1CG9A

Complex recognition of the supertypic bw6-determinant on hla-b and-c molecules by the monoclonal antibody sfr8-b6
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
277
structure length
277
Chain Sequence
GSHSMRYFYTAMFRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex Recognition of the Supertypic Bw6-Determinant on HLA-B and-C Molecules by the Monoclonal Antibody SFR8-B6
rcsb
source organism Homo sapiens
molecule tags Mhc class i
molecule keywords PROTEIN (HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-35 B* 350
total genus 74
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cg9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1cg9A01
3V2AR 1LO4L 2JTDA 3P9MB 5F97E 5LWYH 1XCTA 3O4OC 3WE6A 2DICA 3JWOL 3W5MA 4O2CA 2CKBL 5HYJE 1EJOH 2ZG3A 3FFCA 2IANB 1F3DH 2MQ3A 1S7XA 2DQIH 4ZFFA 4JY5L 2IWGA 3CFKB 4JN1L 3UBXA 4HKBB 5SWZD 2QADB 1MCCA 4NDMB 5D96B 2J8UB 1JV5B 4GW5A 3VI4F 3TCXA 4P4KA 1RHHA 4D2NA 5CD5D 5JLZB 2DQGL 4HEPG 3MV7B 1JV5A 4GW5B 4KTEL 3SO5A 4DN3H 1YMMD 2UWEA 2P47B 4S1QL 3BVNB 1A6UL 2BVYA 3PWPA 1TMCA 2VERN 5E94A 1MUJA 2FL5B 4FQHA 3CVHL 4OF5A 1T22B 1ERNA 1HYSC 1MHEB 1KSRA 3PHQB 3G6DL 5J9PB 1XGUB 4G7YL 4KRPD 1KLGA 3VXUE 3RBGA 4JZJC 4XMPL 3N85H 1NPUA 4EKXA 2EDQA 4ZO6A 3VGAC 3UTSA 1J9CT 3GGWB 5FKAB 4QRRD 3AS2A 4JO3H 2ED9A 4OZHA 1F4HA 1CFVH 3I50L 4JY6A 3MV01 4JE4B 3H9SE 3ECBB 2JJUA 1IQDB 3ME0A 3PIQB 5FV1L 5EC2B 4YR6B 1DE4B 2BMKA 4U2YA 3TVMC 4KU1A 1B6DA 3FOMA 2JELH 2EYTA 3UPCA 2LVEA 4BQCA 4Y4FB 4OLUL 5F7DB 5AWNL 5CZVH 1AXTH 2B1HL 1KLUA 2FECI 4XNUH 2OP4H 2W07A 3D1MC 3VXOA 15C8H 1FNFA 1ZLWK 3FO0H 2QSVA 3MRCA 3OAZH 4WFHE 3QCUL 3RKDD 5DJCA 5D5MF 1XGYL 4UIMA 3MNZA 1RUAL 2Y7QB 1CFBA 4JLRA 1D9KB 2ITDA 3TZVA 5D7JC 3ZDZF 4K71C 5D7JD 4EOWL 3GMOA 4PG2C 2P8PB 3C87A 1BHGA 2F5BH 5D2NE 3RWEA 2DMBA 4FZ8H 5J6HA 2BOCA 2W0FB 3V7AG 3WLBA 2MCPL 3EIFA 4DEPB 1H5BC 1U8IA 3C60A 4YO0B 4OZIA 5ISZD 3I84A 4ODVL 4RAUB 2R2HB 2E7HA 3MLRL 3LV3B 1D5BA 1NCAH 4PJXB 5ACMA 2UYLB 5C0CE 4NN7C 4P4RA 2N7BA 2HN7B 1U6AH 3HG1A 5IHUL 4AIZB 3MRBA 1MIEH 3WLWC 3FB8A 4B53A 1I7ZB 3TIEA 2NY4B 4F7PA 2R0ZH 2QTEA 3MRRA 5IV2B 5FV2A 1ADQA 3CFDA 4F7PB 1HQRA 4RFNC 1DN0B 5IBUG 2NXYB 4Z7VF 1CS6A 3CH1A 1HQRB 2NY1B 3HN3A 4JB9L 2AEQH 5E7FA 1QSVA 5D7LD 4E0RB 3I2CH 5ALCL 1QVOA 5K9KB 2IG2L 3KWWA 1ES0B 1AI1L 5KW9L 4MQSB 3VDBA 3LIZH 1JGUL 3CK0L 5SWSB 3GJFA 5DD5L 3FRPA 25C8L 1ED3A 3F58L 5ALCH 5HHQB 1KTDA 4M3JA 3QIBB 1DUYB 1ED3B 4Y5YC 1NMBH 2DKSA 3GI9L 1JI1A 2YBRB 3CX5K 2CXKA 5IVZA 3JXAA 1MAML 2MJWA 1WT5A 4IMLA 4QKXB 1L0YA 2FD6L 4KKBD 4L9LA 1UWXK 4UV7H 4IJ3C 1SBBA 4F7MB 5C0BE 4RWYL 5EG6C 1BZ9A 3OJDA 3D18B 4HWEL 3WFCL 3DVGA 3LKRB 4OQTH 2R0KH 2NW2B 5FK9B 4H88L 5JDSB 3KPRD 3IKCB 4LDLB 1AH1A 4HGWB 5FK9A 2Z8RA 3DI3B 3V5KA 4U1JA 3VFTB 5GRYA 2F54E 3MROB 4OCYH 3CMOH 3DLQR 3TA3C 4XVTH 1KFAL 4Y4FA 5IFJB 4V2BA 2HT2C 1YY8B 5EU4A 3D9AH 5T5NF 3GSOB 1WAAA 3NZHL 4ONFL 5FYKE 3U7YL 5K33A 2FLRT 3HZKA 5E1AB 2XWJA 4NQDE 3BD3A 3ULVF 1B0RA 1KJ3L 3TIDB 1R5WA 2X7LA 3C8HA 3GKWH 5DF0A 4I2XA 4EDXB 5H94B 1NFDE 1QD0A 2VLRB 1LO0H 1UWGL 4PV9A 4D9LL 3HUJB 2ZNWA 3BIBX 5EU6A 4I2XB 3F7PC 4EDXA 2IANE 2R1WB 1BLNB 5BCAA 3M17B 3QI9B 5MP6L 4TULL 2OSLA 3NCJH 1I85C 3K74B 3VRIB 1UWGH 4AYFA 1ZA3B 4XNZB 2PO6C 1AO7E 4LCWD 3RVWC 4HT1L 5EZIH 1AY1H 3ROLA 3TZVD 4Z7NE 1GHFH 4YHML 1BBJA 1G9NL 1ZVHA 4ACPA 4RAVB 1JK8A 2SEBA 3QRGL 2GTZB 4ODWB 5E1HB 4JFZH 1BBJB 1F02I 2R1YB 3L7FB 3B43A 5ETUB 4RFOL 4MA7L 3WN5A 5IMOB 5C3LD 2QQKL 7CGTA 1D9KD 2R0WH 2XY1A 3TNMB 3KLAB 1UJ3C 3O3BA 3FB8B 1K4CB 4X5WA 5IW3A 1PD6A 1KT2A 3MXWH 2A1WH 1IGIH 2H6PA 2RJMA 3CFDB 3P4OA 12E8L 3B9AA 3SE9L 2DM2A 1QSFD 2EDNA 1O7SA 2HTLD 5ANMB 4FQ1L 2PXYD 4YHKL 3I6LE 2NXYC 1J1OH 2ICWI 5CS7A 1LO5A 1W0VB 2X4OB 3VFMA 3SDDA 5KSBA 4X4ZA 5FKPA 1WTLA 3AGVA 2F74A 5CILH 2AGJH 3LKQA 4XP9L 5GJTL 1YPZB 5FM4A 1CT8B 2BSRB 1WZ1H 3AB0B 3NAAL 4XP6H 5IEKA 2ZUQC 3T08A 3MGTA 4Q9RH 3A0OA 3OKEB 4X7EC 2GIYA 2EEDA 5KSAA 1DQML 4CJ1A 3X14A 1YMHB 3D0VA 5EIIA 4JG1H 2IQ9L 1N26A 4LEXL 4LSRH 5J6GA 1INDH 4ELMB 1M7DB 3GIVA 5KS9E 2Z93A 1HKFA 4TNWF 1UH3A 2FWOB 1KEML 1J1PL 5F3BB 4NUGH 1OARH 1J12A 5E8EB 4Z76A 4RGNC 5GS1C 2EDWA 4M43L 5IGXH 1IZJA 1EMTH 1F11A 1ND0A 4MD0B 4TSAH 3SCMC 3SQBA 4ZAKB 4MQXC 4PUBH 4QNPF 4QXUL 1ZT1A 4IHOB 3PL6B 1S9YA 3S3PA 5GGTH 4Q9QH 1UA6L 3UX9B 3PL6A 3R4DA 3IXAB 5I74B 4LLVA 3BW9A 3ZDXF 4LOUC 1PSKL 1AD9B 1U8HA 1QRNE 1YMMB 4N5ED 2EDEA 5E8OA 2A74B 2NLJB 1AY1L 3TO4B 1P7QD 1QSZA 5DSCA 4JR9L 2ORBL 4MB3A 1NUNB 1KPRA 3EYVA 1D6EB 2ADGA 4QRQB 3O45B 4MVBC 1MVFA 3LN4B 2DQHH 2R0WL 2EE9A 3T4AA 1QR1B 4NUJA 4NGHL 1E6OL 5CIPA 1UM5L 2VXUL 1U8QA 4OZHE 3X13A 3MXWL 1RZ8A 4KPHH 3L3KA 4Z0XA 5I73B 1INQA 4JM2A 3MLVL 1S3KH 3EJYC 1BQLL 3IS1X 3CXHJ 4LHUD 2W38A 2YN3A 3PGCA 1FFPA 3WO4B 2C3GA 5D1QC 3MRLA 4NDMA 4U1HA 4ZNEA 3I85A 3SDAB 1GRWA 3K8LA 1J5OL 5IK3B 1MH5B 1WFOA 1NEUA 2R56L 4R26H 1V3MA 1QLEH 4CN1A 5I8OH 3QCVL 1U36A 2QQLH 2WW8A 5JHDE 4MX7A 4YXLL 3PQYA 1BAFH 1NCBH 3OXRA 1T7XA 4DGIH 2CO6B 2YXFA 3C2AH 4XZUB 3ARFA 4URTB 1RZFH 1X5AA 3MJ9H 1BX2B 5C0AE 2ZOLA 1XF3B 2FYYA 3VG9C 5DVNA 2DMKA 1FCCA 1NDGB 1UWEL 3LRGA 5C09D 4MGXA 1JWSA 2Q87A 4NRYA 5JPNB 1V7NL 2OR9L 4X9BA 3V8OA 4Y4HA 4LLQA 1MCRA 4M8VA 4MJ6A 3QZWA 4C4KT 1CTNA 2XZAL 5FYJL 3IGAB 4YAQB 1AR1C 1U8MA 1U3ZA 3I6LD 1WAAE 4MS8A 4DGVL 2UZXB 4FFVD 2VISA 1HHJA 2APVA 2XZAH 4WWID 3V6BR 4XAKE 4JFEB 1X5IA 4OGAD 3WL9A 3N9GL 2BSSA 5J57B 4QHLA 3HZYA 4I0PD 1JWMB 2DWDB 3LQAL 5DJDB 3GMNA 5C3TA 3U0WH 3V0VA 3BDYH 2D9CA 5MENA 3ZKXB 2AJYL 3OXSA 4S1DD 5IW1B 4ZTOL 2ICCA 1Q72H 3C6LB 1S7QA 2DQHL 1LK3L 1YUHB 1W0WA 2HLFC 3BN3B 1EGJA 1P4BL 3TESA 4Z7WE 2HFTA 3RGHA 5JORB 3TWCH 3DX8B 3L3HB 3EOYG 3MOQA 3IKKA 5DHYB 1HZHH 4FXKA 1RU9L 4HV8A 4B41A 4CMHC 4GAJH 4I77H 1XF1A 1YN6A 3UXFA 1BOGA 3OBAA 5L7XL 4BZ1H 4S1SH 4BK4A 1ZSDA 2Z31B 1JGUH 4NN5C 1VB9A 1IT9H 3FB7B 4AEHH 1FFQA 1PW3A 5JHDA 1CF8H 1VPOH 5ENWB 3U0PA 2KZWA 2YKLL 3RDTC 2JLLA 4PJCE 1RUKL 4HH9B 3U0PB 3JV4A 5CGMA 5L2JA 3BP6A 2NZ9C 5D70L 4HC1A 3RP1A 1QSFA 1MF2L 4U2ZA 3SE4C 1VDGA 4JPKH 2Q6WA 5BW7C 1NJ9B 4V1DB 3REVA 3GMLB 2GEEA 2LE9A 5TGBB 5L9DH 1N5AA 4S2SB 2APXA 4RAHA 4KMTL 5AD0A 5IJKA 1NCUA 1G9NC 3SDXA 4FQCH 3QPQD 5E95B 5F9OL 4B0MM 5HJ3B 5CD5C 3QQ4A 1EZVX 5J1AB 1RUMH 4GH7B 3OG6B 2B1HH 1P2CB 3ARDA 1AHWB 5ADOL 3FCTB 4G59A 4YIQA 4YHNA 2P5EE 4G9FB 3GJFB 3D25B 1FFOA 3RHWF 2ICWB 2HH0H 3LZFL 2Z9TA 4S11A 1MRDH 4Y4KD 2DL9A 1ZLVH 2DIBA 4WGWB 3DO7B 3ZMRA 1MFEH 3CVHA 3RGVC 4HZLA 4MJ4A 3CDCA 3MLRH 3QIWD 3H9SA 3ULUF 1IAIH 4KY1H 2FIKA 3R8BB 2DQCH 3ZSSA 1I3VA 1ZHNB 2EZ0D 2I60L 5T1LD 4X8XA 3LPGA 3LHPH 4MSWB 1ZHNA 4CU7A 1J1XH 5E6IB 1U2HA 3MJ7A 4IEFB 5HDQH 4F7MA 2EDKA 4LKCA 3LQAH 1OGTA 5I1LA 3TBSB 4NZRH 2C3WA 3HR5B 4NQCA 4HIEB 3MV9A 4APQB 1QYGH 1WBZB 2IG2H 2VABB 3KYOA 3IDMB 1OOAA 3FFDB 2NX5A 5I0DA 1LD9A 1QSFE 4O2EA 1UKTA 3VXPB 4NQXB 4JDTH 4KH2A 3HZYB 4WO4D 4U1GC 3RVVD 3NIFE 2ATPA 2ZJSH 3ULUH 1AIFB 4WHCA 1RVFH 2C4FT 3SDXE 1OPGL 4MJ5B 1NQBA 4M7JL 4O51A 2B0SH 3C5ZA 2HMID 4YWGL 2HTKD 3I6KA 3DTXA 4RMSA 2PYFA 1OTUD 2JK5B 4YNYA 4MZ2A 1SMOA 3ISWA 1P4LB 4Y4FC 4DN4H 3D18A 3WJJC 3V4VL 4Z7UB 5F1IB 1OHQA 2E27L 3ILPA 3O8XD 1RSFA 4GMTL 4TNVK 3KNBB 1S7TB 1CDGA 5TQ0L 5I18L 2YA2A 4JO1L 4XNYH 2DMCA 4PJFB 3L6FB 5JOFA 2XRAH 2BVUA 3DHJA 4J3UA 1EUUA 4PJHF 2Y5TB 1URLA 2DQTL 5CINL 3VFOB 3GKZA 3THMH 5GS0L 4H88H 4LPWA 3OF6A 2X2YA 1BOYA 5GJSL 4V1DA 2N56A 5T3ZH 3LKOB 3MGOB 4GMSL 4OB5H 4JN2A 3ZTJH 4TSCL 4WFFD 1T1XA 1T83C 3FT2B 2Z31D 3PJSB 1I9IL 3QHTC 2HVKA 4P2QD 3D9AL 4WVRA 5ELIA 5J12B 4QYOA 5JTWA 1CFNB 3MUJA 3JWDH 5F7KC 5DHVB 3VE0A 2XA8H 1KG0A 4LCWA 3U6RA 3KPQA 2DYPB 4HPYL 2P8MB 2I9TB 4V1DD 3MLXH 3LH2L 1CXIA 2Y07H 3MNWA 1OGAE 3D39D 4ZXBC 2Q8AH 5CEYB 1R3LA 1LVEA 3LDBB 3GK8L 1OAKL 1AFVL 2NY2C 3RNKA 5HHXH 5IB1B 1V8HA 3QR2A 1XGRB 3FRUA 1P4IL 2X1OA 1I9RH 1LO3H 5HHNA 1JPSH 1BQLH 1KF9B 4JM4H 4TNWK 1YNLH 1BP3B 4G8FA 4FFZH 4KKAC 4L3EA 4PD4J 1Q0YH 4UU9B 3PGDB 4ZO9A 4PJ5D 1XZ0A 5HYSB 4UB0H 4UT7H 3CDGB 3HI6L 5HGBB 2XFXB 4M62L 1SHMA 1NSNL 5ESAB 5DRWB 1NGQL 3QQ9D 4IS6B 1FPTH 4FNLH 5DVKA 5E08H 1YEHH 3MV8B 4KV5E 2AJ3A 3V79C 2P24B 3LQZA 2VH5H 2X70A 4NKMB 1S7RB 1NGQH 1F8TL 4PB0H 4GXUN 4M7LH 3OB0H 4S10A 3RWCB 3MJGX 4G6AC 4FXGA 2DD8H 5ISZA 3QNZB 3CFEB 4D0DA 5F6IB 1GZQA 1KC5H 1A7RH 3QCUH 3D0VB 1G7IB 3EOTL 5JQHC 4XP5H 4ZDHA 1B2WH 3HE7B 4R8WH 5GHWH 5H94A 1JFQL 3CFBB 3BP4A 2HYMA 4L4JA 5DD3L 5IJKC 3WUWB 3PHSA 1K3ZA 2VNCA 3QDGB 3O4LE 1OSZA 4MNHA 3CZFA 3B9KB 4TN9A 3KPSA 1BEYL 1T21A 4JZJB 3GMPA 1MFBH 4PJDE 3H3PL 1S7SA 4N0RA 2DM3A 2E9BA 3IFPA 2A38A 5SWSD 1CL7H 1RULL 4HX1B 3AFLA 2VLKA 1U3HB 5E2WH 1PZ5A 1RIHH 5B8CA 5ETUA 1WZLA 2WIIA 3QPXH 5T3ZE 5EOCL 1N0LA 4X6DE 5MEOA 5D96C 1U9KA 1NFDF 1SM3H 2VDKL 4OCWH 5CZXC 3IDGB 1IKFH 2KQMA 4S0UC 1BVLA 1CGYA 4QRTA 2ZOKA 4WDIA 4KI5C 2Z4QA 3CGTA 4ELKA 1P53A 2FHFA 1YJDL 4OKVA 3SY0B 3OAUL 1E27B 1R3JB 2FYYB 3BEVB 3GJFK 4MXQD 2VLME 4I8DA 1H8NA 3T2NH 3HUJA 5EU6B 4U1NB 3M1BB 4QOKE 1NMCC 1A7QL 2CXGA 4LU5H 5F1KC 4W81A 3QHZL 4KQ3H 5A2IH 5KANG 3UYRL 4F33A 4AT6B 3W81A 5LBSH 1YA5A 2PYEB 5HHOE 3V0WL 4F15C 4NN6B 4YHOH 2VDPL 4GG6F 4LHJB 1C16A 1FLTX 1IARB 1YYLH 3N85L 4LNVA 1Z9MA 1T89C 3DRQA 3STLB 4I0CC 3DV4A 3HZVA 3IJYA 4PREB 2QL1A 3VD4A 2LQRA 1AGBB 2XZCL 2EIEA 3PNWB 5F70A 3HZMA 2X1WL 3QDJE 4ELMA 1MH5A 4FP8L 1FNEB 1XGPB 4GKZB 2ERJC 3K1DA 5I1EH 5GGTA 4KROC 3SGKA 2AKRA 2I07B 3LEVL 3NVQA 4MXWH 1FV1B 1S78C 4OZGF 2CLRA 3HMXH 5F88A 1N2RA 3PWPD 1XR8B 1KPVB 2AQ3A 5GRZA 4FQXA 1JPTH 4KGLA 2FJFA 1OAQL 2YUVA 2EECA 5B38A 4K8RH 4H1LA 5C7XH 3SE8L 5L8KB 5HXMA 3LKNA 1FJ1A 4JG0H 5I15L 3IXAA 1EBAA 1PX4A 3RZCA 1GC1L 2WUBL 1KCRH 2E9WA 4PRHA 1JN6A 5LWYL 4NIKB 3MJ9L 1LGVA 3QISA 3AUVA 5C09E 1HH6B 4EUPB 5AAWA 4ORZC 2OK0H 2ESVD 5IM7A 4EJ1C 5GSRB 4R2GC 4EUPA 1IQDA 4KRLB 3QJHB 3NABL 5F7WC 4X6CE 2W60B 4FQIH 3DMMC 5F7LB 3ORJA 4PJCB 3SDYH 2NXZD 3BYTA 3Q5TA 3HAEA 4JFDE 1S7WA 3SDCB 4F7CB 2QKIB 5DYOB 1YQVH 5HHMB 5FCUL 5F3BA 3IDIA 4EZMA 3BP7A 2YD2A 3F8UB 3OKKB 3WYRA 3IDIB 3O2WL 4F37F 2R0ZL 2DTSA 4WU7B 5D7KD 3W0WE 4NP4H 1FNGB 1Y18B 1I9JH 2Q8BL 4TTDC 4F9PC 3BH9B 3MO1B 1F58L 2OJZH 3WNPA 1T2JA 3OG4B 1FORH 1TJGH 4JFDD 5F7EL 4YEFA 1OLLA 4CN6A 3GBML 1QNZH 3MRGA 2IJ0C 4K55A 3CZJA 2J4WL 2CDEB 1FIGH 2BXYA 4DVRL 4OM0L 3M8OL 4PLNC 1DBBH 1QEWA 3DV6A 4FQQA 1VKXA 2YA1A 4L8DA 4JPIB 3EJZC 4XWOD 1F3JB 3FMGL 3VCLA 2Y36H 5D7IE 1JGVL 3H7BA 4K3HA 4WWKD 4ZYKB 2A6JA 1RK1B 3H3KA 3EGSA 5EB9A 1IC7L 1A8JH 4PTUA 5CILL 1IGJA 1RZ8B 5D70H 4UV7L 1JPTL 2C1PA 4LASL 5BXFA 4P57A 1CTOA 3LRSB 2O5XH 5E9DE 1IEAB 5F9JB 1WWWX 5EUOF 2GSIB 4G6JH 4C83A 3CUPA 1UENA 3VXSB 3TBVA 2NY5L 1EX0A 1R3HB 3UPRA 5D1QB 3QNYB 2O93L 4M1DL 3KPMA 1BVKA 1U8LB 2NZ9D 4AEEA 2X89D 1EXUB 4QHUA 5FHAL 4NUGL 1BFOA 1QO3A 5HDBF 5MEND 4M61B 3MR9A 5L88L 5T3ZL 2VLJD 4WI9A 4FQXD 5CJQL 3MXVH 1LQSR 1JUFB 1AKJA 5DZOA 4Q97A 5D7LE 3H6JA 4NQUA 4NO3B 5C0IA 3SDDB 3PWVA 3P4LA 2QR0B 4H0IA 3GKWL 4HCRL 1WF5A 4YAQA 1RFDL 3KNBA 1VGEH 1B0WA 3K81A 3WLWD 3G6JB 5DQJA 3NBNA 1BD2A 2G60L 5T1MA 4OTXH 4DZ8A 1WITA 4RMWA 2ARJA 1KB9K 3QIWC 1KIPA 4RZCA 1RZ7L 4RQQB 1GZPB 2ARJB 2R2BA 1LNUA 3FN0L 3V4UL 4MB4A 5C0EA 3CD4A 5DUPL 1FCGA 2NY0C 4YEEA 1G7QB 5D1XB 1RZ7H 5HHMA 4N9OB 4JANA 4N0CD 2Z35A 4X5XB 2PW1B 4IOIA 4W6WB 3VFNA 4UNVA 3QQ4B 5D2NC 4JDTL 1R5WB 1V7ML 4Z7QE 1G0DA 2OL3A 2HKHL 5ANME 5JA9A 5GXBB 1QRNA 3ULUL 4NJAH 1RIUH 2R1WA 4J6RL 5D1ZA 3RL1B 3HLAB 1U8IB 2NY2B 1UZ6F 2G2RB 5D1ZB 3WV0A 1HH9A 1L6ZA 3V0AC 1RD6A 1QSEA 4P5MA 1SBSL 2B0SL 3FFCE 4MNQD 1FGVH 4JFHD 3BO8A 2D7OA 3RWDA 4XP4H 3HE7D 1HOCB 2VKXA 3G5VA 1U91B 1BBDH 1FZJB 1VGKA 4XPAL 2ED8A 3SKMA 1HOCA 3KLAA 1IGYA 1BZ7B 3EGSB 1ZLVK 1QFWI 4P2RE 4F57L 3QEHA 4FQXC 4BH7A 5DD1H 3WIFB 2CUMA 5E2WL 5I1JL 5J1SC 3QWQB 1EK3A 2VLKE 3QIUC 5HD8C 3QFDB 3QIUD 3NMEA 5EOCH 3WUWG 1UJ3A 2F53E 3DVFA 4TNVF 4M8QB 5ACZA 1WUNT 4GS7B 4XCNB 5D6CA 5ITBL 2H8PB 4MJIE 5BQ7B 4ODBD 1Y6NR 1Q94B 5EU6E 1A3QA 4Q6IA 5CP3H 1XCQA 4TPRL 5BVPL 5TE4H 2F54B 3RDTB 1OP9A 5FEBA 4RGMC 4Y1AB 1NLDH 3TT3L 5HHQA 3U48A 3HHRB 3UTZB 3DRTA 2EE6A 5CWSB 2P43B 5E2VL 2EO1A 3CX2A 3MUY1 1OTSD 5CUSL 3UROR 1BFOB 3BPNC 4TPRH 4ZO8A 3MJ6A 1QLFA 4E42A 4PP2A 5IUSA 2AABL 5HGDA 1VADB 4QNPE 4JM4L 2IGFL 3TNNB 4FQJL 5GSVA 4H8WH 2PF6A 3MLVH 3WFZA 2ZUYA 4JRXB 3WJLA 1MFDH 4P9MH 5FDWB 3Q5OA 4PLOB 4K7FA 3GUTB 4QGYA 5I1DB 4UT7L 2Q76A 1UM4L 3OJMB 2XICA 1XGTA 1ZVSB 1XH3A 5J11C 2YZ8A 1UVQA 1XIWB 2EXYD 2OLDA 2PNDA 2KL6A 3L3DA 4U1MA 4EQ2A 1JZ6A 3U4EB 4FFZL 3CDFA 2VZOA 2GYSA 4KRNA 5ERWA 2OP4L 1T0PB 4DZ8B 3TP4A 2BMKB 4RDQF 1EHLL 2IANA 4NZTL 4FFYL 4HUUA 5MERA 3G04B 3L1OL 1DFBL 1KN4L 2ATKB 3QIWB 2JELL 3BQUD 3DSNA 4U3HA 4HK3N 3ARYA 4XP6L 1DVFA 2AEWA 1YEHL 5ID0A 4I4WA 4IOFD 1NEZA 2PW2A 4PJEE 4UZGA 2J8UE 5GRUL 4P3WA 4AL8H 5BRZB 2Z8VC 5CLTA 5F9WC 1WWCA 5E6YA 1D9KA 1KPUB 5IMLB 1MUJB 2OK0L 2VXTL 1B3JA 1RUAH 3TA3D 2HLAA 1GPOL 4QRRE 4EI6B 4L4TD 5GS1A 5E00A 3RWEB 4MQ7A 1JF1B 5I1JH 4OSUL 4Y2DB 3K4DA 2GFBB 1KCVH 1TVBB 5DZLA 1EJOL 4PJ9B 2VWEE 3RL2A 3ULSB 1KEGH 5JIKA 3H9HA 1QSEB 2ITCB 4XCCL 3NA9L 2FO1A 4P2QA 4PRAB 5H35B 1UFUA 5DFWH 2XKNB 2ADFL 1A4JB 5I30H 3CFJA 3U7AA 1EA9C 1K5NB 4D0CA 5GGRB 2WUCH 2AK4E 2ZG1A 3CNKA 4UQ2B 2XQBL 1V05A 2NR6D 5F7MC 3D3VA 1DQDH 1T20B 5E99L 3K8KA 4ZPTB 1QHPA 3W9DA 3TBWB 3QQNA 1EDQA 2M26A 5ANMA 1E27A 1R3JA 4W6YB 2EIDA 2NY7L 2B2XH 1M4KA 4L3ED 3OAZK 5D9SA 2DQGH 2B7DT 2Y7QA 4E41D 3L3OA 5BVJA 5JXAL 2YK1L 2BSTB 4HF5L 2NX5E 3B2UC 3Q5YA 4M3KB 3GHBH 4LLQB 3KPQB 1BIIB 2APFA 3T0EE 1WZMA 2OJEB 3MGTB 4YH6A 3KXFB 5IFAH 2YMXH 4WIQA 3E6FA 1CT8A 3S5LG 3VG0L 5CLWA 2VR4A 1JK8B 1SMAA 4MXVE 4NZTH 1GSMA 1RPQA 4HBQA 3ARGD 4OF0A 3WFCH 4CVWA 2VDPH 3OR7A 3T0XA 3WNMA 3MUGB 4EXKA 4ZXBA 1XGQA 3QUMA 3FMGH 3OF6D 1I7UB 4Z6AT 4XNQB 3V52L 2AKRB 4G8FB 2I24N 3VJ6B 3ZT6A 3I75B 4XHJD 5ADPL 4PB9H 5KS9A 3L9RA 3T8XA 3QUXA 1MPAH 3C5SA 5JQ6H 4M02A 2F9BT 3MV9B 2Y4SA 3U4EA 4KXZI 4L5FH 3L7EA 1WWAX 4ZAKA 1GXEA 1RZKC 4HUXA 1FJ1B 2CDGA 3TVMA 1N4XL 2ED7A 5F9OH 4HFUH 4G3YH 1IC4H 2WLZA 1JN6B 1AR2A 1AJ7L 1CICA 3DXAD 4GUPA 1YEDB 3BP5B 3W2DL 4PJHE 4D0DB 3CMOL 5IR1B 2AK1L 4IRZH 3HS0A 1FZKB 2ZOKB 4WDIB 3WJJA 4C54A 3LZFH 1NFIA 5FB8B 4XCEA 2DQFB 4K94C 3LN4A 1Q9OA 1K3IA 5FB8A 5L2JB 2VXVL 4OLYL 2NR6C 1FN4A 1FSKB 4P23C 1SVCP 2Z8SA 2FX8L 5AZEH 3AS3A 2BNQB 4UQ3A 5DHVH 1H0DA 2I9LB 1U8OB 3QG6B 5JMOC 5BZWA 5FECA 4EVNA 1IGJB 4F7EA 3WUWA 5DK2A 2HWZH 3NCYP 5C08D 1REIA 2I5YL 2VAAA 5DFVD 2FX8H 5BW7A 2G5RA 2NY6C 1NL0L 4JZJA 3QWRA 2VSDA 4QXGL 2Q8AL 3ARDD 4DKAA 3N1FC 2W65A 2ILLA 4CDGC 3TV3H 1YPZF 4Z7QF 2UWEF 3BJLA 3O6KL 4Y19D 2VXQH 5DMGD 3HFMH 4GSDL 3DX7B 4QXTA 4NRXA 1H3GA 1CBVH 4S1SL 3U9PH 2YMXL 5EU5B 2VZ1A 3ZO0A 5ESQB 4LLUA 2PCPA 1N2RB 4PD4K 2E9JA 3BHBA 3RNQA 8FABB 5MHSD 2AGJL 5GJTH 4TTGA 4JO4H 4PJ5E 1IM9A 5GIRA 4OZHF 2WBJA 4D9RE 3QWRD 3FFCD 4NO2B 4YHYB 5J7CC 5JIIA 1QR1A 2BXZA 5ICYA 5C0JA 1SJHB 5TQ0H 5HYFA 5I18H 5KN5A 2ERJB 4IRJD 5F21B 1BGXL 1BBDL 3P9MA 4CVZB 1IKNC 1OT2A 1CLYH 1NGWA 3ZYJA 3QHFH 3O2DH 5E2TH 2JIXB 3RUGA 5CEYA 2JF1A 3JV5A 2W9DL 5IG7B 1YY9D 4XNMA 2KH2B 1HWHB 5EBWA 4NT6B 1A22B 3O2DL 4KKLC 5E2TL 4F8TA 5GZOC 3ARFD 5IK3A 3JV6A 1IM3B 1BQHA 5BJTB 5EBWB 3NFPB 5DMYA 1VEPA 1EXUA 4QHUB 1EO5A 4PRDB 1JWMA 5CP3A 1LE9A 4Y5XB 4ZPVB 4OFYD 2IBZY 1RZKH 4O02L 3OKLA 3B2VL 4GT7A 2CLRB 2VSCA 4LDEB 5CGTA 5MENE 5K93A 4M1DH 5EDXA 4AY0A 2H45A 4O51B 5B38B 4GMSH 3ES6B 1YEEL 3VGHA 1EPFA 2EZ0C 1NDGA 1HIMH 1FE8H 4XC1H 5JOPE 3ES6A 2VDQH 3P9LA 3QUXD 1MHCA 3AXLB 3BKJL 1YYMH 3G9AB 3VA2C 1KNOB 5D4QA 3F6LA 3TM6A 2BNRB 1C8PA 1E6OH 4LLWB 3O6FD 4LSUH 1JYWA 3TN0A 1GGBH 3MRKB 4ODSL 4PG9B 3SDAD 3FZUD 4FQPA 1RFDH 1Z0NA 3U4AA 1RK0B 4QRSB 2GKIA 3VU2A 4MA3A 2D4FA 2IQAA 4OLXH 5ILTH 3IF1A 4RMUA 3CZFB 4LCCA 3V4PH 3OHXB 2VC2H 3VWJB 4WU7A 5TE6H 4TRPL 1IGFH 1V7MH 3WXVL 1UT9A 5LKNA 1Y0LB 2GSGB 3NZ8B 3FJTA 2OTPA 3BP7B 4JLRB 2H2SD 4C58B 3S34L 1VSCA 5I8CA 3MQIA 3PDDA 2EDHA 3MV8D 4K8RC 5KJRL 5SX4I 4QYOB 1UG9A 1U8JA 2L7JA 4X4ME 3OTTA 4HG4K 2QHRH 3BQUB 1JRHL 4HUKB 1U8JB 5ECJE 4C56E 5E08L 3S88H 4JJHA 1FZMA 4ZXBD 2FR4B 4PJ8B 5DURB 1YDPA 3UJJH 1T2QL 4CRPA 2W0KA 3QH3B 3CVHB 4L8DB 5BRZD 3VFGL 5I9QB 4WO4C 2PCPB 1MCSA 2H26B 1CGUA 3AB0C 4YJZL 1WVZA 1INDL 2A6JB 1MHHA 2J8HA 4PGDA 3ZE0E 4MLIA 4AL8L 3UJIL 3GJEA 4JKLA 4OLVH 3VWJC 3VXTA 2F5AL 4M6NH 2ADGB 1IGTA 4LGRB 4LCYA 4AIZA 5JW3L 5HYEA 1ZT4B 1OY3B 3U9UB 4GBXB 1VFOA 4UBDC 3D3VE 1ITBB 2AW2A 2J3SA 4M43H 5IGXL 1P9MC 4XP5L 5HYSA 3TC9A 5B4MD 3HCVA 5T5NG 1KCUL 2PYEA 3FZUC 4OB5L 4AH2A 3DXAA 4MXQA 1G7PA 4JDZB 5DJ8B 4M8QA 2CKBB 3QO0B 2P8LB 5FYLH 2XI9A 4A2MA 2XPGB 2YPKA 3TBVB 3GSXA 1JHKL 4OM1H 5I6XB 1I8IB 4LRNL 2F53D 5F96H 2QADD 3CUPB 3KJ4B 5D1QA 3W9EB 4GRLA 1EMTL 3U30C 4KZEH 5C0EB 2OL3L 2GCYB 5L0QC 4GRLB 1NBVL 5H8DA 3RWFB 1T89A 3SDAC 2AQ1A 4I18A 1UA6H 4DAGH 3KXFE 3RWFA 2ZG2A 4LSUL 5BOZG 4IM8A 4IRJB 3OKLB 5E99H 1HZHL 3TNNA 5IW1A 4XXCA 3V6OC 5EUKA 1AO7D 1GGCL 1OTTC 2DKMA 1B4JH 1OTTD 4N90D 4R7NB 3WKML 2N7AA 5CUSH 1TXKA 4QRUA 3WJLC 4FRWA 1OL0A 4WEMB 2E6PA 3CVHH 4HSQA 4NOBA 2VQTA 1Z9LA 4JM2C 4PJXE 1MY7A 5JHLH 1SYVB 3PWNB 1JHTA 5T3XD 4BQ6A 1VFAB 3QEUA 3TCLA 1JE6A 2X4NA 2QJDA 3CFJB 4YDKH 5CEXA 3BEWB 5MI0B 1A9BA 1CFQB 1R5VA 4R6UA 2OM5A 3CCHB 3O11B 2BNRE 5FM5M 4I3GA 3I50H 3GO1L 2HT2D 3MJ8B 5DJZA 4QY8B 4Y4FD 1JWUB 3FQUB 4PY7B 3VXOB 5J1TC 4XB7A 1BZ7A 2ID5A 4N0UB 4O9HH 1I1YB 5EU4B 4PY7A 1VENA 3V6ZA 3PV6A 1KOAA 3T0DA 3QEGL 3RKPA 3GO1H 1TZIB 4RFEB 4JRWA 1AQKH 4G6FB 2R0KL 3X12A 3SCMB 3L95B 1MPAL 4XNUL 3PL6C 2BNRD 1P1ZA 1S5HB 4OGYL 1G9EA 1K8DA 3EYUL 4G9FA 5FA3B 5HHPB 3TJHC 1FO0L 3V5HB 4JKPL 4Y4KA 3VFSA 1KENH 3AS0A 3F12A 5JW5A 1UQSA 5LCVL 2R2HA 3EYUH 1ZHLA 5C07D 1C08B 4K7PH 3P0YL 2VR5A 3KAAA 4NZRL 3H3BC 1DP0A 5DD6B 4RBPK 4QWWD 3JTTB 2XQBH 4PJAE 4XNQA 4WHYH 2AERT 1MFCL 4KUCD 2VDRL 4OD3H 4DKFL 2HJFA 1G1YA 4YGAB 1CXKA 5J8OA 1TQCB 4F2MB 3FO9A 1IGYB 1PYWA 1Z3GH 1NJ9A 4JB9H 3VXMA 1JTTA 5IMKB 2NY7H 1XR9B 2JB5L 4D8PA 5I2IA 5EO0A 2PXYC 4HMDA 4JN2B 2DJUA 2NXYD 2FJFB 1WFNA 5IMKA 1QQDA 1JGLH 1S8DB 4BJLA 3KVQA 3TN0C 4XPTH 2VLRE 5F3HB 3VW3H 1X6LA 3F58H 3D39A 4BQ8A 3AAZB 1U93A 2WQRA 3FQNA 3MC0A 4M5YL 4O5LH 3GI9H 2EDOA 4NN7B 4IDJL 3OKOB 4GW4B 1NANH 3UC0L 2OMNA 2PO6A 2H1PL 3CFIC 4W68A 4AIOA 3KPRA 4PGBA 5HYJB 3E3QC 2Y36L 3QFJB 4GRLC 2HFGL 5JIHA 1K6QL 4XNXL 3NCFB 3LIZL 1A5FL 2YEZB 3F62A 4UTAH 1B6UA 5LQBL 3FO1B 3BMVA 1MWAH 3S3JA 2YEZA 2DI9A 1V5JA 3QXAA 1FVEB 3EKCA 5C0BB 4NQCE 4HXBL 1EO8H 3MJ7B 4LARL 5E4IA 2ZWLT 2Y72A 1KBGH 4OCLC 3V6OA 1J86A 2VLJA 4WHYG 3D69A 3S36H 4C56A 4L5FL 3CU1A 1E4XH 3H9HB 4TYUA 4ZQKA 3GSWB 4N90E 4WU5B 2NW2A 3BYYA 5D7LA 2DIAA 4U1JB 1WCBA 3GFUA 1FYTE 5D72H 3IETB 4WU5A 4G7VL 2BVQB 5EULV 4AZ8A 4Y4HD 4RBPH 5T1DL 4HQQL 5HHME 2BC4B 2XG5A 2XY2A 3LCYA 3BSZL 4F57H 1NCDH 4M1GH 1VHPA 2A2QT 3KLHC 1PAMA 3C5JA 3JWDL 1UB5A 4ZUUB 3IJSA 3VXNB 3TBWA 4QRQA 4YHIB 1UACL 3JSSA 5CMAA 1P9MA 5I8KH 4IRSA 3UTSE 1MJUH 1U92A 1MFCH 4HLZG 4XCFL 1JTPA 5FA3A 5HHPA 5FO7B 1CFNA 3C5ZB 3WMSA 3DMMD 4OTXL 3QYCA 1HIML 1J11A 1U3YA 3SJVA 1OAYL 1IBGH 2SEBB 1H9VA 3VH8B 4LSQH 2EKJA 2NMSA 2D3VA 1FO0B 5E9DA 3W39A 5B8CB 2XWTA 2CKNA 2F58H 4LSQL 2I07A 1T66C 3EW3B 3DUUA 2HG5B 1MCBA 4PYHA 1LHZA 3FONA 1E0OB 4LLUB 2UY6A 4Z8FL 5D2LF 3HAEG 3T77B 2AK4B 4Z7WA 3F7VB 1TIUA 3LSOB 3UTPD 5I73C 2PXYB 2BDNH 4CAGA 3KPNA 4JAMB 4PJ7E 2HFEA 4HS8H 5TDNB 2APWA 4NO3A 2FRGP 3RWJB 1PDKA 1XCQB 4AT6A 4K94L 5HYQB 4N1CA 1B88A 5EU3B 1DL7L 4R97B 5FKPB 5I8OL 4HLZH 2VL4A 4XP4L 3QG7L 3VXUD 1ZA6B 4UI2A 2Q86B 4G43B 4P59H 2C5DC 1NCBL 4ONOA 4GAFB 4OF7A 3U2SB 4FOMA 3QEQA 4R7DB 2I9TA 3E6FB 5DEFB 2VISB 3CPLA 5GSVB 1KN2L 2LU7A 4PG2A 1CICD 2H32B 1EIBA 3QUXC 1CICC 1KB5B 2J5LC 5J6GB 1N59B 5FDWA 1A64A 2A73B 3MA7A 4JFFD 4QXUH 3R0MA 3OB8A 4M1GL 4EN3A 5DLML 5LXGL 4XHJC 4ZAKC 4ETQA 2WM0A 2LAGB 3QIUB 3H9ZA 3P0VL 3ZDZE 3GSUB 3EBAA 5C0RH 4BH8B 2OL3B 4POYA 1YUHA 1UB6B 1ZHBB 4AQOA 1NAKH 3KXFD 4OCRL 4A6YA 4GRMB 4Z7VB 5EORL 1CIDA 5MP6H 1HINL 3LS5H 1D5ZB 2BVPB 2LFGA 3ULVD 2AEIT 2XKUA 3GSNA 3IDYC 5EBMB 2XN9A 4U1GB 4TUKL 3KGRA 2H32H 1UXWA 2EXWD 5I8EB 5C0AA 4Q2ZA 1QFHA 3DURA 4AEIL 3QZWG 1DLHA 4TTDD 4ZO7A 4NO0B 1DQJB 5CJOH 1CLOH 3Q2CA 5INCA 2HKFL 3SOBH 6CGTA 4WJ5A 3PQYE 5E7BA 3MV9E 4JM2B 3KPLB 3VI3F 1WISA 4MCYB 4Z18A 3BWUC 1GOHA 3SGJA 5I1KL 4Q74A 3VG9B 3X13B 1BM3L 1EHLH 1QBLH 1HYRC 1ZA3A 1WZKA 3BH8B 5GZND 3IU4L 5JA8B 4MNQE 4PR5A 3DV4B 4RMRA 3UBXB 4XP1H 4WWKC 5ILTL 4D0BA 4I9WE 2WY3A 4X4XA 1Z5LB 1AXSB 1QBLL 2ZKHH 4YX2L 2O5YH 4TRPH 4PJBF 4Y1AA 3T0EB 3VI4E 3WXVH 5B8CC 5JW4N 4XP1L 4K8RL 1MJ7H 2CMRL 4FFEX 3MRGB 2BVOA 1B0GA 4YE4L 3S34H 1KC5L 1QFUL 3OPZL 4YPGA 4NHCL 1G6VK 3UTOA 3BD5A 3TLRA 2HFFA 5I6XC 1Q9KB 4U31A 1QO3B 4JFQB 3BDXA 5JW3H 3LS4H 4MNGA 5K9JL 1W72A 1I3RB 2X5PA 1T1ZA 1T0NA 2HVJA 3BOVA 3EDDA 4OGXH 5D7IF 1F90L 5J11B 4TVPL 5JPNA 5ID1B 4V1DE 2FH8A 5I1DA 3X3GH 4QT5A 1QA9A 1OT1A 5ICXA 1JCKA 3ZL4H 3VGDA 4HJJL 3NCBB 5KTEL 2OI9A 4TUJB 4PJEF 2BHUA 2WMPA 3PXHA 3S35X 3N06B 4PJ9D 1I1AB 5T1MB 4PJGB 4KJWC 1C7SA 2VDRH 1ZXQA 1MREH 2VLJE 3G6JA 3LY6A 1WBXA 5MEPA 4PPTA 4DQOL 4R7DA 1FAIL 4RQQA 1YQ2A 3DRQB 4U33A 5EOQL 1JF5A 3NTCL 2OQJA 2EXWC 3BRGC 1HHGA 3LEYL 1X6NA 4YQXL 1A6UH 5E4EB 4LCUA 5DRXB 1GAFH 3MRQB 3X11B 3GMNB 3FKUS 2V2XB 3BN9D 3V6OE 1I3UA 4QCIB 4N0YH 3LMJH 4X98B 3T3MF 3X11A 3I9GL 1K2DB 4AM0B 4BH8A 2VIRA 1K8DB 1DBKL 3VMPA 4PJGF 5HD8D 5IBTH 4OGAC 2ZSWA 1OTUC 2Z91B 1BIHA 4N0YL 1S9XA 4HXAH 4PS4L 2JK5A 1UM6H 2B2XL 5DO2C 2GK0A 4JRYD 1CICB 4X7SH 1P4BH 1KJ2A 3GSVA 1WWBX 3KPOB 4TOYL 3IAPA 4QRRB 2DBJA 1YN6B 2FEEL 4N0FB 3BO8B 1A3RL 4PS4H 1H3XA 3QDMA 4J7RA 2CK0L 1LEIA 4G42A 4HKXA 4K3DH 1LEKB 5DWUH 4L3CB 1IT9L 1KIPB 1FIEA 2OCFD 1IL1B 4NQSA 3CDYA 2BCKA 1SYSB 1CZ8L 1BQSA 3RX7A 1RK1A 1ROWA 1E4KA 1TJIH 2E8YA 1ZE3C 2WLYA 1WQVT 2A6KB 4OV5B 3O2VH 1FH5L 1ZEAH 3QDHA 3H8NA 5DQDH 1MLBA 3AMLA 5BQ7A 4HIXL 1EHAA 1G7PB 3VWJA 2OTWA 1EEYA 5DT1L 1IGCH 4JO1H 1CGSL 1MLCA 1QKZH 4BZ2L 5IF0A 5D7IB 3MRLB 4G9FD 2HRLA 4ODXB 5HSFA 3RGVB 1V7NH 2OR9H 2DI8A 1CLZH 2J8UA 1H3PH 3NN8A 1J0YA 4LSVL 1UZ6E 1OM3H 1N8ZA 1LO2H 4LLDB 3GIZH 3O4LD 1J1XL 2IBBA 4HK3J 3O3DB 3RX8A 3K1KC 4OJFL 4P5KB 5F1NA 3GHEL 5AZEL 4OZFB 4EBQL 4YBQD 4NHUB 1QFWL 1RZKL 2GI7A 1EEUA 1R3KB 4YDVA 1NEZG 4PJBB 2O26U 1NGYA 3MBEC 5CEZL 3D85D 1IM9B 4PP2B 4RGNE 3B9DA 1W72B 1OGAA 2ZOLB 3VWJD 5CSGA 3O0RH 4Y4KC 2E9IA 3C5ZD 3C5ZC 2NY4C 2RFXA 1NUFA 4X9IA 1W0YT 1KJ2H 2DS4A 4OCSH 3U82B 3G5ZB 3LPFA 1LE5A 3UJTL 3IYLW 2J8OA 4NWUL 4NP4L 5DQ9A 5CZXD 3DOSA 2BX5A 1E4WH 5IHUH 3IS0X 4KI5D 3I2CL 1DJSA 1NFDA 2WBWB 3Q3GB 2I5YH 4M5YH 4O5LL 4W4NA 4NWUH 1LMKA 1RZIB 3RX5A 2FB4H 5D6DA 3F7RA 4PBVC 4Z78B 1A7NH 1JPSL 4J3WA 4XPGL 1HHGB 2CJUL 3VFRA 2FB4L 1QSEE 3S4SA 1H3TA 3MLSL 2V5YA 1FVDB 3IJSB 3REWB 4HC1L 3VG0H 1PG7X 1U8LA 2BRQA 4Y8DC 3AREB 3BGAA 1KPUA 5IMLA 1I4FA 5FAAA 4OFPA 1TMCB 2DQUL 3L5IA 4QLRA 5E00B 5DI8A 3HI5H 3SEPA 1DQMH 1YNKH 5DEGA 4KHTL 3VWKB 3SBWA 5ADPH 3KPSB 5C0IB 2D31A 4LSRL 1RIUL 4R4BA 2YC1B 3ECBA 5C9JB 1ZSDB 2Z31A 4ELMF 3IFLH 4WCYL 3PWUB 5A2KH 5DT1H 1IGCL 1NBYA 1PEWA 3HG1E 1RUML 4DN4L 2PTTA 4I3SH 3L3IA 3QEUB 5ALBH 3TCLB 3VGFA 1RHFA 3A6OA 4GRLD 4ZOCA 3P0VH 3KR3H 4NFCA 1DANU 3EFDH 3BGFC 4ONFH 3RTQC 3KHOA 3VFVB 4ODTL 1O5DT 3LN5A 2DN7A 4Q9BA 3F7VA 5IVXA 1XR9A 1SJVA 2PYEE 4IJ3B 3LN9A 5IHLB 1DN0A 4OCYL 5H2BA 1MJUL 2AJUL 4XC1L 1LO0L 2A0LC 2P42B 2P4AB 4HS3B 4ZTPH 3X12B 1J05A 1T1XB 4XRCA 2WBKA 4LAQL 4XC3L 2EYSB 4XVSL 2VDNL 1J05B 1J0HA 1HCFX 2AAVA 4LVOB 4ZFGL 3UTSD 1C1EL 2YXMA 1Q0XL 1XIWD 3BKYL 4QXWA 4UILH 4XWGH 1MCPL 3HLAA 1OAKH 5HHXL 4DKDC 3QWOB 4JJ5A 2DYPD 4LLDA 5DGRA 1E4KC 3H9SB 4IOSD 3VH8A 1TZHA 1UQSB 3OAYH 4XPHH 1DDHA 3O6FB 4OZIB 4ENEC 4CMMA 3FO1A 2VZTA 4XNMB 1D5BB 5FGSA 3DGCR 5HYIA 3VXRB 3STZB 1B4JL 3EYOB 5FA4A 3NFPA 4L8CA 3DWTA 3QHZH 1RJCA 4KQ3L 4CMHB 3T8XB 4I9WD 4R0LC 3ZKSD 1T20A 4RFNB 4GBXC 4R4ND 1T3FA 1HN1A 5TF1H 1NCTA 3TYGL 1QFOA 5DMKB 1DFBH 1KN4H 2DAVA 4J3TA 2F58L 3B8SA 4FMKA 5CJ5A 3DSFL 3C5SB 2AQ2A 3D39B 3MRMA 4X6CF 1F42A 2ZCHL 1C12A 1JI2A 3OPZH 1T1YB 1IGIL 1DL7H 3P73B 4JRXE 1PQZB 1MAKA 3U36A 2EICA 3MCLL 4DVBA 1T1YA 1MHCB 1L4IA 2FX7L 3TT1H 2O5YL 3UYPA 5JLZA 4OGXL 1GGTA 3EOTH 3D2UA 4M7ZB 2CGRH 4BELD 1JHLL 5DDHA 2F5AH 4M6NL 4R3SA 2V2WB 1AIFA 3U2SA 2IFFL 2KDGA 2OX5A 4QHNB 1Y6MR 1A2YB 3V9FA 1JNHB 2DD8L 2WV3A 1FG2B 2HAZA 3VFGH 3N0PB 3ZYZA 1NC2D 1EAPA 1FVEA 2IALA 1U8KB 3BP4B 5CGYC 3WNNA 2JCCE 5FYKU 4F58H 2NZIA 1B2WL 4NFBA 5FUZH 3EJJX 1HSBB 3RJQB 3DVNB 2MCPH 1U8KA 2NCMA 2IPKA 4XPBH 4R96A 3FTGA 4UT6H 5HGHA 1ZT1B 1DBJH 5E5UB 2DQEH 2CIIB 3ESUF 1MCWM 1FNAA 1AXIB 3DYOA 2F53B 4BQBA 1JL8A 1OP5H 4OZIF 4PUBL 3DROA 3RWGB 3ZKMC 5GZOD 4Y2DC 2C3VA 2K9UA 3MCKA 3IDGA 1TDQA 3TO2A 3QEQE 43CAA 2YK1H 2X4TA 3UAJD 5FCSH 1P7QB 1A7BA 1KXVC 4ODSH 5C8JB 2DIJA 1NMCB 2RHEA 1R5IB 4PJAB 3SOBL 4DCQB 1LO3L 4WWKA 2HVKB 1HXMB 4N8VG 4NQEB 1KCGC 1U95A 4L8BB 5DK0B 2VITA 4E41E 5E6IC 4X4YB 4CUCA 2HLAB 3NPZB 4KRMB 3ET9F 4L8BA 3TEUA 1ITCA 2C1OA 4GAGH 4OFYA 3RVUD 5I17B 1NGWB 4XH2A 3UC0H 3ULUE 4IIQA 4PRNA 5CJOL 2C1OB 5I17A 2EDLA 1HILB 2A6IA 3B5GA 1J0JA 4OUOA 2Q7YA 1K6QH 3MNWB 4XNXH 2C9AA 3R0NA 2GT9A 4J3OC 4C83B 4LHUB 3T0WA 1IGMH 4P2OB 4CMMB 4JVUA 4JZOA 2RR3A 2GJ6D 3FHQA 4W4OC 1LDPH 4H20H 5CSBA 4X99A 4R2GB 5DWUL 3FQTB 4U05A 1EFXD 3QUZD 3O4OB 2VZVA 3M07A 4LNRA 2G9HB 4MYWB 1HHKA 5FUCC 3HR6A 4F2MA 1KPVA 5DXWA 4LNRB 4IRJA 1KT2B 4OLUH 4WEBH 1S7VB 3O2VL 4WNQB 2NTFA 3BWAA 3MLTB 1EEZA 2P7TB 1KENL 1C12B 4X9GA 1I7TB 4U6HA 4K3EL 4XAWH 1XF5B 5I71B 2V7NB 5DHYA 3WIHH 4LCWE 4KJYB 5E8PB 4ZD3L 2ZUSA 1U0QA 4X9FA 4LLWA 1RUQH 2R4SH 3LQMA 3H0TB 4JO2L 3S35L 43C9A 3MODH 2V2WA 2EYRB 3IDNB 2DM7A 5HHVH 3ZE1F 3W82A 3TGXA 1R0AH 2BSSB 3P0YH 4OD2B 3JTSA 1IKNA 1H8OA 2VDKH 5HHVL 1ZLWH 4XCCH 2NNAB 3BRDA 5TH2A 4Z0BL 3OR6B 1M7IA 2VXQL 2D7NA 1VFUA 4UBDD 5E8EA 5B4MC 1CBVL 2HJLA 4YIQB 4YHNB 2D2OA 4QOKA 2CDFB 1I8LA 3U0WL 3W0WB 1NC4B 2C7UB 5D8JL 5E2UL 3V5KB 1HK6A 3DX8A 3PUCA 4Y19E 4KKBC 5E8OB 5CSZA 4JO4L 5JHLL 3C09C 2LTQB 2CLVA 3HFML 1Z2KA 3K4AA 5K59E 4K3DL 3C60B 1J87A 2AXGB 4YO0A 4WI3A 4NQVA 2ENYA 4YPGB 2VZSA 5DJYB 2XN9B 4C59B 2PUQT 1ZWIB 3GJEB 3WNKA 3VXTB 3HRPA 4HC1H 4JFFB 4WI5A 3ZE2E 1T83A 2W9EH 5IJVA 4BSWB 4PTTA 1A6ZA 1RUPL 1ZHKB 4G80A 4TSBH 4X0KB 2GAZA 4WWKB 1F2QA 1MJ8L 2EDRA 2Q6WB 3D39E 4XCYB 1INQB 4KQ4L 1X7QA 5EFIA 3UTTB 3F65A 2A6DA 4YWGH 1U8OA 3QG6A 5TGBA 1U8QB 2YRLA 1FG9C 5C6TH 5IHZB 4NCDA 4YHZL 5DJXA 1UJ3B 1U8MB 4WI8A 1MQ8A 4P23A 2VDOL 2CIKB 1EGJH 5GS0C 1ACYL 1WBXB 5MEPB 3IJYB 1CU4L 4KROB 4PJXF 2CIKA 4V2CB 1QVOB 5K9KA 1ADQL 5A3ID 4JZOB 4I3SL 5JXED 1RHHB 2AK1H 1NGZB 1H3UA 1FVDA 3MGAA 1TNMA 2YUXA 2OR7A 3V0VB 5IT2H 1PGRB 1MIML 3GSRA 1YEJL 4OLEA 2V2XA 1VADA 4BYHA 2HH0L 3OXRB 1LP9E 1IRAY 4C55A 1ETZA 2BFVH 4WI2A 3LSOA 2GJ6E 5KVEL 4JQXC 5FHAH 4AM0A 5EZJB 4LSVH 5CEZD 4HPYH 3SDYL 4GRWF 5F89A 2V7NA 1MHEA 1LO5B 5IBLC 2AJSL 3UTSB 1KJVA 4OD3L 3HE7C 1OGTB 2EDDA 1WT5C 4NRZB 3EHBD 2ADJA 3UP1A 1MHPH 3WFDL 2BERA 2JB5H 1LE5B 3QXWA 1XIWA 4MLSA 3NCEB 2XZQL 3ZE2F 5ISZE 4N0FA 3TO4C 5FGCE 3HNVH 1RQ5A 5ERWB 3IGAA 5EIIB 3LH2H 4KI5E 5C0CD 4MJID 5LG1A 1NANI 1RURH 3BPLC 5HVFB 3KPTA 5EO1B 4QTHA 5DJZB 5DK3A 4MVBD 5IVXB 3SDCA 3REWA 2HFGH 5GGVH 5LGHH 1TTGA 4Z7UE 1S5IH 2EIZB 4HS6A 3ZHDA 4OLXL 3O9WB 3GSQA 4HS8L 2BVEA 2NY5C 1YEGL 4S0SD 5EZOH 5FOBB 2DDQL 5AYQA 1IC5L 4NKIH 5JORA 5GGQL 1MLCB 3HPLA 3S3SA 4GRMA 1FDLL 1YJDC 2ZCHH 2JCCA 4JM2F 4X6FB 5DHVA 1DQQA 1P4LA 5HGAA 2BVPA 1D5IH 2FR4A 3VD5A 1QP1A 4OZHB 4X6EA 3RL2B 2XOTA 3AXLA 5EIQA 2EO9A 4G42B 3MYJA 4HKXB 4OUUA 2NY4D 1B9ZA 1GCFA 1CVSC 2YD9A 3BI9X 1TVDA 1UYWH 1IL1A 4JVPA 4ODWA 3L5HA 2NTSP 3F6IA 3LS4L 3MOAH 3QULB 1NC2B 1RZFL 3SKNB 1OGAD 1CE1H 4TQEH 3MUZ1 4P2RB 1PY9A 3WIFA 2FO4A 1JPST 3VI3E 4DZBA 1NC4D 3RVWD 4Y8AA 1I8MA 4XNZC 5FYJU 3VXRE 2C3HA 2B4CL 3BPOB 3EO9L 3FO9B 4NQCD 2VDMH 4HS3A 5DJ8A 1D9KC 3SE3A 1BQUA 3G5XA 2NY0B 2EDJA 3L5JA 5DMIL 1FAIH 1X4YA 2BJMH 4PJBE 4TSAL 3DRTB 4W4OA 2EKSA 5IEHA 5CWSA 3HB3C 1Q1JH 3VFSB 5KVFL 3HB3D 1T0MB 2FHCA 4XX1G 4BFBD 3VD9A 2R8SL 1J0IA 4YHMH 3T2OA 4KJPD 2PO6B 1KTDB 1FG2A 3C8KA 5SWQA 5E94B 1C1EH 1CXFA 1FLRH 4Z77A 2V17H 4JQVA 1NGYB 5J9PA 1KB5A 2CLZA 2WZPD 1L7TL 3VFWA 1B90A 1JWSB 4AG4H 1S5IL 2VLLB 4K7FB 3GUTA 2OI9B 3WD5H 4MJ6B 1IFHL 1PZUB 1CDCA 5DJ2B 3QQ9C 5LAXA 3C2SA 1YNLL 3R06B 1X9QA 3O8XA 4IDLA 3DVGB 3LKRA 4XVJH 3PIQA 4OI7A 5FO8A 1FRGH 4YFLI 4I48B 1IFHH 1N6VA 1PG7W 4V3DB 1FYHB 4LVEA 3IDMA 1TETH 1G0XA 5FOJA 1FYTA 1X5LA 3BX7C 5EBMA 4OZIE 3QIWA 1AD0B 4ZUUA 4PJ7F 5BRZA 1T4KA 3AU1A 4MS8D 2F5BL 5L9DL 4RMQA 1F4AA 3GB7A 2QHRL 5FYLD 4IOIB 2PR4H 5EH1A 1F4WL 3L95A 3GRWA 2EDBA 1GJIA 2NXZB 4G9DA 4F33B 3SDCD 3RUGF 4JZNA 1F4WH 1TVBA 1DQTA 1CLZL 4RX4D 4UDUB 4YGVA 5DLMH 2EDTA 3SDXF 2NY3B 4KI1A 4UMGA 4MQ7B 3SO3C 2WWMC 4WEUD 1N6QH 4FZ8L 1J7VR 1HKLH 3UJIH 3Q0HA 1QBMH 4LQFL 3FB7A 4NKQB 3HNSH 4DWHA 4DFIA 5DZNA 1IMHC 4WW2B 5DJAB 5E9DB 3N50A 3W39B 5TPWL 1WCBB 3WN5B 1NGXB 2P5ED 5F8QC 3ESVF 2BJML 4BFIA 5B38G 5I76A 4HDIA 3FQTA 3TH2T 4BSVB 3VXRA 3O11A 2XNAB 2WIIB 2IPUG 4JKMA 2EYTB 3EJYD 3LKOA 3IVKB 1AHWC 2BP3A 4XPTL 3AM8A 4LPTA 3PQYD 3KYKH 1R6VA 1S9VB 3C5JB 2QLVB 1PJ9A 1X5FA 2XWJB 4P2CG 2JJTC 5D2LE 3G6DH 3S9DB 4WI7A 3P4OB 2GTWB 1GAFL 2WBJB 3VWKD 3AVEA 3MNZB 1SY6L 4PJFE 2HLFD 3K3QA 1M6OA 3TYFB 4L4VA 3MMEA 3B83A 1S5HA 4PYGA 3KLDA 1ES0A 3MBXH 1SEQL 4UTBH 4U6VH 35C8H 5IB4A 3SGDH 2JKXA 4LDOB 1FVCA 4PJ8C 3RRQA 1EFQA 3DVIA 4NCC1 3BPCA 1OB1A 2FIKB 1DQLL 4PGCA 2ZJSL 1FVCB 1G7LA 4PJIA 4DKEL 2Z92B 4GAJL 3C8KB 4N8CL 3UMTA 3NCMA 3GIVB 4YXKH 3HI1B 3P9WB 3HZMB 1WBYB 1M05A 4JFDA 1GIGH 2J88H 4JQIL 3LV3A 4L8CB 1DQLH 4J3SA 5GRVK 4F7CA 4L9LB 4I0PA 4FZEL 4ZS7L 3RAJH 4FMFA 1AR1D 5DJDA 4YXKL 4PJGE 2CRIA 2WP3O 2MQCA 2CO7B 3OJDB 1RJYA 1BGXH 2Q20A 2VQ1A 4ZNCD 5DRWA 2JJTA 5DQ9B 5T1DH 4C56D 1KGCD 3SE3C 4XVTL 3FOLB 2E27H 1RJYB 2VQ1B 3CDGA 5I1EL 3Q3GA 3D6GA 5KSAC 1ZKAA 3KPNB 2O5XL 4LLVB 2CSPA 1PKQB 2XRAL 4XBGB 5E5MB 3SKOA 4X8JB 4MXWL 4X6BB 2AJZA 4U0RC 4YBHA 4HAFA 3D2UB 3QNZA 4E9LA 2V2TB 3MOBH 3T0BA 4U4BA 1OP5K 4QHNA 1A1OA 2BHZA 4PJHB 1G7IA 1HNFA 4HK0A 2E7LA 1YMHA 1A1OB 3BJ91 4NZUH 4PJHA 4HCRH 4FA8A 4CW1A 1MCLA 1SJEB 5B39G 4Q9CA 5HVHB 5JPMA 4ZODA 2GJZA 4ZUWA 5KVEH 4PTUB 4UINL 3RZCC 7FABL 3OZ9L 1P69B 3KYKL 2VZUA 5C08B 4GW1A 2AJSH 2DLTA 3O0RL 1EAJA 2VLKB 4YDJA 4KAQH 2Q7YB 5JDJA 1PY4A 3GEWB 3STLA 1CN4A 4U6XB 1KIRB 4OFKA 1JFMA 3L3IB 4MJIB 4G6ML 1AFVH 2A83A 4HIIA 3L5WB 4HJGA 1KIRA 3MRJB 1K4DA 1JNJA 2J4WH 3QAZC 3BZEA 1X5YA 2DDQH 4S0TD 4QRPA 3QUML 1NMBL 2ICWJ 3K2UL 5TDPB 5GGSY 3Q6GL 2X44D 3DECA 3G6JE 1A7NL 2AJVL 5GZNC 4XI5C 4XWOC 3AC0A 4ODUB 1TCRB 3O45A 4DUVA 4OKVB 5JMRA 1MJ8H 4S1DC 3VXQA 4WENB 2JJWA 3QJFA 4E5XB 1TTFA 2QV2A 1I3RA 5KJRH 1U42A 1X7QB 3UTTA 3O3EB 2FHBA 3GSNH 3IB4A 2LU4A 1EVUA 5GRVL 4KDTC 1G1CA 1KACB 4OLWL 2XQYK 1HH6A 4P57B 4NM8H 2ESVA 3CIQA 5FYJD 1NCCL 2DQTH 4NNYB 1QKZL 1HILA 2A6IB 2XPGA 3ERYA 5F1SA 1IC7H 5KSBE 1HEZA 2DLFL 4NZJA 3PP4H 1MRDL 1HI6B 5IG7A 3KYAA 2H2SC 3VXPA 5L2KD 3C6LD 5C0RL 4XPAH 1I7UA 4K8RD 1OM3L 3TF7A 1F2XK 5C07A 3KPMB 4JFPA 5E8DL 3KYNB 6FABL 4F58L 3GHEH 2QQNH 3FONB 1ZANH 3MR9B 4H1LB 1EBPA 5KOVC 2IH1A 2NW3B 2ZCLH 2ZSVB 4HUNB 3GSUA 3VH8G 3ZYIA 3O2DA 4FQXB 4XBPB 4XWGL 4OBRA 1NC4A 2C7UA 5ID1A 2C4FU 4HPOL 3OZ9H 3VXSD 5T3XE 2MMXA 1KJ2B 3KPOA 4PJ5B 1HH9B 1LK2B 4I1NB 3E6HA 2XV6B 3MLWL 3HS0B 4NC2B 4AK1A 1UXWB 3FB6A 1HHHB 4JFZL 3IXTB 3WHXB 2W60A 4QF1A 5KVGH 2P5EA 5FGBA 4NSKB 2RQ8A 1UEYA 3T0ED 4Z7VE 4ALAL 1BMGA 3SGDI 4NSKA 2VLRD 5GGVL 4UV4L 5LGHL 3RIFF 1OSZB 4E41A 4EVNB 4F7EB 1EZVY 3UYRH 5D1XA 1NFKA 2L0DA 1P7KA 4MA3B 5I71C 4LPCA 4J12A 1ZT7B 5LGJB 3SGEH 3GSQB 4XTRD 3PDOB 4YK4B 1EJ6A 1F6AA 5D7JB 5L8LB 3MCLH 3C6LC 3MO1A 5J89A 3MPCA 4XRCB 3WFBH 5EWIH 4CVUA 4TUOB 1PZ5B 5J06A 5F7HA 3WEXA 5I1IH 3W0WA 3OKNA 4JRYA 3BZEB 3MLZH 3MRHA 2VXTH 5DURD 4KVNH 5GHWL 1UWEH 2W91A 4HWUA 3HMXL 4R4FL 1IAKB 1A6ZB 1ZHKA 2KBGA 4X7TB 2NLJA 1QFPA 1N6QL 5HHNB 5C2BH 2I26N 3HC4L 4RGOH 5FHBL 1G6RB 3O41B 4GBXD 5F89B 3EFDL 4X0KA 2BNUA 2HT4C 3MRNB 4OZGA 1IGTB 1JBJA 4UU9A 1H3WM 3OX8B 1A4KA 4Y16A 4EXPX 2VJXA 4UDTA 4OZGB 1T3FB 1DBMH 1ZV5A 1JFQH 2R39A 5INDA 3RVXC 1AE6H 3BIAX 4NNYA 4PGEB 5GGSB 5FYJH 1QBML 4LQFH 4P23B 1U93B 1F5WA 5TQ2L 4KTEH 3UPRB 5C0CA 4YZFF 5JXEC 1XMWA 3X3FL 3NTCH 3RWCA 1MRCH 3UO1H 1P84J 4OCXL 1KXTB 4FQ2H 4JGUA 1CD9B 5B39A 4NBYB 4OZFA 5BMFH 2YS4A 2D7MA 1LE9B 4YC2B 4YHPA 2Y06H 3EDFA 3W11D 5C6PB 2HJKA 4XPFL 4OCWL 4OCXH 5D2NA 4U7MA 1AGEA 3WSQH 2Y6SD 1S7QB 4JFQA 3U1SH 4PRIA 4EI5C 2R4RL 4LVNB 3B9KA 1JHTB 1T66D 3BPLB 3WSQL 3CK0H 2DTMH 4YHLH 4Y1AD 1NAMA 3DHMA 5L2KB 4H8WL 2H1PH 2PTTB 3FB6B 4UT9H 5CJ8A 4EDWL 1WBZA 4GAGL 5IKCA 4HGWA 1KTLB 4LMQE 1GZPA 3MA9L 1FH5H 5A16A 4BSVA 1I7RA 5KOMC 3BP6B 2BVQA 5JXEA 4TVPE 2VXSL 1RUKH 2DOCA 3TT1L 2FGWH 3MJ8A 4WUUD 1WJ3A 2EIZA 4HS6B 1PLGL 5TH2B 4RFEA 4NKOA 3ARTA 3O4LB 4OZ4B 2QKIA 5DJCB 3P30L 4QTHB 1TJIL 1I1YA 4R4FH 3TH4T 1E28B 4HEME 4EOWH 5GS2H 3LAFA 4NYLA 2GTWA 1F4YL 4JVWA 3E3QE 3WNLA 2HT4D 1TETL 2QSTA 1SVZA 2BSED 3U7WL 2D7QA 2EYSA 2BNQD 5IVXE 3MMEB 3L3OB 2JJSC 4G9DB 5IROC 3FCTA 1K2DA 1DQQB 4G7VH 3WCYA 1VCAA 1QFWH 3T1FB 2O61A 3RGVA 3DX6A 4DGIL 5AG9A 3BPNB 3HPLB 2AXFA 4HUMB 3RWIB 1C08A 3B8YA 3PABA 4M7ZC 2FBJL 2AXFB 3FRPG 4DGVH 1H3PL 2VAJA 3B5TA 3NZHH 2RCSL 3C60C 3L6FA 4LHUG 32C2A 1H5BA 3SCMD 3SJVE 1TZHB 3TJEL 1KIUA 3EOAB 4PTTB 1FNSL 1LEKA 3JV4B 3KS0J 2IMMA 1XF4B 4ORGB 1SYSA 3U46B 2VO5A 3MREA 3U4BH 2P5WE 4U6YA 4LPYA 4UINH 1IQWL 1YNTA 3GBNH 2JB6A 1PYWB 1FL5A 2OMBA 5EC1B 3TBYB 3VXMB 1X3DA 4G8IB 4JDZA 1KJMB 3PJSA 4NM4L 2YD8A 3FFCB 3K46A 4P3DB 3WKMH 5C0FB 2VKWA 4HF5H 4M6ML 4GRWB 1DSFL 5DRNA 3B2UD 4ZOEA 1CWVA 2WP3T 4J1UB 2AJ3B 2IEPA 1C5BH 4YHOL 3GMRA 4DOHE 3S4SB 2QSCL 4P49A 2Q1EA 3H0TA 2MPAH 1BJMA 1G7MB 3BT2H 4LCIH 5AEAA 5KSAB 4JQIH 2P48B 3TN0D 3QIBA 4HXAL 4LVOC 3V6FA 4JHBA 4HUVA 2X9YA 3HE7A 1SEQH 3AS1A 4L8SC 3RNKB 5KZCB 2FL5A 3KPRE 4OZGE 2WWMD 3GHBL 3QXVA 5D2NB 3V5DB 1I1FB 1RZJC 4L3EB 1KLGB 2MCG1 3QA3B 4GKOA 4ZAKD 2R9HD 5DEGB 5GISH 4KWUA 4LKCB 5LAXB 4BQ9A 1P6FA 2AEPL 2WINB 4P46B 1L9MA 1YEKH 4IRJC 1L7IL 3ILPB 4FXLA 2VLJB 1CD1A 3UZQA 3MRMB 4UIKH 4WW2A 1BD2B 3DPBA 3MV8A 5EC2A 2FATH 1CYGA 3DX7A 4QXTB 3RTQA 2EDYA 5CAYB 2X1QA 5C0BD 2DLFH 1UEMA 1ONQA 5J4MA 5ESQA 4JEGB 1J8HE 3FT4A 1BQHG 5DC9B 5IR1A 4DW2H 3FQWA 1KJ3H 4BZ2H 1UADC 2XTJD 3MRDA 3IU3B 5I1HH 4G8GB 2CH8A 4WFGD 2EC9U 4OIIL 4ZFZA 3BSZH 1OCWH 4F37K 4PJEA 1MIMH 1W72H 7FABH 2YSSA 5F7NC 1FL3A 4X4YA 4PRHE 3AREC 4NQDA 3E8UH 1D3CA 3QDGA 2X9WA 4N0UE 4L4VD 5E4EC 1HXMA 3G6JF 4MDIA 5EORH 3MXVL 4ZNEE 1OCWL 5C08A 3VFUA 4Y4KB 2I60H 3WLBB 2FX9L 3ARRA 4CBPA 3UAJC 4XBEL 2BVTA 4QXGH 4PJDF 4OD1L 1JZ7A 5JHDD 4LQ1A 2FDBP 2B39A 5M7QA 1JNLL 2GSIA 2ORBH 4UB0L 4L3EE 4MHHG 4J2XA 1NCWH 2R29L 2VC2L 3VRJA 3DUUB 5TE7L 1XAUA 1UH2A 4MCZA 1OP3H 3MRBB 1I9RL 4ORGA 1FAKT 2M8XA 5KAQG 2H3NB 3E2HB 3TH3T 5TDPA 1L7TH 3ZTNH 2LVCA 4Y5XA 3ILQD 4JPVH 2ZPKL 3HC0B 1UGNA 4ISVA 1JGDB 5HI4C 1MRFH 1S9VA 4ZPTA 3W9DB 4HKZB 4F7TB 5TDNA 4Z7OE 4XVJL 5E5RB 3MSPA 2F8XC 3M1BA 3T65B 5HYQA 3UBXG 2VITB 2AJZB 4Q0XL 4WV1A 5E9DD 1TQCC 5CCKH 1TFHA 1WLHA 4K3JL 4FXGB 1TVHB 4NJAL 5I1AA 4HCRA 4QF1B 2P5EB 1RJZB 4R3SB 3QWOA 1ODAA 1WBYA 2UVEA 3KXFA 2FATL 4HUWA 4A6YH 1A6VL 3KDMA 3BXNB 1M7DA 4CW1B 1JNHA 1FC2D 5MEQA 4HUWB 4I0PB 5DEFA 3WHE0 3JWOC 4IMKA 1CI5A 3H2WA 3BZFB 2DF3A 5D71L 2H32A 3P3YA 4DUXA 1KN2H 1DANT 1CE1L 1QRKA 2GUOB 4Z7UF 3PGDA 2ICEB 4PRPA 4L9LC 5DYOA 3P4MB 4MNGE 5I8CB 2J8UF 1LO4H 1PKQA 4XBGA 1CFTA 2YRZA 5KVFH 1T7ZA 2JIXD 3QDME 2NY0D 3PWJB 1HSAA 5KSAD 4YUEL 2ADFH 4MAUL 4DK3A 5J13C 1J18A 1X5XA 2R8SH 3NIGF 4Y5YA 1I1RA 5C0DB 1CE6B 5I8EA 4YUEH 1BZQK 1A7QH 5HYSG 1RZGA 4QHMB 2DRUA 1Q9OB 4XMKL 3MNVB 4XMPH 3TO2B 1A7OH 43CAB 2X4TB 4LSTL 3ZTJG 3TJHD 1MFAL 3ARBB 2VXUH 4CGTA 1L9NA 4R97C 1KYOK 1CGXA 3T4AB 3NOIA 4BSJA 1DEEA 5F6HJ 2BCKB 1ORQB 4P5TD 4BFGA 3CLEL 2A6DB 2DI7A 5J12C 4Z0XB 2NNAA 3I3EA 3UBXI 5DUBA 5FYKD 5EZLA 5CEZE 5K9QI 1MEXH 1E6JH 1ZT7A 3LRSA 4RSVA 2VXSH 1I8KA 5CBAA 2BZDA 2EE2A 4QO1A 3QI9D 3JUYA 5BS0B 4YHLL 3L1OH 5C0GA 1IC5H 4NKIL 4YDIH 4UV4H 3CFKA 1P2CA 1AHWA 1QLEL 2HRPL 2V6HA 4Y88A 4EDWH 3O6LL 5HI3C 1JZ4A 3L3JB 1FDLH 4TUOA 1PG7L 4ODXA 4ONGH 5FYKL 1UKSA 1A1NA 4ZUTA 4U1HB 1Z6JT 4LGSB 4H1LG 2UWEE 1D5IL 3RIFK 2ICES 3RUGE 5DJ0B 1T5XA 4Y16D 4RCAA 1NCNA 5EPMA 3FAXA 4ISVB 1AGEB 4OLVL 1MJ7L 2CMRH 4WNQA 3IRZA 1GH7A 3SY0A 2YD7A 4HMEA 5ICYB 5C08E 3O41A 4FQLL 4I3RL 2VLKD 1BWMA 3UJJL 2HMIC 3SQOH 3BMWA 1PVHA 2RBLA 1A7RL 5DD0L 2YPLB 3N1GC 1MREL 1M1SA 5CP7B 5IB4B 1WFTA 1U6AL 2GJJA 4NRYB 1JVKA 3MJ9A 3F5WA 3GRWH 2DQIL 1HDMB 4HLJA 4TUJA 4WO4A 1OB1B 1I7RB 2YD3A 4LRNH 4Q9QL 1H15A 4M1CC 2VYRE 3X14B 2QADC 1N64L 1Y6KR 4GRWH 3CH8A 5FUZL 5K9OB 1KTRL 4Z78A 3P11H 1AGBA 3PNWA 1YZZA 2JE8A 4FQIL 2IF7A 4LEOB 2COQA 4RGMB 1KIQA 1AE6L 5FIEA 3T4YB 3FQRA 5ID0B 3CSPA 3VXMD 2X4PA 4JR9H 5DJ6A 5KS9B 5LGJA 1I1AD 4OAWB 4BKLA 5JW4M 3ARGA 5IMMA 4HBCH 1IQWH 1HXYB 4IHOA 3VMOA 1S9YB 3PWJA 3VFNB 3ARGC 1AO7B 3DX6B 4WHTA 2P7TA 1T7VA 3E6HB 3V0WH 3ZE1E 1CF8L 1KNOA 4M6MH 5CSZB 1FSKC 4JRYB 5CD3B 5I9QC 3S37L 5I1GH 1INEL 3MX0A 1HHHA 2XA3A 4PJ9A 5DVMA 4HV8B 1XF2A 2NPLX 3SPVA 2D0GA 1ZVYA 3SKMB 5L7XH 3L5XL 4M7JH 4Z5RB 1XT5A 2LV4A 4U49A 3ALXA 1MAJA 5IQ7H 5EBLA 5EFIB 4I13B 1OQOA 1A4KB 4OIAA 3SN6N 1F4XH 1P7HL 4O58H 5ESVA 5CBEB 1L0QA 1YEFL 3CFCL 4G8GE 4ZS7H 5GPRA 3T0VA 3LEXA 5HDBE 1NAML 5DRNB 1HWGB 3GMMB 4GKSA 4XCNA 5D6CB 2H8PA 2OZ4L 2YHGA 4OSUH 2EH8L 2W0FA 1BFVL 4H5SB 3QFJA 3VA6A 5HVGB 4JO2H 3S35H 3MLPA 3OKNB 4NZDA 1KG0B 4LCWB 5C07E 1IAKA 4B7LA 3U6RB 4GQ9L 5DRZA 4XAWL 5HPMB 4PJIB 4MWFB 1KELH 4LFHD 3G5VB 3RY6A 3P11L 2BOBB 5SWQB 4BM7A 3WKNA 3QJFB 3B6SA 4CDHA 3GBLA 1DVFD 3BKML 1BZ9B 3H7BB 5ITFA 4AH2B 5EOTB 1TNNA 2WAHA 4HWBH 1QACA 4UOW0 1MCPH 5JO5A 2CKBA 3QO0A 1F3DJ 1S7XB 3O6KH 4LSPH 4WUKL 3P0GB 1IJ9A 2W59A 1AKJD 3NCJL 4K9EC 3C08L 1IILE 3G04A 4U6TA 1HHJB 3RIAF 3Q6GH 3WO3B 3S7GA 1ONQB 2EKSB 2FEDC 4BK5A 3G9VA 4U6VL 1QYGL 1YY8A 4QHLB 2AI0H 2V5SA 2VE6A 3VXUB 1KV3A 3IFOA 3N1PC 1WC7A 4PGJA 4HKJA 2BRRL 1RIVH 3HZKB 3QNYA 5E1AA 2FLBT 5HHMD 3PHOA 3MRFA 1I4FB 3ZTNL 3DGGA 3O9WA 1T22A 4NYLB 5CCKL 2OI9C 4CNIB 5T33L 4GG8A 5D2LB 4GO6B 1CCZA 3GSNL 1QPXA 4GRWE 1QNZL 1II4E 4EI6A 1LP9F 4GG8B 1W0WB 2GJZB 4ZUWB 5GISL 3NPSB 4OLWH 4Q9RL 4GKNA 1KBGL 4UDUA 4C57C 3BD4A 3VFWB 2GFBA 4O4YL 1T1WA 4X9HA 1OPGH 1XEDA 2DB8A 3L3HA 4JCMA 4P4KC 1F4XL 3VXME 4H25B 5CD3A 4M7LL 4Q0XH 4RGNB 2WINA 4P46A 4CN4A 5GS1B 4PRPE 1VESA 1TQBB 1EGJL 2ADIB 5DVOA 3VGEA 3FTGB 5HGHB 4X7CC 1A9BB 3GGWA 4P23D 5D72L 1DE4A 1DEDA 1N0XL 3OSKA 4PLKD 4U6XA 3PWUA 2W65B 4HQQH 3K8MA 4PG9A 4FTVB 5SWZE 3FQXA 4KUZH 1NGXA 3WUZA 1GL4B 1ZS8A 1KCKA 4MZ3A 3DARA 5SX5H 1FYTB 4JGJA 2FIRT 1BVZA 2XNAA 3A6CH 4NCC2 1ACYH 1YMME 3AY4A 5C86A 2AK4A 3MCKB 2X4RA 4YK4C 5DD1L 3LKSA 4PJAA 1QQDB 1S8DA 2FH6A 3CH1B 3E8UL 3WS3B 1DBJL 1MCIA 3MRPA 4X5LA 3MLUH 1CDHA 2MOVA 3AAZA 3WS3A 4Z9KB 3B2VH 4PRBA 5C09A 5E03A 3OKYA 1W8OA 3O6ML 3ZKND 2OJEA 4F3FA 3DO7A 3U30B 3EAKA 3UTQA 1MELA 3ZLQC 2OSLB 3WHE1 1AC6A 3UO1L 1N8ZB 5HGAB 3CLEH 3BFOA 3SKJH 3P77B 2FEDD 2FJGB 3FT3A 5BZDA 3SE4A 1NMAL 4RFOH 3AMKA 1UM4H 5IVOA 3IT8D 4AENB 1Q0YL 5AUMA 4ZOAA 2GJ6A 1NUDA 3V4PL 4JRYE 4AEIH 1QUNA 5TF1L 4PJIE 1ZLSH 4AENA 1FLRL 1IM3A 1BQHB 1G7HB 2D03H 5BJTA 3J7HA 4LKXB 4KJWD 1G9MC 2YRPA 2HN7A 3HG1B 3MV7E 3IVKA 4EN3B 2Q3AA 3DSFH 1IEBA 4HWZB 5FA4B 4PJ8D 3EDEA 3WDJA 3RZCD 3AY4C 3NIDE 5IWLA 3DUSB 4JO3L 4LLMB 3VRLF 1OAZL 4ZFOL 4RRPA 2A9NL 5BOPA 3LD8B 3MLTA 3WFHA 3IKCA 3FQNB 1BAFL 1CL7I 3MLZL 5T1KA 1CD0A 3HNTL 3CSBA 5E6ZA 2CGRL 5AYUH 4KMQA 5SWZA 3EO0A 4X80H 1W2KT 12E8H 1CDUA 4TVSa 2YPLE 3EO0B 5EWIL 4DTGL 2BSRA 3IFOB 4FQ1H 3IFNH 4HKJB 4XCEB 5I75C 4UUJB 1MCWW 3OKMB 3MZGB 2WK2A 3LOWA 3TPKA 4M7KL 4TQEL 3ALWA 5HGDB 3TIDA 5C0BA 4Y7MA 5IVZB 1KCUH 3BE1L 3O3AA 2YSSB 1E4JA 5CINH 1XGUA 3JTSB 2DQDH 3WIHL 4WW1A 3MACL 3G6AB 3RA7L 5I30L 1NDMA 2QHLA 1NLBL 4WW1B 3KLSA 5I1CH 3RJDA 3N1QC 2RB8A 2AJXL 3MOAL 4OM1L 4PRPB 3ZL4L 4JN1H 4KK6C 4CU6A 4OCNC 2GW5A 3HC3L 5DJAA 4PJFA 5B3JE 3O8XB 3MYZA 4JKKA 3RTQB 4ZQKB 1QHOA 1PKOA 4CKVX 4HBCL 1YY9C 3FN3A 3ULVE 4UILL 3PE9A 4JFXA 4KHXL 3SKJL 3T2NL 4QRPB 1P7QA 4XMLL 5KZCD 1TZIA 3MNVA 4MNGB 3MGOA 3WIIL 2M1KA 1NEZB 2PW2B 1TQBC 5CMAB 1C7TA 1QPPA 1HCVA 2X4QB 1K9TA 1I9JL 1B0RB 2B1AL 1R24A 1M6OB 3TYFA 2YD1A 4ZUVB 1TPXC 3QPQC 2DM4A 4PV9B 1FORL 1TJGL 4YDKL 2IGFH 2QBWA 1DLFL 4JM2D 3S96A 3TWCL 1AQDA 25C8H 4YDIL 1J10A 4XI5D 2XT1B 3KG5A 2O5ZH 1CDBA 2P46B 2P8MA 1AQDB 3V95A 2ZCKL 1JYNA 1FNLA 1UM5H 5K9OA 2LTQC 3SGEI 1DBBL 2X6MA 4UTAL 3RGVD 1VPOL 4OF3A 5I1KH 2HG5A 1LDSA 2GTZA 4KRPB 1K4CA 4HDIB 2GCYA 3WFEH 3OV6A 2W0PA 1BF2A 2E7LE 4HW6A 1A6PA 4KXZH 1YEKL 2JCCF 5GGUA 2XFXA 5HI4D 3K0WA 4NC1C 4M48H 1KB9J 2EE3A 1AO7A 4WHTB 2DLEA 1F6LL 1HNGA 1S9XB 3OB0K 2J6EL 3QFJE 5KANI 4QEGA 2F74B 4NRZA 4ODVH 3ARVA 3UYOD 1AD9A 1OSPL 3VFMB 5KSBB 5FKAA 3GZKA 3OAYK 3ARXA 5CFHA 1NCAL 3OL2A 1KCLA 1NGPH 3MRKA 2CUHA 4LP5A 1GZQB 3BQUC 2DJSA 5F8RC 4HUVB 1A2YA 3ZE0F 4ZDHB 1NUGA 4JFEA 3FB5A 3RVXD 1LNUB 3O3AB 1UXSB 1RY7B 5DA4A 1ZGLA 3VXSE 1H0DB 2I9LA 4KHXH 1FFNA 3QDGE 4N0UA 4L4TB 3O2WH 5IFHL 3BN9C 5A3IC 4NN6C 3LKPB 5EOQH 1JGEB 4EIGB 4OV6F 2NW3A 3DX9B 2D7TL 4MD5A 4U1KB 2GSGA 3NZ8A 4PRIE 1DQDL 5D93B 4EEEA 5KG9A 1TITA 2QSCH 2VR9A 3EDKA 3LMJL 3GMQA 3F12B 1RURL 3I9GH 2Z8WC 4NQVB 3ZZ1A 4I5BB 1KB5H 3C60D 4WUUE 1DUZA 5E2UH 1CGWA 5IBLD 3IDXL 5EU5A 4KK5C 3S37X 1OTSC 4MXVF 2A1WL 2EXYC 3GSNB 3MRDB 5FF6B 5DEZA 4BSWA 2CDEA 2ENSA 3A6BL 4LLAA 3TN0B 1UM6L 2UUDH 5DS8A 2NX5D 3RIAK 2H26A