1CFYA

Yeast cofilin, monoclinic crystal form
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
133
structure length
133
Chain Sequence
VAVADESLTAFNDLKLGKKYKFILFGLNDAKTEIVVKETSTDPSYDAFLEKLPENDCLYAIYDFEYEINGNEGKRSKIVFFTWSPDTAPVRSKMVYASSKDALRRALNGVSTDVQGTDFSEVSYDSVLERVSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of yeast cofilin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Actin-binding protein
molecule keywords COFILIN
total genus 38
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1cfyA00
2NUPA 1M2OA 4LIZA 3A5MS 4KEDA 4PKIG 2NUTB 3DAWB 1D4XG 1NPHA 1C0FS 1SVYA 2VACA 3L50A 1HQZ1 2FH1A 1WNJA 2LXXA 3CI5G 3TU5B 5FAFA 1F7SA 1T2LA 1P8XA 1AHQA 1CNUA 3EG9A 3EGDB 2XFAA 2FH2A 1M2VB 1WFSA 2I2QA 1T3XA 1VFQA 4KEFA 2L72A 1MDUA 2D8BA 5HVKD 5A1MA 1NMDG 1NM1G 1YVNG 3FFKA 1J72A 1PD0A 2NUPB 5DD2A 3CJBG 2MP4A 5KYNA 3EGXA 1KCQA 5KYWB 3A5LS 4PKHB 1TVJA 2FH3A 3FG7A 3EGDA 1WM4A 1M2VA 2MOTA 1PCXA 4CBXG 1V6FA 1P8ZG 3EGXB 2FH4A 2FF6G 1SVRA 5KYXB 3A5NS 1SVQA 5KYYA 1CFYA 1UDMA 2FGHA 3A5OS 1Q8GA 1C0GS 1Q8XA 5KYXA 1AK7A 1DEJS 2KVKA 2XF1A 4KEEA 1PD1A 2VILA 1M4JA 5KYUA 5L6WC 3EFOA 3EH2A 2LJ8A 2W0IA 3FG6A 1T3YA 3CIPG 5KYWA 1H1VG 1TMWA 3Q2BA 1COFA 2QTVA 1EQYS 3EFOB 4BEX1 5IVUA 4JD2H 2LLFA 2NUTA 3EH1A 1AK6A 5FAEA 4S10C 4CBUG 3CJCG 2MV2A 1JHWA 1T44G 2HD7A 1QPVA 4Z94G 5HVKB 5KYYB 2VIKA 4PKGG 2FF3A 5KYUB 1X67A 4CBWG 1YAGG 1D0NA 1ESVS 3FFNA 3EG9B 1VKKA 1RGIG 1NLVG
chains in the Genus database with same CATH superfamily
2NUPA 1M2OA 4LIZA 3A5MS 4KEDA 4PKIG 2NUTB 3DAWB 1D4XG 1NPHA 1C0FS 1SVYA 2VACA 3L50A 1HQZ1 2FH1A 1WNJA 2LXXA 3CI5G 3TU5B 5FAFA 1F7SA 1T2LA 1P8XA 1AHQA 1CNUA 3EG9A 3EGDB 2XFAA 2FH2A 1M2VB 1WFSA 2I2QA 1T3XA 3DA7A 1VFQA 4KEFA 2L72A 1MDUA 2D8BA 5HVKD 5A1MA 1NMDG 1NM1G 1YVNG 3FFKA 1J72A 1PD0A 2NUPB 5DD2A 3CJBG 2MP4A 5KYNA 3EGXA 1KCQA 5KYWB 3A5LS 4PKHB 1TVJA 2FH3A 3FG7A 3EGDA 1WM4A 1M2VA 2MOTA 1PCXA 4CBXG 1V6FA 1P8ZG 3EGXB 2FH4A 2FF6G 1SVRA 5KYXB 3A5NS 1SVQA 5KYYA 1CFYA 1UDMA 2FGHA 3A5OS 1Q8GA 1C0GS 1Q8XA 5KYXA 1AK7A 1DEJS 2KVKA 2XF1A 4KEEA 1PD1A 2VILA 1M4JA 5KYUA 5L6WC 3EFOA 3EH2A 2LJ8A 2W0IA 3FG6A 1T3YA 3CIPG 5KYWA 1H1VG 1TMWA 3Q2BA 1COFA 2QTVA 1EQYS 3EFOB 4BEX1 5IVUA 4JD2H 2LLFA 2NUTA 3EH1A 1AK6A 5FAEA 4S10C 4CBUG 3CJCG 2MV2A 1JHWA 1T44G 2HD7A 1QPVA 4Z94G 5HVKB 5KYYB 2VIKA 4PKGG 2FF3A 5KYUB 1X67A 4CBWG 1YAGG 1D0NA 1ESVS 3FFNA 3EG9B 1VKKA 1RGIG 1NLVG
chains in the Genus database with same CATH topology
2NUPA 1M2OA 4LIZA 3A5MS 4KEDA 4PKIG 2NUTB 3DAWB 1D4XG 1NPHA 1C0FS 1SVYA 2VACA 3L50A 1HQZ1 2FH1A 1WNJA 2LXXA 3CI5G 3TU5B 5FAFA 1F7SA 1T2LA 1P8XA 1AHQA 1CNUA 3EG9A 3EGDB 2XFAA 2FH2A 1M2VB 1WFSA 2I2QA 1T3XA 3DA7A 1VFQA 4KEFA 2L72A 1MDUA 2D8BA 5HVKD 5A1MA 1NMDG 1NM1G 1YVNG 3FFKA 1J72A 1PD0A 2NUPB 5DD2A 3CJBG 2MP4A 5KYNA 3EGXA 1KCQA 5KYWB 3A5LS 4PKHB 1TVJA 2FH3A 3FG7A 3EGDA 1WM4A 1M2VA 2MOTA 1PCXA 4CBXG 1V6FA 1P8ZG 3EGXB 2FH4A 2FF6G 1SVRA 5KYXB 3A5NS 1SVQA 5KYYA 1CFYA 1UDMA 2FGHA 3A5OS 1Q8GA 1C0GS 1Q8XA 5KYXA 1AK7A 1DEJS 2KVKA 2XF1A 4KEEA 1PD1A 2VILA 1M4JA 5KYUA 5L6WC 3EFOA 3EH2A 2LJ8A 2W0IA 3FG6A 1T3YA 3CIPG 5KYWA 1H1VG 1TMWA 3Q2BA 1COFA 2QTVA 1EQYS 3EFOB 4BEX1 5IVUA 4JD2H 2LLFA 2NUTA 3EH1A 1AK6A 5FAEA 4S10C 4CBUG 3CJCG 2MV2A 1JHWA 1T44G 2HD7A 1QPVA 4Z94G 5HVKB 5KYYB 2VIKA 4PKGG 2FF3A 5KYUB 1X67A 4CBWG 1YAGG 1D0NA 1ESVS 3FFNA 3EG9B 1VKKA 1RGIG 1NLVG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUP A;  1M2O A;  4LIZ A;  3A5M S;  4KED A;  4PKI G;  2NUT B;  3DAW B;  1D4X G;  1NPH A;  1C0F S;  1SVY A;  2VAC A;  3L50 A;  1HQZ 1;  2FH1 A;  1WNJ A;  2LXX A;  3CI5 G;  3TU5 B;  5FAF A;  1F7S A;  1T2L A;  1P8X A;  1AHQ A;  1CNU A;  3EG9 A;  3EGD B;  2XFA A;  2FH2 A;  1M2V B;  1WFS A;  2I2Q A;  1T3X A;  1VFQ A;  4KEF A;  2L72 A;  1MDU A;  2D8B A;  5HVK D;  5A1M A;  1NMD G;  1NM1 G;  1YVN G;  3FFK A;  1J72 A;  1PD0 A;  2NUP B;  5DD2 A;  3CJB G;  2MP4 A;  5KYN A;  3EGX A;  1KCQ A;  5KYW B;  3A5L S;  4PKH B;  1TVJ A;  2FH3 A;  3FG7 A;  3EGD A;  1WM4 A;  1M2V A;  2MOT A;  1PCX A;  4CBX G;  1V6F A;  1P8Z G;  3EGX B;  2FH4 A;  2FF6 G;  1SVR A;  5KYX B;  3A5N S;  1SVQ A;  5KYY A;  1CFY A;  1UDM A;  2FGH A;  3A5O S;  1Q8G A;  1C0G S;  1Q8X A;  5KYX A;  1AK7 A;  1DEJ S;  2KVK A;  2XF1 A;  4KEE A;  1PD1 A;  2VIL A;  1M4J A;  5KYU A;  5L6W C;  3EFO A;  3EH2 A;  2LJ8 A;  2W0I A;  3FG6 A;  1T3Y A;  3CIP G;  5KYW A;  1H1V G;  1TMW A;  3Q2B A;  1COF A;  2QTV A;  1EQY S;  3EFO B;  4BEX 1;  5IVU A;  4JD2 H;  2LLF A;  2NUT A;  3EH1 A;  1AK6 A;  5FAE A;  4S10 C;  4CBU G;  3CJC G;  2MV2 A;  1JHW A;  1T44 G;  2HD7 A;  1QPV A;  4Z94 G;  5HVK B;  5KYY B;  2VIK A;  4PKG G;  2FF3 A;  5KYU B;  1X67 A;  4CBW G;  1YAG G;  1D0N A;  1ESV S;  3FFN A;  3EG9 B;  1VKK A;  1RGI G;  1NLV G; 
#chains in the Genus database with same CATH topology
 2NUP A;  1M2O A;  4LIZ A;  3A5M S;  4KED A;  4PKI G;  2NUT B;  3DAW B;  1D4X G;  1NPH A;  1C0F S;  1SVY A;  2VAC A;  3L50 A;  1HQZ 1;  2FH1 A;  1WNJ A;  2LXX A;  3CI5 G;  3TU5 B;  5FAF A;  1F7S A;  1T2L A;  1P8X A;  1AHQ A;  1CNU A;  3EG9 A;  3EGD B;  2XFA A;  2FH2 A;  1M2V B;  1WFS A;  2I2Q A;  1T3X A;  3DA7 A;  1VFQ A;  4KEF A;  2L72 A;  1MDU A;  2D8B A;  5HVK D;  5A1M A;  1NMD G;  1NM1 G;  1YVN G;  3FFK A;  1J72 A;  1PD0 A;  2NUP B;  5DD2 A;  3CJB G;  2MP4 A;  5KYN A;  3EGX A;  1KCQ A;  5KYW B;  3A5L S;  4PKH B;  1TVJ A;  2FH3 A;  3FG7 A;  3EGD A;  1WM4 A;  1M2V A;  2MOT A;  1PCX A;  4CBX G;  1V6F A;  1P8Z G;  3EGX B;  2FH4 A;  2FF6 G;  1SVR A;  5KYX B;  3A5N S;  1SVQ A;  5KYY A;  1CFY A;  1UDM A;  2FGH A;  3A5O S;  1Q8G A;  1C0G S;  1Q8X A;  5KYX A;  1AK7 A;  1DEJ S;  2KVK A;  2XF1 A;  4KEE A;  1PD1 A;  2VIL A;  1M4J A;  5KYU A;  5L6W C;  3EFO A;  3EH2 A;  2LJ8 A;  2W0I A;  3FG6 A;  1T3Y A;  3CIP G;  5KYW A;  1H1V G;  1TMW A;  3Q2B A;  1COF A;  2QTV A;  1EQY S;  3EFO B;  4BEX 1;  5IVU A;  4JD2 H;  2LLF A;  2NUT A;  3EH1 A;  1AK6 A;  5FAE A;  4S10 C;  4CBU G;  3CJC G;  2MV2 A;  1JHW A;  1T44 G;  2HD7 A;  1QPV A;  4Z94 G;  5HVK B;  5KYY B;  2VIK A;  4PKG G;  2FF3 A;  5KYU B;  1X67 A;  4CBW G;  1YAG G;  1D0N A;  1ESV S;  3FFN A;  3EG9 B;  1VKK A;  1RGI G;  1NLV G; 
#chains in the Genus database with same CATH homology
 2NUP A;  1M2O A;  4LIZ A;  3A5M S;  4KED A;  4PKI G;  2NUT B;  3DAW B;  1D4X G;  1NPH A;  1C0F S;  1SVY A;  2VAC A;  3L50 A;  1HQZ 1;  2FH1 A;  1WNJ A;  2LXX A;  3CI5 G;  3TU5 B;  5FAF A;  1F7S A;  1T2L A;  1P8X A;  1AHQ A;  1CNU A;  3EG9 A;  3EGD B;  2XFA A;  2FH2 A;  1M2V B;  1WFS A;  2I2Q A;  1T3X A;  3DA7 A;  1VFQ A;  4KEF A;  2L72 A;  1MDU A;  2D8B A;  5HVK D;  5A1M A;  1NMD G;  1NM1 G;  1YVN G;  3FFK A;  1J72 A;  1PD0 A;  2NUP B;  5DD2 A;  3CJB G;  2MP4 A;  5KYN A;  3EGX A;  1KCQ A;  5KYW B;  3A5L S;  4PKH B;  1TVJ A;  2FH3 A;  3FG7 A;  3EGD A;  1WM4 A;  1M2V A;  2MOT A;  1PCX A;  4CBX G;  1V6F A;  1P8Z G;  3EGX B;  2FH4 A;  2FF6 G;  1SVR A;  5KYX B;  3A5N S;  1SVQ A;  5KYY A;  1CFY A;  1UDM A;  2FGH A;  3A5O S;  1Q8G A;  1C0G S;  1Q8X A;  5KYX A;  1AK7 A;  1DEJ S;  2KVK A;  2XF1 A;  4KEE A;  1PD1 A;  2VIL A;  1M4J A;  5KYU A;  5L6W C;  3EFO A;  3EH2 A;  2LJ8 A;  2W0I A;  3FG6 A;  1T3Y A;  3CIP G;  5KYW A;  1H1V G;  1TMW A;  3Q2B A;  1COF A;  2QTV A;  1EQY S;  3EFO B;  4BEX 1;  5IVU A;  4JD2 H;  2LLF A;  2NUT A;  3EH1 A;  1AK6 A;  5FAE A;  4S10 C;  4CBU G;  3CJC G;  2MV2 A;  1JHW A;  1T44 G;  2HD7 A;  1QPV A;  4Z94 G;  5HVK B;  5KYY B;  2VIK A;  4PKG G;  2FF3 A;  5KYU B;  1X67 A;  4CBW G;  1YAG G;  1D0N A;  1ESV S;  3FFN A;  3EG9 B;  1VKK A;  1RGI G;  1NLV G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...