3LQZA 3SKUD 1I1FB 9CGTA 1KB5H 4WWID 2VAJA 4Q9CA 4PJIF 4QOKB 4JFZL 4XXDA 1INQA 1E27B 4HWBA 5J9PB 1KOAA 4BZ2H 4LLMA 3FTGA 3MMEB 4PJCA 1T80A 2WSKA 5J1TC 5ID0A 1VFOA 1WAAE 2BXYA 4XNZC 3TLRA 2JIXA 1MCWM 4O02L 3LEYH 1YQVH 4XNXL 2NX5B 4P59L 4YBLC 5EN2B 3SOBH 1A6WH 1D5IL 4HJJH 3M8OL 1MQKL 1A4JB 4I3GA 1R3JA 5IM7B 4L5FL 2AJVH 4ETQB 2LVEA 1A7PL 1OTUD 4R2GC 2ZUSA 5DVLA 5B3JE 4DK6A 4TRPL 1XF2B 3HR5A 3GHBH 4LIQE 1ZHNA 3Q6GL 4KQ4H 3TWCL 1N59A 2V9RA 3CXDL 4YDLB 4NKIL 1ZEAH 3S88L 2HT2D 2Y7QB 4LLUB 4EUPG 3HB3C 3FB6B 2EDXA 3MRFB 4DTGL 5IJVA 4R4BA 3RWHA 3S96A 2OL3A 2IPUK 1F8TH 2ADGA 1U58A 4FQXB 3CFBA 4WU7A 2EC9T 5BQ7B 4E0RB 4HIXL 1T1XB 3VFPB 3PQYB 4JPWL 5DT1H 1DBJL 2W38A 3A67L 3KPOA 4WO4B 1AQKH 3EFDL 4HC1A 2R2BB 1NEZB 5I16B 4GAYB 4YHKL 2SEBB 5HYJD 4LPVA 1CZ8L 2F53E 2V5YA 1UWXH 4L8CB 2X7LB 1FNGB 4KAQH 4WV1A 1MOEA 3I6KB 5IMKA 2JIXD 1M6OA 4MQSB 3WXWH 5IW1A 5CEZL 1XF4B 4MA7H 5E4EB 2R4SH 1XT5A 3L3GB 4JGMA 5CZXD 4LCCC 4OQTA 3TBSA 3TBVA 5IWLC 2W0FA 4PRHE 3QNYA 2VDRL 2XPGB 1A02N 3QDGB 2G5BB 1S78D 2AGJL 3VH8A 4Z7NF 2VKXA 5E2TH 3QYCA 4DGVH 4L3AA 5E2WH 4S2SB 2BK8A 2IFFL 4Y1AB 1XIWB 1M7DB 3IJYA 2UYLA 5E03A 5C08B 5C9KA 4KDTA 3V6ZA 3QQ3A 3VMOA 1UB5A 2N56A 1KYOJ 2FEDC 2P5WB 1RPQA 1GC1H 1C08B 4XCFL 2D2OA 5EZJA 4UT6L 4PRHA 1MSPA 4QRQB 4F7CB 4L4TD 5C0DA 3QXUA 2NYYD 4TUOB 4EKXA 1Z3GL 2ZUYA 4R7DB 5TQ2H 1CICD 1BECA 2OR8A 3MLVH 1LO4L 4CVXA 5IROA 4JZNA 3QCUL 1PZ5B 1HHKB 1BFVH 2DICA 2H3NB 4YWGH 4I2XB 4L29B 5E7BA 2E8ZA 4O2FA 1UZ6F 2QJDA 3BE1H 4LVNB 3SY0A 5DVOA 4DCQB 3RJQB 1S7QA 2J6EL 1UWGH 3V5DB 4KHTH 3QEGH 1Z5LA 2PETA 3IJSA 5HYQB 2ZOKA 2NY7L 1N6UA 2YK1L 2VDKH 4C58B 3VXME 1VB9A 2GHWB 1CK0L 3RBGA 2YD7A 4NN7B 3U1SL 3U4AA 3LS5L 5CCKL 4HBCL 2F53D 5C09D 5FYLE 4PY8J 3JV0A 3VG0L 1L0QA 1RIHL 3QAZC 1G1CA 3GFUA 3F7YB 4HT1L 2EEDA 1G7PB 2QBWA 3EJYC 3S35H 1FZJB 1U92A 1TTFA 5H2BA 4D3CL 3U9PH 1BFOB 1KFAL 4JN2B 3ZTJH 5LGKA 1RIUH 4LHUG 2PXYB 3H3KA 1OTUC 5BV7H 1OAXL 1OTTC 1RJLB 2Z91A 1FP5A 4GQ9L 2DQIH 2CIKB 2XFXB 2YN3A 3B8YA 3EO0B 5HDBF 3QEQE 4JQVC 1SJEB 5GRZA 4NUJA 2RB8A 4L8SA 4KJWD 1MCSA 2CKBB 3QHZL 3LY6A 4UB0L 5F3BB 4JFZH 2AEPH 5D2LB 1FO0A 3FT3B 1JZ2A 1HDMB 4GRWE 1LO5A 1Q9OA 1IC4H 3X14B 1TZGL 4JFXB 4PP2B 5GSVB 4HH9B 1L6ZA 4ORZC 1CL7L 1WIOA 3VJ6A 1F6FB 2QADD 3IU4H 1CU4H 3FOMB 1FC2D 4P59H 5BOZG 5TDPB 2HKHL 1D5IH 3M8OH 2E9BA 4R7NB 1MQKH 2V9TA 3MACL 5MEPB 3AM8C 5IEHB 1BBDH 3QEQA 3WIIL 2FBOJ 5T3ZH 3C5ZA 4TRPH 3I3BA 1RJYA 1R5VA 1U41A 5CKGA 3RI5F 3Q6GH 1EV2E 3S34L 1CDYA 3TWCH 3MLRL 5CKAA 3TV3L 2VAAB 3BZFA 3S88H 3ES6B 2CIIA 1ZT1B 3ZKXB 1WCBB 4P57B 2O61A 3GB7B 1P9MC 5EUOE 4ALAL 4N5EC 1EFXB 1Q9KA 3EAKA 4PJAE 5AZEL 1S7TB 5E8OA 5CZXC 3GSVA 2YPLD 3VRJB 1ZMYA 1IM3A 3C6LD 3RUGB 2DQUL 4NRXA 4HIXH 1KEML 2NNAA 3OG6B 5TF0A 3IETA 3VFTB 4FXGB 3A67H 1S78C 3VXMD 4JKMA 4Z7UA 3EFDH 2X1OA 2YD6A 4FTVB 4HK3N 4WDIB 1ZA3A 1C5DB 4LCUB 4MQ7B 1T7XA 4YHKH 5EUOA 3HPJA 4EZMA 5TQ0L 4OCSL 3C5SA 3OKMA 3OMZA 4DGYH 4O51A 4PJAA 4ODHL 1T22B 2FR4B 3LKNB 1UA6H 3RVTC 2WIMA 4LSDA 5JNYB 3LV3A 3LS4L 5CEZH 2NYYC 2RR3A 1WFOA 1CICC 5SV4A 4PB0L 4PJ7B 2B1AL 3QEQD 3KHOA 5L8LB 4LPUA 1LO3H 3C5ZD 4ZXBB 1EO8L 3QP3A 2VDRH 4NJ9L 2C7UB 4KRPB 2R0KL 4YBHA 2ZKHL 4MLSA 5B21A 2YD2A 3O2DH 2NY1B 4DN4L 3SJVA 3HE7A 3IS0X 2I5YH 2ICEB 3O9WA 4HXBL 4U1KB 3MTRA 1L7IL 2IFFH 3FO0L 2V2XA 3JSSA 4Q2ZB 1HINH 2P46B 3ZTJG 4JHAL 3LSOA 3T4YB 4F9LC 1Y6NR 5KW9H 4Y4KD 3MXWL 4AJ0A 3SE3C 4ZFOB 2XI9A 4CW1B 4UT6H 5DJAA 5E8EB 5JO5B 4NNXB 4ZPTB 4RMTA 3O4LA 1Z3GH 1CDUA 4YO0B 5C0JA 1N7ML 4JFPA 3SPVA 4ESKA 2ATPA 2MOVA 3RZCC 1N6QL 2HFEB 1LO4H 4YUEL 3GSRB 3EFFB 1M71A 3S4SA 3WDJA 4XVUD 2VLJB 1GXEA 3QCUH 1PZUB 2XTLA 5DD3L 2VIRA 2A73B 5AAWA 1S9KC 1G7IB 5DR5H 2NTFA 3QEHA 4Y89A 1NC2D 3MV9E 3I6LD 3FRUB 3DRTA 4HLZG 5BJTB 3RX5A 5I66B 3BZ4A 1K5NA 3H9SB 4OZGB 2IH1B 1CFNB 4RRPA 2YK1H 5JTWA 4J1UB 5DJCB 4AEHL 4C56E 4WW2A 2X4OB 2BVUA 4GOSA 3CLEH 5B8CB 5C0CA 3U1SH 5CCKH 3VGEA 2ZSWA 4HBCH 4ONHB 3VRIA 4KI1A 2NXZD 1DVFC 2M1KA 3RNQB 1RIHH 2QHRH 3D2UD 4K3GA 1IQWL 3CX5K 2R39A 3IAPA 1PAMA 3CDFA 4LPWA 3VFVA 2JK5A 4HS8L 3ARGD 1A1MB 5GPRA 5I76A 1OAXH 4WHTB 1Z2KA 4X5LA 3WCYA 4RDQG 5HPOA 4JQIL 4C56A 2AK4E 4NCC2 2XWBA 2WW8A 3T65B 1OWRM 4GRLD 4LOUD 1DE4B 1C5CL 4KMTL 2BVQA 1JPFA 4XPTL 2AABL 3KDMA 3QIBB 1ETZB 1UJTA 1QBML 3DUSB 3REVB 3FQXA 3QIUB 2QSVA 2X40A 5SWSA 5E8PA 2KZWA 5JOPE 3NBNA 3C6LC 1GGCH 2A6JA 3C09C 1XGQB 4Y4HC 1KJ2B 1AO7E 3ILPA 3MV8E 1HXMB 4H1LB 1LO0L 1JGUL 2FECL 3S8WA 5C2UB 1VGKA 3F7RA 5FAAA 5DEZA 4QY8A 2DIBA 2NY4D 3S7GA 2J8OA 4WJ5A 5FDWA 2IADA 5KS9E 4KXZI 1JYXA 5GGSB 1MRCH 5E5MA 1EVTC 3MLRH 1MPAL 1DSFL 3PWVB 4D9RE 5HHVL 3PHQA 1RZ7H 1YEKL 1OP3K 4OFDA 4ALAH 1GGYA 3FQTA 3CU7A 4YXKH 5TGBB 4LCWD 3MV9D 2D7NA 3WYRA 2GTWA 3MV8A 4QT5B 4I0KA 4DKFL 3UTOA 3ALPA 1CDGA 1KCVL 4YHPA 3BGAA 4ZS6D 1UQSA 1GZPB 2OTUB 4B41A 4C56D 2EDHA 1JPTH 5KS9A 5DHYB 4ONOA 4YDKH 3BYTA 4J4PA 2JKXA 3LN4B 3QISA 4F80A 4K8RH 2CDFB 5EBGA 4X80L 1T20A 3VXPA 2DWDA 3MRJB 1MLBB 5IHZA 4KXZH 4ODHH 3QT2A 4Y4KC 4EOWL 3LKSA 2DQCL 5HYIA 3L5WB 4PJ8D 4NN6B 3E6HA 4LEOB 1NUDA 3HI5L 4L3CA 4M5ZH 5BO1L 3LS4H 2WUBL 1RHFA 5CSBA 4JDTL 3HA0A 2AK4D 3GMNB 2B1AH 3KLDA 3W39A 4UOW0 1EO8H 5CD5D 1DZBA 3S97C 4HWUA 1ND0A 2WWKO 2B2XH 2HVJA 4HJ0C 4QXUH 5JOPD 3U7AA 3IDGB 4HXBH 4JPKH 1VPOL 3O3BB 5EZLA 1T66D 1AO7D 3MV8D 3K8MA 4JHAH 3CX5J 3CH1B 3KYKL 4Q6IB 3DV4A 4OD1H 3QO0B 3GI8L 1UEYA 4XCEB 5JHDE 4KMQA 1RVFH 4NHUB 2P4AB 4YUEH 4D9RD 3GSXB 4LRNL 1QA9B 4WTZG 4KTDL 2C4FU 4Y16B 2JTDA 2A6KB 3GKZA 3NIDF 3UBXI 4PJDE 4X5WA 1UM6H 3FMGL 5IB3B 5J1AA 2CPCA 3RJDA 3ARXA 4HKZA 5ACMA 4AT6B 5ID1B 4EUPA 1NAML 1V3KA 3I3EA 1T3FA 5FKAA 3F65A 1AD0B 4E5XB 5IESH 4GRLC 1FORL 1A4KB 4LOUC 3CJJA 5CJ8A 5E5RB 4YX2L 5GGTA 5JHDA 1WWCA 4K3EL 1KXTB 2YXMA 1EBPA 2AVGA 2YOCA 3BKCL 5L0QB 4HG4J 3DO7A 1TJGH 2LU7A 4P2RE 4W6XB 5DEFB 4ZG1A 3QFDB 1DP0A 3LD8B 3MRPA 2PKDA 1O7VA 3RY6A 4PJDA 4GG6A 1CFVH 4L4VA 2AJSL 2FECI 5C6TL 3MBEA 4JO4H 1MJUL 4MS8D 3E8UH 1QFOA 1IQWH 5EU7C 4BZ1L 3NGBC 5BXFB 3L3IB 4P2OA 3S36L 3NCMA 3BP5A 4ZODA 5EIIA 3PIQA 4N8VG 2FEEL 4HIEA 5DVNA 3WUWA 1AR1D 4K3DH 4K2UL 2QQKL 5ADOH 1C5CH 4KMTH 4P2RA 4OBSA 4XPTH 4DKAA 5IG7B 2AABH 2AJ3A 2DYPD 4LLWB 4NO5B 3QUYD 3TO2A 2HJKA 3P11H 1TVDA 1R6VA 2W59A 1IGFH 4NC1C 4HUXA 4NKMB 4C83A 4ORGA 4BK4A 4IRJC 1I85C 4PJHE 1LO0H 2R8SL 2DWEB 1ZLSL 3SDXA 1HNGA 5MERB 4M00A 4P46B 1R0AL 2DQHH 1QPXA 4FG6C 4M7JL 1BM3H 4JO3L 2FCBA 5EDXA 2KZ1B 1E4WL 1MPAH 3OZ9L 1DSFH 2X4NB 4I3SH 5HHVH 1Q72L 3EYUL 1UKSA 4MNQE 1DEEB 1QP1A 2DQTL 4N8PA 5KANI 2VNCA 5D8JH 5HVHB 1KB5A 4PYHA 5CZVL 5DHVB 3ARFD 1ZGLB 5IB5A 3VA6A 4QRTB 4PY7A 1C16A 3BVNA 4DKFH 5GRYA 1KCVH 1JNJA 5CD5C 2P8LB 3T04D 1QLRB 3GIVA 5L2KE 4TVPL 4P2RD 3RL2B 5FOBA 3UTSD 3QHFL 1AC0A 1N26A 3GJFB 4MCZB 4MNQA 1U42A 2CUMA 3MRMB 1T66C 3ZYIA 3GJFK 1CXLA 3MRHB 2DQEL 3FQUB 4X80H 4WY7H 5CEYB 4K55A 3RWDA 4PTUB 3MLUH 3HI5H 4JZJB 5ESAA 5IR1A 1LD9A 2IEPA 3DVGA 5GISH 3VDCA 4X4ZA 3KPQB 4L9LA 4XT1C 1SEBB 3TO4A 3GGWB 1SJHB 5L2KA 4P4RA 2VL4A 5IJKC 3G5YA 5LAXB 3LDBB 5E1HB 1PKOA 3TNMA 3V0WL 3DOSA 3BXNA 4BH7A 5CUSL 2VUOA 5J13C 2W0KA 3VXRE 4RX4A 1L7TL 1G6RH 2QSTA 3LPWA 1VPOH 3TIDB 4X6DE 1BX2A 1OP5K 2CLZA 1ZS8B 1ZTXH 2AK1L 4G3YL 5D1ZD 5F6HJ 2HYMA 1F6AB 4DUWA 1WICA 2AXJA 4WU5A 4ZFZA 3VGDA 4Q0XL 4ZUWB 3R06A 5D7SH 5ALCL 3B4NA 1GGTA 4MSWA 2IFGA 1I4FA 4MS8C 3F12B 4PLKC 3B6SB 3MNVB 4RBPK 4ZTPL 4MJIE 2FEEI 2OMBA 4GSDL 3H9HA 4OLWL 1NCDH 4S10A 5D1QA 3EYFB 2P24B 1YEGL 5BW7A 4RFNB 3Q3GB 4M1CC 4N1CA 3QXTA 1SBBA 2DLFL 4MA8L 4JFOB 3OKYA 3AREB 1U8HB 4I0CC 4YDVA 4YX2H 4UT9L 4EI6B 3TO4D 3LEXA 5DXWA 5L2KD 3RDTA 1QYGL 5MI0B 2B4CC 1MFAL 3V5KB 3DRQA 4FQCH 2ZUVA 5MENE 3QUYC 5E8NA 3DROB 4DZ8B 2VDLH 5I1HH 3QUMB 5J12B 2VITA 4WI5A 4LEXL 4XPHL 1MCPL 5D7JA 2DL9A 1MCBA 3EGSA 3GK8L 3MRBA 3PABA 1MCOL 4MA3A 5ICYA 4BZ1H 5I9QB 3KGRA 1DQDL 3BPLB 4PD4K 4OUOA 3LIZH 3S36H 4FABL 1RAMA 1S5HB 4N0UE 25C8H 2AV7A 3FO2B 2EIZB 2PW2A 2Z35B 3KYAA 5DMKB 3ZKND 2VSCA 3JTSA 2XT1B 2KL6A 4K2UH 4LFHG 4XTRC 3BO8A 5CBEB 5MENA 1EJOL 4OUUB 1RUMH 1KBGH 4NM8H 4X7SL 3OJ2C 3VXRD 4S1QH 5GGRA 5FGCB 1XGUB 4PRPD 3ARFC 4J2XA 2X5PA 4PRIE 3C08L 3LKRB 1GRWA 4U6VH 4NBXB 5HYEA 2DI7A 4U1MB 5T5NF 3ARDD 1J87A 4NRYB 3LB6C 3G5XB 4P48A 3NPSB 3VFWB 1OARL 3L3KB 1ZLSH 4JHBA 4YAQA 2WIIB 3MV7A 4M61B 3EYVA 4KK5D 1FVEB 3FQWB 1R0AH 1Q1JL 1HHGA 3UJJL 3L1OH 4I0PD 1PEZA 3MV11 1E4WH 3KPLB 2H41A 2VERN 3OZ9H 4MJID 5DD0H 1FYTB 4Z7WF 3EYUH 1ZHLB 5T3ZE 5I8CB 3QPQC 1XGYH 3ZTNL 3W0WB 2K7QA 2EKJA 5CZVH 5J6HA 1OPGL 4BSVB 4S1SL 1CF8H 4NQXA 4ZQKA 3MRKB 5F9DC 5IB1B 4TQEL 2CH8A 2AJYL 3MJ9L 1PX3A 4WFHD 1N64H 1PEWA 4QWWD 4U1HB 1ZOXA 5F9WC 4ZUSA 2AAVA 2ARWA 3EDKA 1MJ7L 4NQCE 3QCVL 5MEND 4TVPH 1LWRA 3O6FD 3QHFH 3W9DB 5CS7A 4GXVH 4IDJH 4LSVL 2D0FA 1HSAA 3EYOA 1EZVY 2EYTA 4OTXL 5TH2B 1NCCL 1JNNH 4NUGL 4PBVC 2G75A 1PG7H 2OZ4L 3WO4B 1T5WB 1YYLL 3MUZ1 2Q3AA 3T0BA 3B2UD 3BQUB 3CAFA 1RUKL 4OCLC 3UPRA 2HG5A 4GW5A 4YBQD 3MQIA 2HMID 4MMZC 5DTFB 5HI4D 1WV7T 1A7RH 1EFQA 2PF6A 2O5ZH 2AJXL 3NAAL 1PSKH 5ISZE 2VLKB 2BZDA 3V0WH 5CEZE 3P9LA 5E95B 3WO3B 1IAOB 5I1LB 1JMXA 1FL5B 4PRID 5HDLA 4QRRE 3NZ8A 4LSTH 2F8OA 5I8OH 3V4VL 5FF6A 2Q76B 4PTTB 5FECB 3KPRB 5K59E 2MQ3A 1XF1A 5LCVL 2UWEF 4WI6A 1BIIA 4KKCC 3DTXA 3F62A 5DA4A 1PYWA 4MD4B 2AK1H 3V8OA 4G8GE 1NGZB 1TZIA 3STBA 3VXQB 5FM8A 1EIBA 3VRLE 2G60H 4M7KH 5JW3H 5ISZA 4YXLH 1VKXB 2ITCB 1DQQA 1QUNA 1J0YA 2HN7A 3WHXB 1NMAH 2DKSA 3JWNC 1CFBA 1INDH 5CGTA 2ZSVB 4M1DH 3UO1L 4GSDH 1JF5A 4XP9L 5ALBL 4GBXD 3GMMA 5D2NB 1ORSB 4OZFB 3IYLW 2JJSC 3P2TA 3W5NA 2D7TL 1E4XL 3O2DA 2DLFH 4AIOA 4MA8H 3ZKNC 1IC7H 1NLBL 3EOBA 1MWAL 1J8KA 3TN0A 4R4ND 3MNWA 3SN6N 3SQBA 4NQCD 4JDZA 3MLZH 5IMOA 4U6XB 1MFAH 4TUKH 4MJ2A 2RFXB 4NWUH 4PY8I 4RGMB 2R0WL 1YJDC 4Y5VC 2CLVB 3MBXL 3I84A 2R1YB 5D6DC 1S9VA 1IL1A 3ARDC 4N9GB 1MCPH 3OJDA 3QEUB 2E7LC 1A1NB 2W65B 5I17B 3W5MA 1MCOH 3OR6A 4HUVB 4JAMA 3BJ91 1DQDH 5L88H 4TNVF 4GMSL 4UQ3B 2WLZA 4FABH 2PO6C 3BEVA 5CILL 2CKBL 3LQZB 4F58L 5EZIL 2OXGA 4PJXE 4I0PC 4XXDB 5L8JB 1INQB 1FQ9C 5HYJB 4U1GB 5ISZD 3B8SA 2ED7A 2W92A 3IF1A 3JV6A 2QLVB 3JVGC 5CEZD 1WJ3A 5JR1H 2NZ9D 4JQVA 4WEMB 5ID0B 3DMMC 4PJ5E 3MZGB 4QRRD 5F89B 2JIXB 3BX7C 5CAYB 3MROA 4HDIB 1UM5L 3C08H 4QXTA 5KSBE 2V6HA 3GRWH 3H7LA 1R3JB 1FSKC 4HPOH 1IAKA 3ARBA 2BRRH 1G9MC 4QWWC 1JNHA 3HR5B 1ZHNB 4G8GD 4PJXA 2ZCLL 3EO9H 1RZIB 1OARH 1JGLL 4TSCL 1T03L 3NH7L 5I1GH 1DQTA 4UUJB 4IJ3B 3IS1X 4HD9A 1Q1JH 3VWKC 1WTLA 4PJ5A 5IJVB 5FCSH 3SBWA 4R4BB 3RWHB 1GGIH 2OL3B 5JUEL 1U58B 4R97B 5D5ME 3CFBB 6FABH 3B2UC 1EUUA 2GJZA 1EEZB 4FN0A 3V0AC 1P9MA 1C5BL 3IGAB 1OPGH 3HE6D 3KPOB 2V7HA 3WN5C 3FONA 4LNRA 2AJYH 4N8VB 3AROA 4CN6A 2BNRE 4Z0XA 3K1KC 4YHML 1SM3L 1DDHA 2Q1EA 3QI9C 1MJ7H 1KELL 3IDYB 1ACYL 5C0ND 4MQTB 4P3DA 5F1IA 5E2JA 1JWUB 5IMKB 3CPLA 5D5MA 5IW1B 5J3HD 1A0QH 2JJTC 4NHCL 1ES0A 1P84K 1PJ9A 4NUGH 1IEBB 5EU6A 1I7ZA 2AQ3A 2ERJB 3HG1A 1KPRA 3TBSB 4M6OL 5FO9B 2BDNH 5GZND 3N1GC 3RL1A 1RUKH 4JQXC 5C9JB 1OTSC 2F53B 2EZ0C 5IOPA 1XGRB 1IEAA 5FM5M 4DAGH 4LKCA 3GI9H 5T5FL 1E4XI 4U3CA 4AL8L 3IJYB 2UYLB 4GBXC 2JCCF 1XH3A 3RIAF 3V6ZB 1TFHA 4UNVA 5BVPL 3VD7A 1UB5B 3S3JA 2UZIL 5H35B 1MQ8A 3PWLA 5J8OA 4PRHB 1GHFL 4ENED 5C0DB 1MFCL 4OBRA 3NTCL 3SO3B 1RZKL 1HQRA 2IAND 5DUPH 4ONFL 5INCA 4X6CE 4CVXB 4OSUL 3TT1L 1JFQH 4JZNB 1E4KC 4LARL 2XNAB 1EA9C 1A6VL 1FAIL 3ZKQD 1RZJC 3O81A 1TNNA 3WXVH 3SHSA 3TIEB 3GMPA 4S0SD 1MI5A 3OAZH 1S7QB 3RZCA 2QADB 3NZHL 1CG9A 4YEFA 1W8OA 2EICA 1BF2A 5F6IC 4XP9H 2J8UA 2D3VA 1Z5LB 1MCNA 3IJSB 4NYLA 5ALBH 4PREB 2Q87A 3NFNB 4KZDL 2NPLX 1JBJA 1E4XH 4OLXL 2QHLA 1QOKA 1A6PA 1NLBH 2BNRD 4X6CA 1MWAH 3GBML 3HR6A 4U0RC 4L8DB 1I8IA 4EJ1C 2A6IA 2CK0H 5DHXB 2PW1A 3VG9C 5H2BB 1KCRL 1S7VA 5LKNA 3ZKMD 2DF3A 3MBXH 3T1FA 2L7UA 3IFNL 5EPMA 1X5AA 3QWQB 2OS7A 1OSZA 3PDOA 4XC1L 1P6FA 3ESUF 1F11A 3U2SB 4GMSH 4EN3C 1FIGL 1YEDA 4NUJB 3VXMB 1NBYA 5KJRL 4F58H 5EZIH 2B0SH 4X6BA 3RKDD 4V1DE 3QULA 4M7LL 1FNAA 1NAKH 3BZEA 1FZKB 5FCUH 1YPZF 5I1IL 3D48R 4ZFGL 3MLXL 2VQTA 1JF6A 4PJCF 4R0LC 1HWHB 3K4AA 1NCBL 3TFKD 3QIWC 3HE6C 1AC6A 1FVDA 5KSVA 4ONGL 5E6IC 1N5YH 1A6UL 4PGCB 3WFBL 1N0XL 3QEQB 1P84J 1RMFH 5I30L 2QSCL 1H0DB 3C5ZB 5I1CL 4TNWK 3GIZL 3VXOA 1R5VB 4PJ9A 1DLFL 2NW2A 2ZCLH 3DJ9A 4V1DA 3D9AH 1JGLH 5C0NC 3BZFB 1FFOB 2GW5A 2M2DA 3MRQA 4QF1A 4GRWB 1IFHL 2YD1A 1MHHA 1WZLA 3ZE2E 1Q9KB 5EOQL 4TTGA 3UDWC 1F4YH 1J1PH 5E8OB 5EO1A 3GSVB 32C2B 4LSUH 2RQ8A 4UOW1 5EBWA 1P7HL 5C92A 5B39A 3GSNH 4P23A 1RUAL 2CDEA 1VSCA 2Z92B 3IETB 3GMLA 3N1PC 2NY0C 3VXSE 1AP2A 4XBGA 3CK0L 4Z95L 2IF7A 4OF6A 3SE4A 43C9A 5JW5A 4LASL 1ZHKB 3NIGF 4M7ZB 4XMKH 4F37K 5KN5A 2GAZA 5LJYH 4NO2A 1QFPA 1JV5B 1PQZA 5E00A 5EUOB 2YEZA 1Z6JT 3OKMB 1LP9F 4HX1A 1ACYH 4PJAB 2HP4A 1EEYA 4XB8A 4Z7VF 1NC2B 2CRZA 4TSAL 1K4DA 2FNBA 3LV3B 4NHCH 1RZGA 5EOCL 4ZOBA 1AXTL 4H5SA 5HI5C 5DZNA 3VXSA 4WNQA 5I18L 2F5BH 4UIKH 3VA2C 1IAMA 1BZ7A 3D0LA 3GSOB 4JJ5A 1E28B 4HWZA 4M8QB 1IGIH 4HK3J 2NXZB 4R26H 5F97E 3D2UB 3MXVL 1IZJA 3FHQA 1VACA 5T5FH 1NFIA 4JM4L 2GFBA 2V2XB 5A2LH 3QDHA 3ARGB 1QVOA 3OR7B 43CAA 5EWIL 1KCSL 1TENA 2BVOA 3P30H 4P23D 5HJ3A 4XMPH 5DJAB 3BH9A 1I1AA 5C0JB 4JFPB 1RZKH 2ATPB 1GZQA 1M71B 1BP3B 1FHGA 4P5TD 4PRDB 4HHAA 5C0BE 3SCMD 4XP1H 2GIYA 2VIRB 2BC4A 4W81A 2NTFB 4FQHB 1JYWA 1QLFA 4EBQL 1DFBL 1MAKA 2JJUA 3DRTB 2G2RB 4FFZL 3OGOE 1N3NB 2A9ML 3NZHH 1K5NB 1BIHA 1U3HA 1I7RA 2Z0BA 3CFKA 2NY4B 4RGND 3OX8A 3RKDC 4WW2B 2XQYK 4OLXH 4PR5B 5C0CB 2OJZL 1UVQA 1G6RA 4OZHA 3BUTA 2K7PA 2ZSWB 1MCFA 4M6ML 3UZQA 1INEL 3QWOA 4XZUA 4H26A 2CXKA 3MV9B 4IBLT 2CK2A 3MX0A 2JK5B 1N4XH 5D7IE 1Z9LA 3TBYA 4MDIA 4BUHA 5I76B 5HY9A 3PWPA 4ZFFB 1S7RB 3LVEA 4V2CB 1NC4A 4XCNA 2YXFA 4HIIA 5EU3B 4DW2L 4XC1H 1BQHG 1S7XB 4C56B 2O93L 5JOFA 1NANH 2OI9B 4K23H 4I3RH 4XHQA 3EIFA 1WGOA 1YMMD 2A6DA 3ZSTA 3KDMB 1ZLVK 1W72H 3T2NL 2C9AA 5BS0E 3FQXB 1OW0A 4HWEL 3KPMA 5I1IH 1HQ4A 1AGFA 1MCDA 5E8PB 5EU5B 1TDQA 4PJIE 4LPTA 5C8JB 3GJEB 3ILQC 4PJ8B 3PJSA 1H5BB 3ILPB 1NCBH 2J7LA 4MB5A 1AFVH 2UVEA 3K2UH 4RWYL 4L3EA 1J10A 4OD3H 4EI5C 4ONGH 5EU4A 1A6UH 4Y19E 5BZWA 4KUCF 5C0FB 4WJ5B 4U1LA 4TNWF 5FDWB 2IADB 4ZNEE 1EO7A 3CFDA 3TA3A 3GIZH 4JKPH 2NY5H 3F7PC 5E5MB 3VFMA 2W0PA 3B2VL 3QDME 2CSPA 3D69A 15C8H 2CQVA 5C0BD 4JM2F 4IRJA 1I85A 1NGWA 3PHQB 4TPRH 3E2HC 1KTLB 3O4OB 4P3CL 3PL6A 4YIQA 3GHEL 1IFHH 5HHOE 5BRZE 1AHWA 4PJIA 2GTWB 2JLLA 5EOQH 4UBDD 3MV8B 4RISL 3H2WA 1NFDF 4WUKH 5I19H 4YHPB 1T21A 1NC4D 4Y19A 3U4EA 4G9DB 2XWTA 5KS9B 3NCEB 4BQ9A 3BAEL 3CSGA 4I48B 2EC9U 4LASH 4Z7UF 3QDMA 4XNMA 2VLRE 4N0FA 3RY5A 3NCJL 1T20B 3VXPB 2Q3ZA 2DWDB 5IHZB 4H8WL 4I9WE 5DJZA 1WFNA 1CR9H 1QZ1A 2DLIA 4OCXL 1LE5A 3E3QE 1JK8A 3E6HB 4L3CB 4KPHH 2XG5A 1S7UA 1MH5B 1F2XK 1CWVA 5EOCH 2AP2A 3T2QA 1JCKA 1AXTH 1K3ZA 1FAKT 4TVPE 3W39B 4WWKD 3X11A 4O2EA 3DVNA 5F44A 4YDIL 2FO1A 2DBJA 1ZT7A 1MUJA 4HFUL 1ND0B 3HMWL 2VLRA 5BS0D 3O8XC 2HVJB 1EHNA 4K9EL 3K2MC 1A7NL 3BPOB 3MXVH 4XP6H 2OSLA 1YMHA 1GPOH 5EZLB 5C0RH 1FN4A 1SEQL 5ENWA 4U2ZA 1EHAA 7FABH 5MP6L 4Z7NE 1ZLWH 4RGNC 5CHNB 1KT2A 1I8LA 1F4WL 1QSVA 1ZANL 2XWJA 3DV4B 4KVCL 4Y19D 4ZUVA 1KCSH 1P4BL 1UADC 1VERA 1WF5A 4YLQT 4WI4A 2W1NA 3OXRA 2J5LC 5F6HI 3UTTE 1TPXB 4P49A 4F7MA 3LQMA 2OK0L 5GRJL 4D9LH 4YHYC 5GGQH 1QSFE 1BPVA 3CDGB 3DX9B 2FB4L 5HHOD 5BRZD 2A9NL 3N1MC 1G9EA 3WFEL 1KCUH 5F7KC 1CQYA 4LGSB 5F21B 2DQFB 4MXWH 1DFBH 4N0RA 3SDDD 5FKAB 1T3FB 1MIEL 3GBNH 1DJSA 1FCCA 5DQJA 3L5IA 1JVKA 4XBPA 1UENA 2EH7L 1P4IH 5JHDB 5AYQA 4JG0L 1UZ6E 3DSNA 3O45B 2J1KA 3S5LG 2VL5A 1W0VA 1W8NA 4YC2B 4G6AD 1HN1A 2OJZH 3DO7B 5F7LB 4OV5A 5E5UB 3QUML 4M6MH 3TPUB 4PJDB 5GS1C 1R3HA 4L4VB 1MLCA 4DN3L 1FDLL 1KF9B 4I9WD 4NSKA 3LZFL 1O5DT 3QXVA 5E1AA 5I71B 4JVPA 4K7FA 3BP5B 1P7QD 5B38A 1CXKA 5EIIB 5E2UH 3PIQB 5FYJH 2F15A 4HIEB 3WUWB 1QR4A 2IBZY 4ODVL 1HYSD 4H25A 1JPSH 1MFBH 4P2RB 1WZ1L 3RPIB 5IW6A 3VFSB 2FIKA 4XPAL 2VE6A 3RRQA 1F90H 5HDBE 5CJQH 2XZCL 4HWEH 5IUSA 1DBAH 1ZHBA 2IMNA 4K07A 1J05A 4LAQL 3BI9X 3QQ9D 2VQUA 4YZFF 2OX5A 3L9RA 4NN5C 2JE8A 3QG7H 2E8YA 1JJUA 2OM5A 4JRWA 1FGVL 1KIPB 3VXUA 4K94H 1X6LA 1FZMB 1NCUA 1U8MB 3UTTD 5HHMB 4NFCA 2R0LL 5DRXB 4WFFE 1JHLL 4PG9A 2ZNXA 3ULSA 4X7FC 3OAYH 2MPAL 3T0EC 3ARUA 3VE0A 3U30B 1QSFD 3B2VH 3BGFB 4M8VA 1FFPB 1X6NA 2VYRE 3MJ7A 2J88H 1GOHA 4P3CH 4LLDB 4QHUA 3GHEH 2Y25A 5DMIL 2YWZA 3P9MA 3FL7A 4XVSL 1W2KT 1U8PA 1CD1A 5IB5B 4RISH 4RNRB 3NABL 3RP1A 3BVNB 1MFNA 2WUCL 5D1ZB 1F3JB 2BNUA 4X6FA 5C0IB 2VJXA 3BP7A 3TCLA 2EDKA 5BVJB 3FQNA 3GIVB 5CGMA 5I1AA 2QSQA 3V7AE 2FJGA 2XYCA 4P2QE 1OQXA 3PWUA 3GRWA 4I18C 2C5DC 2OJEA 3PQYE 5HPMB 1T5XA 4Z8FL 4MNQB 3CC5B 4GMTL 4LGPB 1U6AL 3NCJH 2X4QA 5DS8A 2IJ0C 3RAJL 3TYGL 3MNZB 5DFWH 5TDNA 2BCKA 5A2IH 4P4KA 2N7AA 2JELL 1ZT4B 3RWDB 4BJLA 3VD9A 1AKJD 2GITB 5ESAB 5IR1B 3DVGB 1KN2L 1FZOB 4NP4L 4L9LB 1YECL 3TO4B 5L2KB 4NQDE 3STZA 3ARPA 3G5YB 3S3SA 5AG8A 4A6YL 3HMWH 2R0ZL 1SJVA 3F7VA 4PGDB 4LCYA 3W11D 4NJAL 1BX2B 1SEQH 4JFHE 3NIFF 4H0HB 1E4JA 1VDGA 2CLZB 4LDEB 2WWMC 1F4WH 4PGEB 3QUZD 1UWXK 4G6AC 5K9QI 3PHOB 4UMGA 1QR1A 4ZFZB 4AQOA 3R06B 3DWTA 4WFFD 2Z4QA 1DN0A 3JV4A 1MCQA 2OK0H 3CFJA 1I4FB 2NMSA 5GRJH 1HI6B 4OLZL 4P9HL 3LRHA 3OKKA 4AENB 5GQBA 3VXRB 2FB4H 1KV3A 3H9HB 4GUPA 3G08A 2OLDA 1MVUA 4X6DB 5D1QB 5GRXG 3L6FA 3IKKA 4P4KD 1RJZB 4JCMA 1UM4L 3SDCA 1MIEH 1DEDA 2C4XA 4YDVB 3NCYS 3BWAA 3CCHA 2EH7H 5C0AA 3BIKA 3LEXB 4P3WA 1JIBA 4IRZH 3RDTB 2AJUH 3O0RL 1XGTA 3CLFH 4FQXD 4MJ6B 4P2QD 3S37L 2JJSA 5E8NB 3PQYD 2P8PB 3UBXG 3KAAA 3ULUF 4MJIB 4OZ4B 1A3RH 4GG6F 2BFVL 4DN3H 1DBKH 1FDLH 3D39E 3KLSA 5D7JB 3EGSB 4APQC 4LVHC 8FABA 4N68A 3RVVD 1FV1A 3LZFH 3PF2A 4U1SB 3MRBB 5ICYB 3B3IA 3AS1A 4UQ2A 1JPGA 2BVYA 5DWUH 3O3EA 4KROD 2C3VA 4O00A 5I8KL 2DTMH 4G7VL 5GHWH 2AV7B 2PW2B 2JB6A 4QYOA 4CVZB 3ZL4H 1G1YA 4HWBL 4Z7OF 4N1HB 4ODXA 4NQDD 3RIFF 2EH8L 3LN5B 4Z5RA 5TF1L 2Q8AL 1WZKA 5MENB 3Q5OA 3V6OE 4WFEE 1WZ1H 1XZ0A 3O6FB 2QQLH 1EJ6A 2F54E 4XPAH 2PO6A 5GGRB 3D39A 3BSZH 4Y5YC 2N4IA 3QDGD 4JFHD 1MY7A 1YUHA 3L3DA 1RY7B 4NBYB 4LAQH 2C1OA 4E42B 3JVGA 4N0UB 3KYNA 4G5ZH 1NCWH 3DX7A 4CRPA 3DMMA 2BSRA 4Z78B 5D96C 5IIEA 2VH5L 1MRFH 4YAQB 3EYVB 4YBLB 3SDXF 4IIQC 1WCQA 3T77A 2MMXA 2YPVH 3RTQC 1EAPB 2RCSL 2X6MA 3ARYA 5BV7B 3D25A 4Y4FA 2F54A 2MPAH 3MCG1 4UDTB 3OHXA 3OKNA 4KI5C 2OL3L 2CO6B 3MO1B 2F58L 1S5IH 1AGBA 3RNKB 4PRIB 1FVCA 1NGPL 4U4BA 5CJXC 2BHZA 5F7NC 5DMIH 2YA1A 4M62H 4XVSH 5J6HB 3VWKA 1CGXA 1U91B 4ZQKB 4NQXB 1H3PL 3NABH 1F02I 1F3RB 3FQRB 1WUNT 3INUL 4HC1L 3TYFA 3MJ8A 1E6JL 1PLGL 1QFWH 2BERA 4U3HA 3U7WH 3DURA 3LPFA 2Y5EA 2LAAA 3L7EA 4OFPA 3NA9L 1L9NA 3MLSL 4JPIA 4HMCA 4Z8FH 3D39D 1KN4H 1MIML 3RWIA 4KHXH 2G75B 2ADIA 3PP3H 3QQNA 4NQVA 4OQTL 3QI9A 4HPYH 4YHIA 3RWFA 5SWZE 2D03L 4XPBH 4G8EB 4OI8A 2HG5B 1WWBX 4GW5B 1KN2H 4NP4H 3SEPA 3GMQB 3VGAB 3BKML 2NCMA 4NQCB 2EEAA 3IVKA 1CFSB 1KLFA 1CXHA 4XHJC 4AIZB 4WFED 2FDBP 1IGTA 4CDHA 1JE6A 4UOJA 1QACA 2E5EA 2F54D 3GSUB 1FL6A 2RIKA 4A6YH 4G9FE 3GSNA 1BHGA 3QH3A 4YDLC 5F7UA 2R0ZH 4JQXA 4GAGH 3SGJC 1OLZA 4X8JB 3GMOA 1D5BB 2R2HA 3AXLA 5JQ6L 3AB0B 5EIVA 5IBUG 4ISVA 1QNZL 4OLVH 5DVKA 3DTXB 1GOGA 1HILA 1PYWB 3DUUA 4FQXC 1TZIB 3HAEH 1TIUA 5DJ0B 1YEEL 5ISZB 1DQQB 1CE1H 1FNFA 3G6AA 4WO4C 2HN7B 4G9FA 1JF1A 4N8CL 5DRNB 5GJSL 4PJEA 4P9HH 4X4ME 4LLAA 4NKDA 1P4LB 4QRRB 3HZVB 5DQDL 1K4CA 5D1XA 5B3NA 2YWYA 4S11A 4HZLA 3HRZB 3CMOH 1CDIA 3UX9B 1E4KA 2ICWI 3UYPA 1RZ8A 1X5LA 1UEMA 3L5HA 5IB4A 2XA8H 3NIDE 5I1EL 1EGJH 5FGBA 4IMLB 3TN0B 4M7LT 1EFXD 4CMHB 5E4EC 3CFEB 1JNLH 4UNUA 4K7PL 5FFLA 4H20H 1AGDA 4ODSL 4PJGF 1I1RA 3WJLC 1TITA 5IMOB 2VZUA 3BHBA 1R5IB 3M1BA 5F3HA 4X4MA 2X89A 4JFDA 2IBBA 1YDPA 3RGVA 4GW4B 1HEZA 5A2KH 1S9VB 5IMMA 1IL1B 4LBEA 3OJDB 4J23A 1HKLL 2OP4L 5E94A 5SWZD 1J0ZA 1B6UA 3I9GL 4FTVD 5FUOL 4QGYA 3MRDA 4O58L 1HHJA 1XIWC 3KS0H 4YE4L 1KJVA 5HYSA 3AUVA 4HFWA 3QRGL 5GGVL 3SKJL 1FO0L 5FYLL 3B9EA 3B9KD 3AS0A 5HGBB 3MREB 1YEHL 5TF1H 1UCBL 1F6LL 2Q8AH 3WKML 3IF1B 2VXVH 3H3BC 3ZHLA 1S3KH 1F4XH 3C60A 1GCFA 4EN3A 5D1XD 3MROB 3D3VE 1BD2A 4KRPD 2WP3T 2MWCA 2Y5TA 2MSPA 3PHSA 1QQDA 1IAKB 3ARBB 4NQSA 5I1JL 5ERWA 4LVNC 3MODL 4PG2C 1A5FL 2V5TA 2XN9E 4PJXB 1Q0YH 5IVXA 1TXKA 1FH5L 2GYSA 3QIWA 1XF5B 2ATKB 5E6IA 4XVTL 4PJ5B 3RGVD 5JMRA 4IRSD 2DTSA 2W9EH 4NN7C 2NW3B 4CVUA 5IFHL 3D3VA 1NGPH 5KSBB 2EYSA 1IM9A 3BDXA 5F7EL 4LLYB 4XI5C 2GJZB 3BJLA 3KWWB 4ZUUB 3O41B 1W72A 2VLJD 5JORA 4OLYL 2V7HB 2XN9A 1H3PH 2PXYC 3FONB 4LNRB 1ERNA 1I1CA 3INUH 1LMKA 3O2VL 1E6JH 2GT9A 4XPGH 1DDHB 4JFFE 1CCZA 2WLYA 2ZWLT 2QR0B 1KNOA 3CFCL 1MFEL 2GK2A 2BMKA 4YXHL 1JWSA 3C60D 3NA9H 5I74B 3CU1A 1GJIA 3MLSH 4LSRL 2DD8L 3CPLB 5D5MB 3I02A 3S5LA 4XH2B 4MD0A 3DV6A 4D0CA 1ES0B 4OM1L 4BH8A 4XAWL 1I7ZB 2YR3A 3RGHA 4YHZL 1B88A 3B5HA 4OQTH 1KPRB 1RZFL 3V8CA 4POUB 3EDFA 3RL1B 3WFCH 2BNRB 4ZO6A 4OCYL 5K9JL 4GFTB 4Z76B 2FBJL 4GRMA 5I2IA 4ZAKD 2IALA 1BFTA 2H2SD 5KTEL 4LKCB 1DBML 4HKBA 4RDQF 2P42B 2HFFA 4Y2DA 1CLZL 3G6JA 3D6GA 3A6CL 3D3VD 4RFOL 1JHTA 2J3SA 3ZKXC 1KIQA 3PV6B 2BNQE 4MWFA 5E2VL 1P53A 3PWLB 5HD8C 2X4TA 4PJFA 4XVJL 1VADA 4KGJA 4QNPF 1JI1A 5JQ6H 3QIBD 2G9HB 5D72L 4OKDA 2YPKA 1HH9B 4JB9L 4XC3L 4H0GA 3IB4A 4YJZL 3D0VB 4Q7DA 1IC5L 5GJSH 1NMBH 2IAMD 3FO1A 1IKFL 3FT4A 2BNQA 4XX1E 3X17A 1CXIA 2F19L 4J12A 3WD5H 4F7TA 2ZOLA 1KJ3L 3BMVA 5TE4L 4QLRA 2GUOA 5H37G 1RK1B 2VXSL 2P44B 4RGOH 2GSGA 4X6CB 5I1EH 4ELKA 5K9OA 3HZYA 1QHPA 1I8IB 4JFFD 2P45B 4NO0A 2AEIT 3HS0A 2A6IB 4I4WA 3ZT6A 4OAWA 4ODSH 3R8BB 3IFLL 4ZXBC 3NVQA 1P1ZA 3KR3L 1OCWL 3L95B 3ULVC 4KRPC 3RWGA 4DQOH 1S8DA 3T1FB 1DBBL 4U49A 5ICZA 5EPMB 1TQBB 2MKWA 2NY1C 4B0MM 1OF2A 4KK8C 5CJOL 3TZVA 1FNEB 4DEPB 4CU8A 4F8TA 3I9GH 1F11B 3IJHA 1G0YR 4MNHA 3F5WB 4D0DA 4PP1D 1SYSA 3MSPA 1VEOA 3UAJD 2YBRA 2NLJA 3QULB 2FO4A 3QR2A 1CBVH 3BZEB 1HZHH 3T4AA 1CN4A 1UCBH 5T1LD 3WFHA 3G5ZA 4GXUM 5GS0L 5DK0B 1G7HB 1AGEA 4PGBB 5J56B 1KTRL 2BNQD 4EXKA 1P2CA 4RAVB 5FUZH 2CKNA 4B53A 2PTTB 3UTQA 4FXKA 5KSVB 4LCIL 2IPUG 1U8OA 5DZLA 3SKMB 5I1JH 4LSPH 4G6ML 3Q2CA 1F3DH 5AYUH 4RZCA 5HVGB 3VXOB 2YMXH 4PJ9B 3MODH 2H32H 3ZHKA 2HTLD 4V1DB 1YN6A 3ZYZA 4U1JA 3T0AA 3EKCA 2ITDB 5IT2H 1G9NH 3MRQB 1FFNB 1T89C 4EI5A 3QG6A 4XVTH 4QRUA 3UBXB 1NEZG 4ELMF 5B8CC 1WWWX 1V7NL 4M43H 5IFHH 5DQ9B 1NMCB 3HI6L 4ZSOA 3TZVD 5F7EH 3ARRA 3JBG7 5B39B 2MNUA 4P23B 1NCAL 3SE8H 2X4RB 1WIPA 4LU5H 1AP2B 4XBGB 4Y16D 4OLYH 4Z7WE 1G6VK 1IT9H 5JW5B 3MRGA 5F1SA 1P6AB 5ICXA 3O2VH 2LU4A 1IQDA 2GAZB 4NO2B 1BLNA 4P5TB 5E00B 1WLHA 3SCMB 1IRAY 4HX1B 3UC0L 3CFCH 4PRAA 1EEYB 4NZUH 5D7KE 2QV2A 4ACPA 4LSRH 4Z6AT 5HXMA 3QIBC 1RZGB 3FRPG 4P2CG 4YHNA 5GZOD 1IVLA 4MNGE 5IGXH 3QIUC 3EYQD 3VXSB 4WNQB 4YHZH 1RZFH 2HVKA 1T83C 4LNVA 3D0LB 4MX7A 4JJ5B 2H45A 3GBLA 2CLRB 2XV6B 4FNLH 2QL1A 2YC1A 5C0EB 3DXAE 1YY9D 3ZYJA 3EZ8A 1KPUA 5JIHA 1DBMH 3SKOA 1VACB 1HE7A 1RFDL 5TE7L 4P5MA 5IK3A 5H94B 4LPYA 4R90H 3A6CH 1IGJB 43CAB 2VOTA 4MNGA 2X05A 2VDPL 3O8XA 5HJ3B 5HHPB 5D4QA 5DA0B 5ITFA 1HCFX 4EQ3A 4JPVL 3GNML 1I1AB 3V0VB 3H3PL 3RVWD 1JZ4A 3P0YH 1GVIA 2ARJA 4YK4B 1GZQB 3TH2T 1OAKL 4I77L 1RJCA 2XZAH 3BT2L 1PW3A 2I24N 4N1EA 2UWEE 5JDJA 3ULVH 1IKNA 3V4UL 3WL9A 4OCMC 3P4NB 3KJ4B 3IDJA 3LQAL 3C8KA 5AG9A 3S9DB 4MMXC 4CADA 3H0TB 4D0BA 4CJ0A 4LK4A 2AEQL 1IKFH 4IOFC 3EJZC 3U6RB 4O9HL 5EBLA 1UGNA 5KVGL 4KVNL 5GGTL 4PP1C 1U3HB 2J8UF 5TE4H 1I8KA 1I7RB 1I7TA 1H3WM 3OX8B 5EC1A 4NKOA 2HLAA 4NN6C 2EXWD 4ODUA 2X1WL 1G6RB 4OB5L 1I3VA 5I15L 1GGBL 5C0BB 3LHPH 3QWOB 4EIZC 4H26B 1DQJA 1UC6A 2DI8A 4HS3A 4LRIC 4DZBA 3KR3H 1OCWH 4QXGL 4Q9RL 1Z9OA 3VGFA 4LMQI 4MDIB 3TBYB 4JKKA 2FJFA 5HY9B 3PWPB 1DBBH 1KUMA 4FP8L 4P5KA 4F57L 1NC4B 4XCNB 4HIIB 1CS6A 5GS1A 3OKDB 2ENSA 4HAGA 2CDGB 5JOFB 1D5MA 2X4PA 2AKRB 2COQA 4C4KO 4BK5A 2A6DB 3P4OA 4Q6IC 3DXAD 3KPSE 1ROWA 3KPMB 1HQ4B 1NUGA 3REWA 1VCAA 5GS0H 5D7IB 4UU9B 1M4KA 2EKSA 1JGVL 3PJSB 1QLEH 4FQIL 4Y16C 3WIFA 3FT2B 4IOIB 4M1GL 5EU4B 4LCIH 2AXFA 4DOHE 3FB8B 2QQNL 3QDJE 4WWKB 4ZO9A 4U1LB 3BPNB 4KKBD 3MA7A 2L0DA 3CFDB 4G6MH 3TA3B 5FGCE 5DD6A 3VFMB 4BM7A 3D69B 4DUVA 3BGMA 3KPSA 4XNQB 3S6CA 1MCEA 1NGWB 3I85A 5BS0B 5EO0A 3PL6B 4YIQB 3O6LL 1AHWB 4CKVX 1KB5L 4PJIB 4MHHG 3QXAB 2A0LD 3L3OA 5L0QC 4OT1H 5F96L 1V7NH 2WM0A 3EYQC 4BZ2L 3LD8C 4MZ2A 1UH3A 1MREH 4P0DA 3T0EA 2X9WA 2X70A 1T21B 4Y19B 3GMRA 2CJUH 2XWTB 5J4MA 3LEYL 3K46A 1A6WL 1I7UA 3EYSL 1BOGA 3JWDC 3QDMB 4HJJL 4F9PA 1WEJL 4XNMB 2DQDL 5IKCA 4NPYA 1VFAA 4QRPA 2CXGA 4LPCA 5HHOB 1UB6A 5BRZB 3BUYA 5DJ6A 3ARED 4NT6A 3DYMA 4KQ4L 5IHLB 4TTDD 5A3ID 1ZEAL 1CVSC 5FKPA 1LE5B 1NDMB 2ORBH 3SDDB 1I3UA 5DJYA 2R2CA 4XGZA 3A6OA 1CT8A 4FHBD 5F7HA 3RVWC 1U8LA 1NKOA 5INDA 2BSTB 3X11B 4RMRA 1F8TL 1X5ZA 5KSAD 5F8QC 1MUJB 3EZJB 5DT1L 2HT3C 3KPSD 3OPZL 2VLRB 2XTJE 3TNNA 4FQQA 1WZMA 4FFVC 1AQKL 4P46C 4CN4A 1FN4B 5ENWB 4TSBH 1WK0A 3SDAA 5CLTA 3QZWA 2VXUL 4OIAA 4OKVA 5FYJU 1KT2B 2XWJB 3VI4F 2VO5A 1N0LA 3QDJD 4L4JA 4X9GA 3KJ6H 4JANA 3L5XH 5HVHC 2AXHA 5GIRA 3FFDA 2JCCE 3OXRB 4M6AA 4JPVH 1CXFA 3GNMH 4XP5L 3H3PH 3BISA 2NY3B 4MA7L 5SX5H 2R4SL 2NY6D 4H88L 1ZV5A 1A7OH 3BKYH 4I77H 4D8PB 1FNSH 2AQ1A 4UV7L 1I1YA 3KPTA 1RV6X 1T04A 1HHIA 5GSRA 2AEWA 1HKFA 3U0TA 1Z9MA 4EUPH 2R56H 5E2TL 3MJGX 1BEYH 4O9HH 5DQJB 4XBPB 1KG0A 5GGTH 4W6YB 4A6YA 4GKSA 2IQ9H 4DVRL 2RJMA 4H8WC 2VLME 2C3HA 2FLBT 4JY4A 3UEZA 2VL5B 3WE6A 2EDDA 5J11B 2DIAA 5DFVD 4XRCA 1T1YB 4JZJC 4IM8A 3W0WD 1ZVSB 3ULUH 2NR6C 1GGBH 4OZHF 1GC1L 1QSFB 2PYEE 1AI1L 1BFSA 2BVEA 1R3HB 4WIQA 4DKEH 1MLCB 3BKJH 1EXUA 4NSKB 1D9KA 3QA3A 4I1NB 4LAJH 4QXGH 4POYA 5E1AB 3LDBC 3WEXA 4W70A 4Q9RH 1EAJA 2XY1A 5B38B 2YUZA 3TJEH 1BFVL 4FP8H 1I75A 5GRUH 1TQCB 4F57H 4K9EC 5IBLC 3BE1L 5I8EA 5TJWK 4APQA 1A22B 1FRGH 4H25B 4JRXE 1UWGL 4H1LG 5IW6B 2XTJD 4NDMB 5EC2A 4FZEH 2VDKL 3EO1A 4BFGA 1EGJA 4CL7A 1ZHBB 5C3LD 4UTAL 1J05B 4Z7QF 1JGVH 5CSZB 4OD2B 4AY0A 1YPZE 3SGDI 4YQXH 4Q6YA 5HGDB 4G7YL 3S35L 2UV3A 3Q5YA 4PJCE 3VGGA 2VLKD 3OTTA 1A3LH 4M1GH 1RIUL 3VXUB 3B83A 4RFNC 4HUKB 2ZJSL 3MJ6A 3K80A 4JRXA 3VFGH 4PG9B 5F9JB 4CJ1A 1VENA 3ULSB 1B0RA 3VE0B 3AREC 1G7JA 3KPRD 1QTYT 4X99B 4HGKC 4HCRH 3MJ7B 1MHEA 5EOTB 1CFQA 4WFGD 5A3IC 3D5OF 3ABZA 5DEGA 4QHUB 1T2QH 1D9KD 5MI0C 4IIQA 3U83A 2AEPL 3RTQA 1EO5A 1CD1B 3V95A 1DCLA 5F96H 2X44D 5F70A 2ICWA 1YPZA 2VC2L 3FB7B 5J12C 3QUZB 5EULV 1IC4L 2YRLA 2BNUB 2WP3O 4X6FB 1X4ZA 1K6QH 3BP7B 3TCLB 3X3FL 5CJXA 2VLMD 5FO8A 4JFEA 3FQNB 4YNYA 1ACZA 5I9QC 1LK2A 2GSIB 3BPLC 3IU4L 1CU4L 1CTOA 1MCIA 3EYSH 2PYED 1XR8A 4PPTA 2YUVA 3JUYA 4O2CB 1WEJH 2OJEB 1BBDL 2VQ1A 4G6JH 1T5XB 1NSNH 3SGDH 5IMLA 5T3ZL 2DQDH 1K8IA 1HOCA 3HC0B 2WBJA 3SGKA 3Q48A 3QFJA 2X4QB 4HUUB 4B5EA 5DS8B 3NIGE 4WTXA 3RI5K 5TDNB 2BCKB 3OSKA 2P49B 4P4KB 4PYGA 3I6GA 3PNWA 1N8ZB 3MRIA 1S7WB 1PG7W 1UACL 1LP9E 5HGAA 3NN8B 4QOKA 4OFYD 1E27A 5J9PA 4Z7VE 2EIDA 2VLLA 3X12B 3O3DB 3MMEA 4P2QB 2LQRA 1M05B 3E6FB 2AV1A 1X4YA 1XFPA 3OPZH 3NPSC 4OGXH 1K3IA 4DJMA 4LCYB 1CE6B 3HCVB 1K85A 4N0CD 1A4JA 1AH1A 4ETQA 4Z18A 4MXQD 12E8H 3MLTB 2VXUH 4KWUA 4KROB 1T0NB 2V17H 1LP9A 1HWGB 4DGYL 3NA4A 1QR1B 4Z7VA 4NQDB 5ADPH 1UA6L 4GW1A 4LLUA 3SGJA 1DN0B 4XP5H 3JV4B 3FB6A 3CFJB 4H88H 3MRFA 3OKKB 2IQAB 1LO3L 4UV7H 3QRFM 2WBJD 3G08B 4WI9A 3N1FC 4YHLH 4E0RA 4JLRB 1OQOA 3L6FB 2DLGA 2EYRB 2XXCB 3O2DL 2VISA 4GKZB 4WO4A 5ESVA 3SDCB 1SVCP 2I5YL 4UV4H 2OQJA 3CCHB 5HHNA 2R2BA 1NEZA 2ARJQ 3HFMH 1HINL 1BQLH 2SEBA 3V7MA 3WO4C 4DVRH 1XGTB 4MAUH 2VDNH 4L8CA 3BQUC 5KW9L 1FNGA 3GKWH 4R4FL 1YQ2A 4PRNA 4Y5XB 3HC4L 1LE9B 2ADJB 3BD4A 1AI1H 3I6KA 3NFSH 5F1KC 4GG8B 2W9DH 4ZS7L 8FABB 1FV1B 3WNNA 3B3IB 3L3GA 4MXVF 5LVEA 5DSCA 3O3EB 2XPGA 2YD3A 3VFUB 5DR5L 3DHMA 4QYOB 2E3VA 1KXQE 2G5BA 3OKLA 4ODXB 4JVWA 5E70A 2XQBL 4Z5RB 3UJIL 1CD0A 1U93A 1LDSA 3HMXH 5DDHB 5F7DA 1XZ0B 2DBLH 3OAZK 5KAQG 4Y1AA 5LQBL 1XIWA 5FA3A 5C08A 4UI2A 3D39B 3O2WH 3IDNA 5FM4A 3CLEL 1MWAB 1R5WA 1YUHB 2P5WA 3L3DB 1ZSDA 2WANA 3FFCE 1C08A 4UTAH 4NWTL 2C1OB 1C7TA 3U46A 3GSWA 4AEEA 4R7DA 2QHRL 4G8FB 3DX7B 2BSRB 4G7YH 3MZTA 4XNYH 2C3XA 3P0VL 3T77B 3TP4A 5D2NC 2ZJSH 5KVDL 1HHKA 4GO6B 3B9VA 3D25B 3QQ4A 2F54B 4Y4FB 5L7XL 5FB8A 3OHXB 3OKNB 4PRHD 1AGBB 5GGSY 4PG2A 4AEIH 2Q8BH 2HT2C 2ZUQB 4RFEA 1ONQA 1LEKB 4PLNC 3FFCA 1CGTA 4YFDB 4RGMC 3TVMA 1ITCA 2GJ6A 2X4UA 2VC2H 3O3AB 3MJ8B 1GGCL 1P5VA 3DURB 5C0GA 3X3FH 3RWCB 2X4SB 4HLZH 5TE6L 3NFPA 1NFDE 2E7HA 1Q9LA 4JPIB 4OI7A 5CGYD 3OB0H 2VXTL 4I13B 4M93B 5D70L 1RJLA 4U1GC 1MRCL 1I9RH 2H32A 4Z7UE 4BQ6A 4NQVB 2FZ3A 1WBYA 4JM2A 4YHIB 3RWFB 1L0YA 2HKFH 5C70A 4CUCA 2EDNA 1PKQE 1RZ7L 1JZ7A 4JFYA 3QPXH 3C8HA 1KIRA 1UACH 4YR6A 1P7KA 1C1EH 3H8NA 5F3BA 1LILA 4YXKL 4FFYH 5LWYL 3OF6A 1G7LA 3MCLL 1CLCA 1XCTB 3FT3A 4OFVA 4ZTOH 5FUCC 1NFDA 2YA0A 3BD5A 5IF0B 3T3PF 1F4AA 1IGTB 2VXQH 2YZ1A 3TPKA 1FL6B 3LKPB 3X14A 1YY8B 4JFXA 3BEWA 3QH3B 1JPTL 3O6ML 4YDKL 2FH8A 3FOMA 5DC9B 1KEGH 4IJ3C 5TDPA 3FFCD 3GMOB 1FGNH 2R2HB 5SWZB 4PS4L 5MEPA 5IEHA 1G84A 4NM4L 5FYLD 3PV7A 1PKQA 4JO1L 2FHFA 1XCQA 4K8RL 1YN7A 4ISVB 1X5HA 3SJVE 1HILB 3V79C 4R97C 1MY5A 4FRWA 2BVPA 1J1OH 2VAAA 3B9KB 3ES6A 1XMWA 3VDAA 3IDXL 1FL3B 4M5ZL 5DJXB 5IV2B 5FO7A 3I50H 3G6AB 3ECBA 1A1OA 4G9FB 4MDJA 1JF1B 4JEGB 4KUCD 1JGEB 4PJEB 4LGRB 4NKDB 1OOAA 1S7TA 5D1XB 1PY4A 3O4LE 3UZVB 5C86A 2FWOA 4HS6A 1RZ8B 3IDYC 4JM2D 3N50A 1LEIA 3RWJB 2B2XL 3VFTA 4JG1H 1DQLL 4FXGA 4N90E 5IB4B 4QXUL 5T1KA 1A6ZA 1QRNE 4JPKL 4TVSa 3U79A 1T0MB 4MQ7A 2ERJC 5M94B 2DM7A 3PGDB 1H8OA 1JZ3A 3BHBB 4OD1L 1F58H 3M1BB 2JJVA 4R4FH 4OCNC 3HC4H 1QFUL 3RGVB 4IRSB 2FR4A 1HEZB 3OB8A 5JNYA 4J3WA 5IMMB 1TCRB 1UJ3A 4LBEB 4ZS7H 2APWA 4PUBL 2DLHA 1RVFL 5C0CE 2FX8L 1UKTA 1R3IL 3MRCA 1EHLH 1C7SA 3C9NA 4ZXBA 1HHJB 1QRNA 1BVKB 4EEEA 1KJVB 1UM6L 4KDTC 2EE9A 5KVEH 2XQBH 5DRWA 4HV8A 4XMLH 5CZKA 3UJIH 4X5XB 2ICEA 5IESL 3RX7A 3SO3C 4OF8A 3G9AB 4CMMA 4KJWC 2E9IA 3C60B 5LQBH 4Q2ZA 5K9KB 5IROC 2DJUA 5B4MD 2NQCA 5GXBB 2WQ8A 1OY3B 2VDMH 4OGYH 4X4XA 1TJGL 4EVNA 2DMBA 2V7NA 2Y5TB 4ZFOA 4NQSB 5KZCB 4CW1A 3PWNA 4NWTH 5JO5A 1CFVL 4HK0A 5LGHL 4NNXA 3SJVD 3HE7D 4PJBF 4X7DC 3O9WD 4JO4L 2FGWH 3E8UL 2QADC 5SWSE 4BQBA 2IGFH 5JXEA 3HLAA 3P0VH 1A3QA 4YZFE 4ZAKB 1RUQH 3P4MA 1FJ1A 5KVDH 1MNUH 4JGJA 1FG2A 1JHKH 2VSDA 5L7XH 2EIEA 5D71H 4K3DL 3D3VB 3O4LD 5ADOL 3B43A 4MAYA 5BJTA 2EYSB 3TF7C 1KLUB 3H9SA 5DYOA 5ECJE 3OKOA 5LXGH 2IH1A 4LMQE 2R2EA 1W72B 1T89A 4N90D 2XN9B 3DI2B 3P11L 1IGFL 3VWJA 4BQ8A 4YEEA 4ONHA 2C3WA 4MQXD 5TE6H 2KH2B 2FJHB 1I8MB 1A6TB 1WC7B 2BMKB 1JWSB 3WLWD 4FMFA 5DFTA 1KCKA 1WISA 3WNKA 4HG4K 2IAMB 3I02B 2VXTH 1J86A 4D0CB 2DQHL 1NGXA 5FYKU 5D70H 2MHAB 4MB3A 1BM3L 5C0CD 3RKPA 4ERSH 2G5RA 4DVBB 4Z0BH 4BSWA 4I3SL 1QKZL 1B4JH 5FIEA 1JGDA 4KC3B 5D8JL 3ROLB 4JFFB 5JXED 3VCLA 3WMSA 2WMPA 5LWYH 3DGGA 2DIJA 1ETZA 4L9DA 4JGUA 3ZZ1A 5ACZB 5I2IB 1T1WA 3MCLH 2RGSA 4F33B 3QIUA 3ARTA 3C5ZC 4HKBB 4NGHL 3MA9L 2HFFB 2VDQL 4Y2DB 1PVHA 3HZKB 5LGJA 3IDMA 4OF5A 3IT8D 1KJ2A 1YNLL 3O6MH 4NRZA 2XKNA 2FD6L 1HXMA 1KIQB 3EOYG 4H1LA 2H8PA 4PLJD 1OM3L 5I75B 2ESVE 1VADB 2HTKD 4PS4H 2YA2A 1SY6A 4NM4H 4K71B 1OGAE 4JO1H 2YPKB 1D6VL 2ZG2A 3X13A 4RA0C 5SWSD 5CP7B 4WY7L 2YD4A 3X3GL 5CJ5A 5GS0D 3GM0A 3NIFE 4OZFG 3CZJA 3MLUL 3IDXH 5T1LB 3F58L 5GISL 1FYHB 2HJLB 5TGBA 4M7ZC 4PJEF 3FO1B 3FT4B 2BNQB 1W0WA 4XVUC 4OM0H 2ESVA 5F72S 1MCLA 3V4PH 1OGAA 2OTUA 1U95A 2X42A 5C07E 2DMKA 3SO5A 1DQLH 2GSGB 5DI8B 2D7PA 1JZ5A 4ELKB 1G6RL 5T33H 2WAHA 3BW9A 4LSQH 4NO0B 3RVUD 3HS0B 1U2HA 4I4WB 1AD9A 4OAWB 1N5AA 4F2MB 4U7KA 2R15A 5B4MC 5JIPA 1P1ZB 1ZTXL 2Z8RA 1ZLWK 1A9EA 1H15A 4G6KL 4KJYB 1EX0A 2EDLA 1QFUH 3RWGB 1S8DB 3L5WA 1BAFL 5D7SL 1EK3A 3CDCA 1OF2B 3TZVB 1JZ8A 2NXZC 4PUBH 4J4PD 4ZO8A 3P4LA 2FX8H 5C07A 1R3IH 1DQML 3FB5B 3IJHB 3ULUE 3S36X 1YYMH 4GG6E 1SYSB 3ARGC 3HUJF 1NCDL 1S7SA 4L4VE 2YBRB 2NLJB 5IQ9B 1MF2H 2FO4B 4WUUE 2BP3A 3O3BA 5IFJA 4Z7OE 1A8JH 4JR9H 1BREA 3OV6A 1ZKAA 3CH1A 3OXSB 4H0IA 4E41E 4FQCL 1QSZA 2Z9TA 3UTQB 2OTWA 2VDLL 3ZE1F 5I1HL 3QO0A 5SX4I 1U8OB 3IXTA 4XCEA 3BPCA 5LGHH 3VI3F 3EOAA 3HI1B 2HRPL 3KPPB 4U1JB 3GSXA 5IVXF 4WUUA 3LIZL 5JZ7D 3IXAB 1BMGA 2NY4C 2NZIA 3B5GA 4WW2C 1DLHB 3QG6B 25C8L 4QRUB 3RA7H 3BD3A 3TBTA 5ID1A 4M5YL 1TJHL 3SDXE 2ADFL 4E41A 5HHME 1R3KB 4QTIL 4ZYKA 5M95B 4RCAA 1A4KA 1RUML 3T0DA 2P47B 1KBGL 4M4PA 4NM8L 1XEDA 5C07D 2ZCKL 3U9UB 4B7IA 1KLGA 4KY1H 5CEXA 1SMAA 4KV5F 4G80A 4S1QL 4J3XA 1CIUA 1RULL 3DBXA 3V6FB 1IQDB 4U6VL 3QFDA 2WK2A 5IEKB 4ZS6C 2P7TB 1EPFA 4X9IA 5SX4H 2IG2H 2OI9C 4PRAB 3D18A 3O3UN 4PLJC 1A6AB 1S9WB 5JHDD 3VH8G 3IDIA 4RAUA 3CH8A 3L1OL 2FSEB 4YHNB 5EOCJ 1SBSH 1RHHA 4L1HA 4F15B 1U8IB 2UZYB 4Z7WB 5DD0L 1QKZH 4HCRA 4NO3A 1JYNA 4L4VD 2HVKB 3MBED 4PJ8C 1H5BC 1XGYL 4YH6A 2DKUA 2GY5A 1QSEE 3ZT5A 5F88A 2YC1B 4WUUD 3H42L 4P2OD 4NO5A 1CF8L 5IVZA 1KPUB 4IOSD 3L3HA 3AY4A 3SKOB 1N64L 1J18A 4NGHH 3MA9H 2VDQH 3HNVL 1H8SA 5IK3B 5C7XH 2R1WA 5K93A 1YNLH 3G6JF 2FD6H 4MNGB 1CD8A 2B8OT 2P8MA 2OR7A 4XPFH 3O4OC 4KTEH 1OM3H 1LO2H 3S98A 4J8RB 2DWEA 4GXVL 4PJFF 5ITFB 4IDJL 4C55A 1A7BA 4BFEA 4P9ML 1D6VH 2YS4A 3H7BB 1JNNL 2ARJB 1QSEA 1PG7L 3X3GH 3PGFH 1RD6A 1MVFA 3DXAB 2NY2B 1B9ZA 4YHOL 3WL9B 1UYWL 1FNLA 2F74A 3CUPB 1DEEA 3F58H 2D31B 5HBBA 3MRNA 3IDJB 2ED9A 3C8KB 4CADB 4LHUA 4D0BB 1A7RL 5HHMD 2O5ZL 1PSKL 3I75B 4M48L 4M02A 3BWUC 3WFDH 4FQ1H 2I9LA 4OZIF 3U0WL 4X9HA 1I8KB 1I7TB 2CUHA 4W4NA 2HLAB 1KTDA 1FNHA 4LSTL 5I8OL 5GS2H 4ODUB 3RL2A 1U8KB 4PRBA 4I5BB 2UWEB 3GJFA 4OIBA 3MRMA 3QUXA 4KTYA 1DQJB 5ACLA 3C8DA 5C3TA 1EEUA 4DZBB 4PGJA 4G6KH 3VFNB 1RSFA 4HSQA 2FJFB 2G60L 5IFAL 1BAFH 4M7KL 2VZTA 5JW3L 1JWMA 4PJGE 4YXLL 3GUTB 4QGTA 4P5KB 5EBMB 3BPOC 3KPQA 1NMAL 1DQMH 4MNQD 1INDL 2X4PB 4M1DL 4ODTL 5LAXA 3LMJL 5JZ7C 3P4OB 4QCIB 2EDOA 4UILL 3A0OA 3T1WA 3I2CL 1AR1C 1IC7L 1J8HA 2LABA 3REWB 3OJMB 1TPXC 3CVIL 3CMGA 2KQMA 4PJGA 2VRAA 4LLQA 3MLZL 1UXWA 1OVZA 4TUKL 5DMYA 3JWOC 5F9AC 4NWUL 1OAYH 2P5EA 3ALWA 4ZUWA 3LQAC 5MEQA 1DUYA 5DUMH 1H3UA 4RX4D 5DD6B 1G7QA 5KSAB 1N2RA 2HRPH 3RWEB 3OL2A 5JLZB 3AMKA 4QO1A 3BGMB 3KPSB 3B6SA 3G04A 5L88L 3MYJB 2Y1VA 5EO0B 4TNVK 1ZLVH 1TVBA 2HJFB 2WBWB 3RVXD 3TJHD 3EYFA 4YC2C 3L3OB 2P48B 1ORQB 3UYOD 4M5YH 1TJHH 3MV7E 2ADFH 4JFOA 3RY6C 2N1KA 2X70B 3HMXA 4QTIH 2Z31A 4X83A 4DOHB 5JR1L 3QDJB 5D7LA 1MAJA 4ZPVA 4CNIB 4PBXA 1A9BA 2ZCKH 4KH2A 5EA0L 1OAUH 5I71C 3LPGA 1RULH 4Y88A 1IMHC 1I7UB 1BOGB 3GRWL 5D1QD 2NY6B 4DZ8A 3EHBD 4HPOL 4A2MA 2BRRL 5JHLL 5ESQA 1AXSA 1VFUA 2BOCA 2DQJH 2E7MA 2MKLC 4WRLA 4NT6B 3K74B 1JRHL 3EO9L 1V3LA 2Y6SD 5I1GL 1D6EA 1TJIL 3RDTD 5DJYB 2B5IB 1CT8B 1T7ZA 3UTZB 1S5HA 4NCDA 3FO2A 2EIZA 2Z35A 4QHLB 4EXPX 2AJZB 1RURH 5DMKA 5INDB 1GGIL 4OCRL 1T1ZB 6FABL 5D7JD 4YPGA 2R23A 5HYFA 2GEEA 4LLVA 1E6OL 3MOAL 1QBAA 4FQQB 3H42H 5BZDB 2EXYD 2P1YA 4MVBD 4ZDHB 1D3CA 3HNVH 3SDAB 1KCLA 4U1MA 4OKVB 3U30C 3BGFC 3QJHA 4R3SA 4NRYA 3V6BR 4RSVA 1EUTA 5AWNH 5T3XL 2WIIA 5MEOB 1FVEA 5GIRB 3FFDB 4R96A 1A0QL 3MYZA 4P9MH 3MGTB 2HWZH 3HPLA 3O11A 2APBA 2XTJB 3KPLA 4RRPG 4QNPE 2XQYG 5D1ZC 1FYTA 2CGRL 2BDNL 3PP3K 4YHOH 3ARWA 1UYWH 3HZMA 5I8CA 5JQHC 1HHIB 2E9WA 5T1MA 4ZUTA 3MV7D 2FLRT 2OXHA 4BSVA 3MRKA 5IVOA 5IB1A 1OGTA 1ZWIA 4M48H 4DAGL 3FN9A 3GI9L 5HGGS 1KG0B 2WWKT 4LCCA 4R2GD 2C3GA 1CI5A 3U0WH 5IWLA 4A6YB 3EUUA 2JCCB 2A77L 2N7BA 2VUYA 4JY4B 3WE6B 3RIAK 1CFTA 2WBKA 4BUGA 4XRCB 3DIFA 3FKUS 1G7MB 4DFIA 1SQ2N 4JZOA 4HXAH 1XF3A 1A2YA 4L9LC 1B4RA 1YA5A 2IBGA 1EXUB 3TO4C 1B6DA 5DGQA 3WSQL 5DUPL 1D9KB 3QA3B 4Q58C 3DSFH 4K7PY 1JFQL 3HAEB 2B4CH 1DN2A 5IFAH 4AM0B 5A43C 1YJDL 5TFSH 1TVHA 3MUGB 2DOCA 3WXVL 5DTFA 5F8RC 5IQ7L 5I8EB 1CDJA 4NOFA 5T3ZD 3ZDYF 1NJ9B 1GAFL 4ODTH 3LMJH 2PYEB 5EC2B 1VESA 3DX6A 1IAOA 5HTSA 5I1LA 1FL5A 4UILH 3EO1B 1ITBB 1U9KA 2IH3A 3I2CH 3LEVH 5GGVY 8CGTA 4PTTA 3CVIH 1M7XA 1SHMA 3CXHK 5A1AA 4S1RL 4AZ8A 3VXTA 5IW3A 2CK0L 1QFWM 4MD5B 4QHNB 4U31A 3TBWA 3BH8B 1BZQK 2FX9H 4MD4A 1NGZA 4C54A 1J0KA 5BW7C 1JRHI 3NPZB 3T8XA 2OR9L 4JRXB 1YNTB 1B0RB 1GL4B 1Q94B 1CFQB 2Y6SC 1DUZB 1GIGL 5DEGB 3J7HA 4KK5C 3RDTC 4LVOB 4ZD3H 4YFEA 2B0SL 1WIUA 3KXFE 4CU7A 3TT3H 4LLMB 1NAKL 1LGVA 2ICWB 1GC1C 1YPZB 3FTGB 2FEDD 4NBZB 5FCUL 4PJCB 1KIUA 1P5UA 1XGPA 4KDVA 5D7JC 3WS6C 1BBJA 4ELME 5AEAA 5F1NA 4YNYB 1LHZA 3SQOL 5EA0H 4A2LA 4FA8A 1BQUA 3WNOA 2EDTA 1N5YL 2RFXA 4Q9QH 5IMLB 4MVBC 2CLVA 4U05A 2R1YA 1RMFL 5JHLH 3VMNA 3DX8A 1CLYH 2EE6A 3AGVA 2WBJB 5FHBL 5AZ2H 1JRHH 3TN0D 1N59B 4BYHA 4QHMA 1JUFA 3KXFA 2W65A 3D9AL 5I17A 4CVWA 3O6FC 3RHWF 3I6GB 1TJIH 1LNUA 4E9LA 1WQVT 3ET9F 5HGAB 3AM8A 3OAUL 4ELMA 1BJ1H 3BDYL 1F4YL 4NZTL 1J1PL 5HYJA 3S96B 1O7SA 1T7YA 2VLLB 2ADGB 2W0LA 4OCRH 4LSUL 3SDYL 4WU7B 35C8H 2MTPA 3PXHA 2AV1B 3GSNL 4YBQC 2UY7A 4WTZA 5EU6E 4EDWL 2HMIC 3FZUD 1E6OH 5F89A 3MOAH 3HG1E 1Y18A 3EJYD 5HI4C 4HDIA 3RU8L 4XNUH 4XMKL 5BV7C