1CG5B

Deoxy form hemoglobin from dasyatis akajei
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
141
structure length
141
Chain Sequence
VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTTRLFSKLQGLFSANDIGVQQHADKVQRALGEAIDDLKKVEINFQNLSGKHQEIGVDTQNFKLLGQTFMVELALHYKKTFRPKEHAAAYKFFRLVAEALSSNYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the deoxy and CO forms of haemoglobin from Dasyatis akajei, a cartilaginous fish.
pubmed doi rcsb
molecule tags Oxygen transport
molecule keywords PROTEIN (HEMOGLOBIN)
total genus 60
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 1999-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 1cg5B00
5F0BA 2W31A 2SPNA 1COHA 2OIFA 1OFKA 3ARLA 1S5YB 4MQCB 1OR4A 1Y4BA 1LA6A 2BWHA 1IBEA 1MKOB 1XYEA 2GRHA 1HBSB 1Y0TB 3SZKB 2R4ZA 1NIHA 2B7HA 1IBEB 3AQ6A 3DHRB 3WCPB 1R1YA 3PI8B 1Y0AA 1YDZA 3G4UA 3MOUA 1BIJB 5HY8B 3E5OA 1C7CB 2D2MD 1G0BA 1RQ3B 3S1JA 1HDBA 1TU9A 1J7YB 3D1KB 1THBB 1IDRA 1Y01B 2H35B 1BZ0B 2HBEB 1J7SB 1Y7ZB 3WCTC 1MYJA 3UHHA 1FLPA 3UHRA 3HHBB 1A3OA 2QSSB 4F4OA 1OUTB 2MGKA 5B85A 1YGFA 5HY8A 1Y8HB 3ZOMA 1HBAB 2D2MA 2W72B 1R1YB 1YHRA 2D5XB 2ZSNA 1J7WA 3QJDA 3BOMA 1O1PB 3A2GA 2G12A 3AT5B 3ZHWA 3PI4A 3UH6A 4WJG1 1GLIA 3WHMA 3M39A 1IWHB 1HABB 1XYEB 1UFJA 1UX8A 5E6EB 1XZUB 2MYDA 4MQGA 5D1VA 1M9PB 1Y4QA 2MYAA 1LFVB 1JZMA 1V5HA 1DM1A 1HBBB 3ECXA 1DXVB 4M4AA 3QMAA 3IC0A 3WFUA 1BZ1A 1Y45A 1MLUA 3B75B 4G51B 2MHBB 1O1NB 4MQJA 3PELA 2DN2B 3PI9A 1FSXA 3UHQA 1V4XB 5CN7A 2DC3A 1QXDA 3K9ZA 1J3FA 1MNHA 3D4XA 1BINA 1TESA 1GZXB 3PI2A 2PGHA 1DWTA 1KD2A 3E55A 1YMCA 2V1JA 1O1LA 1JZLA 2MGIA 1KR7A 5KERA 4FWXA 4U8UC 3EU1B 1JP6A 2GKNA 1QPWB 3WCWD 1F63A 1LJWB 2V1EA 2G3HA 3WI8A 4GZGA 2HHBA 1MLHA 2VYZA 2W6WA 4NI0A 1LHTA 1HGAB 1XZ5B 1GBVA 4C0NA 1K0YA 1G9VB 1CMYA 1ECNA 1Y0DB 4H2LA 1LFLA 3QJEA 1LH3A 1Y4PB 4UIQA 1CH2A 5ILMA 2ZS1C 3NFEB 4ESAA 4G1BA 3MKBB 4KN3A 1YE2B 3G4YA 1CG8B 2ZLWB 3ZJLA 1MBSA 1ABWB 1V75B 2R80B 4MQKA 1Y35A 1H1XA 3ZJPA 3BJ3B 3W4UA 1YG5B 1Y31B 1YDZB 1S0HA 3UHWA 2W6VA 2OHAA 1OFJA 2M6ZB 1XQ5B 2IN4A 1QI8A 107MA 1UMOA 1HBHB 4X0LB 2VYYA 1GCVA 1GBUA 1A01B 3PELB 4O2GA 1Y5KA 1A6MA 1S0HB 1YOGA 2O5SX 3QJBB 1JDOA 1Y8IB 1N9IA 3GQGA 2MYEA 5CNGA 1UFPA 2OHBA 4ZVAA 3PI3A 3OJ1A 1GDKA 2MGBA 2NSRA 2D2MB 1CG5B 2LH6A 3OZWA 1VREA 3ARKA 112MA 5CNEA 2MGAA 1HV4A 4F4OB 5CNCA 2LHBA 5AZQA 4NK1A 4O35A 108MA 3GDJA 4B4YA 4NI1B 1J3ZA 2V1HA 1Y22A 1A4FB 3S48C 1G9VA 3OO5A 1A9WA 2YRSA 5AZRA 2BKMA 1YE0B 1RQAB 2HHEA 1J7YA 1IOPA 1SI4B 3D1AA 3BA2A 3LB1A 3DUTB 2H8FB 3GQRA 3UBVA 3ZJNA 5E83A 1YE2A 1IRDA 3HEOA 4ESAB 1MBOA 104MA 3WFXA 5HLQA 5CN4A 4KMWA 3R5IB 1Y0WB 1Y7CA 3DHRA 1A6NA 3QZXA 1FSXB 3CIUB 1LUEA 1VHBA 1RQ4A 3LQDA 2H8DA 2O5LX 1MLOA 3GK9A 1Y4BB 1DWRA 3AQ8A 2BW9M 2VYWA 1YFFB 2ZSOA 4PNJA 106MA 1XZ2B 3ASEA 3VRFA 1A01A 3G4VA 3WR1A 3GKVA 1CH5A 4YU3A 1DO4A 2ZLVA 4MQGB 4N8TB 1MODA 4TYXA 3ZJRA 5HBIA 3G53A 1PMBA 3GYSB 3ZJMA 2AUQA 3ECZA 2ZS0C 4DC7A 1L2KA 2HBSB 1XZ4A 3VREB 3GOUA 2QU0B 1YEQA 4PQ6A 4F6IA 3LQDB 3S1IA 1VXEA 3PT7B 1URVA 4N7OB 3WCWB 1YEOB 2ZLVB 3S65A 1MWBA 1HHOB 1DO7A 1A0UB 2HBDB 1Y4PA 3DHTA 4FH7A 3WCUC 2GLNA 1Y46A 4IT8A 4PQCA 5CNDA 1Y4VA 5KDQA 1CMYB 1MGNA 5JGGA 1HACB 1NS6A 1Y8KB 3MVCA 1Y8WB 4ZVBA 4TWUA 5C6EA 4DWUA 1BBBA 3W4UB 3MN0A 4NI0B 3AT6B 2R4WA 3MJPB 5EQMA 1RVWB 1YIEA 1HDSB 1LJWA 1DXUA 1XZ7A 3S65B 1YOHA 1HBAA 2HBGA 1YOIA 1HDBB 2V1GA 3WCVC 1DXTA 3A59A 1Y8WA 3V2VA 4N7PA 2ZS1D 3ARJA 1AJGA 3LHBA 1Y7DB 2R1HB 105MA 3HHBA 4MBNA 4O4TA 1ABSA 1DWSA 3QJEB 2VLXA 4FC3B 2QU0A 2KSCA 2WTHA 3MJUA 1K0YB 4F69A 1SHRB 3FS4B 2LH1A 1RSEA 1LH6A 2ZLUA 1CLSA 1I3EA 1YGDA 3A0GA 4ROLB 3DUTA 1MLRA 2D2ND 5M3SA 1QSIA 3V2ZA 4N8TA 1LFYB 3OGBA 5CN9A 2MB5A 1O1LB 1YIHB 1F5PA 1X9FA 2WTGA 1NGKA 7HBIA 2MGFA 1FCSA 1HV4B 1G09A 1O1KA 1QXEA 1X3KA 1Y5KB 2HHDB 1QSIB 1CG5A 1EWAA 1OUUB 2LH2A 2ZLTB 3EOKA 4WJGA 3SZKA 1HGCA 1MTJA 3IXFA 5C6YA 3WCVB 4G51A 1G09B 1O1KB 4FWZA 2DHBA 2MGEA 1X9FC 1YEUA 1MYFA 1A00B 1M6MA 1YVQA 2Z6SA 1S56A 3BCQB 3LB4A 3CY5B 1C7BB 4HRRA 3TLDA 2GNWA 3BJ2A 101MA 1NS9A 3LB3A 2D5ZB 1SPGA 1NQPA 1RQAA 1QSHB 1CLSB 5C6EB 109MA 2V1FA 1S61A 1Y31A 2FRIX 2DN3A 1V4WB 2ZWJA 4MXLA 3ZJSA 4VHBA 1R1XB 1DKEB 1SI4A 3D1AB 1Y83B 1AZIA 1IRDB 1NZ5A 2EKTA 1IT3A 3HF4A 5KKKA 4HRRB 2QLSB 1RPSB 1NPGA 1UIWA 1Y22B 2Z6NA 3QM9A 2ZT2A 1YVQB 5B84A 1PBXB 3GQGB 3TM9A 2B7HB 1AJHA 1MYHA 3VRGA 1MBNA 2GNVA 1LHSA 2FRJX 3HYUB 1FN3A 1Z8UB 1J41B 1B86A 1D8UA 4O1TA 1V4XA 4N7NB 2RAOA 2XYKA 2ZLXB 1Y0CB 2FAMA 3GKTA 1HBRA 1Y4FB 3WCUD 3NG6A 1GBUB 3ZJIA 2HZ2A 3MYNA 4XS0B 2NSSA 2ZSTA 1YEUB 1YHEA 1MTIA 1BZZB 3UHCA 1O1JB 1CBLA 1BVCA 1UT0A 3HEPA 2RAOB 1Y5JA 3MBAA 5IKSA 3R0GA 2GRFA 1QI8B 1HCOA 6HBWA 1IRCA 1LFQA 1Y4RA 1UVXA 2VRYA 2ZFOA 4DWTA 2GTLA 3BJ1A 2ZS1A 1NZ3A 1M9PA 1Y4QB 4PQBA 1MNOA 1Y35B 3NFEA 2H8FA 1A0ZA 2Z85A 1DLWA 1R1XA 1Y09B 1SDLA 1GLIB 4UURA 3HF4B 3K8BA 1MBAA 2ZS1B 3FS4A 1GDIA 1LFTA 3M3BA 2QFKA 4MU5A 1J40B 4FC3A 1QSHA 1AJ9A 4L7YB 4C44A 1A0ZB 1ABYB 1GCWA 2ZSXA 1CPWA 3A59B 4NXCA 1JY7B 2D2NB 1NS9B 1MWCA 1JP8A 3UHNA 2FRKX 1O1NA 4MQJB 2MGLA 1Y7GB 3QJBA 1CH7A 4M4AB 2GDMA 1NQPB 2RI4B 1HGCB 3DHTB 1KD2B 1LFVA 3BJ2B 4JACA 5D5RA 3UHBA 3G46A 2MHBA 1DUOA 1OR6A 1C7CA 1EBTA 1C7BA 1DXDA 3VRGB 3FH9A 1Y0AB 2ZSPA 3WCVD 1HBBA 3PIAA 1GVHA 2MGCA 1YEQB 1JF4A 2ZLXA 2MYBA 4MQCA 1ECAA 3VREA 4MBAA 2MGGA 1C40A 3WCVA 3NG6B 1JP9A 3UHGA 1JEBA 3EDAA 1MCYA 1S6AA 1MYMA 3IC2B 1LA6B 1O1PA 3AG0A 2RI4A 1LFZB 1X46A 2Z6NB 1VXHA 4N7PB 1BUWA 5MBNA 3MJUB 1MNJA 1YG5A 5CHQA 1OUTA 1SDLB 2GRZA 1YZIB 1EBCA 1RPSA 3ED9A 1G0BB 2ZLUB 1YEVB 3ZJJA 4ROMB 3M38A 2O58X 1A4FA 1FHJB 1O1OB 2ZSRA 2ZFOB 1O1MA 5F2AA 1Y0DA 1YH9A 1VXGA 2QMBB 3AQ5A 1HBIA 1CH1A 4ROMA 3IC2A 3ZOLA 4F6DA 1RTXA 1U7RA 1Y4VB 1Y5JB 1NIHB 1HBSA 1Y0TA 1OUUA 3EOKB 111MA 2MYCA 2AA1B 4M4BB 102MA 2BLIA 4HRTB 1G08A 4N7OA 1GJNA 1DO3A 5EE4D 1V07A 3QM7A 4MAXA 4BJAA 1XZ4B 1JW8A 3WCUB 1Y4FA 2BNLA 2C0KA 2ZS0B 4G1VA 2WY4A 1HCOB 2LH3A 2AURA 4MQIB 1IT2A 1EMYA 1NXFA 1X9FB 2ZS0A 1MBIA 2EF2A 3P5QB 1LH1A 3G52A 2AV3A 5EOHA 1QXEB 1I3DA 4FWYA 1HRMA 1VWTB 3KMFA 3PIAB 2HBFA 1XY0B 1HBRB 2H8DB 1FSLA 3P5QA 4TWVA 3GQPA 4ROLA 1YVTA 1S5XB 3MKBA 4WCHD 3NL7B 4YU4A 1AJ9B 4L7YA 3OK5A 3GKVB 1RQ4B 4U8UD 2ZSSA 3VAUA 1MYZA 3KUNA 2ZT4A 5HU6B 1J7WB 3GQRB 4HRTA 1MLJA 5ILRA 3IA3B 3OZVA 1MOCA 1CQXA 2OH9A 1NZ4A 2BLHA 3CIUA 4NK2A 3ZJOA 2O5QX 3H58A 2VM0A 3CY5A 1MLNA 2E2YA 3G4WA 2ZFBB 3AQ7A 3UI0A 1MBDA 1Y4GB 5E29B 4YU4B 3AT6A 1BABB 1BJEA 2DN3B 2NX0A 1LH7A 3UHIA 1G0AA 1T1NA 1JWNA 3U3EA 3D1KA 3GDJB 3S66B 3UH3A 3A5GA 2G0XA 1U7SA 3WCTD 4F6BA 1K1KB 1YE0A 3GOUB 1BIJA 1HDAA 4XS0A 2AUOA 3D7OA 3OVUC 1CP5A 2R4XA 2HBFB 1Y5FA 1HDAB 1MOBA 2G0ZA 1GZXA 4MXKA 3WCPA 2LH7A 3TM3A 1QXDB 3ZJQA 2O5OX 4H0BA 1JEBB 3H57A 1VRFA 2DN2A 1YENA 3PI9B 2ZT0A 4MQIA 1VXCA 1SDKA 1DO1A 1MDNA 1JL6A 2DXMB 1O1JA 5CNBA 1MZ0A 1F5OA 2D5XA 2XKGA 1CH4A 1ECOA 4H07A 2R1HA 1GDLA 1JY7A 1Y85A 1Y7GA 3UGZA 1GCWB 2ZFOC 1XQ5A 2EVKA 1Y7CB 2VEBA 3WFTA 3UH7A 1XZ7B 3R5IA 1DKEA 4ODCA 5CN8A 1BBBB 5CN5A 3KMFC 1FHJA 2ZFOD 2G0SA 5E83B 1YCAA 5E29A 1Y4GA 1Y09A 1YZIA 2SPMA 2D60B 5EYSA 2D2NA 1LFTB 3ODQA 2QSPA 1Y8HA 1NWNA 2JHOA 2PEGA 3PT7A 1ABYA 5JDOD 2EB8A 1NEJB 1YHUD 2MBWA 4OF9A 3SDHA 5JDOF 5HAVA 1A6KA 5KERB 2Z8AA 2MGMA 3QJCB 3WTGB 3OO5B 3QM8A 5KDQB 3K8BB 2ZS0D 2VLZA 5MBAA 2O5MX 2G0RA 5ILPA 6HBWB 5SW7B 4OODA 3B75A 4HHBA 1X9FD 2W72C 1Y5FB 3BCQA 1YHUC 3UHTA 1VWTA 1YHEB 1LFYA 1YCBA 2HBSA 3HYUA 2AA1A 4M4BA 5ILEA 3WCWC 1BVDA 2ZLTA 2W6VB 1Y0CA 1C7DA 3PT8A 3UHXA 3WCUA 2QRWA 1V9QA 3QJCA 3WTGA 2M6ZA 3ECLA 3QJDB 2O5TX 5JOMA 4U8UB 1IWHA 1HABA 4MQKB 4L2MA 1HLBA 2DN1B 1YMBA 1YMAA 2ZT1A 1KFRA 2VHBA 1XZ5A 5EUIA 1B86B 1VXDA 4LPIA 4HHBB 3ORDA 2W6XA 5CHRA 5E6EA 3UHYA 3A9MA 5SW7A 2D60A 1N9FA 2GL3A 1MLKA 1NPFA 3NMMA 2EKUA 4HSXA 1HGBA 2G0VA 1J3YA 2YRSB 1F65A 1ITHA 1Y8KA 110MA 1A6GA 3AT5A 2H35A 4NZIA 1ASHA 1LH2A 1MOHA 1YHUA 3GLNA 2EB9A 3ONZA 1J52A 3NMMB 4F6GA 3WCTA 4JYQA 1Y7DA 2ZFBA 1WMUA 3AQ9A 1XXTA 2AUPA 1CBMA 1HSYA 3UHZA 3VHBA 4NS2A 5AB8A 5EUIB 1HGBB 1UC3A 1N9HA 3UBCA 3WCTB 2DN1A 1FDHA 3G4RA 2DHBB 3DR9A 4UZVA 1BUWB 2HCOB 1J3ZB 1LFZA 1LFQB 1Y4RB 4FH6A 1MOAA 2AV0A 1CIKA 1EW6A 1SWMA 3LR7A 3UHVA 1NAZA 1BZRA 2BMMA 1URYA 2HBCB 1HLMA 1XZ2A 2R4YA 3HENA 103MA 4DC8A 1CH9A 4B3WA 1J41A 1SDKB 3QQRA 2R80A 3G4QA 1HBHA 1CG8A 2ZLWA 3D17B 2MGJA 5HLXA 1YGFB 2GKMA 1MYTA 1FN3B 2GTLC 4O4ZA 1Y0WA 2VLYA 1YHRB 3UH5A 3UGYA 3UHKA 4AVEA 2HZ3A 1O1OA 1XZVB 2QLSA 3O7NA 2PEGB 5CN6A 4QAUA 1G08B 1DUKA 1SPEA 3OZUA 1Q1FA 3S66A 1HDSA 1HBGA 4XDIA 1YGDB 1G0AB 2OH8A 1YHUB 2G10A 1CO8A 1J7SA 1JPBA 1Y7ZA 1XXTB 1VXBA 1Y83A 5JDOE 1MNKA 2R50A 4F6FA 1DXUB 1Y46B 1BABA 1MLMA 3HXNB 3NMLA 1SPGB 3EDBA 5JDOC 1JF3A 1N9XA 4F68A 2BK9A 1B0BA 1RQ3A 1S5XA 1MYGA 1C7DB 3PT8B 4AVDA 4SDHA 1THBA 3PI8A 1MLQA 2SPLA 1RVWA 1YIEB 1C40B 1LTWA 1YEOA 2HHEB 4NXAA 5HLUA 2EVPA 2O5BX 2D2NC 1HACA 1NS6B 1BZ1B 2GTLB 1MTKA 1CH3A 2MGDA 3QQQA 3QZZA 2G11A 4ODCB 4F6JA 4U8UA 2HZ1A 3A5AA 3OO4B 1S69A 2XKHA 1MLFA 5EV5A 1OJ6A 3OO4A 2CMMA 3HC9A 2V1IA 1XY0A 4N7NA 1PBXA 1MLLA 3BOMB 5EU2A 1K1KA 3IC0B 1Y2ZB 2ZSZA 2HBCA 2D2MC 3A5BA 3D7OB 2FALA 3GYSA 4MPMA 1FDHG 1YFFA 2QSPB 1A9WE 1WMUB 1XZUA 1A3OB 2QSSA 2QMBA 3QM6A 3SDNA 2D6CA 1O1MB 3MYMA 2NRLA 1DLYA 3QM5A 5EE4C 1O16A 1RTEA 2ZT3A 1J3YB 2D5ZA 1MWDA 3UHSA 1GDJA 1O1IA 2W72A 1ABWA 3MJPA 1NEJA 1V4WA 3ODQB 2VEEA 1VXFA 1O1IB 5EYJA 3ONZB 3HXNA 3E4NA 1MLGA 1FAWA 4IROA 3K3UA 4MQHB 3D4XB 1JZKA 2SPOA 3UHDA 1HJTA 3ZJHA 1LH5A 2NRMA 3M3AA 1MKOA 1QPWA 1HHOA 2V1KA 1CQ2A 1A00A 5CMVA 1XZVA 3RJNB 1COHB 1YIHA 1CO9A 4HBIA 1YENB 1GCVB 1JL7A 3FH9B 2PGHB 3HRWA 3RGKA 3D17A 1CP0A 3WHMB 3VRFB 4HSWA 1MLSA 3PI1A 2XKIA 1DTIA 1SHRA 3LR9A 3ZH0A 3KUOA 3O89A 3BJ3A 2IG3A 1Y8IA 2QFNA 1M6CA 1NZ2A 6HBIA 1DXVA 5EETA 1MBCA 1UIWB 4X0LA 1A3NA 3A0GB 2LH5A 1WVPA 1DXTB 1V4UB 3LB2A 1OBMA 1MYIA 2Z6TA 3WFWA 1YH9B 2G14A 1LFLB 1WLAA 1H97A 1T1NB 5HU6A 2W6YA 2HCOA 1MNIA 1XCHA 1GBVB 5JGGB 1DTMA 4ILZA 1FAWB 4IROB 3E5IA 4MQHA 3RJ6A 3UHEA 2HHBB 2MGHA 1A0UA 2HBDA 1V75A 3EU1A 1V4UA 2OLPA 3UHUA 1YEVA 1BZPA 5CNFA 1UX9A 2FRFA 2BLJM 1ECDA 1NWIA 1BZ6A 4H2LB 1Y2ZA 3NL7A 1J40A 2GTLD 1W92A 1BZ0A 2HBEA 2DXMA 1HGAA 1UVYA 1CIOA 4NI1A 1VXAA 3GQPB 2HHDA 1DXCA 3WCWA 1BZZA 4KJTA 3HRWB 1S5YA 2ZSYA 4YU3B 1YVTB 1Y85B 1Y45B 3BJ1B 4KMVA 2ZSQA 1A3NB 3WR1B
chains in the Genus database with same CATH superfamily
5F0BA 2W31A 2SPNA 1COHA 2OIFA 1OFKA 2C7LA 3O18B 3ARLA 1S5YB 4MQCB 1OR4A 1QGWC 1Y4BA 1LA6A 2BWHA 1IBEA 1MKOB 1XYEA 2GRHA 1HBSB 1Y0TB 3SZKB 2R4ZA 1NIHA 2B7HA 1IBEB 4ZIZB 3V58A 3AQ6A 3DHRB 3WCPB 1R1YA 3PI8B 1Y0AA 1YDZA 3G4UA 3MOUA 1BIJB 5HY8B 3E5OA 1C7CB 2D2MD 1G0BA 1RQ3B 3S1JA 1HDBA 1TU9A 2DKDA 4Z8KA 1J7YB 3D1KB 1THBB 1IDRA 1Y01B 2JLFA 2H35B 1BZ0B 2HBEB 1J7SB 1Y7ZB 3O2CA 3WCTC 1MYJA 3UHHA 1FLPA 3UHRA 4ETTA 3HHBB 1A3OA 2QSSB 4F4OA 1OUTB 2MGKA 5B85A 1YGFA 5HY8A 1Y8HB 3ZOMA 1HBAB 2D2MA 2W72B 1R1YB 1YHRA 2D5XB 2ZSNA 1J7WA 3QJDA 3BOMA 1O1PB 3A2GA 2G12A 4H0MB 3AT5B 3PMCA 3ZHWA 3PI4A 3UH6A 4WJG1 1GLIA 3WHMA 3M39A 1IWHB 1HABB 1XYEB 1UFJA 1UX8A 5E6EB 1XZUB 2MYDA 4MQGA 5D1VA 1M9PB 1Y4QA 2MYAA 1LFVB 1CIIA 1JZMA 2UUMA 1V5HA 1DM1A 1HBBB 3ECXA 1DXVB 4M4AA 1GH0B 3QMAA 3IC0A 3WFUA 1BZ1A 1Y45A 1MLUA 3B75B 4G51B 2MHBB 1O1NB 2VJTB 4MQJA 4AE1A 3PELA 2DN2B 3PI9A 2WCQA 1FSXA 3UHQA 1V4XB 5CN7A 2DC3A 1QXDA 3K9ZA 1J3FA 1MNHA 3D4XA 1BINA 1TESA 1GZXB 3PI2A 2PGHA 1DWTA 1KD2A 1MDTA 3E55A 4XXKA 1YMCA 2V1JA 1O1LA 1JZLA 2MGIA 1KR7A 5KERA 4FWXA 4U8UC 5B13G 3EU1B 1JP6A 2GKNA 1QPWB 3WCWD 1F63A 1LJWB 2V1EA 2G3HA 3WI8A 4GZGA 2HHBA 1MLHA 2VYZA 2W6WA 4NI0A 1B33B 1LHTA 1HGAB 1XZ5B 1GBVA 3MWNA 1K0YA 1G9VB 4C0NA 1CMYA 1ECNA 1Y0DB 4H2LA 1LFLA 3QJEA 1LH3A 1Y4PB 4UIQA 1CH2A 1COLA 1DDTA 5ILMA 2ZS1C 3O2CB 4L1EA 3NFEB 4ESAA 4G1BA 3MKBB 4KN3A 1YE2B 3G4YA 1CG8B 2ZLWB 3ZJLA 1MBSA 1ABWB 4HH0A 1V75B 2R80B 4MQKA 1Y35A 1H1XA 3ZJPA 3BJ3B 3W4UA 1YG5B 1Y31B 1YDZB 1B8DA 1S0HA 3UHWA 2W6VA 2OHAA 1OFJA 1KN1A 2M6ZB 1A87A 1XQ5B 2IN4A 1QI8A 107MA 1UMOA 1HBHB 4X0LB 2VYYA 1GCVA 1GBUA 1A01B 3PELB 4O2GA 4F0UA 1Y5KA 1A6MA 1B8DB 1S0HB 1YOGA 2O5SX 3QJBB 1JDOA 1Y8IB 1N9IA 3GQGA 1F99A 2MYEA 5CNGA 1UFPA 2OHBA 4ZVAA 3PI3A 3OJ1A 1GDKA 2MGBA 2NSRA 2D2MB 1CG5B 2LH6A 3OZWA 1VREA 2JLGA 3ARKA 112MA 5CNEA 2MGAA 1HV4A 4F4OB 2WCRA 5CNCA 2LHBA 5AZQA 4BJUA 4NK1A 4O35A 108MA 3GDJA 4B4YA 4NI1B 1J3ZA 4A8SA 2V1HA 1Y22A 1A4FB 3S48C 1G9VA 1ON7B 3OO5A 1A9WA 2VJRA 2YRSA 5AZRA 2BKMA 1YE0B 1RQAB 2HHEA 1J7YA 1IOPA 1SI4B 3D1AA 3BA2A 3LB1A 3DUTB 2H8FB 3GQRA 3UBVA 3ZJNA 5E83A 1YE2A 1IRDA 4ESUA 3HEOA 4ESAB 1MBOA 104MA 3WFXA 4RMPB 5HLQA 5CN4A 4KMWA 3KVSB 3R5IB 1Y0WB 1Y7CA 3DHRA 1A6NA 3QZXA 1FSXB 3CIUB 1LUEA 1VHBA 1RQ4A 1PHNA 3LQDA 2H8DA 2O5LX 1MLOA 3GK9A 1Y4BB 1DWRA 3AQ8A 2BW9M 1EYXB 1XF6C 2VYWA 1YFFB 4A8QA 2ZSOA 4PNJA 106MA 1XZ2B 3ASEA 3VRFA 1A01A 3G4VA 3WR1A 3GKVA 1CH5A 4YU3A 1DO4A 2ZLVA 4MQGB 1UVMA 4N8TB 1MODA 4TYXA 3ZJRA 5HBIA 3G53A 1PMBA 3GYSB 3ZJMA 2AUQA 3ECZA 2ZS0C 4DC7A 1L2KA 2HBSB 1XZ4A 3VREB 4F0TA 3GOUA 2QU0B 1YEQA 4PQ6A 4F6IA 3LQDB 3S1IA 4A8FA 1VXEA 3PT7B 1URVA 4N7OB 3WCWB 1YEOB 2ZLVB 3S65A 1MWBA 1HHOB 1DO7A 1A0UB 2HBDB 1Y4PA 3DHTA 4FH7A 3WCUC 2GLNA 1Y46A 4IT8A 4PQCA 5CNDA 1Y4VA 5KDQA 3L0FB 1CMYB 1MGNA 5JGGA 1HACB 1NS6A 1Y8KB 3MVCA 1Y8WB 4ZVBA 4TWUA 5C6EA 4DWUA 1BBBA 3W4UB 3MN0A 4NI0B 3AT6B 2R4WA 3MJPB 5EQMA 1RVWB 1YIEA 1HDSB 1LJWA 1DXUA 1XZ7A 3S65B 1YOHA 1HBAA 2HBGA 1YOIA 1HDBB 2V1GA 3WCVC 1DXTA 3A59A 1Y8WA 3LQ9A 3V2VA 4N7PA 2ZS1D 3ARJA 1AJGA 3LHBA 1Y7DB 2R1HB 105MA 4Q70A 3HHBA 4MBNA 4O4TA 1ABSA 1DWSA 3QJEB 2VLXA 4FC3B 2QU0A 2KSCA 2WTHA 3V57B 3MJUA 1K0YB 1HI8A 1SHRB 3FS4B 4F69A 4HH1A 2LH1A 1RSEA 1LH6A 2ZLUA 1CLSA 1I3EA 1YGDA 3A0GA 4ROLB 3DUTA 1MLRA 2D2ND 5M3SA 1QSIA 3V2ZA 4N8TA 4GXEB 1LFYB 3OGBA 5CN9A 2MB5A 1O1LB 4F0UB 1YIHB 1F5PA 1X9FA 2WTGA 1NGKA 7HBIA 2MGFA 1FCSA 4F0TB 1HV4B 1G09A 1O1KA 1QXEA 1X3KA 1Y5KB 2HHDB 1QSIB 1CG5A 1EWAA 1OUUB 2LH2A 2ZLTB 3EOKA 4WJGA 3SZKA 1HGCA 1MTJA 3IXFA 5C6YA 3WCVB 4G51A 1G09B 1O1KB 4FWZA 2DHBA 2MGEA 1X9FC 1YEUA 1MYFA 1A00B 1M6MA 4GY3A 1YVQA 2Z6SA 1S56A 3BCQB 3LB4A 1I7YA 4BS9A 3CY5B 1C7BB 4HRRA 3TLDA 2GNWA 3BJ2A 101MA 1NS9A 3LB3A 2D5ZB 1SPGA 1NQPA 1RQAA 1QSHB 1CLSB 5C6EB 109MA 2V1FA 1ON7A 1S61A 1Y31A 2FRIX 2DN3A 1V4WB 2ZWJA 4MXLA 3ZJSA 4VHBA 1R1XB 1DKEB 1SI4A 3D1AB 1SGKA 1Y83B 1AZIA 1IRDB 1NZ5A 2EKTA 1IT3A 3HF4A 5KKKA 4HRRB 2QLSB 1RPSB 1NPGA 1UIWA 1Y22B 2Z6NA 3QM9A 2ZT2A 1YVQB 2C7KB 5B84A 1PBXB 4A8WA 3GQGB 3TM9A 2B7HB 1AJHA 1MYHA 3VRGA 1MBNA 2GNVA 1LHSA 2FRJX 3HYUB 1FN3A 1Z8UB 1J41B 1B86A 1D8UA 4O1TA 1V4XA 4N7NB 2RAOA 2XYKA 2ZLXB 1Y0CB 2V8AA 2FAMA 3GKTA 1HBRA 1Y4FB 3WCUD 3NG6A 1GBUB 3ZJIA 2HZ2A 3MYNA 4XS0B 2NSSA 2ZSTA 1YEUB 1EYXA 1YHEA 1MTIA 1BZZB 3UHCA 1O1JB 4YJJB 1CBLA 1HA7A 1BVCA 1UT0A 3HEPA 2RAOB 1Y5JA 3MBAA 5IKSA 3R0GA 2GRFA 1QI8B 4H0MA 1HCOA 6HBWA 1IRCA 1LFQA 1Y4RA 1UVXA 2VRYA 4RMPA 1UVIA 2ZFOA 4DWTA 2GTLA 3BJ1A 2ZS1A 1NZ3A 1M9PA 1Y4QB 4PQBA 1MNOA 4ERTA 1Y35B 3NFEA 2H8FA 1A0ZA 2Z85A 1DLWA 1R1XA 4AE0A 1Y09B 1SDLA 1GLIB 4UURA 3HF4B 3K8BA 1MBAA 2ZS1B 3FS4A 1GDIA 1LFTA 3M3BA 2QFKA 4MU5A 4L1EB 1J40B 4FC3A 1QSHA 1AJ9A 4L7YB 4C44A 1A0ZB 1ABYB 1GCWA 2ZSXA 1CPWA 3A59B 4NXCA 1JY7B 2D2NB 1NS9B 1MWCA 1JP8A 1KTPA 3UHNA 2FRKX 1O1NA 2VJTA 4MQJB 2MGLA 1Y7GB 3QJBA 1CH7A 4M4AB 2GDMA 1NQPB 2RI4B 1HGCB 1LIAA 3DHTB 1KD2B 1LFVA 2DKAA 3BJ2B 4JACA 5D5RA 3UHBA 3G46A 2MHBA 1DUOA 1OR6A 1C7CA 1EBTA 1C7BA 1DXDA 3VRGB 2BV8B 3FH9A 2C7JB 1Y0AB 2ZSPA 3WCVD 1HHTP 1HBBA 3PIAA 1GVHA 2MGCA 1YEQB 1JF4A 2ZLXA 2MYBA 4MQCA 1ECAA 3VREA 4MBAA 2MGGA 1C40A 3WCVA 3NG6B 1JP9A 1KTPB 3UHGA 1JEBA 3EDAA 1MCYA 1S6AA 1MYMA 3IC2B 1LA6B 1O1PA 3AG0A 2RI4A 1LFZB 1X46A 2Z6NB 1VXHA 2I88A 4N7PB 1BUWA 5MBNA 3MJUB 1MNJA 1YG5A 5CHQA 1OUTA 1SDLB 2GRZA 1YZIB 1EBCA 1RPSA 3ED9A 1G0BB 2ZLUB 4LMXB 1YEVB 3ZJJA 4ROMB 3M38A 4N6SB 2O58X 1A4FA 1FHJB 3GUQA 1O1OB 2ZSRA 2ZFOB 1O1MA 5F2AA 1Y0DA 1YH9A 1VXGA 2QMBB 3AQ5A 1HBIA 1CH1A 4ROMA 1ALLB 3IC2A 3ZOLA 4F6DA 1RTXA 1U7RA 1Y4VB 1Y5JB 1NIHB 1HBSA 1Y0TA 1OUUA 3EOKB 111MA 4ETUA 2MYCA 2AA1B 4M4BB 4Z8KB 102MA 2BLIA 4HRTB 1G08A 4N7OA 1GJNA 1DO3A 5EE4D 1V07A 3QM7A 4MAXA 4BJAA 1XZ4B 1JW8A 3WCUB 1Y4FA 2BNLA 2C0KA 2ZS0B 4G1VA 2WY4A 1HCOB 2LH3A 2AURA 4MQIB 1IT2A 1EMYA 1NXFA 1X9FB 2ZS0A 4ERVA 1MBIA 2EF2A 3P5QB 1LH1A 3G52A 2AV3A 5EOHA 3ZTAA 1QXEB 1I3DA 4FWYA 1HRMA 1F99B 1UVJA 1VWTB 3KMFA 3PIAB 2HBFA 1XY0B 1HBRB 2H8DB 1FSLA 3P5QA 4TWVA 3GQPA 4ROLA 1NY9A 1YVTA 1S5XB 3MKBA 4GXEA 4WCHD 1KN1B 3NL7B 4YU4A 1AJ9B 4L7YA 3OK5A 4A8OA 3GKVB 1RQ4B 4U8UD 4Q70B 2ZSSA 3VAUA 1MYZA 3GIOA 4N6SA 3KUNA 2ZT4A 5HU6B 1J7WB 3GQRB 4HRTA 1MLJA 5ILRA 3IA3B 3OZVA 1MOCA 1CQXA 2OH9A 1NZ4A 2BLHA 3CIUA 4NK2A 3ZJOA 2O5QX 3H58A 1ALLA 2VM0A 2X49A 3CY5A 1MLNA 2E2YA 3G4WA 2ZFBB 2VMLB 3AQ7A 3UI0A 1MBDA 1Y4GB 5E29B 4YU4B 3AT6A 1BABB 1BJEA 2DN3B 2NX0A 1LH7A 3UHIA 1G0AA 1T1NA 1JWNA 3U3EA 3D1KA 1XG0C 3GDJB 3S66B 3UH3A 3A5GA 2G0XA 4YJJA 1U7SA 3WCTD 4F6BA 1K1KB 1YE0A 2JL9A 3GOUB 1BIJA 1HDAA 3DBJA 1HI1A 4XS0A 2AUOA 3D7OA 3OVUC 1CP5A 1CPCA 2R4XA 2HBFB 1Y5FA 1HDAB 1MOBA 3DBJB 2G0ZA 1GZXA 4MXKA 3WCPA 2LH7A 3TM3A 1QXDB 3ZJQA 2O5OX 4H0BA 1JEBB 2C7JA 1LIAB 3H57A 1VRFA 2DN2A 1YENA 3PI9B 2ZT0A 4MQIA 1VXCA 1SDKA 1DO1A 1MDNA 1JL6A 2DXMB 1O1JA 5CNBA 1MZ0A 1F5OA 2D5XA 2XKGA 1CH4A 1ECOA 4H07A 2R1HA 1GDLA 1JY7A 1Y85A 1Y7GA 3UGZA 1GCWB 2ZFOC 1XQ5A 2EVKA 1Y7CB 2VEBA 3WFTA 3UH7A 1XZ7B 3R5IA 1DKEA 4ODCA 5CN8A 1BBBB 5CN5A 3KMFC 1FHJA 2ZFOD 2G0SA 5E83B 1YCAA 1Y4GA 5E29A 1Y09A 1YZIA 2SPMA 2D60B 5EYSA 2D2NA 1LFTB 3ODQA 2QSPA 1Y8HA 1NWNA 2JHOA 2PEGA 3PT7A 1ABYA 5JDOD 2UULA 2EB8A 1NEJB 1YHUD 2MBWA 4OF9A 3SDHA 5JDOF 5HAVA 1A6KA 5KERB 2Z8AA 2MGMA 3QJCB 3WTGB 3OO5B 3QM8A 4LM6B 5KDQB 3K8BB 2ZS0D 2VLZA 1TOXA 5AQDA 5MBAA 2O5MX 2G0RA 5ILPA 6HBWB 5SW7B 4OODA 3B75A 4HHBA 1X9FD 2J96A 2W72C 1Y5FB 3BCQA 1YHUC 3UHTA 2UUMB 1VWTA 2UUMX 1YHEB 1LFYA 1YCBA 2HBSA 3HYUA 2AA1A 4M4BA 3NUHB 5ILEA 3WCWC 1HHSA 1BVDA 2ZLTA 2W6VB 1Y0CA 2V8AB 1C7DA 3PT8A 3UHXA 3WCUA 2QRWA 1V9QA 3QJCA 3WTGA 2M6ZA 3ECLA 3QJDB 2O5TX 5JOMA 4U8UB 1IWHA 1HABA 2C7LB 4MQKB 4L2MA 1HLBA 2DN1B 1YMBA 1YMAA 2ZT1A 1KFRA 2VHBA 1XZ5A 5EUIA 1B86B 4LPIA 1VXDA 4HHBB 2UUND 3ORDA 2W6XA 5CHRA 5E6EA 3UHYA 3A9MA 5SW7A 2D60A 1N9FA 2UULC 2GL3A 1MLKA 1NPFA 3NMMA 2EKUA 4HSXA 1HGBA 2G0VA 1J3YA 2VJRB 2YRSB 1F65A 1ITHA 1Y8KA 110MA 1A6GA 3AT5A 2H35A 4NZIA 1ASHA 1LH2A 1MOHA 1YHUA 3GLNA 2EB9A 3ONZA 1J52A 3NMMB 4F6GA 3WCTA 4JYQA 1Y7DA 2ZFBA 1WMUA 3AQ9A 5AQDM 1XXTA 2AUPA 1CBMA 1HSYA 3UHZA 3VHBA 4NS2A 5AB8A 5EUIB 1B33A 1HGBB 1UC3A 1N9HA 3UBCA 3WCTB 2DN1A 1FDHA 3G4RA 2DHBB 3DR9A 4UZVA 1BUWB 2HCOB 1J3ZB 1LFZA 3PMDA 1JBOA 1LFQB 1Y4RB 2BV8A 4FH6A 1MOAA 2AV0A 1CIKA 1EW6A 1SWMA 3LR7A 3UHVA 4ETVA 1NAZA 1BZRA 2BMMA 1CPCB 1URYA 2HBCB 1HLMA 1XZ2A 2R4YA 3HENA 103MA 4DC8A 1CH9A 4B3WA 1J41A 3O18A 1SDKB 3QQRA 1GH0A 2R80A 3G4QA 1HBHA 1CG8A 2ZLWA 3D17B 2MGJA 5HLXA 1YGFB 2GKMA 1MYTA 1FN3B 2GTLC 4O4ZA 1Y0WA 2VLYA 4A8KA 1YHRB 3UH5A 3UGYA 3UHKA 4AVEA 2HZ3A 1O1OA 1XZVB 2QLSA 3O7NA 2PEGB 5CN6A 4QAUA 1G08B 1DUKA 1SPEA 3OZUA 1Q1FA 3S66A 1HDSA 1HBGA 4XDIA 2UULB 1YGDB 1G0AB 2OH8A 1YHUB 2G10A 1CO8A 1J7SA 1JPBA 1Y7ZA 1XXTB 1VXBA 1Y83A 5JDOE 1MNKA 2R50A 4F6FA 1DXUB 1Y46B 1BABA 1MLMA 3HXNB 3NMLA 3KVSA 1SPGB 3EDBA 1UVKA 5JDOC 1JF3A 5FVBM 1N9XA 4F68A 2BK9A 1B0BA 1RQ3A 3L0FA 1S5XA 1MYGA 2UUNA 1C7DB 3PT8B 4AVDA 4SDHA 1THBA 3PI8A 1MLQA 2SPLA 1RVWA 1YIEB 1C40B 1LTWA 2X4AA 1YEOA 2HHEB 4NXAA 5HLUA 2EVPA 2O5BX 2D2NC 1HACA 1NS6B 1BZ1B 2GTLB 1I7YB 4ZIZA 1MTKA 3V58B 1CH3A 2MGDA 3QQQA 3QZZA 2G11A 1HI0P 2UULH 4ODCB 4F6JA 4U8UA 2HZ1A 3A5AA 4B02A 3OO4B 1HA7B 1S69A 2XKHA 1MLFA 5EV5A 1OJ6A 3OO4A 2CMMA 3HC9A 2V1IA 1XY0A 3BRPA 4N7NA 1PBXA 1MLLA 2DKCA 3BOMB 5EU2A 1K1KA 3IC0B 1Y2ZB 2ZSZA 2HBCA 2D2MC 3A5BA 3D7OB 2FALA 3GYSA 4LMSB 4MPMA 1FDHG 2UUNB 1YFFA 4A8MP 2QSPB 1A9WE 1WMUB 2VJHA 1XZUA 1UVLA 1A3OB 2QSSA 3V57A 2QMBA 3QM6A 3SDNA 2D6CA 2C7KA 1O1MB 3MYMA 4A8YA 2NRLA 1DLYA 3QM5A 5EE4C 1O16A 1RTEA 2ZT3A 1J3YB 1XDTT 2D5ZA 5FVBA 1MWDA 3UHSA 3VNCA 1GDJA 1O1IA 2W72A 2VMLA 1ABWA 4PO5A 3MJPA 1NEJA 1RH1A 1V4WA 3ODQB 2VEEA 1VXFA 3RQRA 1O1IB 5EYJA 4GY3B 3ONZB 3HXNA 3E4NA 1MLGA 1FAWA 4IROA 3K3UA 4MQHB 3D4XB 1JZKA 2SPOA 3UHDA 1HJTA 3ZJHA 1LH5A 2NRMA 3M3AA 1MKOA 1QPWA 1HHOA 2V1KA 1CQ2A 1A00A 2YSKA 5CMVA 1XZVA 3RJNB 1COHB 1YIHA 1CO9A 4HBIA 1YENB 1GCVB 1JL7A 3FH9B 2PGHB 3HRWA 3RGKA 3D17A 1CP0A 1JBOB 3WHMB 3VRFB 4HSWA 1MLSA 5B13A 3PI1A 2XKIA 1DTIA 1SHRA 3LR9A 3ZH0A 3KUOA 3O89A 1UVNA 3BJ3A 2IG3A 1Y8IA 2QFNA 1M6CA 3BRPB 1NZ2A 6HBIA 1DXVA 5EETA 1MBCA 1PHNB 1UIWB 4X0LA 1A3NA 3A0GB 2LH5A 1WVPA 1DXTB 1V4UB 3LB2A 1OBMA 1MYIA 2Z6TA 3WFWA 2UULD 1YH9B 2G14A 1F0LA 1LFLB 1WLAA 1H97A 1T1NB 4XXIA 5HU6A 2W6YA 2HCOA 1MNIA 1XCHA 1GBVB 5JGGB 1DTMA 4ILZA 1FAWB 4IROB 3E5IA 4MQHA 3RJ6A 3UHEA 2HHBB 2MGHA 4PO5B 1WACA 1A0UA 2HBDA 1V75A 3EU1A 1V4UA 2OLPA 3UHUA 1YEVA 1BZPA 5CNFA 1UX9A 2FRFA 2BLJM 1ECDA 1NWIA 1BZ6A 4H2LB 1Y2ZA 3NL7A 1J40A 2GTLD 1W92A 3FEWX 1BZ0A 2HBEA 2VJHB 2DXMA 1HGAA 1UVYA 1CIOA 4NI1A 1VXAA 3GQPB 4TMAB 2HHDA 1DXCA 3WCWA 1BZZA 4KJTA 3HRWB 1S5YA 2ZSYA 4YU3B 1YVTB 1Y85B 1Y45B 3BJ1B 4KMVA 2ZSQA 1A3NB 3WR1B
chains in the Genus database with same CATH topology
5F0BA 2W31A 2SPNA 1COHA 2OIFA 1OFKA 3ARLA 1S5YB 4MQCB 1OR4A 1Y4BA 1LA6A 2BWHA 1IBEA 1MKOB 1XYEA 2GRHA 1HBSB 1Y0TB 3SZKB 2R4ZA 1NIHA 2B7HA 1IBEB 3AQ6A 3DHRB 3WCPB 1R1YA 3PI8B 1Y0AA 1YDZA 3G4UA 3MOUA 1BIJB 5HY8B 3E5OA 1C7CB 2D2MD 1G0BA 1RQ3B 3S1JA 1HDBA 1TU9A 1J7YB 3D1KB 1THBB 1IDRA 1Y01B 2H35B 1BZ0B 2HBEB 1J7SB 1Y7ZB 3WCTC 1MYJA 3UHHA 1FLPA 3UHRA 3HHBB 1A3OA 2QSSB 4F4OA 1OUTB 2MGKA 5B85A 1YGFA 5HY8A 1Y8HB 3ZOMA 1HBAB 2D2MA 2W72B 1R1YB 1YHRA 2D5XB 2ZSNA 1J7WA 3QJDA 3BOMA 1O1PB 3A2GA 2G12A 3AT5B 3ZHWA 3PI4A 3UH6A 4WJG1 1GLIA 3WHMA 3M39A 1IWHB 1HABB 1XYEB 1UFJA 1UX8A 5E6EB 1XZUB 2MYDA 4MQGA 5D1VA 1M9PB 1Y4QA 2MYAA 1LFVB 1JZMA 1V5HA 1DM1A 1HBBB 3ECXA 1DXVB 4M4AA 3QMAA 3IC0A 3WFUA 1BZ1A 1Y45A 1MLUA 3B75B 4G51B 2MHBB 1O1NB 4MQJA 3PELA 2DN2B 3PI9A 1FSXA 3UHQA 1V4XB 5CN7A 2DC3A 1QXDA 3K9ZA 1J3FA 1MNHA 3D4XA 1BINA 1TESA 1GZXB 3PI2A 2PGHA 1DWTA 1KD2A 3E55A 1YMCA 2V1JA 1O1LA 1JZLA 2MGIA 1KR7A 5KERA 4FWXA 4U8UC 3EU1B 1JP6A 2GKNA 1QPWB 3WCWD 1F63A 1LJWB 2V1EA 2G3HA 3WI8A 4GZGA 2HHBA 1MLHA 2VYZA 2W6WA 4NI0A 1LHTA 1HGAB 1XZ5B 1GBVA 4C0NA 1K0YA 1G9VB 1CMYA 1ECNA 1Y0DB 4H2LA 1LFLA 3QJEA 1LH3A 1Y4PB 4UIQA 1CH2A 5ILMA 2ZS1C 3NFEB 4ESAA 4G1BA 3MKBB 4KN3A 1YE2B 3G4YA 1CG8B 2ZLWB 3ZJLA 1MBSA 1ABWB 1V75B 2R80B 4MQKA 1Y35A 1H1XA 3ZJPA 3BJ3B 3W4UA 1YG5B 1Y31B 1YDZB 1S0HA 3UHWA 2W6VA 2OHAA 1OFJA 2M6ZB 1XQ5B 2IN4A 1QI8A 107MA 1UMOA 1HBHB 4X0LB 2VYYA 1GCVA 1GBUA 1A01B 3PELB 4O2GA 1Y5KA 1A6MA 1S0HB 1YOGA 2O5SX 3QJBB 1JDOA 1Y8IB 1N9IA 3GQGA 2MYEA 5CNGA 1UFPA 2OHBA 4ZVAA 3PI3A 3OJ1A 1GDKA 2MGBA 2NSRA 2D2MB 1CG5B 2LH6A 3OZWA 1VREA 3ARKA 112MA 5CNEA 2MGAA 1HV4A 4F4OB 5CNCA 2LHBA 5AZQA 4NK1A 4O35A 108MA 3GDJA 4B4YA 4NI1B 1J3ZA 2V1HA 1Y22A 1A4FB 3S48C 1G9VA 3OO5A 1A9WA 2YRSA 5AZRA 2BKMA 1YE0B 1RQAB 2HHEA 1J7YA 1IOPA 1SI4B 3D1AA 3BA2A 3LB1A 3DUTB 2H8FB 3GQRA 3UBVA 3ZJNA 5E83A 1YE2A 1IRDA 3HEOA 4ESAB 1MBOA 104MA 3WFXA 5HLQA 5CN4A 4KMWA 3R5IB 1Y0WB 1Y7CA 3DHRA 1A6NA 3QZXA 1FSXB 3CIUB 1LUEA 1VHBA 1RQ4A 3LQDA 2H8DA 2O5LX 1MLOA 3GK9A 1Y4BB 1DWRA 3AQ8A 2BW9M 2VYWA 1YFFB 2ZSOA 4PNJA 106MA 1XZ2B 3ASEA 3VRFA 1A01A 3G4VA 3WR1A 3GKVA 1CH5A 4YU3A 1DO4A 2ZLVA 4MQGB 4N8TB 1MODA 4TYXA 3ZJRA 5HBIA 3G53A 1PMBA 3GYSB 3ZJMA 2AUQA 3ECZA 2ZS0C 4DC7A 1L2KA 2HBSB 1XZ4A 3VREB 3GOUA 2QU0B 1YEQA 4PQ6A 4F6IA 3LQDB 3S1IA 1VXEA 3PT7B 1URVA 4N7OB 3WCWB 1YEOB 2ZLVB 3S65A 1MWBA 1HHOB 1DO7A 1A0UB 2HBDB 1Y4PA 3DHTA 4FH7A 3WCUC 2GLNA 1Y46A 4IT8A 4PQCA 5CNDA 1Y4VA 5KDQA 1CMYB 1MGNA 5JGGA 1HACB 1NS6A 1Y8KB 3MVCA 1Y8WB 4ZVBA 4TWUA 5C6EA 4DWUA 1BBBA 3W4UB 3MN0A 4NI0B 3AT6B 2R4WA 3MJPB 5EQMA 1RVWB 1YIEA 1HDSB 1LJWA 1DXUA 1XZ7A 3S65B 1YOHA 1HBAA 2HBGA 1YOIA 1HDBB 2V1GA 3WCVC 1DXTA 3A59A 1Y8WA 3V2VA 4N7PA 2ZS1D 3ARJA 1AJGA 3LHBA 1Y7DB 2R1HB 105MA 3HHBA 4MBNA 4O4TA 1ABSA 1DWSA 3QJEB 2VLXA 4FC3B 2QU0A 2KSCA 2WTHA 3MJUA 1K0YB 4F69A 1SHRB 3FS4B 2LH1A 1RSEA 1LH6A 2ZLUA 1CLSA 1I3EA 1YGDA 3A0GA 4ROLB 3DUTA 1MLRA 2D2ND 5M3SA 1QSIA 3V2ZA 4N8TA 1LFYB 3OGBA 5CN9A 2MB5A 1O1LB 1YIHB 1F5PA 1X9FA 2WTGA 1NGKA 7HBIA 2MGFA 1FCSA 1HV4B 1G09A 1O1KA 1QXEA 1X3KA 1Y5KB 2HHDB 1QSIB 1CG5A 1EWAA 1OUUB 2LH2A 2ZLTB 3EOKA 4WJGA 3SZKA 1HGCA 1MTJA 3IXFA 5C6YA 3WCVB 4G51A 1G09B 1O1KB 4FWZA 2DHBA 2MGEA 1X9FC 1YEUA 1MYFA 1A00B 1M6MA 1YVQA 2Z6SA 1S56A 3BCQB 3LB4A 3CY5B 1C7BB 4HRRA 3TLDA 2GNWA 3BJ2A 101MA 1NS9A 3LB3A 2D5ZB 1SPGA 1NQPA 1RQAA 1QSHB 1CLSB 5C6EB 109MA 2V1FA 1S61A 1Y31A 2FRIX 2DN3A 1V4WB 2ZWJA 4MXLA 3ZJSA 4VHBA 1R1XB 1DKEB 1SI4A 3D1AB 1Y83B 1AZIA 1IRDB 1NZ5A 2EKTA 1IT3A 3HF4A 5KKKA 4HRRB 2QLSB 1RPSB 1NPGA 1UIWA 1Y22B 2Z6NA 3QM9A 2ZT2A 1YVQB 5B84A 1PBXB 3GQGB 3TM9A 2B7HB 1AJHA 1MYHA 3VRGA 1MBNA 2GNVA 1LHSA 2FRJX 3HYUB 1FN3A 1Z8UB 1J41B 1B86A 1D8UA 4O1TA 1V4XA 4N7NB 2RAOA 2XYKA 2ZLXB 1Y0CB 2FAMA 3GKTA 1HBRA 1Y4FB 3WCUD 3NG6A 1GBUB 3ZJIA 2HZ2A 3MYNA 4XS0B 2NSSA 2ZSTA 1YEUB 1YHEA 1MTIA 1BZZB 3UHCA 1O1JB 1CBLA 1BVCA 1UT0A 3HEPA 2RAOB 1Y5JA 3MBAA 5IKSA 3R0GA 2GRFA 1QI8B 1HCOA 6HBWA 1IRCA 1LFQA 1Y4RA 1UVXA 2VRYA 2ZFOA 4DWTA 2GTLA 3BJ1A 2ZS1A 1NZ3A 1M9PA 1Y4QB 4PQBA 1MNOA 1Y35B 3NFEA 2H8FA 1A0ZA 2Z85A 1DLWA 1R1XA 1Y09B 1SDLA 1GLIB 4UURA 3HF4B 3K8BA 1MBAA 2ZS1B 3FS4A 1GDIA 1LFTA 3M3BA 2QFKA 4MU5A 1J40B 4FC3A 1QSHA 1AJ9A 4L7YB 4C44A 1A0ZB 1ABYB 1GCWA 2ZSXA 1CPWA 3A59B 4NXCA 1JY7B 2D2NB 1NS9B 1MWCA 1JP8A 3UHNA 2FRKX 1O1NA 4MQJB 2MGLA 1Y7GB 3QJBA 1CH7A 4M4AB 2GDMA 1NQPB 2RI4B 1HGCB 3DHTB 1KD2B 1LFVA 3BJ2B 4JACA 5D5RA 3UHBA 3G46A 2MHBA 1DUOA 1OR6A 1C7CA 1EBTA 1C7BA 1DXDA 3VRGB 3FH9A 1Y0AB 2ZSPA 3WCVD 1HBBA 3PIAA 1GVHA 2MGCA 1YEQB 1JF4A 2ZLXA 2MYBA 4MQCA 1ECAA 3VREA 4MBAA 2MGGA 1C40A 3WCVA 3NG6B 1JP9A 3UHGA 1JEBA 3EDAA 1MCYA 1S6AA 1MYMA 3IC2B 1LA6B 1O1PA 3AG0A 2RI4A 1LFZB 1X46A 2Z6NB 1VXHA 4N7PB 1BUWA 5MBNA 3MJUB 1MNJA 1YG5A 5CHQA 1OUTA 1SDLB 2GRZA 1YZIB 1EBCA 1RPSA 3ED9A 1G0BB 2ZLUB 1YEVB 3ZJJA 4ROMB 3M38A 2O58X 1A4FA 1FHJB 1O1OB 2ZSRA 2ZFOB 1O1MA 5F2AA 1Y0DA 1YH9A 1VXGA 2QMBB 3AQ5A 1HBIA 1CH1A 4ROMA 3IC2A 3ZOLA 4F6DA 1RTXA 1U7RA 1Y4VB 1Y5JB 1NIHB 1HBSA 1Y0TA 1OUUA 3EOKB 111MA 2MYCA 2AA1B 4M4BB 102MA 2BLIA 4HRTB 1G08A 4N7OA 1GJNA 1DO3A 5EE4D 1V07A 3QM7A 4MAXA 4BJAA 1XZ4B 1JW8A 3WCUB 1Y4FA 2BNLA 2C0KA 2ZS0B 4G1VA 2WY4A 1HCOB 2LH3A 2AURA 4MQIB 1IT2A 1EMYA 1NXFA 1X9FB 2ZS0A 1MBIA 2EF2A 3P5QB 1LH1A 3G52A 2AV3A 5EOHA 1QXEB 1I3DA 4FWYA 1HRMA 1VWTB 3KMFA 3PIAB 2HBFA 1XY0B 1HBRB 2H8DB 1FSLA 3P5QA 4TWVA 3GQPA 4ROLA 1YVTA 1S5XB 3MKBA 4WCHD 3NL7B 4YU4A 1AJ9B 4L7YA 3OK5A 3GKVB 1RQ4B 4U8UD 2ZSSA 3VAUA 1MYZA 3KUNA 2ZT4A 5HU6B 1J7WB 3GQRB 4HRTA 1MLJA 5ILRA 3IA3B 3OZVA 1MOCA 1CQXA 2OH9A 1NZ4A 2BLHA 3CIUA 4NK2A 3ZJOA 2O5QX 3H58A 2VM0A 3CY5A 1MLNA 2E2YA 3G4WA 2ZFBB 3AQ7A 3UI0A 1MBDA 1Y4GB 5E29B 4YU4B 3AT6A 1BABB 1BJEA 2DN3B 2NX0A 1LH7A 3UHIA 1G0AA 1T1NA 1JWNA 3U3EA 3D1KA 3GDJB 3S66B 3UH3A 3A5GA 2G0XA 1U7SA 3WCTD 4F6BA 1K1KB 1YE0A 3GOUB 1BIJA 1HDAA 4XS0A 2AUOA 3D7OA 3OVUC 1CP5A 2R4XA 2HBFB 1Y5FA 1HDAB 1MOBA 2G0ZA 1GZXA 4MXKA 3WCPA 2LH7A 3TM3A 1QXDB 3ZJQA 2O5OX 4H0BA 1JEBB 3H57A 1VRFA 2DN2A 1YENA 3PI9B 2ZT0A 4MQIA 1VXCA 1SDKA 1DO1A 1MDNA 1JL6A 2DXMB 1O1JA 5CNBA 1MZ0A 1F5OA 2D5XA 2XKGA 1CH4A 1ECOA 4H07A 2R1HA 1GDLA 1JY7A 1Y85A 1Y7GA 3UGZA 1GCWB 2ZFOC 1XQ5A 2EVKA 1Y7CB 2VEBA 3WFTA 3UH7A 1XZ7B 3R5IA 1DKEA 4ODCA 5CN8A 1BBBB 5CN5A 3KMFC 1FHJA 2ZFOD 2G0SA 5E83B 1YCAA 5E29A 1Y4GA 1Y09A 1YZIA 2SPMA 2D60B 5EYSA 2D2NA 1LFTB 3ODQA 2QSPA 1Y8HA 1NWNA 2JHOA 2PEGA 3PT7A 1ABYA 5JDOD 2EB8A 1NEJB 1YHUD 2MBWA 4OF9A 3SDHA 5JDOF 5HAVA 1A6KA 5KERB 2Z8AA 2MGMA 3QJCB 3WTGB 3OO5B 3QM8A 5KDQB 3K8BB 2ZS0D 2VLZA 5MBAA 2O5MX 2G0RA 5ILPA 6HBWB 5SW7B 4OODA 3B75A 4HHBA 1X9FD 2W72C 1Y5FB 3BCQA 1YHUC 3UHTA 1VWTA 1YHEB 1LFYA 1YCBA 2HBSA 3HYUA 2AA1A 4M4BA 5ILEA 3WCWC 1BVDA 2ZLTA 2W6VB 1Y0CA 1C7DA 3PT8A 3UHXA 3WCUA 2QRWA 1V9QA 3QJCA 3WTGA 2M6ZA 3ECLA 3QJDB 2O5TX 5JOMA 4U8UB 1IWHA 1HABA 4MQKB 4L2MA 1HLBA 2DN1B 1YMBA 1YMAA 2ZT1A 1KFRA 2VHBA 1XZ5A 5EUIA 1B86B 1VXDA 4LPIA 4HHBB 3ORDA 2W6XA 5CHRA 5E6EA 3UHYA 3A9MA 5SW7A 2D60A 1N9FA 2GL3A 1MLKA 1NPFA 3NMMA 2EKUA 4HSXA 1HGBA 2G0VA 1J3YA 2YRSB 1F65A 1ITHA 1Y8KA 110MA 1A6GA 3AT5A 2H35A 4NZIA 1ASHA 1LH2A 1MOHA 1YHUA 3GLNA 2EB9A 3ONZA 1J52A 3NMMB 4F6GA 3WCTA 4JYQA 1Y7DA 2ZFBA 1WMUA 3AQ9A 1XXTA 2AUPA 1CBMA 1HSYA 3UHZA 3VHBA 4NS2A 5AB8A 5EUIB 1HGBB 1UC3A 1N9HA 3UBCA 3WCTB 2DN1A 1FDHA 3G4RA 2DHBB 3DR9A 4UZVA 1BUWB 2HCOB 1J3ZB 1LFZA 1LFQB 1Y4RB 4FH6A 1MOAA 2AV0A 1CIKA 1EW6A 1SWMA 3LR7A 3UHVA 1NAZA 1BZRA 2BMMA 1URYA 2HBCB 1HLMA 1XZ2A 2R4YA 3HENA 103MA 4DC8A 1CH9A 4B3WA 1J41A 1SDKB 3QQRA 2R80A 3G4QA 1HBHA 1CG8A 2ZLWA 3D17B 2MGJA 5HLXA 1YGFB 2GKMA 1MYTA 1FN3B 2GTLC 4O4ZA 1Y0WA 2VLYA 1YHRB 3UH5A 3UGYA 3UHKA 4AVEA 2HZ3A 1O1OA 1XZVB 2QLSA 3O7NA 2PEGB 5CN6A 4QAUA 1G08B 1DUKA 1SPEA 3OZUA 1Q1FA 3S66A 1HDSA 1HBGA 4XDIA 1YGDB 1G0AB 2OH8A 1YHUB 2G10A 1CO8A 1J7SA 1JPBA 1Y7ZA 1XXTB 1VXBA 1Y83A 5JDOE 1MNKA 2R50A 4F6FA 1DXUB 1Y46B 1BABA 1MLMA 3HXNB 3NMLA 1SPGB 3EDBA 5JDOC 1JF3A 1N9XA 4F68A 2BK9A 1B0BA 1RQ3A 1S5XA 1MYGA 1C7DB 3PT8B 4AVDA 4SDHA 1THBA 3PI8A 1MLQA 2SPLA 1RVWA 1YIEB 1C40B 1LTWA 1YEOA 2HHEB 4NXAA 5HLUA 2EVPA 2O5BX 2D2NC 1HACA 1NS6B 1BZ1B 2GTLB 1MTKA 1CH3A 2MGDA 3QQQA 3QZZA 2G11A 4ODCB 4F6JA 4U8UA 2HZ1A 3A5AA 3OO4B 1S69A 2XKHA 1MLFA 5EV5A 1OJ6A 3OO4A 2CMMA 3HC9A 2V1IA 1XY0A 4N7NA 1PBXA 1MLLA 3BOMB 5EU2A 1K1KA 3IC0B 1Y2ZB 2ZSZA 2HBCA 2D2MC 3A5BA 3D7OB 2FALA 3GYSA 4MPMA 1FDHG 1YFFA 2QSPB 1A9WE 1WMUB 1XZUA 1A3OB 2QSSA 2QMBA 3QM6A 3SDNA 2D6CA 1O1MB 3MYMA 2NRLA 1DLYA 3QM5A 5EE4C 1O16A 1RTEA 2ZT3A 1J3YB 2D5ZA 1MWDA 3UHSA 1GDJA 1O1IA 2W72A 1ABWA 3MJPA 1NEJA 1V4WA 3ODQB 2VEEA 1VXFA 1O1IB 5EYJA 3ONZB 3HXNA 3E4NA 1MLGA 1FAWA 4IROA 3K3UA 4MQHB 3D4XB 1JZKA 2SPOA 3UHDA 1HJTA 3ZJHA 1LH5A 2NRMA 3M3AA 1MKOA 1QPWA 1HHOA 2V1KA 1CQ2A 1A00A 5CMVA 1XZVA 3RJNB 1COHB 1YIHA 1CO9A 4HBIA 1YENB 1GCVB 1JL7A 3FH9B 2PGHB 3HRWA 3RGKA 3D17A 1CP0A 3WHMB 3VRFB 4HSWA 1MLSA 3PI1A 2XKIA 1DTIA 1SHRA 3LR9A 3ZH0A 3KUOA 3O89A 3BJ3A 2IG3A 1Y8IA 2QFNA 1M6CA 1NZ2A 6HBIA 1DXVA 5EETA 1MBCA 1UIWB 4X0LA 1A3NA 3A0GB 2LH5A 1WVPA 1DXTB 1V4UB 3LB2A 1OBMA 1MYIA 2Z6TA 3WFWA 1YH9B 2G14A 1LFLB 1WLAA 1H97A 1T1NB 5HU6A 2W6YA 2HCOA 1MNIA 1XCHA 1GBVB 5JGGB 1DTMA 4ILZA 1FAWB 4IROB 3E5IA 4MQHA 3RJ6A 3UHEA 2HHBB 2MGHA 1A0UA 2HBDA 1V75A 3EU1A 1V4UA 2OLPA 3UHUA 1YEVA 1BZPA 5CNFA 1UX9A 2FRFA 2BLJM 1ECDA 1NWIA 1BZ6A 4H2LB 1Y2ZA 3NL7A 1J40A 2GTLD 1W92A 1BZ0A 2HBEA 2DXMA 1HGAA 1UVYA 1CIOA 4NI1A 1VXAA 3GQPB 2HHDA 1DXCA 3WCWA 1BZZA 4KJTA 3HRWB 1S5YA 2ZSYA 4YU3B 1YVTB 1Y85B 1Y45B 3BJ1B 4KMVA 2ZSQA 1A3NB 3WR1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F0B A;  2W31 A;  2SPN A;  1COH A;  2OIF A;  1OFK A;  3ARL A;  1S5Y B;  4MQC B;  1OR4 A;  1Y4B A;  1LA6 A;  2BWH A;  1IBE A;  1MKO B;  1XYE A;  2GRH A;  1HBS B;  1Y0T B;  3SZK B;  2R4Z A;  1NIH A;  2B7H A;  1IBE B;  3AQ6 A;  3DHR B;  3WCP B;  1R1Y A;  3PI8 B;  1Y0A A;  1YDZ A;  3G4U A;  3MOU A;  1BIJ B;  5HY8 B;  3E5O A;  1C7C B;  2D2M D;  1G0B A;  1RQ3 B;  3S1J A;  1HDB A;  1TU9 A;  1J7Y B;  3D1K B;  1THB B;  1IDR A;  1Y01 B;  2H35 B;  1BZ0 B;  2HBE B;  1J7S B;  1Y7Z B;  3WCT C;  1MYJ A;  3UHH A;  1FLP A;  3UHR A;  3HHB B;  1A3O A;  2QSS B;  4F4O A;  1OUT B;  2MGK A;  5B85 A;  1YGF A;  5HY8 A;  1Y8H B;  3ZOM A;  1HBA B;  2D2M A;  2W72 B;  1R1Y B;  1YHR A;  2D5X B;  2ZSN A;  1J7W A;  3QJD A;  3BOM A;  1O1P B;  3A2G A;  2G12 A;  3AT5 B;  3ZHW A;  3PI4 A;  3UH6 A;  4WJG 1;  1GLI A;  3WHM A;  3M39 A;  1IWH B;  1HAB B;  1XYE B;  1UFJ A;  1UX8 A;  5E6E B;  1XZU B;  2MYD A;  4MQG A;  5D1V A;  1M9P B;  1Y4Q A;  2MYA A;  1LFV B;  1JZM A;  1V5H A;  1DM1 A;  1HBB B;  3ECX A;  1DXV B;  4M4A A;  3QMA A;  3IC0 A;  3WFU A;  1BZ1 A;  1Y45 A;  1MLU A;  3B75 B;  4G51 B;  2MHB B;  1O1N B;  4MQJ A;  3PEL A;  2DN2 B;  3PI9 A;  1FSX A;  3UHQ A;  1V4X B;  5CN7 A;  2DC3 A;  1QXD A;  3K9Z A;  1J3F A;  1MNH A;  3D4X A;  1BIN A;  1TES A;  1GZX B;  3PI2 A;  2PGH A;  1DWT A;  1KD2 A;  3E55 A;  1YMC A;  2V1J A;  1O1L A;  1JZL A;  2MGI A;  1KR7 A;  5KER A;  4FWX A;  4U8U C;  3EU1 B;  1JP6 A;  2GKN A;  1QPW B;  3WCW D;  1F63 A;  1LJW B;  2V1E A;  2G3H A;  3WI8 A;  4GZG A;  2HHB A;  1MLH A;  2VYZ A;  2W6W A;  4NI0 A;  1LHT A;  1HGA B;  1XZ5 B;  1GBV A;  4C0N A;  1K0Y A;  1G9V B;  1CMY A;  1ECN A;  1Y0D B;  4H2L A;  1LFL A;  3QJE A;  1LH3 A;  1Y4P B;  4UIQ A;  1CH2 A;  5ILM A;  2ZS1 C;  3NFE B;  4ESA A;  4G1B A;  3MKB B;  4KN3 A;  1YE2 B;  3G4Y A;  1CG8 B;  2ZLW B;  3ZJL A;  1MBS A;  1ABW B;  1V75 B;  2R80 B;  4MQK A;  1Y35 A;  1H1X A;  3ZJP A;  3BJ3 B;  3W4U A;  1YG5 B;  1Y31 B;  1YDZ B;  1S0H A;  3UHW A;  2W6V A;  2OHA A;  1OFJ A;  2M6Z B;  1XQ5 B;  2IN4 A;  1QI8 A;  107M A;  1UMO A;  1HBH B;  4X0L B;  2VYY A;  1GCV A;  1GBU A;  1A01 B;  3PEL B;  4O2G A;  1Y5K A;  1A6M A;  1S0H B;  1YOG A;  2O5S X;  3QJB B;  1JDO A;  1Y8I B;  1N9I A;  3GQG A;  2MYE A;  5CNG A;  1UFP A;  2OHB A;  4ZVA A;  3PI3 A;  3OJ1 A;  1GDK A;  2MGB A;  2NSR A;  2D2M B;  1CG5 B;  2LH6 A;  3OZW A;  1VRE A;  3ARK A;  112M A;  5CNE A;  2MGA A;  1HV4 A;  4F4O B;  5CNC A;  2LHB A;  5AZQ A;  4NK1 A;  4O35 A;  108M A;  3GDJ A;  4B4Y A;  4NI1 B;  1J3Z A;  2V1H A;  1Y22 A;  1A4F B;  3S48 C;  1G9V A;  3OO5 A;  1A9W A;  2YRS A;  5AZR A;  2BKM A;  1YE0 B;  1RQA B;  2HHE A;  1J7Y A;  1IOP A;  1SI4 B;  3D1A A;  3BA2 A;  3LB1 A;  3DUT B;  2H8F B;  3GQR A;  3UBV A;  3ZJN A;  5E83 A;  1YE2 A;  1IRD A;  3HEO A;  4ESA B;  1MBO A;  104M A;  3WFX A;  5HLQ A;  5CN4 A;  4KMW A;  3R5I B;  1Y0W B;  1Y7C A;  3DHR A;  1A6N A;  3QZX A;  1FSX B;  3CIU B;  1LUE A;  1VHB A;  1RQ4 A;  3LQD A;  2H8D A;  2O5L X;  1MLO A;  3GK9 A;  1Y4B B;  1DWR A;  3AQ8 A;  2BW9 M;  2VYW A;  1YFF B;  2ZSO A;  4PNJ A;  106M A;  1XZ2 B;  3ASE A;  3VRF A;  1A01 A;  3G4V A;  3WR1 A;  3GKV A;  1CH5 A;  4YU3 A;  1DO4 A;  2ZLV A;  4MQG B;  4N8T B;  1MOD A;  4TYX A;  3ZJR A;  5HBI A;  3G53 A;  1PMB A;  3GYS B;  3ZJM A;  2AUQ A;  3ECZ A;  2ZS0 C;  4DC7 A;  1L2K A;  2HBS B;  1XZ4 A;  3VRE B;  3GOU A;  2QU0 B;  1YEQ A;  4PQ6 A;  4F6I A;  3LQD B;  3S1I A;  1VXE A;  3PT7 B;  1URV A;  4N7O B;  3WCW B;  1YEO B;  2ZLV B;  3S65 A;  1MWB A;  1HHO B;  1DO7 A;  1A0U B;  2HBD B;  1Y4P A;  3DHT A;  4FH7 A;  3WCU C;  2GLN A;  1Y46 A;  4IT8 A;  4PQC A;  5CND A;  1Y4V A;  5KDQ A;  1CMY B;  1MGN A;  5JGG A;  1HAC B;  1NS6 A;  1Y8K B;  3MVC A;  1Y8W B;  4ZVB A;  4TWU A;  5C6E A;  4DWU A;  1BBB A;  3W4U B;  3MN0 A;  4NI0 B;  3AT6 B;  2R4W A;  3MJP B;  5EQM A;  1RVW B;  1YIE A;  1HDS B;  1LJW A;  1DXU A;  1XZ7 A;  3S65 B;  1YOH A;  1HBA A;  2HBG A;  1YOI A;  1HDB B;  2V1G A;  3WCV C;  1DXT A;  3A59 A;  1Y8W A;  3V2V A;  4N7P A;  2ZS1 D;  3ARJ A;  1AJG A;  3LHB A;  1Y7D B;  2R1H B;  105M A;  3HHB A;  4MBN A;  4O4T A;  1ABS A;  1DWS A;  3QJE B;  2VLX A;  4FC3 B;  2QU0 A;  2KSC A;  2WTH A;  3MJU A;  1K0Y B;  4F69 A;  1SHR B;  3FS4 B;  2LH1 A;  1RSE A;  1LH6 A;  2ZLU A;  1CLS A;  1I3E A;  1YGD A;  3A0G A;  4ROL B;  3DUT A;  1MLR A;  2D2N D;  5M3S A;  1QSI A;  3V2Z A;  4N8T A;  1LFY B;  3OGB A;  5CN9 A;  2MB5 A;  1O1L B;  1YIH B;  1F5P A;  1X9F A;  2WTG A;  1NGK A;  7HBI A;  2MGF A;  1FCS A;  1HV4 B;  1G09 A;  1O1K A;  1QXE A;  1X3K A;  1Y5K B;  2HHD B;  1QSI B;  1CG5 A;  1EWA A;  1OUU B;  2LH2 A;  2ZLT B;  3EOK A;  4WJG A;  3SZK A;  1HGC A;  1MTJ A;  3IXF A;  5C6Y A;  3WCV B;  4G51 A;  1G09 B;  1O1K B;  4FWZ A;  2DHB A;  2MGE A;  1X9F C;  1YEU A;  1MYF A;  1A00 B;  1M6M A;  1YVQ A;  2Z6S A;  1S56 A;  3BCQ B;  3LB4 A;  3CY5 B;  1C7B B;  4HRR A;  3TLD A;  2GNW A;  3BJ2 A;  101M A;  1NS9 A;  3LB3 A;  2D5Z B;  1SPG A;  1NQP A;  1RQA A;  1QSH B;  1CLS B;  5C6E B;  109M A;  2V1F A;  1S61 A;  1Y31 A;  2FRI X;  2DN3 A;  1V4W B;  2ZWJ A;  4MXL A;  3ZJS A;  4VHB A;  1R1X B;  1DKE B;  1SI4 A;  3D1A B;  1Y83 B;  1AZI A;  1IRD B;  1NZ5 A;  2EKT A;  1IT3 A;  3HF4 A;  5KKK A;  4HRR B;  2QLS B;  1RPS B;  1NPG A;  1UIW A;  1Y22 B;  2Z6N A;  3QM9 A;  2ZT2 A;  1YVQ B;  5B84 A;  1PBX B;  3GQG B;  3TM9 A;  2B7H B;  1AJH A;  1MYH A;  3VRG A;  1MBN A;  2GNV A;  1LHS A;  2FRJ X;  3HYU B;  1FN3 A;  1Z8U B;  1J41 B;  1B86 A;  1D8U A;  4O1T A;  1V4X A;  4N7N B;  2RAO A;  2XYK A;  2ZLX B;  1Y0C B;  2FAM A;  3GKT A;  1HBR A;  1Y4F B;  3WCU D;  3NG6 A;  1GBU B;  3ZJI A;  2HZ2 A;  3MYN A;  4XS0 B;  2NSS A;  2ZST A;  1YEU B;  1YHE A;  1MTI A;  1BZZ B;  3UHC A;  1O1J B;  1CBL A;  1BVC A;  1UT0 A;  3HEP A;  2RAO B;  1Y5J A;  3MBA A;  5IKS A;  3R0G A;  2GRF A;  1QI8 B;  1HCO A;  6HBW A;  1IRC A;  1LFQ A;  1Y4R A;  1UVX A;  2VRY A;  2ZFO A;  4DWT A;  2GTL A;  3BJ1 A;  2ZS1 A;  1NZ3 A;  1M9P A;  1Y4Q B;  4PQB A;  1MNO A;  1Y35 B;  3NFE A;  2H8F A;  1A0Z A;  2Z85 A;  1DLW A;  1R1X A;  1Y09 B;  1SDL A;  1GLI B;  4UUR A;  3HF4 B;  3K8B A;  1MBA A;  2ZS1 B;  3FS4 A;  1GDI A;  1LFT A;  3M3B A;  2QFK A;  4MU5 A;  1J40 B;  4FC3 A;  1QSH A;  1AJ9 A;  4L7Y B;  4C44 A;  1A0Z B;  1ABY B;  1GCW A;  2ZSX A;  1CPW A;  3A59 B;  4NXC A;  1JY7 B;  2D2N B;  1NS9 B;  1MWC A;  1JP8 A;  3UHN A;  2FRK X;  1O1N A;  4MQJ B;  2MGL A;  1Y7G B;  3QJB A;  1CH7 A;  4M4A B;  2GDM A;  1NQP B;  2RI4 B;  1HGC B;  3DHT B;  1KD2 B;  1LFV A;  3BJ2 B;  4JAC A;  5D5R A;  3UHB A;  3G46 A;  2MHB A;  1DUO A;  1OR6 A;  1C7C A;  1EBT A;  1C7B A;  1DXD A;  3VRG B;  3FH9 A;  1Y0A B;  2ZSP A;  3WCV D;  1HBB A;  3PIA A;  1GVH A;  2MGC A;  1YEQ B;  1JF4 A;  2ZLX A;  2MYB A;  4MQC A;  1ECA A;  3VRE A;  4MBA A;  2MGG A;  1C40 A;  3WCV A;  3NG6 B;  1JP9 A;  3UHG A;  1JEB A;  3EDA A;  1MCY A;  1S6A A;  1MYM A;  3IC2 B;  1LA6 B;  1O1P A;  3AG0 A;  2RI4 A;  1LFZ B;  1X46 A;  2Z6N B;  1VXH A;  4N7P B;  1BUW A;  5MBN A;  3MJU B;  1MNJ A;  1YG5 A;  5CHQ A;  1OUT A;  1SDL B;  2GRZ A;  1YZI B;  1EBC A;  1RPS A;  3ED9 A;  1G0B B;  2ZLU B;  1YEV B;  3ZJJ A;  4ROM B;  3M38 A;  2O58 X;  1A4F A;  1FHJ B;  1O1O B;  2ZSR A;  2ZFO B;  1O1M A;  5F2A A;  1Y0D A;  1YH9 A;  1VXG A;  2QMB B;  3AQ5 A;  1HBI A;  1CH1 A;  4ROM A;  3IC2 A;  3ZOL A;  4F6D A;  1RTX A;  1U7R A;  1Y4V B;  1Y5J B;  1NIH B;  1HBS A;  1Y0T A;  1OUU A;  3EOK B;  111M A;  2MYC A;  2AA1 B;  4M4B B;  102M A;  2BLI A;  4HRT B;  1G08 A;  4N7O A;  1GJN A;  1DO3 A;  5EE4 D;  1V07 A;  3QM7 A;  4MAX A;  4BJA A;  1XZ4 B;  1JW8 A;  3WCU B;  1Y4F A;  2BNL A;  2C0K A;  2ZS0 B;  4G1V A;  2WY4 A;  1HCO B;  2LH3 A;  2AUR A;  4MQI B;  1IT2 A;  1EMY A;  1NXF A;  1X9F B;  2ZS0 A;  1MBI A;  2EF2 A;  3P5Q B;  1LH1 A;  3G52 A;  2AV3 A;  5EOH A;  1QXE B;  1I3D A;  4FWY A;  1HRM A;  1VWT B;  3KMF A;  3PIA B;  2HBF A;  1XY0 B;  1HBR B;  2H8D B;  1FSL A;  3P5Q A;  4TWV A;  3GQP A;  4ROL A;  1YVT A;  1S5X B;  3MKB A;  4WCH D;  3NL7 B;  4YU4 A;  1AJ9 B;  4L7Y A;  3OK5 A;  3GKV B;  1RQ4 B;  4U8U D;  2ZSS A;  3VAU A;  1MYZ A;  3KUN A;  2ZT4 A;  5HU6 B;  1J7W B;  3GQR B;  4HRT A;  1MLJ A;  5ILR A;  3IA3 B;  3OZV A;  1MOC A;  1CQX A;  2OH9 A;  1NZ4 A;  2BLH A;  3CIU A;  4NK2 A;  3ZJO A;  2O5Q X;  3H58 A;  2VM0 A;  3CY5 A;  1MLN A;  2E2Y A;  3G4W A;  2ZFB B;  3AQ7 A;  3UI0 A;  1MBD A;  1Y4G B;  5E29 B;  4YU4 B;  3AT6 A;  1BAB B;  1BJE A;  2DN3 B;  2NX0 A;  1LH7 A;  3UHI A;  1G0A A;  1T1N A;  1JWN A;  3U3E A;  3D1K A;  3GDJ B;  3S66 B;  3UH3 A;  3A5G A;  2G0X A;  1U7S A;  3WCT D;  4F6B A;  1K1K B;  1YE0 A;  3GOU B;  1BIJ A;  1HDA A;  4XS0 A;  2AUO A;  3D7O A;  3OVU C;  1CP5 A;  2R4X A;  2HBF B;  1Y5F A;  1HDA B;  1MOB A;  2G0Z A;  1GZX A;  4MXK A;  3WCP A;  2LH7 A;  3TM3 A;  1QXD B;  3ZJQ A;  2O5O X;  4H0B A;  1JEB B;  3H57 A;  1VRF A;  2DN2 A;  1YEN A;  3PI9 B;  2ZT0 A;  4MQI A;  1VXC A;  1SDK A;  1DO1 A;  1MDN A;  1JL6 A;  2DXM B;  1O1J A;  5CNB A;  1MZ0 A;  1F5O A;  2D5X A;  2XKG A;  1CH4 A;  1ECO A;  4H07 A;  2R1H A;  1GDL A;  1JY7 A;  1Y85 A;  1Y7G A;  3UGZ A;  1GCW B;  2ZFO C;  1XQ5 A;  2EVK A;  1Y7C B;  2VEB A;  3WFT A;  3UH7 A;  1XZ7 B;  3R5I A;  1DKE A;  4ODC A;  5CN8 A;  1BBB B;  5CN5 A;  3KMF C;  1FHJ A;  2ZFO D;  2G0S A;  5E83 B;  1YCA A;  5E29 A;  1Y4G A;  1Y09 A;  1YZI A;  2SPM A;  2D60 B;  5EYS A;  2D2N A;  1LFT B;  3ODQ A;  2QSP A;  1Y8H A;  1NWN A;  2JHO A;  2PEG A;  3PT7 A;  1ABY A;  5JDO D;  2EB8 A;  1NEJ B;  1YHU D;  2MBW A;  4OF9 A;  3SDH A;  5JDO F;  5HAV A;  1A6K A;  5KER B;  2Z8A A;  2MGM A;  3QJC B;  3WTG B;  3OO5 B;  3QM8 A;  5KDQ B;  3K8B B;  2ZS0 D;  2VLZ A;  5MBA A;  2O5M X;  2G0R A;  5ILP A;  6HBW B;  5SW7 B;  4OOD A;  3B75 A;  4HHB A;  1X9F D;  2W72 C;  1Y5F B;  3BCQ A;  1YHU C;  3UHT A;  1VWT A;  1YHE B;  1LFY A;  1YCB A;  2HBS A;  3HYU A;  2AA1 A;  4M4B A;  5ILE A;  3WCW C;  1BVD A;  2ZLT A;  2W6V B;  1Y0C A;  1C7D A;  3PT8 A;  3UHX A;  3WCU A;  2QRW A;  1V9Q A;  3QJC A;  3WTG A;  2M6Z A;  3ECL A;  3QJD B;  2O5T X;  5JOM A;  4U8U B;  1IWH A;  1HAB A;  4MQK B;  4L2M A;  1HLB A;  2DN1 B;  1YMB A;  1YMA A;  2ZT1 A;  1KFR A;  2VHB A;  1XZ5 A;  5EUI A;  1B86 B;  1VXD A;  4LPI A;  4HHB B;  3ORD A;  2W6X A;  5CHR A;  5E6E A;  3UHY A;  3A9M A;  5SW7 A;  2D60 A;  1N9F A;  2GL3 A;  1MLK A;  1NPF A;  3NMM A;  2EKU A;  4HSX A;  1HGB A;  2G0V A;  1J3Y A;  2YRS B;  1F65 A;  1ITH A;  1Y8K A;  110M A;  1A6G A;  3AT5 A;  2H35 A;  4NZI A;  1ASH A;  1LH2 A;  1MOH A;  1YHU A;  3GLN A;  2EB9 A;  3ONZ A;  1J52 A;  3NMM B;  4F6G A;  3WCT A;  4JYQ A;  1Y7D A;  2ZFB A;  1WMU A;  3AQ9 A;  1XXT A;  2AUP A;  1CBM A;  1HSY A;  3UHZ A;  3VHB A;  4NS2 A;  5AB8 A;  5EUI B;  1HGB B;  1UC3 A;  1N9H A;  3UBC A;  3WCT B;  2DN1 A;  1FDH A;  3G4R A;  2DHB B;  3DR9 A;  4UZV A;  1BUW B;  2HCO B;  1J3Z B;  1LFZ A;  1LFQ B;  1Y4R B;  4FH6 A;  1MOA A;  2AV0 A;  1CIK A;  1EW6 A;  1SWM A;  3LR7 A;  3UHV A;  1NAZ A;  1BZR A;  2BMM A;  1URY A;  2HBC B;  1HLM A;  1XZ2 A;  2R4Y A;  3HEN A;  103M A;  4DC8 A;  1CH9 A;  4B3W A;  1J41 A;  1SDK B;  3QQR A;  2R80 A;  3G4Q A;  1HBH A;  1CG8 A;  2ZLW A;  3D17 B;  2MGJ A;  5HLX A;  1YGF B;  2GKM A;  1MYT A;  1FN3 B;  2GTL C;  4O4Z A;  1Y0W A;  2VLY A;  1YHR B;  3UH5 A;  3UGY A;  3UHK A;  4AVE A;  2HZ3 A;  1O1O A;  1XZV B;  2QLS A;  3O7N A;  2PEG B;  5CN6 A;  4QAU A;  1G08 B;  1DUK A;  1SPE A;  3OZU A;  1Q1F A;  3S66 A;  1HDS A;  1HBG A;  4XDI A;  1YGD B;  1G0A B;  2OH8 A;  1YHU B;  2G10 A;  1CO8 A;  1J7S A;  1JPB A;  1Y7Z A;  1XXT B;  1VXB A;  1Y83 A;  5JDO E;  1MNK A;  2R50 A;  4F6F A;  1DXU B;  1Y46 B;  1BAB A;  1MLM A;  3HXN B;  3NML A;  1SPG B;  3EDB A;  5JDO C;  1JF3 A;  1N9X A;  4F68 A;  2BK9 A;  1B0B A;  1RQ3 A;  1S5X A;  1MYG A;  1C7D B;  3PT8 B;  4AVD A;  4SDH A;  1THB A;  3PI8 A;  1MLQ A;  2SPL A;  1RVW A;  1YIE B;  1C40 B;  1LTW A;  1YEO A;  2HHE B;  4NXA A;  5HLU A;  2EVP A;  2O5B X;  2D2N C;  1HAC A;  1NS6 B;  1BZ1 B;  2GTL B;  1MTK A;  1CH3 A;  2MGD A;  3QQQ A;  3QZZ A;  2G11 A;  4ODC B;  4F6J A;  4U8U A;  2HZ1 A;  3A5A A;  3OO4 B;  1S69 A;  2XKH A;  1MLF A;  5EV5 A;  1OJ6 A;  3OO4 A;  2CMM A;  3HC9 A;  2V1I A;  1XY0 A;  4N7N A;  1PBX A;  1MLL A;  3BOM B;  5EU2 A;  1K1K A;  3IC0 B;  1Y2Z B;  2ZSZ A;  2HBC A;  2D2M C;  3A5B A;  3D7O B;  2FAL A;  3GYS A;  4MPM A;  1FDH G;  1YFF A;  2QSP B;  1A9W E;  1WMU B;  1XZU A;  1A3O B;  2QSS A;  2QMB A;  3QM6 A;  3SDN A;  2D6C A;  1O1M B;  3MYM A;  2NRL A;  1DLY A;  3QM5 A;  5EE4 C;  1O16 A;  1RTE A;  2ZT3 A;  1J3Y B;  2D5Z A;  1MWD A;  3UHS A;  1GDJ A;  1O1I A;  2W72 A;  1ABW A;  3MJP A;  1NEJ A;  1V4W A;  3ODQ B;  2VEE A;  1VXF A;  1O1I B;  5EYJ A;  3ONZ B;  3HXN A;  3E4N A;  1MLG A;  1FAW A;  4IRO A;  3K3U A;  4MQH B;  3D4X B;  1JZK A;  2SPO A;  3UHD A;  1HJT A;  3ZJH A;  1LH5 A;  2NRM A;  3M3A A;  1MKO A;  1QPW A;  1HHO A;  2V1K A;  1CQ2 A;  1A00 A;  5CMV A;  1XZV A;  3RJN B;  1COH B;  1YIH A;  1CO9 A;  4HBI A;  1YEN B;  1GCV B;  1JL7 A;  3FH9 B;  2PGH B;  3HRW A;  3RGK A;  3D17 A;  1CP0 A;  3WHM B;  3VRF B;  4HSW A;  1MLS A;  3PI1 A;  2XKI A;  1DTI A;  1SHR A;  3LR9 A;  3ZH0 A;  3KUO A;  3O89 A;  3BJ3 A;  2IG3 A;  1Y8I A;  2QFN A;  1M6C A;  1NZ2 A;  6HBI A;  1DXV A;  5EET A;  1MBC A;  1UIW B;  4X0L A;  1A3N A;  3A0G B;  2LH5 A;  1WVP A;  1DXT B;  1V4U B;  3LB2 A;  1OBM A;  1MYI A;  2Z6T A;  3WFW A;  1YH9 B;  2G14 A;  1LFL B;  1WLA A;  1H97 A;  1T1N B;  5HU6 A;  2W6Y A;  2HCO A;  1MNI A;  1XCH A;  1GBV B;  5JGG B;  1DTM A;  4ILZ A;  1FAW B;  4IRO B;  3E5I A;  4MQH A;  3RJ6 A;  3UHE A;  2HHB B;  2MGH A;  1A0U A;  2HBD A;  1V75 A;  3EU1 A;  1V4U A;  2OLP A;  3UHU A;  1YEV A;  1BZP A;  5CNF A;  1UX9 A;  2FRF A;  2BLJ M;  1ECD A;  1NWI A;  1BZ6 A;  4H2L B;  1Y2Z A;  3NL7 A;  1J40 A;  2GTL D;  1W92 A;  1BZ0 A;  2HBE A;  2DXM A;  1HGA A;  1UVY A;  1CIO A;  4NI1 A;  1VXA A;  3GQP B;  2HHD A;  1DXC A;  3WCW A;  1BZZ A;  4KJT A;  3HRW B;  1S5Y A;  2ZSY A;  4YU3 B;  1YVT B;  1Y85 B;  1Y45 B;  3BJ1 B;  4KMV A;  2ZSQ A;  1A3N B;  3WR1 B; 
#chains in the Genus database with same CATH topology
 5F0B A;  2W31 A;  2SPN A;  1COH A;  2OIF A;  1OFK A;  2C7L A;  3O18 B;  3ARL A;  1S5Y B;  4MQC B;  1OR4 A;  1QGW C;  1Y4B A;  1LA6 A;  2BWH A;  1IBE A;  1MKO B;  1XYE A;  2GRH A;  1HBS B;  1Y0T B;  3SZK B;  2R4Z A;  1NIH A;  2B7H A;  1IBE B;  4ZIZ B;  3V58 A;  3AQ6 A;  3DHR B;  3WCP B;  1R1Y A;  3PI8 B;  1Y0A A;  1YDZ A;  3G4U A;  3MOU A;  1BIJ B;  5HY8 B;  3E5O A;  1C7C B;  2D2M D;  1G0B A;  1RQ3 B;  3S1J A;  1HDB A;  1TU9 A;  2DKD A;  4Z8K A;  1J7Y B;  3D1K B;  1THB B;  1IDR A;  1Y01 B;  2JLF A;  2H35 B;  1BZ0 B;  2HBE B;  1J7S B;  1Y7Z B;  3O2C A;  3WCT C;  1MYJ A;  3UHH A;  1FLP A;  3UHR A;  4ETT A;  3HHB B;  1A3O A;  2QSS B;  4F4O A;  1OUT B;  2MGK A;  5B85 A;  1YGF A;  5HY8 A;  1Y8H B;  3ZOM A;  1HBA B;  2D2M A;  2W72 B;  1R1Y B;  1YHR A;  2D5X B;  2ZSN A;  1J7W A;  3QJD A;  3BOM A;  1O1P B;  3A2G A;  2G12 A;  4H0M B;  3AT5 B;  3PMC A;  3ZHW A;  3PI4 A;  3UH6 A;  4WJG 1;  1GLI A;  3WHM A;  3M39 A;  1IWH B;  1HAB B;  1XYE B;  1UFJ A;  1UX8 A;  5E6E B;  1XZU B;  2MYD A;  4MQG A;  5D1V A;  1M9P B;  1Y4Q A;  2MYA A;  1LFV B;  1CII A;  1JZM A;  2UUM A;  1V5H A;  1DM1 A;  1HBB B;  3ECX A;  1DXV B;  4M4A A;  1GH0 B;  3QMA A;  3IC0 A;  3WFU A;  1BZ1 A;  1Y45 A;  1MLU A;  3B75 B;  4G51 B;  2MHB B;  1O1N B;  2VJT B;  4MQJ A;  4AE1 A;  3PEL A;  2DN2 B;  3PI9 A;  2WCQ A;  1FSX A;  3UHQ A;  1V4X B;  5CN7 A;  2DC3 A;  1QXD A;  3K9Z A;  1J3F A;  1MNH A;  3D4X A;  1BIN A;  1TES A;  1GZX B;  3PI2 A;  2PGH A;  1DWT A;  1KD2 A;  1MDT A;  3E55 A;  4XXK A;  1YMC A;  2V1J A;  1O1L A;  1JZL A;  2MGI A;  1KR7 A;  5KER A;  4FWX A;  4U8U C;  5B13 G;  3EU1 B;  1JP6 A;  2GKN A;  1QPW B;  3WCW D;  1F63 A;  1LJW B;  2V1E A;  2G3H A;  3WI8 A;  4GZG A;  2HHB A;  1MLH A;  2VYZ A;  2W6W A;  4NI0 A;  1B33 B;  1LHT A;  1HGA B;  1XZ5 B;  1GBV A;  3MWN A;  1K0Y A;  1G9V B;  4C0N A;  1CMY A;  1ECN A;  1Y0D B;  4H2L A;  1LFL A;  3QJE A;  1LH3 A;  1Y4P B;  4UIQ A;  1CH2 A;  1COL A;  1DDT A;  5ILM A;  2ZS1 C;  3O2C B;  4L1E A;  3NFE B;  4ESA A;  4G1B A;  3MKB B;  4KN3 A;  1YE2 B;  3G4Y A;  1CG8 B;  2ZLW B;  3ZJL A;  1MBS A;  1ABW B;  4HH0 A;  1V75 B;  2R80 B;  4MQK A;  1Y35 A;  1H1X A;  3ZJP A;  3BJ3 B;  3W4U A;  1YG5 B;  1Y31 B;  1YDZ B;  1B8D A;  1S0H A;  3UHW A;  2W6V A;  2OHA A;  1OFJ A;  1KN1 A;  2M6Z B;  1A87 A;  1XQ5 B;  2IN4 A;  1QI8 A;  107M A;  1UMO A;  1HBH B;  4X0L B;  2VYY A;  1GCV A;  1GBU A;  1A01 B;  3PEL B;  4O2G A;  4F0U A;  1Y5K A;  1A6M A;  1B8D B;  1S0H B;  1YOG A;  2O5S X;  3QJB B;  1JDO A;  1Y8I B;  1N9I A;  3GQG A;  1F99 A;  2MYE A;  5CNG A;  1UFP A;  2OHB A;  4ZVA A;  3PI3 A;  3OJ1 A;  1GDK A;  2MGB A;  2NSR A;  2D2M B;  1CG5 B;  2LH6 A;  3OZW A;  1VRE A;  2JLG A;  3ARK A;  112M A;  5CNE A;  2MGA A;  1HV4 A;  4F4O B;  2WCR A;  5CNC A;  2LHB A;  5AZQ A;  4BJU A;  4NK1 A;  4O35 A;  108M A;  3GDJ A;  4B4Y A;  4NI1 B;  1J3Z A;  4A8S A;  2V1H A;  1Y22 A;  1A4F B;  3S48 C;  1G9V A;  1ON7 B;  3OO5 A;  1A9W A;  2VJR A;  2YRS A;  5AZR A;  2BKM A;  1YE0 B;  1RQA B;  2HHE A;  1J7Y A;  1IOP A;  1SI4 B;  3D1A A;  3BA2 A;  3LB1 A;  3DUT B;  2H8F B;  3GQR A;  3UBV A;  3ZJN A;  5E83 A;  1YE2 A;  1IRD A;  4ESU A;  3HEO A;  4ESA B;  1MBO A;  104M A;  3WFX A;  4RMP B;  5HLQ A;  5CN4 A;  4KMW A;  3KVS B;  3R5I B;  1Y0W B;  1Y7C A;  3DHR A;  1A6N A;  3QZX A;  1FSX B;  3CIU B;  1LUE A;  1VHB A;  1RQ4 A;  1PHN A;  3LQD A;  2H8D A;  2O5L X;  1MLO A;  3GK9 A;  1Y4B B;  1DWR A;  3AQ8 A;  2BW9 M;  1EYX B;  1XF6 C;  2VYW A;  1YFF B;  4A8Q A;  2ZSO A;  4PNJ A;  106M A;  1XZ2 B;  3ASE A;  3VRF A;  1A01 A;  3G4V A;  3WR1 A;  3GKV A;  1CH5 A;  4YU3 A;  1DO4 A;  2ZLV A;  4MQG B;  1UVM A;  4N8T B;  1MOD A;  4TYX A;  3ZJR A;  5HBI A;  3G53 A;  1PMB A;  3GYS B;  3ZJM A;  2AUQ A;  3ECZ A;  2ZS0 C;  4DC7 A;  1L2K A;  2HBS B;  1XZ4 A;  3VRE B;  4F0T A;  3GOU A;  2QU0 B;  1YEQ A;  4PQ6 A;  4F6I A;  3LQD B;  3S1I A;  4A8F A;  1VXE A;  3PT7 B;  1URV A;  4N7O B;  3WCW B;  1YEO B;  2ZLV B;  3S65 A;  1MWB A;  1HHO B;  1DO7 A;  1A0U B;  2HBD B;  1Y4P A;  3DHT A;  4FH7 A;  3WCU C;  2GLN A;  1Y46 A;  4IT8 A;  4PQC A;  5CND A;  1Y4V A;  5KDQ A;  3L0F B;  1CMY B;  1MGN A;  5JGG A;  1HAC B;  1NS6 A;  1Y8K B;  3MVC A;  1Y8W B;  4ZVB A;  4TWU A;  5C6E A;  4DWU A;  1BBB A;  3W4U B;  3MN0 A;  4NI0 B;  3AT6 B;  2R4W A;  3MJP B;  5EQM A;  1RVW B;  1YIE A;  1HDS B;  1LJW A;  1DXU A;  1XZ7 A;  3S65 B;  1YOH A;  1HBA A;  2HBG A;  1YOI A;  1HDB B;  2V1G A;  3WCV C;  1DXT A;  3A59 A;  1Y8W A;  3LQ9 A;  3V2V A;  4N7P A;  2ZS1 D;  3ARJ A;  1AJG A;  3LHB A;  1Y7D B;  2R1H B;  105M A;  4Q70 A;  3HHB A;  4MBN A;  4O4T A;  1ABS A;  1DWS A;  3QJE B;  2VLX A;  4FC3 B;  2QU0 A;  2KSC A;  2WTH A;  3V57 B;  3MJU A;  1K0Y B;  1HI8 A;  1SHR B;  3FS4 B;  4F69 A;  4HH1 A;  2LH1 A;  1RSE A;  1LH6 A;  2ZLU A;  1CLS A;  1I3E A;  1YGD A;  3A0G A;  4ROL B;  3DUT A;  1MLR A;  2D2N D;  5M3S A;  1QSI A;  3V2Z A;  4N8T A;  4GXE B;  1LFY B;  3OGB A;  5CN9 A;  2MB5 A;  1O1L B;  4F0U B;  1YIH B;  1F5P A;  1X9F A;  2WTG A;  1NGK A;  7HBI A;  2MGF A;  1FCS A;  4F0T B;  1HV4 B;  1G09 A;  1O1K A;  1QXE A;  1X3K A;  1Y5K B;  2HHD B;  1QSI B;  1CG5 A;  1EWA A;  1OUU B;  2LH2 A;  2ZLT B;  3EOK A;  4WJG A;  3SZK A;  1HGC A;  1MTJ A;  3IXF A;  5C6Y A;  3WCV B;  4G51 A;  1G09 B;  1O1K B;  4FWZ A;  2DHB A;  2MGE A;  1X9F C;  1YEU A;  1MYF A;  1A00 B;  1M6M A;  4GY3 A;  1YVQ A;  2Z6S A;  1S56 A;  3BCQ B;  3LB4 A;  1I7Y A;  4BS9 A;  3CY5 B;  1C7B B;  4HRR A;  3TLD A;  2GNW A;  3BJ2 A;  101M A;  1NS9 A;  3LB3 A;  2D5Z B;  1SPG A;  1NQP A;  1RQA A;  1QSH B;  1CLS B;  5C6E B;  109M A;  2V1F A;  1ON7 A;  1S61 A;  1Y31 A;  2FRI X;  2DN3 A;  1V4W B;  2ZWJ A;  4MXL A;  3ZJS A;  4VHB A;  1R1X B;  1DKE B;  1SI4 A;  3D1A B;  1SGK A;  1Y83 B;  1AZI A;  1IRD B;  1NZ5 A;  2EKT A;  1IT3 A;  3HF4 A;  5KKK A;  4HRR B;  2QLS B;  1RPS B;  1NPG A;  1UIW A;  1Y22 B;  2Z6N A;  3QM9 A;  2ZT2 A;  1YVQ B;  2C7K B;  5B84 A;  1PBX B;  4A8W A;  3GQG B;  3TM9 A;  2B7H B;  1AJH A;  1MYH A;  3VRG A;  1MBN A;  2GNV A;  1LHS A;  2FRJ X;  3HYU B;  1FN3 A;  1Z8U B;  1J41 B;  1B86 A;  1D8U A;  4O1T A;  1V4X A;  4N7N B;  2RAO A;  2XYK A;  2ZLX B;  1Y0C B;  2V8A A;  2FAM A;  3GKT A;  1HBR A;  1Y4F B;  3WCU D;  3NG6 A;  1GBU B;  3ZJI A;  2HZ2 A;  3MYN A;  4XS0 B;  2NSS A;  2ZST A;  1YEU B;  1EYX A;  1YHE A;  1MTI A;  1BZZ B;  3UHC A;  1O1J B;  4YJJ B;  1CBL A;  1HA7 A;  1BVC A;  1UT0 A;  3HEP A;  2RAO B;  1Y5J A;  3MBA A;  5IKS A;  3R0G A;  2GRF A;  1QI8 B;  4H0M A;  1HCO A;  6HBW A;  1IRC A;  1LFQ A;  1Y4R A;  1UVX A;  2VRY A;  4RMP A;  1UVI A;  2ZFO A;  4DWT A;  2GTL A;  3BJ1 A;  2ZS1 A;  1NZ3 A;  1M9P A;  1Y4Q B;  4PQB A;  1MNO A;  4ERT A;  1Y35 B;  3NFE A;  2H8F A;  1A0Z A;  2Z85 A;  1DLW A;  1R1X A;  4AE0 A;  1Y09 B;  1SDL A;  1GLI B;  4UUR A;  3HF4 B;  3K8B A;  1MBA A;  2ZS1 B;  3FS4 A;  1GDI A;  1LFT A;  3M3B A;  2QFK A;  4MU5 A;  4L1E B;  1J40 B;  4FC3 A;  1QSH A;  1AJ9 A;  4L7Y B;  4C44 A;  1A0Z B;  1ABY B;  1GCW A;  2ZSX A;  1CPW A;  3A59 B;  4NXC A;  1JY7 B;  2D2N B;  1NS9 B;  1MWC A;  1JP8 A;  1KTP A;  3UHN A;  2FRK X;  1O1N A;  2VJT A;  4MQJ B;  2MGL A;  1Y7G B;  3QJB A;  1CH7 A;  4M4A B;  2GDM A;  1NQP B;  2RI4 B;  1HGC B;  1LIA A;  3DHT B;  1KD2 B;  1LFV A;  2DKA A;  3BJ2 B;  4JAC A;  5D5R A;  3UHB A;  3G46 A;  2MHB A;  1DUO A;  1OR6 A;  1C7C A;  1EBT A;  1C7B A;  1DXD A;  3VRG B;  2BV8 B;  3FH9 A;  2C7J B;  1Y0A B;  2ZSP A;  3WCV D;  1HHT P;  1HBB A;  3PIA A;  1GVH A;  2MGC A;  1YEQ B;  1JF4 A;  2ZLX A;  2MYB A;  4MQC A;  1ECA A;  3VRE A;  4MBA A;  2MGG A;  1C40 A;  3WCV A;  3NG6 B;  1JP9 A;  1KTP B;  3UHG A;  1JEB A;  3EDA A;  1MCY A;  1S6A A;  1MYM A;  3IC2 B;  1LA6 B;  1O1P A;  3AG0 A;  2RI4 A;  1LFZ B;  1X46 A;  2Z6N B;  1VXH A;  2I88 A;  4N7P B;  1BUW A;  5MBN A;  3MJU B;  1MNJ A;  1YG5 A;  5CHQ A;  1OUT A;  1SDL B;  2GRZ A;  1YZI B;  1EBC A;  1RPS A;  3ED9 A;  1G0B B;  2ZLU B;  4LMX B;  1YEV B;  3ZJJ A;  4ROM B;  3M38 A;  4N6S B;  2O58 X;  1A4F A;  1FHJ B;  3GUQ A;  1O1O B;  2ZSR A;  2ZFO B;  1O1M A;  5F2A A;  1Y0D A;  1YH9 A;  1VXG A;  2QMB B;  3AQ5 A;  1HBI A;  1CH1 A;  4ROM A;  1ALL B;  3IC2 A;  3ZOL A;  4F6D A;  1RTX A;  1U7R A;  1Y4V B;  1Y5J B;  1NIH B;  1HBS A;  1Y0T A;  1OUU A;  3EOK B;  111M A;  4ETU A;  2MYC A;  2AA1 B;  4M4B B;  4Z8K B;  102M A;  2BLI A;  4HRT B;  1G08 A;  4N7O A;  1GJN A;  1DO3 A;  5EE4 D;  1V07 A;  3QM7 A;  4MAX A;  4BJA A;  1XZ4 B;  1JW8 A;  3WCU B;  1Y4F A;  2BNL A;  2C0K A;  2ZS0 B;  4G1V A;  2WY4 A;  1HCO B;  2LH3 A;  2AUR A;  4MQI B;  1IT2 A;  1EMY A;  1NXF A;  1X9F B;  2ZS0 A;  4ERV A;  1MBI A;  2EF2 A;  3P5Q B;  1LH1 A;  3G52 A;  2AV3 A;  5EOH A;  3ZTA A;  1QXE B;  1I3D A;  4FWY A;  1HRM A;  1F99 B;  1UVJ A;  1VWT B;  3KMF A;  3PIA B;  2HBF A;  1XY0 B;  1HBR B;  2H8D B;  1FSL A;  3P5Q A;  4TWV A;  3GQP A;  4ROL A;  1NY9 A;  1YVT A;  1S5X B;  3MKB A;  4GXE A;  4WCH D;  1KN1 B;  3NL7 B;  4YU4 A;  1AJ9 B;  4L7Y A;  3OK5 A;  4A8O A;  3GKV B;  1RQ4 B;  4U8U D;  4Q70 B;  2ZSS A;  3VAU A;  1MYZ A;  3GIO A;  4N6S A;  3KUN A;  2ZT4 A;  5HU6 B;  1J7W B;  3GQR B;  4HRT A;  1MLJ A;  5ILR A;  3IA3 B;  3OZV A;  1MOC A;  1CQX A;  2OH9 A;  1NZ4 A;  2BLH A;  3CIU A;  4NK2 A;  3ZJO A;  2O5Q X;  3H58 A;  1ALL A;  2VM0 A;  2X49 A;  3CY5 A;  1MLN A;  2E2Y A;  3G4W A;  2ZFB B;  2VML B;  3AQ7 A;  3UI0 A;  1MBD A;  1Y4G B;  5E29 B;  4YU4 B;  3AT6 A;  1BAB B;  1BJE A;  2DN3 B;  2NX0 A;  1LH7 A;  3UHI A;  1G0A A;  1T1N A;  1JWN A;  3U3E A;  3D1K A;  1XG0 C;  3GDJ B;  3S66 B;  3UH3 A;  3A5G A;  2G0X A;  4YJJ A;  1U7S A;  3WCT D;  4F6B A;  1K1K B;  1YE0 A;  2JL9 A;  3GOU B;  1BIJ A;  1HDA A;  3DBJ A;  1HI1 A;  4XS0 A;  2AUO A;  3D7O A;  3OVU C;  1CP5 A;  1CPC A;  2R4X A;  2HBF B;  1Y5F A;  1HDA B;  1MOB A;  3DBJ B;  2G0Z A;  1GZX A;  4MXK A;  3WCP A;  2LH7 A;  3TM3 A;  1QXD B;  3ZJQ A;  2O5O X;  4H0B A;  1JEB B;  2C7J A;  1LIA B;  3H57 A;  1VRF A;  2DN2 A;  1YEN A;  3PI9 B;  2ZT0 A;  4MQI A;  1VXC A;  1SDK A;  1DO1 A;  1MDN A;  1JL6 A;  2DXM B;  1O1J A;  5CNB A;  1MZ0 A;  1F5O A;  2D5X A;  2XKG A;  1CH4 A;  1ECO A;  4H07 A;  2R1H A;  1GDL A;  1JY7 A;  1Y85 A;  1Y7G A;  3UGZ A;  1GCW B;  2ZFO C;  1XQ5 A;  2EVK A;  1Y7C B;  2VEB A;  3WFT A;  3UH7 A;  1XZ7 B;  3R5I A;  1DKE A;  4ODC A;  5CN8 A;  1BBB B;  5CN5 A;  3KMF C;  1FHJ A;  2ZFO D;  2G0S A;  5E83 B;  1YCA A;  1Y4G A;  5E29 A;  1Y09 A;  1YZI A;  2SPM A;  2D60 B;  5EYS A;  2D2N A;  1LFT B;  3ODQ A;  2QSP A;  1Y8H A;  1NWN A;  2JHO A;  2PEG A;  3PT7 A;  1ABY A;  5JDO D;  2UUL A;  2EB8 A;  1NEJ B;  1YHU D;  2MBW A;  4OF9 A;  3SDH A;  5JDO F;  5HAV A;  1A6K A;  5KER B;  2Z8A A;  2MGM A;  3QJC B;  3WTG B;  3OO5 B;  3QM8 A;  4LM6 B;  5KDQ B;  3K8B B;  2ZS0 D;  2VLZ A;  1TOX A;  5AQD A;  5MBA A;  2O5M X;  2G0R A;  5ILP A;  6HBW B;  5SW7 B;  4OOD A;  3B75 A;  4HHB A;  1X9F D;  2J96 A;  2W72 C;  1Y5F B;  3BCQ A;  1YHU C;  3UHT A;  2UUM B;  1VWT A;  2UUM X;  1YHE B;  1LFY A;  1YCB A;  2HBS A;  3HYU A;  2AA1 A;  4M4B A;  3NUH B;  5ILE A;  3WCW C;  1HHS A;  1BVD A;  2ZLT A;  2W6V B;  1Y0C A;  2V8A B;  1C7D A;  3PT8 A;  3UHX A;  3WCU A;  2QRW A;  1V9Q A;  3QJC A;  3WTG A;  2M6Z A;  3ECL A;  3QJD B;  2O5T X;  5JOM A;  4U8U B;  1IWH A;  1HAB A;  2C7L B;  4MQK B;  4L2M A;  1HLB A;  2DN1 B;  1YMB A;  1YMA A;  2ZT1 A;  1KFR A;  2VHB A;  1XZ5 A;  5EUI A;  1B86 B;  4LPI A;  1VXD A;  4HHB B;  2UUN D;  3ORD A;  2W6X A;  5CHR A;  5E6E A;  3UHY A;  3A9M A;  5SW7 A;  2D60 A;  1N9F A;  2UUL C;  2GL3 A;  1MLK A;  1NPF A;  3NMM A;  2EKU A;  4HSX A;  1HGB A;  2G0V A;  1J3Y A;  2VJR B;  2YRS B;  1F65 A;  1ITH A;  1Y8K A;  110M A;  1A6G A;  3AT5 A;  2H35 A;  4NZI A;  1ASH A;  1LH2 A;  1MOH A;  1YHU A;  3GLN A;  2EB9 A;  3ONZ A;  1J52 A;  3NMM B;  4F6G A;  3WCT A;  4JYQ A;  1Y7D A;  2ZFB A;  1WMU A;  3AQ9 A;  5AQD M;  1XXT A;  2AUP A;  1CBM A;  1HSY A;  3UHZ A;  3VHB A;  4NS2 A;  5AB8 A;  5EUI B;  1B33 A;  1HGB B;  1UC3 A;  1N9H A;  3UBC A;  3WCT B;  2DN1 A;  1FDH A;  3G4R A;  2DHB B;  3DR9 A;  4UZV A;  1BUW B;  2HCO B;  1J3Z B;  1LFZ A;  3PMD A;  1JBO A;  1LFQ B;  1Y4R B;  2BV8 A;  4FH6 A;  1MOA A;  2AV0 A;  1CIK A;  1EW6 A;  1SWM A;  3LR7 A;  3UHV A;  4ETV A;  1NAZ A;  1BZR A;  2BMM A;  1CPC B;  1URY A;  2HBC B;  1HLM A;  1XZ2 A;  2R4Y A;  3HEN A;  103M A;  4DC8 A;  1CH9 A;  4B3W A;  1J41 A;  3O18 A;  1SDK B;  3QQR A;  1GH0 A;  2R80 A;  3G4Q A;  1HBH A;  1CG8 A;  2ZLW A;  3D17 B;  2MGJ A;  5HLX A;  1YGF B;  2GKM A;  1MYT A;  1FN3 B;  2GTL C;  4O4Z A;  1Y0W A;  2VLY A;  4A8K A;  1YHR B;  3UH5 A;  3UGY A;  3UHK A;  4AVE A;  2HZ3 A;  1O1O A;  1XZV B;  2QLS A;  3O7N A;  2PEG B;  5CN6 A;  4QAU A;  1G08 B;  1DUK A;  1SPE A;  3OZU A;  1Q1F A;  3S66 A;  1HDS A;  1HBG A;  4XDI A;  2UUL B;  1YGD B;  1G0A B;  2OH8 A;  1YHU B;  2G10 A;  1CO8 A;  1J7S A;  1JPB A;  1Y7Z A;  1XXT B;  1VXB A;  1Y83 A;  5JDO E;  1MNK A;  2R50 A;  4F6F A;  1DXU B;  1Y46 B;  1BAB A;  1MLM A;  3HXN B;  3NML A;  3KVS A;  1SPG B;  3EDB A;  1UVK A;  5JDO C;  1JF3 A;  5FVB M;  1N9X A;  4F68 A;  2BK9 A;  1B0B A;  1RQ3 A;  3L0F A;  1S5X A;  1MYG A;  2UUN A;  1C7D B;  3PT8 B;  4AVD A;  4SDH A;  1THB A;  3PI8 A;  1MLQ A;  2SPL A;  1RVW A;  1YIE B;  1C40 B;  1LTW A;  2X4A A;  1YEO A;  2HHE B;  4NXA A;  5HLU A;  2EVP A;  2O5B X;  2D2N C;  1HAC A;  1NS6 B;  1BZ1 B;  2GTL B;  1I7Y B;  4ZIZ A;  1MTK A;  3V58 B;  1CH3 A;  2MGD A;  3QQQ A;  3QZZ A;  2G11 A;  1HI0 P;  2UUL H;  4ODC B;  4F6J A;  4U8U A;  2HZ1 A;  3A5A A;  4B02 A;  3OO4 B;  1HA7 B;  1S69 A;  2XKH A;  1MLF A;  5EV5 A;  1OJ6 A;  3OO4 A;  2CMM A;  3HC9 A;  2V1I A;  1XY0 A;  3BRP A;  4N7N A;  1PBX A;  1MLL A;  2DKC A;  3BOM B;  5EU2 A;  1K1K A;  3IC0 B;  1Y2Z B;  2ZSZ A;  2HBC A;  2D2M C;  3A5B A;  3D7O B;  2FAL A;  3GYS A;  4LMS B;  4MPM A;  1FDH G;  2UUN B;  1YFF A;  4A8M P;  2QSP B;  1A9W E;  1WMU B;  2VJH A;  1XZU A;  1UVL A;  1A3O B;  2QSS A;  3V57 A;  2QMB A;  3QM6 A;  3SDN A;  2D6C A;  2C7K A;  1O1M B;  3MYM A;  4A8Y A;  2NRL A;  1DLY A;  3QM5 A;  5EE4 C;  1O16 A;  1RTE A;  2ZT3 A;  1J3Y B;  1XDT T;  2D5Z A;  5FVB A;  1MWD A;  3UHS A;  3VNC A;  1GDJ A;  1O1I A;  2W72 A;  2VML A;  1ABW A;  4PO5 A;  3MJP A;  1NEJ A;  1RH1 A;  1V4W A;  3ODQ B;  2VEE A;  1VXF A;  3RQR A;  1O1I B;  5EYJ A;  4GY3 B;  3ONZ B;  3HXN A;  3E4N A;  1MLG A;  1FAW A;  4IRO A;  3K3U A;  4MQH B;  3D4X B;  1JZK A;  2SPO A;  3UHD A;  1HJT A;  3ZJH A;  1LH5 A;  2NRM A;  3M3A A;  1MKO A;  1QPW A;  1HHO A;  2V1K A;  1CQ2 A;  1A00 A;  2YSK A;  5CMV A;  1XZV A;  3RJN B;  1COH B;  1YIH A;  1CO9 A;  4HBI A;  1YEN B;  1GCV B;  1JL7 A;  3FH9 B;  2PGH B;  3HRW A;  3RGK A;  3D17 A;  1CP0 A;  1JBO B;  3WHM B;  3VRF B;  4HSW A;  1MLS A;  5B13 A;  3PI1 A;  2XKI A;  1DTI A;  1SHR A;  3LR9 A;  3ZH0 A;  3KUO A;  3O89 A;  1UVN A;  3BJ3 A;  2IG3 A;  1Y8I A;  2QFN A;  1M6C A;  3BRP B;  1NZ2 A;  6HBI A;  1DXV A;  5EET A;  1MBC A;  1PHN B;  1UIW B;  4X0L A;  1A3N A;  3A0G B;  2LH5 A;  1WVP A;  1DXT B;  1V4U B;  3LB2 A;  1OBM A;  1MYI A;  2Z6T A;  3WFW A;  2UUL D;  1YH9 B;  2G14 A;  1F0L A;  1LFL B;  1WLA A;  1H97 A;  1T1N B;  4XXI A;  5HU6 A;  2W6Y A;  2HCO A;  1MNI A;  1XCH A;  1GBV B;  5JGG B;  1DTM A;  4ILZ A;  1FAW B;  4IRO B;  3E5I A;  4MQH A;  3RJ6 A;  3UHE A;  2HHB B;  2MGH A;  4PO5 B;  1WAC A;  1A0U A;  2HBD A;  1V75 A;  3EU1 A;  1V4U A;  2OLP A;  3UHU A;  1YEV A;  1BZP A;  5CNF A;  1UX9 A;  2FRF A;  2BLJ M;  1ECD A;  1NWI A;  1BZ6 A;  4H2L B;  1Y2Z A;  3NL7 A;  1J40 A;  2GTL D;  1W92 A;  3FEW X;  1BZ0 A;  2HBE A;  2VJH B;  2DXM A;  1HGA A;  1UVY A;  1CIO A;  4NI1 A;  1VXA A;  3GQP B;  4TMA B;  2HHD A;  1DXC A;  3WCW A;  1BZZ A;  4KJT A;  3HRW B;  1S5Y A;  2ZSY A;  4YU3 B;  1YVT B;  1Y85 B;  1Y45 B;  3BJ1 B;  4KMV A;  2ZSQ A;  1A3N B;  3WR1 B; 
#chains in the Genus database with same CATH homology
 5F0B A;  2W31 A;  2SPN A;  1COH A;  2OIF A;  1OFK A;  3ARL A;  1S5Y B;  4MQC B;  1OR4 A;  1Y4B A;  1LA6 A;  2BWH A;  1IBE A;  1MKO B;  1XYE A;  2GRH A;  1HBS B;  1Y0T B;  3SZK B;  2R4Z A;  1NIH A;  2B7H A;  1IBE B;  3AQ6 A;  3DHR B;  3WCP B;  1R1Y A;  3PI8 B;  1Y0A A;  1YDZ A;  3G4U A;  3MOU A;  1BIJ B;  5HY8 B;  3E5O A;  1C7C B;  2D2M D;  1G0B A;  1RQ3 B;  3S1J A;  1HDB A;  1TU9 A;  1J7Y B;  3D1K B;  1THB B;  1IDR A;  1Y01 B;  2H35 B;  1BZ0 B;  2HBE B;  1J7S B;  1Y7Z B;  3WCT C;  1MYJ A;  3UHH A;  1FLP A;  3UHR A;  3HHB B;  1A3O A;  2QSS B;  4F4O A;  1OUT B;  2MGK A;  5B85 A;  1YGF A;  5HY8 A;  1Y8H B;  3ZOM A;  1HBA B;  2D2M A;  2W72 B;  1R1Y B;  1YHR A;  2D5X B;  2ZSN A;  1J7W A;  3QJD A;  3BOM A;  1O1P B;  3A2G A;  2G12 A;  3AT5 B;  3ZHW A;  3PI4 A;  3UH6 A;  4WJG 1;  1GLI A;  3WHM A;  3M39 A;  1IWH B;  1HAB B;  1XYE B;  1UFJ A;  1UX8 A;  5E6E B;  1XZU B;  2MYD A;  4MQG A;  5D1V A;  1M9P B;  1Y4Q A;  2MYA A;  1LFV B;  1JZM A;  1V5H A;  1DM1 A;  1HBB B;  3ECX A;  1DXV B;  4M4A A;  3QMA A;  3IC0 A;  3WFU A;  1BZ1 A;  1Y45 A;  1MLU A;  3B75 B;  4G51 B;  2MHB B;  1O1N B;  4MQJ A;  3PEL A;  2DN2 B;  3PI9 A;  1FSX A;  3UHQ A;  1V4X B;  5CN7 A;  2DC3 A;  1QXD A;  3K9Z A;  1J3F A;  1MNH A;  3D4X A;  1BIN A;  1TES A;  1GZX B;  3PI2 A;  2PGH A;  1DWT A;  1KD2 A;  3E55 A;  1YMC A;  2V1J A;  1O1L A;  1JZL A;  2MGI A;  1KR7 A;  5KER A;  4FWX A;  4U8U C;  3EU1 B;  1JP6 A;  2GKN A;  1QPW B;  3WCW D;  1F63 A;  1LJW B;  2V1E A;  2G3H A;  3WI8 A;  4GZG A;  2HHB A;  1MLH A;  2VYZ A;  2W6W A;  4NI0 A;  1LHT A;  1HGA B;  1XZ5 B;  1GBV A;  4C0N A;  1K0Y A;  1G9V B;  1CMY A;  1ECN A;  1Y0D B;  4H2L A;  1LFL A;  3QJE A;  1LH3 A;  1Y4P B;  4UIQ A;  1CH2 A;  5ILM A;  2ZS1 C;  3NFE B;  4ESA A;  4G1B A;  3MKB B;  4KN3 A;  1YE2 B;  3G4Y A;  1CG8 B;  2ZLW B;  3ZJL A;  1MBS A;  1ABW B;  1V75 B;  2R80 B;  4MQK A;  1Y35 A;  1H1X A;  3ZJP A;  3BJ3 B;  3W4U A;  1YG5 B;  1Y31 B;  1YDZ B;  1S0H A;  3UHW A;  2W6V A;  2OHA A;  1OFJ A;  2M6Z B;  1XQ5 B;  2IN4 A;  1QI8 A;  107M A;  1UMO A;  1HBH B;  4X0L B;  2VYY A;  1GCV A;  1GBU A;  1A01 B;  3PEL B;  4O2G A;  1Y5K A;  1A6M A;  1S0H B;  1YOG A;  2O5S X;  3QJB B;  1JDO A;  1Y8I B;  1N9I A;  3GQG A;  2MYE A;  5CNG A;  1UFP A;  2OHB A;  4ZVA A;  3PI3 A;  3OJ1 A;  1GDK A;  2MGB A;  2NSR A;  2D2M B;  1CG5 B;  2LH6 A;  3OZW A;  1VRE A;  3ARK A;  112M A;  5CNE A;  2MGA A;  1HV4 A;  4F4O B;  5CNC A;  2LHB A;  5AZQ A;  4NK1 A;  4O35 A;  108M A;  3GDJ A;  4B4Y A;  4NI1 B;  1J3Z A;  2V1H A;  1Y22 A;  1A4F B;  3S48 C;  1G9V A;  3OO5 A;  1A9W A;  2YRS A;  5AZR A;  2BKM A;  1YE0 B;  1RQA B;  2HHE A;  1J7Y A;  1IOP A;  1SI4 B;  3D1A A;  3BA2 A;  3LB1 A;  3DUT B;  2H8F B;  3GQR A;  3UBV A;  3ZJN A;  5E83 A;  1YE2 A;  1IRD A;  3HEO A;  4ESA B;  1MBO A;  104M A;  3WFX A;  5HLQ A;  5CN4 A;  4KMW A;  3R5I B;  1Y0W B;  1Y7C A;  3DHR A;  1A6N A;  3QZX A;  1FSX B;  3CIU B;  1LUE A;  1VHB A;  1RQ4 A;  3LQD A;  2H8D A;  2O5L X;  1MLO A;  3GK9 A;  1Y4B B;  1DWR A;  3AQ8 A;  2BW9 M;  2VYW A;  1YFF B;  2ZSO A;  4PNJ A;  106M A;  1XZ2 B;  3ASE A;  3VRF A;  1A01 A;  3G4V A;  3WR1 A;  3GKV A;  1CH5 A;  4YU3 A;  1DO4 A;  2ZLV A;  4MQG B;  4N8T B;  1MOD A;  4TYX A;  3ZJR A;  5HBI A;  3G53 A;  1PMB A;  3GYS B;  3ZJM A;  2AUQ A;  3ECZ A;  2ZS0 C;  4DC7 A;  1L2K A;  2HBS B;  1XZ4 A;  3VRE B;  3GOU A;  2QU0 B;  1YEQ A;  4PQ6 A;  4F6I A;  3LQD B;  3S1I A;  1VXE A;  3PT7 B;  1URV A;  4N7O B;  3WCW B;  1YEO B;  2ZLV B;  3S65 A;  1MWB A;  1HHO B;  1DO7 A;  1A0U B;  2HBD B;  1Y4P A;  3DHT A;  4FH7 A;  3WCU C;  2GLN A;  1Y46 A;  4IT8 A;  4PQC A;  5CND A;  1Y4V A;  5KDQ A;  1CMY B;  1MGN A;  5JGG A;  1HAC B;  1NS6 A;  1Y8K B;  3MVC A;  1Y8W B;  4ZVB A;  4TWU A;  5C6E A;  4DWU A;  1BBB A;  3W4U B;  3MN0 A;  4NI0 B;  3AT6 B;  2R4W A;  3MJP B;  5EQM A;  1RVW B;  1YIE A;  1HDS B;  1LJW A;  1DXU A;  1XZ7 A;  3S65 B;  1YOH A;  1HBA A;  2HBG A;  1YOI A;  1HDB B;  2V1G A;  3WCV C;  1DXT A;  3A59 A;  1Y8W A;  3V2V A;  4N7P A;  2ZS1 D;  3ARJ A;  1AJG A;  3LHB A;  1Y7D B;  2R1H B;  105M A;  3HHB A;  4MBN A;  4O4T A;  1ABS A;  1DWS A;  3QJE B;  2VLX A;  4FC3 B;  2QU0 A;  2KSC A;  2WTH A;  3MJU A;  1K0Y B;  4F69 A;  1SHR B;  3FS4 B;  2LH1 A;  1RSE A;  1LH6 A;  2ZLU A;  1CLS A;  1I3E A;  1YGD A;  3A0G A;  4ROL B;  3DUT A;  1MLR A;  2D2N D;  5M3S A;  1QSI A;  3V2Z A;  4N8T A;  1LFY B;  3OGB A;  5CN9 A;  2MB5 A;  1O1L B;  1YIH B;  1F5P A;  1X9F A;  2WTG A;  1NGK A;  7HBI A;  2MGF A;  1FCS A;  1HV4 B;  1G09 A;  1O1K A;  1QXE A;  1X3K A;  1Y5K B;  2HHD B;  1QSI B;  1CG5 A;  1EWA A;  1OUU B;  2LH2 A;  2ZLT B;  3EOK A;  4WJG A;  3SZK A;  1HGC A;  1MTJ A;  3IXF A;  5C6Y A;  3WCV B;  4G51 A;  1G09 B;  1O1K B;  4FWZ A;  2DHB A;  2MGE A;  1X9F C;  1YEU A;  1MYF A;  1A00 B;  1M6M A;  1YVQ A;  2Z6S A;  1S56 A;  3BCQ B;  3LB4 A;  3CY5 B;  1C7B B;  4HRR A;  3TLD A;  2GNW A;  3BJ2 A;  101M A;  1NS9 A;  3LB3 A;  2D5Z B;  1SPG A;  1NQP A;  1RQA A;  1QSH B;  1CLS B;  5C6E B;  109M A;  2V1F A;  1S61 A;  1Y31 A;  2FRI X;  2DN3 A;  1V4W B;  2ZWJ A;  4MXL A;  3ZJS A;  4VHB A;  1R1X B;  1DKE B;  1SI4 A;  3D1A B;  1Y83 B;  1AZI A;  1IRD B;  1NZ5 A;  2EKT A;  1IT3 A;  3HF4 A;  5KKK A;  4HRR B;  2QLS B;  1RPS B;  1NPG A;  1UIW A;  1Y22 B;  2Z6N A;  3QM9 A;  2ZT2 A;  1YVQ B;  5B84 A;  1PBX B;  3GQG B;  3TM9 A;  2B7H B;  1AJH A;  1MYH A;  3VRG A;  1MBN A;  2GNV A;  1LHS A;  2FRJ X;  3HYU B;  1FN3 A;  1Z8U B;  1J41 B;  1B86 A;  1D8U A;  4O1T A;  1V4X A;  4N7N B;  2RAO A;  2XYK A;  2ZLX B;  1Y0C B;  2FAM A;  3GKT A;  1HBR A;  1Y4F B;  3WCU D;  3NG6 A;  1GBU B;  3ZJI A;  2HZ2 A;  3MYN A;  4XS0 B;  2NSS A;  2ZST A;  1YEU B;  1YHE A;  1MTI A;  1BZZ B;  3UHC A;  1O1J B;  1CBL A;  1BVC A;  1UT0 A;  3HEP A;  2RAO B;  1Y5J A;  3MBA A;  5IKS A;  3R0G A;  2GRF A;  1QI8 B;  1HCO A;  6HBW A;  1IRC A;  1LFQ A;  1Y4R A;  1UVX A;  2VRY A;  2ZFO A;  4DWT A;  2GTL A;  3BJ1 A;  2ZS1 A;  1NZ3 A;  1M9P A;  1Y4Q B;  4PQB A;  1MNO A;  1Y35 B;  3NFE A;  2H8F A;  1A0Z A;  2Z85 A;  1DLW A;  1R1X A;  1Y09 B;  1SDL A;  1GLI B;  4UUR A;  3HF4 B;  3K8B A;  1MBA A;  2ZS1 B;  3FS4 A;  1GDI A;  1LFT A;  3M3B A;  2QFK A;  4MU5 A;  1J40 B;  4FC3 A;  1QSH A;  1AJ9 A;  4L7Y B;  4C44 A;  1A0Z B;  1ABY B;  1GCW A;  2ZSX A;  1CPW A;  3A59 B;  4NXC A;  1JY7 B;  2D2N B;  1NS9 B;  1MWC A;  1JP8 A;  3UHN A;  2FRK X;  1O1N A;  4MQJ B;  2MGL A;  1Y7G B;  3QJB A;  1CH7 A;  4M4A B;  2GDM A;  1NQP B;  2RI4 B;  1HGC B;  3DHT B;  1KD2 B;  1LFV A;  3BJ2 B;  4JAC A;  5D5R A;  3UHB A;  3G46 A;  2MHB A;  1DUO A;  1OR6 A;  1C7C A;  1EBT A;  1C7B A;  1DXD A;  3VRG B;  3FH9 A;  1Y0A B;  2ZSP A;  3WCV D;  1HBB A;  3PIA A;  1GVH A;  2MGC A;  1YEQ B;  1JF4 A;  2ZLX A;  2MYB A;  4MQC A;  1ECA A;  3VRE A;  4MBA A;  2MGG A;  1C40 A;  3WCV A;  3NG6 B;  1JP9 A;  3UHG A;  1JEB A;  3EDA A;  1MCY A;  1S6A A;  1MYM A;  3IC2 B;  1LA6 B;  1O1P A;  3AG0 A;  2RI4 A;  1LFZ B;  1X46 A;  2Z6N B;  1VXH A;  4N7P B;  1BUW A;  5MBN A;  3MJU B;  1MNJ A;  1YG5 A;  5CHQ A;  1OUT A;  1SDL B;  2GRZ A;  1YZI B;  1EBC A;  1RPS A;  3ED9 A;  1G0B B;  2ZLU B;  1YEV B;  3ZJJ A;  4ROM B;  3M38 A;  2O58 X;  1A4F A;  1FHJ B;  1O1O B;  2ZSR A;  2ZFO B;  1O1M A;  5F2A A;  1Y0D A;  1YH9 A;  1VXG A;  2QMB B;  3AQ5 A;  1HBI A;  1CH1 A;  4ROM A;  3IC2 A;  3ZOL A;  4F6D A;  1RTX A;  1U7R A;  1Y4V B;  1Y5J B;  1NIH B;  1HBS A;  1Y0T A;  1OUU A;  3EOK B;  111M A;  2MYC A;  2AA1 B;  4M4B B;  102M A;  2BLI A;  4HRT B;  1G08 A;  4N7O A;  1GJN A;  1DO3 A;  5EE4 D;  1V07 A;  3QM7 A;  4MAX A;  4BJA A;  1XZ4 B;  1JW8 A;  3WCU B;  1Y4F A;  2BNL A;  2C0K A;  2ZS0 B;  4G1V A;  2WY4 A;  1HCO B;  2LH3 A;  2AUR A;  4MQI B;  1IT2 A;  1EMY A;  1NXF A;  1X9F B;  2ZS0 A;  1MBI A;  2EF2 A;  3P5Q B;  1LH1 A;  3G52 A;  2AV3 A;  5EOH A;  1QXE B;  1I3D A;  4FWY A;  1HRM A;  1VWT B;  3KMF A;  3PIA B;  2HBF A;  1XY0 B;  1HBR B;  2H8D B;  1FSL A;  3P5Q A;  4TWV A;  3GQP A;  4ROL A;  1YVT A;  1S5X B;  3MKB A;  4WCH D;  3NL7 B;  4YU4 A;  1AJ9 B;  4L7Y A;  3OK5 A;  3GKV B;  1RQ4 B;  4U8U D;  2ZSS A;  3VAU A;  1MYZ A;  3KUN A;  2ZT4 A;  5HU6 B;  1J7W B;  3GQR B;  4HRT A;  1MLJ A;  5ILR A;  3IA3 B;  3OZV A;  1MOC A;  1CQX A;  2OH9 A;  1NZ4 A;  2BLH A;  3CIU A;  4NK2 A;  3ZJO A;  2O5Q X;  3H58 A;  2VM0 A;  3CY5 A;  1MLN A;  2E2Y A;  3G4W A;  2ZFB B;  3AQ7 A;  3UI0 A;  1MBD A;  1Y4G B;  5E29 B;  4YU4 B;  3AT6 A;  1BAB B;  1BJE A;  2DN3 B;  2NX0 A;  1LH7 A;  3UHI A;  1G0A A;  1T1N A;  1JWN A;  3U3E A;  3D1K A;  3GDJ B;  3S66 B;  3UH3 A;  3A5G A;  2G0X A;  1U7S A;  3WCT D;  4F6B A;  1K1K B;  1YE0 A;  3GOU B;  1BIJ A;  1HDA A;  4XS0 A;  2AUO A;  3D7O A;  3OVU C;  1CP5 A;  2R4X A;  2HBF B;  1Y5F A;  1HDA B;  1MOB A;  2G0Z A;  1GZX A;  4MXK A;  3WCP A;  2LH7 A;  3TM3 A;  1QXD B;  3ZJQ A;  2O5O X;  4H0B A;  1JEB B;  3H57 A;  1VRF A;  2DN2 A;  1YEN A;  3PI9 B;  2ZT0 A;  4MQI A;  1VXC A;  1SDK A;  1DO1 A;  1MDN A;  1JL6 A;  2DXM B;  1O1J A;  5CNB A;  1MZ0 A;  1F5O A;  2D5X A;  2XKG A;  1CH4 A;  1ECO A;  4H07 A;  2R1H A;  1GDL A;  1JY7 A;  1Y85 A;  1Y7G A;  3UGZ A;  1GCW B;  2ZFO C;  1XQ5 A;  2EVK A;  1Y7C B;  2VEB A;  3WFT A;  3UH7 A;  1XZ7 B;  3R5I A;  1DKE A;  4ODC A;  5CN8 A;  1BBB B;  5CN5 A;  3KMF C;  1FHJ A;  2ZFO D;  2G0S A;  5E83 B;  1YCA A;  5E29 A;  1Y4G A;  1Y09 A;  1YZI A;  2SPM A;  2D60 B;  5EYS A;  2D2N A;  1LFT B;  3ODQ A;  2QSP A;  1Y8H A;  1NWN A;  2JHO A;  2PEG A;  3PT7 A;  1ABY A;  5JDO D;  2EB8 A;  1NEJ B;  1YHU D;  2MBW A;  4OF9 A;  3SDH A;  5JDO F;  5HAV A;  1A6K A;  5KER B;  2Z8A A;  2MGM A;  3QJC B;  3WTG B;  3OO5 B;  3QM8 A;  5KDQ B;  3K8B B;  2ZS0 D;  2VLZ A;  5MBA A;  2O5M X;  2G0R A;  5ILP A;  6HBW B;  5SW7 B;  4OOD A;  3B75 A;  4HHB A;  1X9F D;  2W72 C;  1Y5F B;  3BCQ A;  1YHU C;  3UHT A;  1VWT A;  1YHE B;  1LFY A;  1YCB A;  2HBS A;  3HYU A;  2AA1 A;  4M4B A;  5ILE A;  3WCW C;  1BVD A;  2ZLT A;  2W6V B;  1Y0C A;  1C7D A;  3PT8 A;  3UHX A;  3WCU A;  2QRW A;  1V9Q A;  3QJC A;  3WTG A;  2M6Z A;  3ECL A;  3QJD B;  2O5T X;  5JOM A;  4U8U B;  1IWH A;  1HAB A;  4MQK B;  4L2M A;  1HLB A;  2DN1 B;  1YMB A;  1YMA A;  2ZT1 A;  1KFR A;  2VHB A;  1XZ5 A;  5EUI A;  1B86 B;  1VXD A;  4LPI A;  4HHB B;  3ORD A;  2W6X A;  5CHR A;  5E6E A;  3UHY A;  3A9M A;  5SW7 A;  2D60 A;  1N9F A;  2GL3 A;  1MLK A;  1NPF A;  3NMM A;  2EKU A;  4HSX A;  1HGB A;  2G0V A;  1J3Y A;  2YRS B;  1F65 A;  1ITH A;  1Y8K A;  110M A;  1A6G A;  3AT5 A;  2H35 A;  4NZI A;  1ASH A;  1LH2 A;  1MOH A;  1YHU A;  3GLN A;  2EB9 A;  3ONZ A;  1J52 A;  3NMM B;  4F6G A;  3WCT A;  4JYQ A;  1Y7D A;  2ZFB A;  1WMU A;  3AQ9 A;  1XXT A;  2AUP A;  1CBM A;  1HSY A;  3UHZ A;  3VHB A;  4NS2 A;  5AB8 A;  5EUI B;  1HGB B;  1UC3 A;  1N9H A;  3UBC A;  3WCT B;  2DN1 A;  1FDH A;  3G4R A;  2DHB B;  3DR9 A;  4UZV A;  1BUW B;  2HCO B;  1J3Z B;  1LFZ A;  1LFQ B;  1Y4R B;  4FH6 A;  1MOA A;  2AV0 A;  1CIK A;  1EW6 A;  1SWM A;  3LR7 A;  3UHV A;  1NAZ A;  1BZR A;  2BMM A;  1URY A;  2HBC B;  1HLM A;  1XZ2 A;  2R4Y A;  3HEN A;  103M A;  4DC8 A;  1CH9 A;  4B3W A;  1J41 A;  1SDK B;  3QQR A;  2R80 A;  3G4Q A;  1HBH A;  1CG8 A;  2ZLW A;  3D17 B;  2MGJ A;  5HLX A;  1YGF B;  2GKM A;  1MYT A;  1FN3 B;  2GTL C;  4O4Z A;  1Y0W A;  2VLY A;  1YHR B;  3UH5 A;  3UGY A;  3UHK A;  4AVE A;  2HZ3 A;  1O1O A;  1XZV B;  2QLS A;  3O7N A;  2PEG B;  5CN6 A;  4QAU A;  1G08 B;  1DUK A;  1SPE A;  3OZU A;  1Q1F A;  3S66 A;  1HDS A;  1HBG A;  4XDI A;  1YGD B;  1G0A B;  2OH8 A;  1YHU B;  2G10 A;  1CO8 A;  1J7S A;  1JPB A;  1Y7Z A;  1XXT B;  1VXB A;  1Y83 A;  5JDO E;  1MNK A;  2R50 A;  4F6F A;  1DXU B;  1Y46 B;  1BAB A;  1MLM A;  3HXN B;  3NML A;  1SPG B;  3EDB A;  5JDO C;  1JF3 A;  1N9X A;  4F68 A;  2BK9 A;  1B0B A;  1RQ3 A;  1S5X A;  1MYG A;  1C7D B;  3PT8 B;  4AVD A;  4SDH A;  1THB A;  3PI8 A;  1MLQ A;  2SPL A;  1RVW A;  1YIE B;  1C40 B;  1LTW A;  1YEO A;  2HHE B;  4NXA A;  5HLU A;  2EVP A;  2O5B X;  2D2N C;  1HAC A;  1NS6 B;  1BZ1 B;  2GTL B;  1MTK A;  1CH3 A;  2MGD A;  3QQQ A;  3QZZ A;  2G11 A;  4ODC B;  4F6J A;  4U8U A;  2HZ1 A;  3A5A A;  3OO4 B;  1S69 A;  2XKH A;  1MLF A;  5EV5 A;  1OJ6 A;  3OO4 A;  2CMM A;  3HC9 A;  2V1I A;  1XY0 A;  4N7N A;  1PBX A;  1MLL A;  3BOM B;  5EU2 A;  1K1K A;  3IC0 B;  1Y2Z B;  2ZSZ A;  2HBC A;  2D2M C;  3A5B A;  3D7O B;  2FAL A;  3GYS A;  4MPM A;  1FDH G;  1YFF A;  2QSP B;  1A9W E;  1WMU B;  1XZU A;  1A3O B;  2QSS A;  2QMB A;  3QM6 A;  3SDN A;  2D6C A;  1O1M B;  3MYM A;  2NRL A;  1DLY A;  3QM5 A;  5EE4 C;  1O16 A;  1RTE A;  2ZT3 A;  1J3Y B;  2D5Z A;  1MWD A;  3UHS A;  1GDJ A;  1O1I A;  2W72 A;  1ABW A;  3MJP A;  1NEJ A;  1V4W A;  3ODQ B;  2VEE A;  1VXF A;  1O1I B;  5EYJ A;  3ONZ B;  3HXN A;  3E4N A;  1MLG A;  1FAW A;  4IRO A;  3K3U A;  4MQH B;  3D4X B;  1JZK A;  2SPO A;  3UHD A;  1HJT A;  3ZJH A;  1LH5 A;  2NRM A;  3M3A A;  1MKO A;  1QPW A;  1HHO A;  2V1K A;  1CQ2 A;  1A00 A;  5CMV A;  1XZV A;  3RJN B;  1COH B;  1YIH A;  1CO9 A;  4HBI A;  1YEN B;  1GCV B;  1JL7 A;  3FH9 B;  2PGH B;  3HRW A;  3RGK A;  3D17 A;  1CP0 A;  3WHM B;  3VRF B;  4HSW A;  1MLS A;  3PI1 A;  2XKI A;  1DTI A;  1SHR A;  3LR9 A;  3ZH0 A;  3KUO A;  3O89 A;  3BJ3 A;  2IG3 A;  1Y8I A;  2QFN A;  1M6C A;  1NZ2 A;  6HBI A;  1DXV A;  5EET A;  1MBC A;  1UIW B;  4X0L A;  1A3N A;  3A0G B;  2LH5 A;  1WVP A;  1DXT B;  1V4U B;  3LB2 A;  1OBM A;  1MYI A;  2Z6T A;  3WFW A;  1YH9 B;  2G14 A;  1LFL B;  1WLA A;  1H97 A;  1T1N B;  5HU6 A;  2W6Y A;  2HCO A;  1MNI A;  1XCH A;  1GBV B;  5JGG B;  1DTM A;  4ILZ A;  1FAW B;  4IRO B;  3E5I A;  4MQH A;  3RJ6 A;  3UHE A;  2HHB B;  2MGH A;  1A0U A;  2HBD A;  1V75 A;  3EU1 A;  1V4U A;  2OLP A;  3UHU A;  1YEV A;  1BZP A;  5CNF A;  1UX9 A;  2FRF A;  2BLJ M;  1ECD A;  1NWI A;  1BZ6 A;  4H2L B;  1Y2Z A;  3NL7 A;  1J40 A;  2GTL D;  1W92 A;  1BZ0 A;  2HBE A;  2DXM A;  1HGA A;  1UVY A;  1CIO A;  4NI1 A;  1VXA A;  3GQP B;  2HHD A;  1DXC A;  3WCW A;  1BZZ A;  4KJT A;  3HRW B;  1S5Y A;  2ZSY A;  4YU3 B;  1YVT B;  1Y85 B;  1Y45 B;  3BJ1 B;  4KMV A;  2ZSQ A;  1A3N B;  3WR1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...