1CG9A

Complex recognition of the supertypic bw6-determinant on hla-b and-c molecules by the monoclonal antibody sfr8-b6
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
277
structure length
277
Chain Sequence
GSHSMRYFYTAMFRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex Recognition of the Supertypic Bw6-Determinant on HLA-B and-C Molecules by the Monoclonal Antibody SFR8-B6
rcsb
source organism Homo sapiens
molecule tags Mhc class i
molecule keywords PROTEIN (HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-35 B* 350
total genus 74
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cg9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1cg9A01
3WJLA 3H3PH 3O3DA 4NPYB 4OZGA 5E8DL 3OKEB 2W65B 1ZGLP 3OXSB 1T5XA 5KSUB 3MCG1 4OD1L 1BQLL 2H41A 1FL6B 3FB7A 5DLMH 2APXA 1JGDB 5DJXB 3PHQA 5C92A 1QRKA 3M45A 5E8OA 4L3EE 3RWFA 4G8FA 4NBYB 2Z31C 2KUTA 1D5BA 1EFQA 2O5YH 4BZ1L 3TNNB 1NMAH 3SDDA 4P4RA 1ZLSL 3AM8A 3UP1A 3PDOA 2OL3H 1WWCA 5D72L 1MWAL 4LP4A 32C2A 5EN2A 4EN3D 1A64A 5C6WH 5IBUB 5DVOA 3OKOA 4CMMB 4HJGB 4Y4KC 3VXNA 3WIFA 5E95B 4BJLA 1U8QB 2HVJB 3ILQC 3THML 4Z0XB 4Z7OF 5DD1H 4IRSB 4MJ2A 1OCWL 4IOSD 2ZOKA 3G9VA 2N1KA 4KJWD 5H37G 1UVQA 2WWMC 4MA7H 3VXMD 1N2RB 1XR9A 4JDZA 2BERA 4KHTL 2EDXA 5TE7H 3D1MC 1GHFH 2V9QA 3RY6C 3GJFK 3FT4B 3MRGB 3Q0HA 3MCLH 4NHUA 4P23C 2O5YL 3PGCB 4CVWA 1X5YA 3UX9B 1GHFL 5TE6H 1ORSB 4KV5F 5J11B 2VLRD 5K59F 3QXDB 4CAGA 4K3JL 3NACL 4B5EA 4I48A 5IM7B 5L7XL 1A3LL 3KPSB 4KJYB 5DHVH 5E7FA 3K1DA 5E00B 5BW7A 1RJZA 4UQ3A 4NM8H 4QXTB 1M6OB 1IE5A 3KPNA 4XCYB 3UTSA 2FJFB 4PJFB 1MLCB 4YZFF 1KEMH 1RZFL 1AH1A 1RJYB 2A9MH 3AS1A 1SY6L 3E3QC 5IW1B 3WO3B 1TZIA 1A21A 1PKQE 3K8MA 4IRZH 1AO7A 3HE7C 3AS3A 4PJ7B 5LQBH 4LCYB 3SN6N 3QUXB 5CD5C 3D39D 4YX2L 4ISVA 4PJAF 1J8HB 4OCNC 5DMKA 4LKXA 2AXFB 2JIXB 5L2JB 4AIOA 5SV4A 5B4MC 3OHXB 4WU5B 3BQUC 1ERNA 5CBAA 1HXYA 3NABL 5CEXB 4LRIA 1NLDH 1YEEL 1FO0A 1I1AA 4ENED 4ETQB 2CXKA 3W9EA 3ZSSA 2FX9L 1NFDB 4RGMC 3W5MA 4P3DA 3QDMB 2X89D 1W72L 2FZ3A 1MWAH 2X4RB 1IGTA 1X5FA 2C9AA 1ETZB 2IFFL 1GH7A 2JE8A 1CT8B 4P2OB 3HG1A 3MLYH 4X6EA 3S34H 4PB0H 5GS1B 3BEWA 4G80A 3PNWA 5DD0H 5GS2D 1YECL 1FCCA 4PRNA 4J1UB 1IGFH 1N5YL 4HKJA 5AUMB 3BSZL 2R2BB 5D6CA 1F3JB 1F8TH 1FLRH 2ZUQC 2W9DL 3G6JF 2WNGA 1U8IA 2BSED 3VXNB 3VXQB 3WIFB 3PXJA 1CG9B 4HJGA 4XMLH 1NDMB 5HGHA 3BJLA 3SDCA 4ESKA 1BF8A 1TZIB 2F15A 5C07D 4DZBA 1TJGL 2BSSA 5B3JE 1K4DB 5HHXL 4KDVA 3SKUD 1J0YA 1NCCH 4HC1H 3WNPA 3ARGB 2JK5B 2MJWA 5DJYA 2FH8A 3IVKB 4PJXB 5L2KD 4Y5XA 4HMDA 2B2XL 1TITA 1FE8H 4OFKA 2LU3A 3TYFA 4E42A 5IB1A 2C3WA 2BHUA 4XVUD 1CGVA 4ONHA 3JUYA 2HWZL 4NPYA 1IAKB 3GDBA 4JZOA 1JNJA 1I1RA 1FZMA 4DKDC 4Z9KB 2XZQH 3PGCA 4ONFH 3OPZH 5IROC 1DLFH 4QHKI 4Y5XB 4ZDHA 3IS1X 5I16A 2ARJQ 3WFCL 1MEXH 2DLGA 4ODWB 2DWDB 1V8HA 3S88H 5DD1L 4LSPL 2CKNA 4GG6B 4TPRL 2OR9H 1F2XK 3CFJB 2EC9T 2AI0L 1I7TB 4MDIB 1WZ1L 3JBG7 3VGHA 3GB7B 1U2HA 3LRSA 1GPOL 4V3DB 4I0KA 1G7IA 2FATL 5J13C 1HSAB 1FNSH 4X99B 5BV7B 1MHHA 5T3ZL 4M48L 1FIGL 2X7LA 1JHKL 4MQXC 5HI3D 2DQJL 3LKQB 3ORJA 2YN5A 4UNUA 3U46A 1H3GA 3HAEA 1IQWL 5IBLC 8FABB 3QDJA 1UWGL 2AKRA 2F19H 3MR9A 2I9TB 2YRLA 1B0GB 1WBZB 2VXTH 4JZNB 4LHQB 1INQA 4GAYA 4KRPB 1A1MB 2LU7A 1A6VL 3UPCA 3BVNB 1UACL 4D0BB 4WW2B 1FFRA 2B20A 3EYUH 1ZKAA 3X14B 3MJ8B 4G6FD 4HLZG 1AP2A 2PO6D 5AAMA 3VDBA 3UYPA 3HNVL 3VI4E 4KXZH 1F3JA 5EC2A 5HHQA 5IHLB 4NT6B 4WDIA 3RWEB 3VXUA 3U30B 3RY4A 4A2LA 3SJVB 3S4SG 4EIGB 3P9LA 3GGWB 4JKLA 1FBIH 1T20B 3IAQA 1DSFH 3CFKB 5AG9A 4FXGB 3BE1H 2D2OA 5ISZB 2HLAA 4U6XA 1UJ3A 4DN4L 3FQTB 3IDGA 4XI5D 2XQYK 3M17B 2JJSC 1NCBL 2FIKB 4WENB 5C0BA 1G9MC 3SGKC 3BE1L 3ESUF 4R9HA 5IFJB 5FCUH 2YRPA 1LMKA 2R2BA 5T5NF 1GSMA 2ATPA 3C5JB 4KKBD 2F53A 5DC9B 5TDOB 1CI5A 4XMPH 3T0XA 1KCRH 3EO0B 1RJLB 5FUZL 3D18A 4HWBL 4XGZA 4QCIA 4XPHL 3M8OL 4AEIH 2OXHA 4PJIA 5EOQH 1S7QA 4PJEE 5GGRA 3EYVB 1HNFA 3UJJH 4FQPA 2VKXA 1OB1B 3BGAA 5EBWA 2NY1D 4TRPL 2OJZL 1K5NB 3RDTD 3B2VH 5IESL 1G7JB 4BFEA 1WC7A 5DD5H 4U0RC 4TQEL 5F1IA 5K59E 1AY1H 4EDWH 1MFAH 5E1AB 1N0XH 5ISZE 3MV8D 2NZIA 3VH8A 4MD5B 1JN6B 4LRIC 3VFSA 4R97C 4KKAD 2WINA 1KCUH 3GB7A 1J1OL 3KPMA 1G7MA 1T1WB 4RAVA 3QFJA 5D7KD 3VGDA 3O41B 1JGUL 4M5YH 5F8QC 3DTXB 2YUZA 3GMMA 4GXVL 4HEPG 4W68A 1N5AA 1WAAE 2NTFB 4WUKH 1EEYB 1RJZB 5C0EA 3QCTL 4QXUH 5B22A 5DURD 4GG6E 3EJZD 4BH8A 1FZMB 2NY0B 3BWUC 1GAFH 1NPUA 2VLJA 3BT2L 4XCFL 3B2VL 3AC0A 3WD5L 1IC7L 4WEBH 3TFKA 2HJLB 2Z8SA 1DLHA 1PLGH 3EOBB 3D85A 3MYJA 3TO2B 1H3WM 3V4VH 2VXSH 2ESVE 3QA3A 4K8RD 4ENEC 3MRKA 3TPUB 1NDGA 3CC5A 2D0HA 2BNQA 3BRGC 5HYQA 4KI1A 3GBNH 5GGSY 1KIRA 4PGDB 1VGEH 3F7YA 1EJOH 3MCKA 3V6BR 4P9HH 3MUHL 4I77H 2XTJD 4HIEA 4KGJA 3UBXG 5HYEA 3OKYA 3B8YA 2XT1B 3MLZL 4TVPH 5E2WH 3U7YL 1T80A 4PBXA 1CFSA 4UIKH 5F1IB 1LQVA 4KDTC 2W38A 2ZNXA 4MNQA 2MSPA 4NZRL 5BVPL 1RMFL 4HLZH 5I66A 4M8QB 2A0LD 2ZUWA 3BW9A 5L8KB 2EZ0D 1KFAL 3GBMH 3FO0H 2EIEA 4IDLA 1T89C 2CGRL 3ZYZA 4GAGL 2XWJB 2D4FA 3QNXB 2A6KB 2GJJA 3TFKC 5FYJH 5GRZA 3SJVE 4MJIE 3WLWD 3CSYA 4M1CD 3RVUC 3IDIA 3MA7A 1RIVH 2KBGA 4CVUA 4OM0H 1SY6H 3T2QA 3QWRA 1A5FL 4PJCB 3GNMH 1JNLL 3CD4A 4HHAA 2VN4A 3ABZA 43CAA 5TF1L 3U48A 4OJFL 1BFTA 1NC2B 1PLGL 1T3FB 1NDGB 4F7PA 4L9LA 2EZ0C 2CLZA 2XPGA 4PS4H 4IDJL 4XRCA 4DUXA 4DVBA 1JRHI 3WLWC 3V7MA 5LKNA 3LSOB 3B9KC 3GRWA 4JQIH 3C6LA 3CFDB 4LGPB 1RIUH 3VXTB 4P2RB 3RFZC 1UENA 3QNZB 4KK9C 4U1IB 3UTTB 5IMOA 5TDNB 2AQ2A 4Z7NE 2P5WB 1FO0H 1CICA 1DEDA 4FQ1H 4W4NA 2P8PB 1P6FA 4MAYC 4DTGL 4PRID 5FYKU 2Y5TB 3WO4B 2XY2A 4K9EC 4W4OA 3MLPA 3VXRD 2ZOLA 1WFNA 2X4OB 5BOPA 2FL5A 4F9PC 1BJ1H 2EEBA 4PJCE 1XGRA 2A73A 1GOGA 1FNFA 1JGLH 1ZV5A 5CZXD 4NBXB 3RWCA 2Z8RA 4CN6A 5DVNA 3CNKA 1YEDB 4YHIB 5GGVH 4EIZC 3MNZA 4JFHD 4AENB 1U3YA 4UAOB 4EOWH 1A8JH 1Q9OA 5FYJD 5FKPB 1DQLH 1FZOB 1F42A 1F5WA 4O9HH 5KG9B 3D25B 4G8GB 2HA1A 4QY8B 3G04A 4HC1A 4NZRH 5BVPH 5BS0D 1CFVL 4X7DC 3GHBL 3QEHB 2VLJE 4M1DH 2D7OA 3CFCL 3AM8C 2VUOA 5IVNA 5DHXB 2HMIC 3PDOB 2PW1A 4JFPA 2IPUG 5DI8A 3MLUH 3MGOB 4GG6A 4D0CB 3GMPA 4L3EB 4HF5H 3O6MH 5JOPE 4EUPH 1FZKA 5ESVB 3ARYA 5FGBC 4NYLB 1RIVL 4J3XA 1S5HB 1J0KA 1AQDB 2G75A 4GG6F 1YPZA 3IJHA 4M7LT 3Q5YA 2OP4H 4P59L 1MFNA 2DF3A 1R0AH 4OZGB 5GRJH 4MA3A 1MHEB 4PP2B 1MUJA 1QSZA 4Y2DA 4LLYA 2P4AB 3T1FB 2P1YA 1T20A 1KTLA 4LSRH 3SO3B 4DEPB 1G9ML 4RRPA 1QLFB 1KPRB 4M6OH 3O4OC 1ZTXL 5CINL 2FYYB 4XH2A 3RDTC 1EXUA 3NIGE 2YUVA 5HY9B 3JTSA 2IEPA 2CLRA 5I2IB 5L88H 4PJHB 4U1GB 5KBNC 3EO9L 1YC7A 1BZ7B 1CXEA 4LSPH 4CN4A 4PPTA 1EV2E 1S78C 3DIFB 3PV6A 3TWCH 4AEFA 5BZWA 1ODAA 4WWID 1JK8B 1HHJB 5EIIA 2NY2B 1RUKL 1NKRA 2BVPA 4F9LC 1BREA 3Q48A 3T0VA 4QO1A 5E94B 4YHLL 3C5ZA 5IFHL 5D9SA 4L9DA 1NAKL 2NXZB 2JB5H 4I1NB 2DL2A 4GMSL 1QRNB 1SM3H 1YEGL 1FDLL 3C9NB 1N0XL 4XNMA 1JHLH 1VFMA 4O2FB 1GYAA 4PJFE 2SEBB 3CVIL 4JFQA 4PRPB 1YDPA 4OI9A 5L88L 3BH8B 1S9XB 3LV3A 4FS0A 4IBLT 1VESA 1HXYB 4I8DA 2VZOA 1XAUA 4OI7A 3DX9B 1J10A 1DCLA 3DX7B 5DEGA 3I85A 2UYLA 5CWSA 1DFBH 1I7ZA 2IWGA 1J87A 4M61A 4DTGH 4R4FL 3EUUA 5MENE 3RU8H 1AFVH 3DX8B 3B6SB 2APBA 3TBVA 3CFBB 1ZVSA 3KJ4B 3V0AC 3D39B 3BPOB 1I8KA 4RMVA 2CRYA 5A2IH 3QZWA 3L1OH 3R4DA 1Q0XL 2FBJL 3KPNB 4XCYA 3VA2C 2N56A 2J1KA 5E00A 3T4YA 4F37F 4M1GH 3RVVD 3HTLX 3CVHL 1T5WA 3BDXA 2HLFC 1TZGL 3S5LB 1P9MC 2QADB 5FV1L 1HXMB 4HJJH 2Z92A 4D0CA 3BQUB 2VLLA 5DUPL 3D3VD 5DJ0B 5JW5A 4JCLA 3ALXA 3MRPA 3QDJD 4TSAL 2LV4A 1A1OA 5C08E 3RIAF 5SWSE 1A4JA 5C9JB 4WI9A 4UV7H 3SDAD 4XCNB 1XF5A 1U8IB 3VXQA 1PW3A 2YBRB 5JPNA 5DFWH 2FWOB 2XWBA 1EFXD 4RIRB 2XTJE 4UT9H 1N2RA 1OSPH 1T03L 1LO5B 3O6FD 4R96B 2DQTH 5C0AA 1KJ3H 4HQQL 1NBVL 4L4TA 3DXAA 2Y4SA 2DQUH 4NQXB 5CJQL 3BH9B 4KTEH 2WBWB 4NRZA 3WHE0 1NGYA 1ACZA 2DDQH 3MRBB 2BVOA 4CNIA 4CUCA 5IIEA 5DRZA 5J11C 3SO3C 1KB5L 2EYSB 3S4SA 1HH6A 4OFIA 2AV7A 2AJUH 1HWHB 1AI1H 2OP4L 3D3VA 5H37H 4KY1L 3KAAA 1UZ6F 1JPGB 2X41A 2PYEB 4QOKE 4Y4FD 1DBMH 3QIWA 1U3HA 5CHNB 2PXYA 5HHMB 4C83B 5DJXA 4XX1G 1OAYH 4FQLL 1DP0A 4U1MA 2PO6A 4PJBB 2DIAA 1R5IA 2R39A 4U6TA 1T66D 2BZDA 4ERSH 1EHLH 4K2UH 2AJXH 4IRJD 1T1YA 4D9RD 4DOHE 3PP3H 4MXWH 5EO9A 4X4YA 3SDCD 2VC2H 3B3IA 3O6FA 5I9QB 1KPRA 2EE6A 2X1QA 4YFLI 3MNWA 1GRWA 5HPMB 1EMTL 5KS9F 5T5NG 4DAGH 4ZUVB 3TBSA 3CH8A 3L3OA 1XCQA 5ISZD 1XGUB 1JTOA 3FONA 4X80L 4Y1AD 5ICZB 1UH2A 1YMMD 4PR5B 3OJDB 2EC9U 3PV7A 3NCYS 3R06B 5HVFB 3QISA 4HIHA 4Z76B 2B1HL 2F5BH 1DE4B 4JZJB 4DK6A 3D2UD 3NZHH 1A22B 3ULUC 1OP9A 5EH1A 3H0TB 5TFSL 4BM7A 2O5XL 3ZKXC 3IJSB 3SDXF 5DYOA 5EZJA 1NLBH 4NZDA 1DBML 1IC4H 2HVKA 4N8CL 2X9WA 1J1PL 2ZG3A 1ZLSH 1FZOA 5HGAA 3MV8A 5T5FL 4PJAE 3TO4B 5MEOB 5BS0E 1GOFA 1LO5A 4HWZA 4IMLB 4QRRB 5IVXF 4OZIF 4DKFH 3BI9X 1JYVA 1BFVH 4JFDA 3Q5TA 3NGBC 2NY3D 3V6OE 1DN2A 1P7KA 1Q9LB 1R3LB 3GSRA 2ICEB 4ZTPH 4DGIH 1A9EB 4P9HL 3QPQC 3Q3GA 4ZAKC 3QB7C 4MA3B 4NC0B 5IBTH 3S8WA 3WBDA 3UTZB 3IFPB 4V1DA 3NIGF 5DHVB 4JM4L 3OZ9H 3EZJB 5K93A 3CSBA 5H2BB 1ZT7A 4BQ8A 3PQYD 5DC4B 1HQ4B 4JPIA 4OIIL 4XNUH 5I8KL 3CDFA 5DMGD 7FABL 4OGYH 4XNZC 4QTIH 3O3UN 4MHHG 5E2JA 3QWRD 1FLTX 5I76B 4HJJL 1ZHNA 3QFJB 1MIEH 1WLHA 1ZGLM 2GITA 1YY9D 5HGHB 3GGWA 5ECJE 3MRDB 4TUOA 4PJDF 5DJAB 1DQML 2R2HB 1BZ9A 3QBTB 1FYTE 1MCCA 1DBBH 3K0WA 2HRPH 4KTDL 5TQ0L 3WHXB 5B8CC 4I0PC 4X8JA 25C8H 3RWGB 2GSIA 4PJEA 5ALBL 4QRTA 1WC7B 4NN6B 2DYPB 4QYOA 3HC3L 2IQAB 2R8SH 4X6CA 5I1IL 4G43B 3BFOA 4HFWB 4QRPD 3LS4H 1HZHH 5H94B 4LCCB 4J6RL 2GIYA 1RAMA 2R15A 5IB5A 1IFHL 2X4NA 1QFHA 5FGBA 1NCCL 4IOFC 3WFDH 4O4YH 3I9GH 3LKQA 5E5MA 1QR1B 4LEOB 4HUVA 3WE6B 1IFHH 4F9PA 3T2PA 3MRIB 4NN7B 3QAZB 4NRXB 3LZFL 4X8XA 2X4TA 4M02A 1QSFB 1BM3H 3R8QA 4HIIA 2UUDH 4MXQD 3MZTA 1HSBA 4NNXA 3M17A 5HSFA 4BQBA 1YN6A 4MLIA 3LEYH 2BNRE 3V2AR 1CD1A 1JVKA 4CVXB 2XYCA 4U7MA 1VEOA 4XPFL 5I17B 4IHOB 1CGYA 1AJ7L 1RURL 2PTTB 3LN9A 1I3GL 4HZAA 3PQYB 3ARDD 5BXFB 3QEUB 4GG8A 2P7TB 2EXWC 2BY1A 3P4LA 4G9FE 1OTSD 2P47B 3WS6A 4NO5A 1I75A 1NCUA 1T6VN 1UWXK 4U1SA 4YXHH 5IWLC 3ROLB 2VDPH 5SX4I 4D94A 4BFBD 2NY3B 2GHWB 5EG6C 1RZJH 3VXRA 3O3EA 1AO7D 2DKMA 1RK0B 1JZ8A 1AGFB 1GVIA 5ITFA 2CK0H 4YHKH 3HZKA 3DPBA 4GAGH 3VD9A 1IL1A 4KWUA 1U8MA 4P9HC 3L3HB 4OZ4B 4G6JL 4M8QA 1YNLL 3DETC 4RISH 3L3JB 4RFEB 1VACA 4KTEL 4Y16B 4MNHA 3T65B 3UJIH 2ENYA 3HMXA 3OAUL 4NKMA 3QEGH 3IKCB 4LVOC 2YD9A 2IAMA 3AREC 1IAOB 4R90H 2OR9L 3TT1H 5HDLA 1CGSH 4OFYD 4PRNB 3CX5J 5F88A 3SKNB 3TA3D 1WBXB 4GMTH 2VLMD 4MGXA 4ZFOL 1FGNL 5EN2B 1BBDL 1G7JA 4O51A 4OCRL 3SQOL 5T5FH 2F74A 3CSGA 2FNBA 2VERN 3TJEH 5F8RC 3U30C 1QPPA 1A7OL 1ZHLB 1PX4A 2FZ3B 2VABB 4K9EL 5FYLE 4Y1AB 1RUAH 1XGRB 1MLBB 5EBMB 3MRCB 2H8PA 4N0CA 3OX8B 1TTUA 1BIIA 1DJSA 2IPTH 5AWNH 2OZ4A 3OR7B 3PDDA 2WIIA 3RA7L 4JB9L 3VXSE 4QXGH 1BM3L 3RIFF 2FGWH 1QKZH 2WM0A 5KSVA 3CU1A 5C09D 3CZJA 1LDSA 4Q9RH 5EU7E 1CICB 5E4EB 1KYOJ 4GRMA 5L9DH 5K9JL 3PHSA 5EO9B 2X05A 4X4YB 1HHKA 4P2RA 4UT6H 1IKNC 3GSQA 1Q1JL 1E4WH 1DLFL 2XZAH 4JJ5A 1UM4H 2UY6A 5FGRA 4K3JH 3TP4A 1YQVH 4UB0H 4S2SB 4TRPH 4CMHC 3SE3A 3VFUB 4F7MA 4ZXBA 4HUWB 2XN9D 4ELMB 4GRMB 1JNNH 3I75A 5I74C 2FBOJ 5ID0A 1Q38A 1OP3K 1AXIB 1AY1L 4EDWL 3WS6C 5MENB 2FEEI 4I48B 3FN0H 1PQZA 3O4LB 1FG2B 3A6CH 5C0GB 5AZ2H 3CFEA 1K4CA 5J6HB 4S11A 1A2YB 4YDVA 1P9MA 3T0EE 3OGCA 3O11A 5F3BA 3NIFE 5B21A 1C1EL 1N6QL 4F8QA 3FT4A 4XNMB 1EHXA 3WYRA 4I9WD 5DMIH 1XR8B 3T0BA 2EIDA 1X5IA 2VWEE 4ZXBC 3T08A 1JWMA 3GSUA 1LO2H 4UTAL 5CUSL 3U2SA 5CEXA 1HYSD 2FO4A 3QYCA 3ZYIA 3SDAA 2ARJA 4MJ5A 4ODVH 2R2CA 1F6AB 1PY9A 5KZCD 1MHHB 4LPVA 1K6QL 2AABH 1RZ7L 4BFIB 1FFNB 4AT6A 1MH5B 1YYML 2B7DT 5CSBA 2IAMC 1OGAD 4YDLB 3VXRE 3BKCL 3C6SB 1JV5A 4TNVK 1U3HD 4KMLB 4ZTPL 1LWRA 2Y06L 4LHJB 4S2SA 3LIZH 2YXFA 4IJ3B 5HJ3B 1RUML 5CINH 5E8DH 4TULH 4DFIA 4G6KH 4WW1A 1HHKB 5CP3A 3PL6A 3TPUA 1E6OH 1TZHB 2WLYA 4UT9L 5F9OL 2P44B 3AUVA 2QQQA 1QLFA 5A2JH 1T5WB 3VGAB 1CGTA 5H2BA 1R5VB 4P48A 3C87A 1UQSA 4S1RH 5T3ZE 4ODHL 1IILE 1PG7L 5DURB 5IHUL 4EKXA 2ZCKL 1QRNE 3UBXI 1YEKH 3EYUL 4P2OC 5JPMB 1LHZA 2FECI 3W39A 3WEXB 1HI6A 2G2RA 4OLZH 5F70A 3MRCA 3MLSH 5H35B 1P7KB 4NHUB 1FNAA 4WFEE 4YFEA 2XY1A 1DEEA 2AJYL 4EBQH 4GAFB 5B4MD 3TH3T 4IIQB 4JANA 2L4OA 1RZKC 1BEYH 5HHME 4OQ1A 3RKDC 4D9QD 2VOTA 2YD6A 3MOBH 2OR8A 5CAYB 1K4DA 5KW9H 3NACH 3RWJB 4ZYKA 5CFHA 1FPTL 4WJ5B 1P53A 3I3DA 3GMRA 5E9DB 4HIJB 1GZPB 4GW1B 5DFVC 3SE4A 5BVJA 2ITCA 1JN6A 1T0NA 3HZYB 3LOWA 4XI5C 2V9RA 4R8WL 1BMGA 3QUMB 5C0JB 4LNRA 2IMNA 5BRZD 2VISA 3DLQR 1T7YA 4PLKC 2YC1A 3O6FB 3PL6C 4Z7NF 3PNWB 4BUHA 4XMKH 3SGJC 1QRNA 1KIPB 1UB5B 2A6IA 4HCRA 2BSRB 1KCRL 2K7PA 3JXAA 3N85L 5D2LA 4V1DE 2WP3T 1A6ZB 1N3NB 3PWVA 4TUJB 2DWDA 1KENH 4PJFF 2GY7B 3R1GL 5KSBE 4NDMA 5C0CB 2G5BB 4G8FB 1ZHBB 3H7LA 5D5MB 5DFTA 1TPXC 3BP7B 1P7QA 3HFMH 4JY5H 4PR5A 4FXLA 4PJ5B 2WUBH 3WMSA 2R1YA 4HX1B 1XF4B 4WUKL 1WEJH 4K7PY 3JVGC 5IESH 5GZOD 4XVTL 1YMME 4OI8A 5JNYB 1F02I 4TNWK 1CFNA 3GRWH 3EFDH 4NJ9L 1MPAH 1TVBB 2C26A 3W81A 5IEHB 2FJGB 2P7TA 4PG2C 2IH3B 2FECL 4PREB 4HEME 1P7QB 1IGCL 3MSPA 3W2DH 3O8XB 4PRAB 2J12B 2YUWA 3BKML 3QPQD 4N8VG 1R5WB 4AYFA 2IADA 1QD0A 4G6KL 4Z7UE 1J0HA 3A67L 4WFHE 1E28A 1MNUL 4JJ5B 4M6NH 1UEYA 2VDPL 4L4TE 1M7DB 5FO9A 2HT3C 4N0CC 2BVQB 3QULB 1E4KA 1ZGLA 3H9ZA 2FR4A 4WI8A 3IDJA 1FBIL 3KPSA 5I8CA 3BGFB 5IJKC 3PABB 2VDOH 4XWOC 1VPOL 3B9EA 4H5SB 1FGVH 4I5BB 2YZ1A 1EZVY 2DWEA 3RU8L 4RMTA 2ZKHH 3ESVF 4M7KH 2HRLA 3LKRB 4J8RA 4UDUB 2WBKA 1B90A 2W1NA 4ZD3L 5EUKA 1J1PH 4GAYB 2BCKB 2LTQC 3NIFF 3HNVH 3S37L 5I73B 4PYGA 1NAMA 2B0SL 4JY4A 1N3NA 1N0LA 5C86A 5HVWA 1K8IA 3EYQC 3HAEB 3VWKB 4UT7H 4YGAB 4NP4L 2JJSA 2NY4D 4ZFGH 5JQ6L 2BFVL 2YPVL 4LCWA 4LOUC 5DRXA 5J6GB 1UJ3C 2E27H 5K33A 2DMCA 2B8OT 5EUOF 5EU7C 4LNRB 3GMNA 4KMQA 1YY8A 1TVHA 4YHZL 1UKSA 3DV6A 4JRXE 5HHOB 4LIQE 1VFBA 3SDXA 3CK0L 4PRDA 3N85H 4HIJA 1IGCH 4HDIA 3BKMH 3ZKMD 5LBSH 3I6LE 4Z8FH 3EGSA 4PJ9A 3EOYG 4DKAA 3OQ3B 2Z92B 4LVHC 4JRYE 3OL2A 5JIIA 4JZJA 1U42A 1X6LA 3ULUH 4U2ZA 4X7TB 4L8SB 5IVZB 5C2UB 1MVFA 1FPTH 4RBPH 3T2NL 3LAFA 3ZZ1A 5DYOB 5EZJB 3DOSA 1UM6H 1H3TA 5IK3B 3IJSA 3JV0A 1VCAA 1LVEA 3VD7A 5D2LB 3I6KA 1OTTD 3WIHL 2J8HA 4PLOB 5SV3A 1OGTB 1JZ5A 4LL9A 3UO1H 4CVZB 1EO8H 4XMKL 4YAQA 3RL2A 5HHOE 4KUZL 1NEUA 1JHTA 2R8SL 2V5TA 1PKOA 1NMCB 1VADA 5ENWA 4ZUVA 3IFLH 3NAAH 3D0VB 4WW2F 1D9KC 3TT3H 1FP5A 1A7PH 1B2WL 1CICD 4FZ8H 4JRYB 4UV4H 4H8WC 5GS0C 3TN0A 4MD0A 5D7LB 2AJSH 1T2QH 4X4ME 5LAXA 1CT8A 2QHLA 4L8CB 1CXFA 5KVEL 4PRHD 1HINH 4QNPF 3FHAA 1TDQA 3IXAB 3QDGB 4PB0L 3U0TB 4X6CF 4XMPL 3SDDC 1L4IA 2CRZA 4AL8H 1FZKB 2F8OA 1IKFL 2A83A 4F7CA 2O5ZL 3QUZC 5DZNA 5I15L 3DYMA 2J6EH 4WHDA 1K8DB 2DQFA 4JFEE 3QEHA 2DQIL 4PJGF 3ET9F 4PRDB 1TCRA 2J5LB 4RQQB 5IEKB 5FO9B 5FKAB 5CEYA 1ONQA 4OB5H 1YNLH 2V2WB 3VU2A 3CLEH 1A4JB 4HH8A 1QFOA 3NCYP 3NIDE 3WKML 1F6AA 2R1WA 3DARA 4KI5F 1YECH 4JHAL 1YYLH 4GH7B 4JM2D 4PDCE 4OKVA 2B1AL 4EQ3A 4J23A 4B7IA 3BRFA 4ODTL 1J05A 4WEMB 5DJCA 1SY6A 5SWQA 3FRPA 4X9BA 2FX7L 2E7LA 3WNLA 4Y4FC 4U2YA 4WFGD 3BD5A 2AV1A 1M4KA 5EUKB 4JFEA 2APVA 4NQSA 3S3JA 4XBEL 1O7SA 2AEPH 4JFHE 3MUZ1 2I27N 2AEPL 5BQ7A 3ZMRA 1G7PB 1JCKA 2XI9A 3SHSA 2AKRB 3UYOD 2P8PA 4KKNA 4QTHB 2L7JA 4I18A 1YPZF 5IMLB 2V7HA 3L6FA 5D71L 1FNLA 4JFFE 5CZKA 2VLJD 4WEUD 2WANA 2X44D 1AHWA 2BJML 4EDXB 5E2UH 1X5LA 3TJHA 4RDQG 3QQ9D 2H32B 5FUZH 4XRCB 3LRSB 1Z9LA 4U4BA 3QRFM 5E9DA 2DQFB 5DEGB 4WJ5A 3C08H 1I7TA 4HHAB 5EB9A 3V6FB 1CFNB 4Y4HB 3PWNA 3BKJL 1C12B 2QLVB 2IBBA 1M05A 3KYNA 3RVVC 3MLZH 3U7YH 1QSEB 5ITFB 4Y16C 5KOVC 1ZLVK 3BIAX 4YIQB 3EZ8A 2P48B 1XZ0B 1ZGLB 1LK2A 5BRZB 1RHHB 1F4YH 4NFDA 2V5SA 3SGDI 3RZCA 3TO4D 1QBLL 2J88L 5GRUL 1G0DA 5E2TL 3T3PF 4XB8A 5KAQF 4XNXL 4GAJL 3T77A 5C3TA 4R26H 5BZDA 1EEZB 2X1PA 2D7NA 3CLEL 4AK1A 3RTQC 3L3DB 3IJYA 1I9IH 5GZOC 2A6JA 1INDL 3DVFA 3HCVB 3QQ9C 4G9DA 3RWHA 1GGUA 2A9NL 4YNYB 4PV8A 1AGDA 3UTQB 2BY2A 4HX1A 4FXKA 1H5BA 3UYRL 1RSFA 4ZYKB 3RWJA 4WTZA 1F11B 3HN3A 3BVNA 3FQRA 1NC4B 4LFHG 4R4ND 1A0QH 3E0GA 3OZ9L 1I8LA 5FYJL 3SDXE 5I1GH 3MODH 3QNXA 2KQNA 4G80B 4LLDA 4RDQF 2JB6B 5D1XA 3VGAC 3VXSB 1C5BH 1I1YA 4G5ZL 5DUPH 2X4QB 2DLFL 1ETZA 3MYJB 3V5HB 1IGTB 5FHBL 2AV7B 4JFEB 3QAZC 2F5BL 4JN1L 4IJ3C 4L8DA 3G6DL 5FYJE 1P4IL 5DJ8A 1EEYA 3ARVA 3DIFA 2J8UB 1B4RA 1DQDH 5K9QG 2IH1A 3K4ZA 1WWAX 3I02B 3WHXA 2P5WE 2UZYB 1XGPB 5ID0B 4HDIB 4Z7UF 1KLUB 4QRPB 5HHMD 3HI5H 4LLUB 4RMRA 1G9NC 5IQ9B 4R7NB 3KPSE 5A16B 4MJIA 2GITB 3NPZB 4HCRH 4I0PB 4LPYA 5DUBB 2HT2C 4JDTH 1R3IH 4QXWA 3MRHA 2J3SA 4E42B 4MCZB 1EVUA 1SVZA 3EYFB 1A6AB 4WI3A 3JUZA 3P0VH 1GGYA 4N0FB 4UTBL 5MEND 2BXYA 2ZCHL 3IVKA 5FO8A 3F65A 3V5DA 4LIQL 3T0DA 4YR6B 1N5AB 4JHWH 5C07B 1J8HE 1JGEB 2XRAH 5I1EL 3IFPA 3VJ6B 4L3CB 2PXYC 4M6OL 1KGCE 5JHDB 4ZOAA 3V5HA 4G43A 5I74B 3IDUA 4JLRA 4GRWB 1HQRB 3SQBA 2EO9A 3GJFH 1NDMA 1ADQL 2XZCH 5JW4N 3SCMD 4XNQA 3OJMB 1QG3A 3C6SA 4XPTL 3VFSB 2Q8BL 3FO2B 2OLDA 4CMHB 5I1LA 3L7FB 3KXFA 1IBGH 5CKGA 2BNQE 3NMEA 2W9EH 5DRNB 1BBJA 1QFPA 2V17L 2ITDB 3ZTJH 3D0VA 1PX3A 2CO6B 4ZXBD 4YK4C 1D5XB 4XAWH 5ICZA 2HKHH 2E7MA 5E1HB 2AS5M 4TUOB 1CICC 4PY8J 2A83B 2P49B 2QADD 3MUJA 2PTVA 3P4MB 4BZ2L 3RVXC 3FQNA 3AVEA 2RFXA 1H5BC 2A6JB 4A2MA 1JPFA 4Y2DD 1CU4L 1OGTA 2JB5L 1IGIH 4RMUA 1S9VB 2E6PA 2VDRH 2FL5B 3G5VB 1QFWI 3HE6A 3VG0L 5CJ8A 5KS9A 2EE2A 4GRLB 4F57H 1OT2A 2W60A 4FFVC 5JXED 5E2TH 1AGBA 4XC1L 2LFGA 3BPNB 4GS7B 2AEIT 3HUJE 3CLFH 5HVHC 5KANI 1MELA 4M62L 1S7XB 5E4IA 1I9RL 3V6ZB 4MD0B 3OHXA 1T7ZA 4S1RL 4P3WA 2JCCE 4JM2C 5D2LF 2LAGB 2QR0A 2QQKL 3U0PB 2AJVL 4YIQA 1MLBA 5I1JH 1OAXH 4X6DB 5T33L 2PR4L 1T1ZB 4OM1H 3VFGL 2XTJB 3AREB 4M6NL 1F4XL 4RGNC 4WIQA 4TNWF 1GXEA 1A1NB 4PJHA 1A3LH 3JWDH 2CKBA 4WRLA 4FTVA 1Q9WA 3OPZL 3S4SB 1CFTB 5FF6A 3PQYA 4HBCH 1VB9A 3JV6A 3MLXL 3HB3D 4JRXB 3O3BB 1VEPA 4AIZA 1KF9B 3VG0H 2AJZB 1FO0L 2GCYA 3DRQB 3MRNA 4FQIH 1MFBL 2GKIA 2VXUH 4PBWD 4PJBA 5FOBA 4Z18A 2R69H 1G6VK 3DUUB 2PYFA 3ZE1F 1BIIB 2PYEE 2FEDD 2YZ8A 3CSYB 1J1XL 5D1ZB 4LAJH 4JHWL 5EUOB 3MV9B 1GJIA 2HN7A 2YXMA 2CJUH 4PJDB 5T1MA 5CIPB 1QR1A 1SBBA 3ARPA 4DGVH 4N0YL 3B2UD 3SCMB 3QUMH 1NEZG 3OTTA 2X42A 1D9KD 1ZT1A 2CDFB 4WVRA 3SPVA 5MHSE 4OFDA 4PJIE 5DJZB 4G8IB 3STZB 1AQKL 3D25A 5HI5C 4P5KB 2FR4B 2AGJH 3EHBD 3FOLB 2CIKB 3GM0A 4QYOB 2HRPL 1G9NL 1S7TA 3A6BH 2VLRE 5CD3A 1GGIH 1HILA 3GMOB 4OF6A 3O41A 1XF2B 1Q1JH 1FFPA 5EIVA 1TCMA 1RPQA 5E8EB 2NY1B 2GJ6A 2A73B 5HHOD 4QRUA 4MD5A 1RK0A 2W9DH 2GEEA 4H8WL 4LLMA 4PJ9D 5D6CB 4PD4K 3MV9D 5IVXB 4OZIB 5ILTL 4LCCC 1WWWX 4I5BA 2BOCB 4L1HA 3RBSA 5HTSA 2K9UA 2R1XA 3I50H 1A6WL 1TFHA 3TZVD 3RTQD 4FQHB 1L7TH 4WHTA 4LSQL 1NUGA 3MBED 4JPVL 4OCWL 3PUCA 1NAMB 4JY4B 2BP3A 3QUZA 4WTWA 4POZD 2EYRA 3VDCA 3C09B 3FT2A 4OZFG 1ZHKB 4P5TD 5A1AA 5KVEH 2NZ9D 5CJXC 2NX5B 1VKXA 1Y6KR 3DVIA 5JTWA 2GTZA 3U82B 3KS0J 2X4QA 2V2XA 3EFFA 5I8OH 1R5WA 2DQUL 1UKQA 5CJQH 3RBGA 4W6YB 3IDXH 1C08A 1T0MA 2C3VA 2NY6D 1J0IA 3O2DH 3WFBH 1IKFH 2NXYC 3BPOC 5JUEL 1HH9A 2XKSA 3L7FA 4XCCL 4NRXA 4J1UA 5KSBB 1BLNB 2A6DA 3SGDH 4J7RA 4QRSA 1IM3B 5D5ME 3KXFD 3GBNL 1KJ2A 4WV1C 4HS8H 1BQSA 1P84K 3BH8A 5GXBB 5F7NC 1QEWB 4JJHA 1S78D 4G7VH 4RA0C 1B4JH 2BNUA 3IXAA 1MJUL 2YEZB 2FATH 2XZZA 1DL7L 3KPOB 1CF8L 4L3ED 5JMOC 2ILLA 3BZ4A 4Y2DB 2EDEA 5DJ2A 4P4KD 3MRHB 3UTZA 4X7EC 1FN4B 1I7UA 2RQ8A 4OUUB 3N1PC 3OG6B 3MRMB 5TDPB 4D3CH 1I4FA 4I9WE 5A16A 2DICA 2JELH 1V3MA 4LLAA 2W0FA 1VGKB 1VADB 1G7LA 3AGVA 1FSKB 1ZHNB 1MF2H 3RNKB 1MRDL 5I76A 3SE9H 3N1QC 2DI7A 4YGVA 4U3XA 5MI0C 5ETUA 4N5EC 1JV5B 5DJ8B 4ODSL 1K2DA 1WFOA 2APTA 2Z35B 3PP4L 5GISH 4KI5D 1YJDC 1U3HC 4TSCH 4L9LC 1B6DA 2BVYA 4WHYH 2XQBH 4KKLC 3H7BB 1NJ9A 3VFWB 5F3HA 3HPJA 3QJHA 3MBEC 4GKSA 3RDTB 1S7SA 1ITCA 3O4OB 4YHPA 2FGWL 4JG1H 3VWKA 3HE7A 5D1XC 2VZTA 1RZKL 4G6AD 4H0GA 1I9JH 5D7JA 2FGZA 4YEEA 5CEZE 1JIBA 3BN9D 3K8LA 1DEEB 4L3EA 5AD0A 2KH2B 4FFYH 1CZ8H 2Z93A 5I9QC 4JRYD 1E4WL 4W4OC 3A0OA 5AZEL 3EHBC 4M9PA 3GMLA 1X9QA 3ROLA 3NFNB 3OKEA 1W0WA 5ALBH 3TBSB 5FGCE 3HAEH 4K94L 1IGMH 5FA4A 5GGTL 3D0LB 5FYLD 2HJKB 4AG4H 2LE9A 3GKZA 4AM0A 2X4UA 3VRLE 1YEFH 3ARFC 1C08B 3FRUB 1CLOH 5BZDB 4K94H 3QI9C 1BGXL 5A2KH 4YHMH 4N9OB 3ULUD 3GO1H 4MDIA 1CGWA 4EUPB 4LAQH 5EZOH 1LGVA 5C0FA 4MCYB 5B39B 1WIUA 1R5IB 3EDDA 4MZ3A 1OGAB 3QUKA 3QHZH 2AEQH 3LKRA 5C6TL 4NQDB 4AY0A 3RUGB 1PG7X 5FM4A 3RP1A 1NQBA 1BECA 1KLGB 3HB3C 3FFCD 4YBQC 4XHJC 3DROB 4RGOH 3LEVL 2BNRD 1JBJA 4WTZG 2EDJA 3IGAA 4NUGH 1MRFL 3OAZH 2E9IA 4W6XB 5FGCB 2BNUB 2H26B 1Q0YL 5T1KA 3VE0B 1J9CT 2CMRL 5MI0B 1BFVL 1K85A 1JZ6A 3LHPH 3IDNA 5TGBA 2I60H 4NC2B 3MJ9L 2MKWA 2VIRB 4GJTB 2JJTC 1CIUA 1X5KA 2FJHB 4ZPVB 4XXDB 4KJWC 4NT6A 2NR6C 1FIEA 2YPLD 3OF6D 3WLBA 4QRPE 4G8IA 5BQ7B 1YNKH 4FQJL 3P9MB 1T0NB 4GSDH 3FO2A 4JPWH 4NCDA 4HIEB 3VMOA 4JG1L 1WT5C 1L6ZA 1QVOB 2H1PL 3ISWA 4HT1L 4Y5VA 4WUUE 3OXRA 3STBA 3BIKA 5BS0A 4PRPA 3WNOA 4Y2DC 4DUVA 1CD8A 2NY0D 1I7RB 2O61A 1A6TB 3WXVH 4YUEH 3MV8E 5ESAB 4HCRL 2VABA 4S1SH 2D9QB 2XXCB 5AZEH 2H2SC 1JL8A 3T4YB 2P5EA 2X9YA 3U46B 5TDNA 5IMOB 5JMRA 2PYFB 1JNHB 2I60L 5JIHA 5F3HB 3F62A 3CXHK 3HI5L 2VLJB 3GIVB 2NY5L 4U1HA 2NXYB 1LILA 3OAYH 1ROWA 3GJEB 1QFWM 3IXTA 3LQMA 5ETUB 5MERB 1I7ZB 1MRFH 5ITBL 5HHXH 43CAB 5C0FB 1A1NA 1ND0A 5GGSA 3O0RL 3B9DA 3X13A 4RAVB 3VI3E 4J6RH 3BIBX 3Q6FB 2VITB 4BFGA 3SDXB 2NXZC 4XBGA 3T0EB 4XPGH 4F33A 2NY5C 1MH5A 1SEQH 4H1LA 2OTUA 5JLZA 4O2FA 4OAWA 1T5XB 5KSUA 2DJ4A 3KNBB 4PGBA 3U9PL 2MWCA 4WO4D 4E41D 2E9BA 3MREB 3MLRH 5E5MB 5DDHB 5LWYH 5JW3H 2Q86B 3UPAA 1UQSB 5JDJA 5IB3A 5EO1B 1E6OL 1IEBA 3IFOA 1IL1B 4P4RB 5I66B 4N0UA 5C0EB 3U4AA 1YC8A 1WZLA 1ZOXA 1QFWH 2NNAA 3NCJH 5IJVB 2NY1C 4HFWA 4XMLL 5D1ZA 4FQCH 2DQDL 3NZ8B 4N90D 3BKCH 3LEXB 5CKAA 4M6MH 4HMEA 4UZGA 2FB4L 4PJ9C 4P46C 4FFYL 4OV5A 5EU6A 4ZS7H 3HC4L 1JHKH 2F58H 5KVFH 5J89A 1XCTA 4X4ZA 2WSKA 1KT2B 4NN5C 4YAQB 3H9SE 1X7QA 4Q9QH 4W6WB 4XVSH 1UM5H 1B88A 2Y9RT 4HKJB 3RUGE 2VH5L 3MRIA 1SEQL 4JN2A 1N64L 2OZ4H 2R2HA 2FO4B 3WUWB 4X6DF 1HCFX 1W0YT 4LASH 3LQAH 5I19L 2D7PA 4E0RB 4JGJA 1CQYA 2Z31D 4ZO9A 1FVDB 4HF5L 4NQVB 2FX9H 3HLAB 3TNNA 3JWDC 4CVXA 3CX2A 5EBWB 1D5BB 4B0MM 3ALPA 1QNZH 5C07A 3AAZA 4GQ9H 4U0RB 1JGDA 4P46D 2QR0B 4GKNB 3DUHA 1GL4B 2X2YA 3QSKB 4UOW0 4J3WA 2E7CA 3O3AB 4XNYH 2I9LB 4JFZL 4MB4A 3WXWL 1S9YB 4CJ0A 4NOBA 3QRGH 3QIWB 2XKNA 1WF5A 2ED8A 3L5HA 3BYTA 1XF4A 3VWJD 1T21A 1Z9SA 3X11B 3GMQB 3GI9L 1QSED 4WHCA 1LE9A 4LKXB 3KPMB 1ZHBA 5D5MA 2RR3A 4LPWA 5DK2A 4XVSL 1MRCL 5FOJA 2DMBA 4NDMB 4PRIE 1X5XA 3QCVL 3MFGB 4BH7A 3VH8B 1RIUL 5B3JF 3MRBA 4XCEB 1R24B 4UUJB 4Y8AA 2GY5A 4F7TA 4O51B 2UWEF 3TWCL 4NQXA 3BZFB 1GZQB 1OQOA 4PTTB 3UCRA 1O7VA 4XVJL 2YD4A 2WBJC 3RJDA 4KJQC 4BSWA 4MMZC 2WBJB 1MCFA 3PGDB 2GJ6E 2HT4D 1MI5A 1NC2A 1T3FA 4OJFH 1MJUH 3IFNL 4L8BA 1HEZA 4G6MH 1ZWIA 4PRHB 4E5XA 3L95A 3N9GH 1CF8H 3TGXA 4CL7A 2HWZH 1OWWA 3KHOA 4TTGA 4LDLB 3P2TA 3RZWA 5IMMA 1MWAB 2P5WD 3ARZA 3HZVA 4YE4L 5D7LD 2OTPA 3GMLB 4AL8L 4XPHH 4AEIL 5EZLA 2B1AH 5F7FA 5GHWH 4OIBA 2BHZA 4K71C 4OF3A 1AGCA 1QUNA 2F53B 3H9HB 4H25A 2ESVD 3G04B 1B0GA 3REVA 4PRPD 1QBMH 1DQMH 2A77H 1SBSH 4I0PD 4WI6A 4YHPB 4CGTA 3BW9B 1FG9C 2G60L 4YHML 1B0RB 3RDTA 1YJDH 2RCSH 1QBBA 4KRPC 1YEDA 4YHIA 4WUUA 1AE6L 2I07A 2VYRE 1U8HB 1TQCC 3BKYH 4NC1C 4YK4B 2DYPD 2PN5A 1U8NB 2VQ1B 4FG6D 1S8DB 1NBYB 5I15H 4V1DD 2EDQA 1IQDA 3Q6FA 4OFYA 4UNVA 3KWWA 2NLJB 4NO0A 4BKLB 4N5EA 2GFBB 1AD0A 3DX9A 4R4BA 4XAKD 4XP5H 3RGVC 5BV7C 3FB6B 4EOWL 2NCMA 2GUOB 4U33A 3ZL4H 5TQ2H 3O9WB 2WP3O 4IRJC 1AGFA 4CU7A 2BVEA 1MCPH 5ICYA 2D4DA 4DOHB 5DJZA 3STZA 3SOBH 2VXSL 2AJ3A 2CK2A 2X09A 1PSKH 1IAKA 3KYNB 4CKVX 2P8MA 2UWEB 5LJYH 1NCDH 3HG1B 3R1GH 4PP8C 1NGQH 3HNSL 4Y5XC 2DBLH 3ARBB 3BZ4B 2LABA 4OCSH 1I1FB 5CBEA 3CXHJ 3ZTNL 2R2EA 1HH6B 4JQXC 3F7VA 2XIDA 2APWA 5ALCL 4WFHD 2CRMA 4XHJD 1RURH 3RNQA 1RVFH 3E6FB 5DHYA 3KYOB 1G7IB 2HT2D 4HZLA 5DD6B 3DUUA 3KPQA 5INCB 4ORZC 5TFSH 4ZPTA 2YA2A 5FUOL 5TH2B 1K3ZA 1F97A 2GSIB 1TNMA 2AJZA 3L5IA 4PJEB 3V6OA 1WZKA 1IC5L 3IDIB 2X9XA 4BSVA 4YDIH 3W0WD 1I1CA 2AXGA 1YMMA 3HUJB 3RNQB 1J12A 4KGLA 1T1XA 2ADGA 4XP1L 5HHVH 1IC5H 4ELKB 3UZEA 4FHBD 4KVCH 2BVTA 3L5XH 1VEMA 4EXKA 2JLLA 2AJYH 4GKZA 3EO1B 3GSXB 1HHIB 5IB5B 3IU3B 2UZIL 2FX8H 3GI9H 4HK3J 2XZQL 2EC8A 2EYSA 1JGUH 1X5ZA 5F97E 4PY7A 1MREH 1T83A 5GGRB 1RHHA 4FQIL 1RI8A 4PJ7F 3QUYB 1F4WH 1CXLA 5GS1C 2IANA 5F7YC 2BDNL 5LXGL 5A43C 1RVFL 4EI6A 1FGVL 1RHFA 4PJGE 4RAHA 4X5XB 5D2NA 3ALWA 1CLZH 2XWTB 4HKZA 2FD6L 3VI4F 4RNRA 5TE4H 1AGBB 4HMCA 1NL0H 1X3DA 2CJUL 4TYUA 5CEZD 5DQDH 2EE9A 2X1WL 2C1PA 3GHEL 3KJ6H 4DGYL 1JHLL 1G7HA 4Z7QE 4HS6B 3G6DH 1OSZA 5IQ9A 1EBPA 1JZ7A 3IDGB 4XCNA 1RU9L 4YDKL 1UKTA 3BAEH 4BFIA 1PYWA 4LNVA 3QI9A 1JPST 1KOAA 3ZL4L 1MFCH 4PJ5D 4XX1E 4X5WA 3EJZC 3SE8H 2DLFH 5CGYC 1RZ7H 3AU1A 4QOKA 2FJFA 2V2TB 3SKNA 2E6QA 3DMMB 4X98A 1I9EA 1Z9OA 5T3XL 3V7AG 4Y2OA 3CK0H 2BK8A 2CDGA 2IQ9H 3RGHA 4NHCH 4KKLD 4P3DB 4MS8C 2CDFA 1O0VA 2PCPA 4BZ2H 1CU4H 3QXWA 3BO8B 1HHIA 4XP9L 4Y5YC 1QOKA 4YXHL 1U8MB 1Q8MA 3MRPB 1R3KA 1OM3H 4NQSB 2J6EL 5EORL 4MLSA 5GGTH 4JDVA 4ZTOH 4EI6B 5DO2C 5EBGA 2BOBA 1U3JA 2WUCL 3FFCE 1DQLL 2BVQA 3E2HA 5L6YL 4E9LA 5C0BB 3BX7C 5I8EA 2W0KA 3PV6B 2H3NB 4HUWA 4JPVH 4OCWH 5IG7B 1MSPA 4TSAH 1AO7B 5E8PA 5SX4H 3VFVA 4QHNB 3EDJA 4YPGB 2XN9A 4OLUH 4S1QH 1AD9A 5DHYB 1RJYA 3UYRH 4JFQB 2UZXB 1RZFH 4GG8B 4RQQA 4NJAH 5IEKA 3GUTB 2F54D 2GQHA 1RUQH 4DN3L 5IOPB 4ZSOE 4IRSC 3ARFB 1KPVA 4LEXL 2ZSWB 3CPLA 1EFXB 1K8DA 2B4CH 4M5ZL 2H2PC 4LQ1A 1XH3A 4I2XA 4HH9A 2YUXA 3HR5A 4ONFL 1G7QA 5EU5B 3OR7A 1C16A 4ETYA 1DE4A 4MQTB 1WAAA 3LS5H 3NA9H 5MP6H 2BX5A 5F7DA 5E08L 2EH7L 2YPKB 3N06B 4JPWL 1MRCH 2YKLL 4OCYH 2HAZA 1D6VL 2CLVB 1AQKH 1N59B 2B2XH 4F80A 3GMPB 1WAAF 4I2XB 1A9BB 1VERA 5DO2D 4G8EB 2EDLA 5J13B 3DGGB 2VSCA 4BQ9A 4KJQD 4JGUA 5D1XB 3O81A 4N0YH 2NY2D 4ZAKA 3O6KH 1D7FA 3MUGA 4JQIL 3MBEB 5A3ID 3PWJB 1JPSH 4GBXD 3VFNB 4X99A 3VI3F 4LDEB 4BSVB 3WFCH 5CJOH 2GYSA 1NUFA 3KYKH 4DZBB 1I8MA 4Q6IA 3NCJL 1JTPA 2ZUSA 5DJDB 1NMBH 3L6FB 5HD8D 4OCXL 4OTXL 3HCVA 3JV4B 4UINH 3U36B 4KXZI 5IHZA 3CFJA 3P30L 5AD0B 5GIRA 3PWJA 3VFNA 3REVB 1P4LB 1XGQB 4PD4J 4L4VA 3AB0C 4OGXH 1FNEB 1ZSDB 2VRAA 3QA3B 5ERWA 1BIHA 3T77B 1IZJA 2CXGA 1EIBA 1MFDL 1BFOB 3DV4A 3FT3A 2Q6WA 5HI5D 3O8XD 3QZWG 3MA9H 1ADQA 4NWTL 3H3PL 4P49A 5CSZB 4EVNB 3CDGA 2Y25A 3ZE1E 1UWXH 2VL5B 1D9KB 4AEEA 2MMXA 4IMKC 4NWTH 4D2NA 1OW0A 4MAYD 1KCKA 4R96A 1ND0B 2Y5EA 5GGSB 3SE4C 1CLZL 4TOYH 3DNKA 3JTCA 4NIKB 4UILH 3ES6A 1BD2B 4LU5H 5M95B 4ODVL 1NLBL 1CZ8L 3GUTA 3LKNA 1I8LC 4WV1B 1G7HB 2DJUA 2LQRA 4HWEH 3HPLA 3X11A 1LE9B 1F00I 5CZVH 2VAJA 2VAAA 4ONHB 3A6OA 5DRXB 4AG4L 4DGVL 4M1GL 3SEPA 2VDQH 2PNDA 3T04D 4HGMA 1MHCA 4TSBH 1NC4D 2R0KH 4UQ2A 5EC1A 1LK3L 5E6IB 4Q0XL 3ULUE 3TH4T 1DQQA 4JFXA 2R0LH 1Z9MA 2ZUYA 3QCUL 1R3IL 3B9KA 4YO0B 2X4OA 3QUXD 4LVHB 1A14H 1BFOA 5JDSB 5FYKH 1ZVSB 2IQAA 5D9SB 4G6FB 5MEQB 3V5KA 5JHLH 1T7VA 4U3CA 1P4BH 1KEGH 2ZCLH 4Y4KA 5KS9E 1JFMA 2DM3A 4HBCL 2WY3A 3Q1SL 3DUSB 3PGFH 1U93B 1W0VB 2FJHA 4ZPVA 1TMCA 1XFPA 1JF1B 5FO7B 1OAKL 4OGAC 4TSCL 5FXCH 3L5XL 4K55A 1UJ3B 1QSEE 1M71A 1QP1A 4RWYH 5GSVB 2DQHH 4NQVA 4PJHF 3ZHDA 4TPRH 2YD5A 3E6FA 1T7XA 5I75B 4P2QA 3C60D 2OX5A 2DKSA 1UXWA 3BUTA 3UJIL 4PJFA 5E2VH 3V52L 3RVWC 4P3CH 4HS6A 2A6KA 5I73C 1OLLA 1MF2L 4LHUB 5K9OA 3S37H 5C70A 2HH0L 1T1YB 3TIDB 3D85D 3QEQB 4RNRB 5T1DH 3SGJA 1UADC 1A7RH 1E4JA 4KJPC 5FYJU 3JTTA 3P73B 1A0QL 4X6CE 4NUJB 1WUNT 1DQDL 1OP3H 3OX8A 3SCMC 5K9JH 2AXFA 2JIXA 5L2JA 5C0ND 1QO3A 2DM4A 3ULVE 4O5LL 4V3EB 3QUKB 3MACH 4ODBD 1KN2H 5AYUH 2V7NB 4O00A 3ZDYF 2DQIH 3OMZA 4MD4A 2QJDA 4QXGL 1F4AA 4DVRL 5D1ZC 3U1SH 4ODXA 3TO4A 5MEOA 1KIPA 2F8XC 3IAPA 4N8VB 4XXCC 3UTSB 2PYED 4JN2B 3U83A 3MRKB 4Y88A 3I84A 1H15B 3JWOH 4JFOB 4CU6A 4CRPA 5L2KB 1Z2KA 3MODL 5HYJA 3KLHD 3BHBA 1T0PB 4OLYL 2F58L 1W0WB 2EDNA 4ZPTB 3FO0L 3FQWA 3MCKB 1F90L 2BVUA 4R2GC 4NQCB 1RY7B 2JJVA 2Q76B 3FQUB 5FM5O 4H20L 1AQDA 3AS2A 2BMKA 1BBJB 1K8IB 5ACLA 3MV7D 2YK1H 4O2CB 4OTXH 5E0QA 1GC1C 1BGXH 1SJEA 3JZ7A 2MQCA 3RWFB 1XR9B 4JDZB 4N0UB 3D2UA 2ICWB 1A47A 4ORGB 4U1HB 4YHOH 4H88L 3EOBA 1OP5K 3JTTB 2OI9B 5DQ9B 4EI5D 2V17H 3L3OB 2XG5A 1DQQB 1DUZA 2VLKD 3QNYB 4ZUTA 3HG1E 5T1DL 1R5VA 4FP8H 2OXGA 4PG9A 3T09A 3NCEB 3EW3B 4GW4A 1PG7W 2I24N 4F9LA 4GRLC 3QDAA 3T4AA 3QIBB 1BJ1J 2C4FU 3ARED 3ZTNH 3VXSD 5D7JD 4C4KT 2FCBA 4M93B 5E2VL 4JG0L 1YA5A 1MY7A 4OZFH 1KTRL 4Y19E 3CU7A 5E70A 3S9DB 4NNXB 4M43L 3QWOA 5IB4A 4AT6B 5EUOE 4DQOH 2C1PB 1JP5A 4C56B 4G59A 1J8HD 4WI4A 5IFHH 3KPTA 1NCTA 4GRLD 2XKNB 4AQ1B 1OTSC 1NAKH 3PHOB 1MI5D 1FIGH 4KVNH 5JORA 4OF7A 4GRWH 1S9XA 3TIDA 2XN9E 3BXNA 3OJ2C 5TF0A 3HE6B 1MCNA 3HC3H 4QRRD 1IAMA 4RAUA 1CVRA 1BP3B 4N1HB 1WBYA 2VE6A 4H26B 2X5PA 5FDYA 4UOW1 3CFEB 5J6HA 2KDGA 4OZHA 1RJLA 4QRTB 3V0WH 2VLRB 2BRRH 2NXZD 3EYSH 4L29B 5C08B 1XGQA 4G3YL 2ICCA 1CFSB 3GBLA 2QTEA 5D6DA 3OKKB 1Q94B 4OM0L 1HIMH 2YOCA 3HNTH 2ZCLL 1X4YA 2WBJA 3GNML 3QHZL 4L5FH 3CZFB 5C0DB 4LLVB 1GZPA 3MRDA 4G9FD 3FO1B 3MMEA 2NW3B 1FE8L 5C9JA 1G0YR 1P5VA 3ROOB 1M7XA 2RAMA 3B5GA 5D1QC 5JW5B 4KROD 1MCLA 3SJVA 3RGVA 4CADB 3VXUB 4YHOL 5ID1B 1D9KA 2AXHA 3WFHB 43C9A 4NUGL 1CS6A 4URTB 4S0UC 2EXYD 2Y23A 4HSQA 3ULVF 3CDGB 3TVMC 3EOAB 3G5XA 4PRIB 1QFWL 4I3GA 2AJSL 1KG0A 1YUHA 3P0GB 2VDMH 3VFRB 2Z91A 2PKDA 2XNAA 3FQXB 3EKCA 3VXUD 4MNQE 4IOIB 2X7LB 1G9MH 5DK3A 1BQHB 3NABH 4D0BA 1EVTC 4ORGA 1FZJB 5IFAH 2DI9A 3I3EA 3GSNB 3U4BH 4R7NA 1T03H 5E2UL 4APQB 3WS3B 4KPHL 4KFZC 4GXUM 3RQ3A 5BJTA 1IAIH 1WT5A 2AK1L 4GQPH 5IT2L 3PF2A 2NR6D 3TJHC 2Q87A 3ZDXE 4J3OC 1JGVL 5GS0L 4P5TC 1LO3L 5F9DC 1TQBB 3MRMA 2CIIA 4OGAD 3RKPA 3D48R 5ITBH 2OL3A 4GQ9L 3MUGB 3MYZA 3L3JA 1FFQA 1FN4A 3A67H 4LKCA 4CMMA 4MDJA 1KCSH 4NNPL 1EEQA 1FDLH 3KPRE 3BPCA 1N8ZA 3X12B 1JRHL 5F1KC 5D2NC 1U91B 3K2UL 4R3SB 3QIBC 4M5YL 4UDTB 1PGRB 2NTFA 4JDVB 2Z4QA 3RI5F 4P57A 2EH8H 3S96B 5CUSH 5EDXA 4ZDHB 4PTUA 4PGZA 5IF0B 1QHPA 4WO4C 1A6WH 1U8LA 3IRZA 4XGZB 4Z5RA 3BP4A 4IOIA 2AJXL 4UTBH 5C0IB 3U7AA 5CCKL 1DN0A 3EOAA 5C0RH 3EJYC 3FO9B 3ULVC 1ZT4B 4XVJH 4Y4HC 2BC4B 3BT2H 1DBAL 4XCFH 4MJID 2CLRB 4XBGB 3T0EA 3UPRA 3W9DB 3L5JA 4NWUL 5IB2B 1WVZA 2B4CL 4MJ6B 2XV6B 2BFVH 3GZKA 1C5DB 2YPVH 3QI9D 5ACZB 12E8H 2O5ZH 3DVNB 4P2OA 2XICA 5D7IF 5KSAC 1LE5A 1ZTXH 1C7SA 3S35L 1FJ1A 4YBLB 5LWYL 4PJAB 1NCAL 2DKUA 2Q1EA 3MLWL 4Q9QL 2J6EA 4YXLH 4TOYL 1NFDA 4XZUB 5IHUH 5IB2A 2G75B 4M8VA 1INEH 1MCEA 2C1OA 4ZUUA 4NUJA 2DRUA 4WI7A 2VN7A 2WV3A 4MJ5B 5F89A 3CXDH 1WCQA 2DQDH 4LEOA 5GS1A 2I9LA 5L9DL 1J5OL 4K3DL 1EGJA 1S5IH 2ATPB 4DVRH 3CMOH 3SY0B 1OT1A 3D5OF 3F6LA 1OAZH 1KBGL 4JAMA 3G5ZA 4R90L 4JFXB 5JQHC 3U4EB 2YPLE 3KGRA 1JTTA 3CMOL 5DZLA 2F19L 2AK1H 1IMHC 4HWUA 4UQ2B 4WWKC 1A2YA 4MCYA 4YDVB 4BQCA 5B39A 2OZ4L 1I1AB 3CLFL 1R6VA 3OAZK 1DSFL 1ZA3A 4QHNA 4DWHA 3K3QA 4C57C 3K46A 1BPVA 1EO5A 1FRGL 3F8UB 4BK4A 1QZ1A 3W0WA 5L6YH 2R0WL 3SGEH 5DGRA 5D7IB 1MCKA 4XPGL 2GK2A 1T2QL 1ZANH 4NN7C 4ZUSA 1INDH 4F7MB 3MZGB 4X6BA 2IMMA 4DGYH 1KCLA 2YD3A 2OI9A 1GAFL 4RRPG 1BVKB 3FTGA 5I1CL 1KIQA 3T1WA 3IDNB 3C8DA 5TGBB 3R8BB 4Y4KD 4WEBL 1DANU 3DGCR 5F71A 2ICWA 3H3BC 3G6JA 5EOCL 2YSSB 4P57B 2D03L 5JXEC 3ULSA 5IMKA 3QUZB 3MPCA 4QGYA 1PAMA 4RZCA 4YJZL 5C0CD 4G6JH 2ZJSL 2Q8BH 3MJGX 3X12A 1MHCB 3D6GA 5D1QB 3IF1A 4WTXA 1Q9KA 15C8L 2YPLB 1I8IB 4U1IA 3C5ZC 5IR1B 4FQ1L 5IB1B 2OR7A 5JR1L 3EO1A 4MSWB 4PY8I 3U6RB 2AEWA 4MJIB 4JRXA 1S9WB 1HSAA 3H9SA 2Y07L 1JI2A 3QRGL 3KYMA 4XPBL 3V0VA 5F1NB 1FFOA 1KTKE 1NCDL 1KLUA 2K3TA 3MRJA 1OARH 3FB8A 3DX7A 1SYVB 5BRZE 4ZUWB 4HULB 1JZ4A 3QQ3B 5AYQA 2VUYA 4R4BB 3I02A 5I1CH 5BJTB 3KPRB 1CVSC 5I71C 2EEAA 4N5UA 2V7NA 4W81A 1G6RA 2PO6B 4ODWA 1PDKA 2X4UB 1DBJL 3L5WB 5DVKA 1F6LL 3LKPA 1NMCC 3VXOB 3ZSTA 3KYOA 4LRNL 1ZA6A 1ED3A 1HZHL 3G6AA 5EZIH 3HE6C 1YY9C 3PQYE 2VB5A 4MAYA 1CD9B 4K8RH 5DWUH 5L8LB 3T3PE 5C0BD 5FYKL 2VDKL 1S7XA 4R8WH 4LRNH 1RZIB 3N1MC 3UTTD 1FV1B 3S34L 3KDMA 5J57B 3NN8B 4MQ7B 1RULH 3MROA 1CLCA 1TJIH 4JHAH 2GT9B 5EO0A 2VE6B 5EOTA 3L9RA 4M00A 1PSKL 4OD2A 3NGBB 3QG6A 1IVLA 2DTMH 1AGCB 4FQXB 5FB8B 1N4XL 4POZC 2QV2A 3LEVH 3UTQA 5L0QB 1MFEL 4DKFL 1KJ2B 4XP6H 5A3IC 4KZEL 1D5XA 1HYRC 4OLVL 3O3BA 5CGTA 5A2FA 2PTUA 4QF1A 1XIWC 1CLYH 4NO2A 3AY4A 5D5MF 5DMKB 5DJ6A 3S3SA 3T0WA 5FIEA 2HKFL 3T3MF 4QRQA 3L7EB 3BGMA 3ZDZF 4UIMB 1ORQA 4UILL 2W0PA 1RZKH 4LSSL 2OI9C 5FV2A 3ZKXB 1MUJB 2P8MB 1BVLB 2UWEA 4NQEB 2X4RA 4XCEA 4Q9CA 1G7LB 2IADB 3BDBA 3P4NA 1N59A 1OAZL 1FYTA 4DJMA 1L7IH 3IJHB 3WFBL 3HFML 1J0JA 3V5DB 4TTDC 2BY0A 2FLBT 4NKDB 1QBML 5L7XH 1OY3B 4Y1AE 4JPKL 3EYOA 5GGQL 2IQ9L 3TBTB 5IM7A 4JY6B 3V5KB 4DW2L 1K6QH 4R2GB 3ZDXF 5F89B 3RKDD 1KB5B 1ZXQA 3W2DL 3V6FA 1MREL 1KIQB 1LP9E 5FUCC 4OLVH 3HPLB 1RJCA 2IANE 2RIKA 3LPGA 4HUKB 4GLRH 3CCHB 2D7TL 4Y7MA 5T3XE 3ARSA 2O5XH 1JPFB 1KCUL 5DGQA 2F74B 2A9NH 4EUPA 2FLRT 4LLQB 3HZMA 2QQLL 2Q3AA 4MCZA 5ILTH 2V7HB 5FEBA 4X5WB 4YQXH 1MCOH 4M6AA 3RI5K 5JIPA 4I18B 4LGRB 4O02H 5HGAB 1GGBH 4E41E 3SDCC 4GRWF 4KK5D 1PYWB 4Q58C 4ODUB 2QQLH 1KT2A 1TENA 3P4OA 2EDKA 2OQJA 2OJEB 2BCKA 3QEQE 1RFDL 3SE3C 2BDNH 5M94B 5AWNL 3MV7B 4RWHA 4LVNC 5HPOA 1FH5H 3S97C 3GJFB 1P1ZA 3V79C 4HKBA 4EJ1C 5IFAL 3L95B 5A40E 2G9HB 3HS0A 3MJ9H 4GKNA 4L8BB 5I75C 3VGEA 3FB7B 1QYGH 4FNLL 1ZT7B 2E3VA 5BZWB 4RBPK 4GKSB 5JZ7C 4K2UL 4OF8A 2W65A 5F21B 3AS0A 5J3HD 4Z7WE 2GSGA 2OL3B 1QYGL 3JWOC 4FNLH 5FUOH 3TBVB 3CFKA 2HFTA 8CGTA 4LARH 4LCUA 4ELKA 1F4HA 2QQKH 4U1JA 2A2QT 2GJ6B 1JF6A 3MXWH 2JCCB 3PL6B 2ZP0T 1NFKA 5GIRB 4MA8L 1JYWA 1VENA 4WFFE 4QF1B 1OAUL 4WY7L 3O4LD 2YD2A 5D8JH 3RVWD 1XCTB 3G9AB 4OLUL 1H8SA 2RHEA 4M7KL 2EDDA 3WS3A 4F57L 4X6FA 2MFNA 1Z3GH 2QADC 4P4KB 3X3GH 5E6IC 4Y19A 5F7DB 3UTOA 4O2EA 4NYLA 2R9HC 2F53E 4V2BA 3WJJA 4CW1B 4HXAH 5BW7C 4XAKE 5D4QA 3B9KD 1XT5A 2W9LA 1G7QB 5EU5A 3QJFB 4IIQC 3IYLW 1JNHA 4XPAH 1U8PB 4RCAA 1IEHA 4GOSA 1D5ZA 1YEIL 5GPRA 1WK0A 1U3ZA 2JB6A 3VXSA 4WO4A 4M4RA 4F8TA 1ZLUH 4OZFB 3BUYA 2ZKHL 2CLVA 1T6WA 3W0WE 4NQCD 4CW1A 3UTSD 4K3GA 1NGXA 2AJ3B 4LU5L 5CS7A 3PXHA 2HKFH 3OKDB 2DQCL 3F7QA 1QEWA 3QDMD 5IBUG 4FOMA 4WY7H 3QO1A 1KC5L 5HHPB 3VFPA 4RMSA 4MJ4A 2AW2A 1MFCL 3LMJH 5IW3A 2VLKA 3FO1A 2HJFA 5DMIL 4KK5C 2E7BA 3TFKD 4R7DB 4X8JB 1FC2D 2FSEB 3X3FL 1N7MH 3EDFA 2WBJD 5GQBA 1JZ3A 1R3JA 3MTRA 3ZE2E 1G7PA 2FWOA 2XWBB 4RIRA 1WQVT 4IIQA 4JANB 3E3QA 4KROB 1H9VA 1C5CL 3V0VB 4LCWD 1Y0LB 3WCYA 1IM9A 4I77L 2XKUA 3F12A 4J4PA 2HKHL 4H26A 2R9HD 3VGGA 1ZHKA 5CIPH 3FQXA 1RD6A 5E03A 4F58L 4U1MB 1NCWH 4JY6A 4Q97A 3VRJA 3T4AB 3E2HB 4KQ4H 4QTHA 4ZO7A 5EC1B 5JHLL 2N7AA 1CBVH 3K2MC 4NSKA 3I2CH 5GS0D 2EYTB 2O26U 1KN4H 4OKVB 2XA3A 3RL1B 3QNZA 2ADJB 5MP6L 3G6JB 2EECA 4JEGB 3KYKL 2OSLB 4PJ5E 3TCLA 3NZHL 3WN5C 4LSUH 4XWGL 1YMHA 3OV6A 4E41B 4XBEH 4OD3L 3RVXD 4HWNA 4C59B 4GMSH 4JDTL 1HNGA 1NKOA 5B38G 4PJBE 2AJVH 1A3QA 1V5JA 1LO0L 2ZSVB 4NO3B 3JV4A 1JNLH 3O9WC 2HG5B 4Z77A 2C4FT 2OL3L 3DWTA 3FJTA 4KK8D 4F7CB 4NM4H 2X70B 4OZHB 3O2VL 4Z7UB 3TM6A 1I8MB 3FOLA 3HI6L 4PJ8C 2EKJA 2V2WA 5HVGB 3KXFB 4QEGA 1GCFA 4Z78A 3T8XB 2R23A 1TLKA 2VTFA 4S0TD 2ICWI 5EU6E 5JO5B 4A6YA 1CDGA 4J3UA 4HIXH 4QCIB 1V3KA 4GKZB 1KTDA 3ARDC 4OUOA 3QIUA 4KHXL 1KV3A 2R0ZL 4MXQC 5GJTL 1AE6H 4MXVE 3RWDA 3DBXA 3QQ4B 4PJDA 4HLJA 1AKJB 4GO6B 3VWKD 4WU5A 4NSKB 4O2CA 1PKQB 3MJ6A 4PLNC 4KMTL 4Y19B 3CUPA 3LQZA 3C2SA 1BJ8A 3U0TA 1XF1A 3PGDA 3WN5A 4U6YB 1PVHA 3AAZB 3L5WA 1UJTA 4HPYL 1GZQA 3MRRA 5F6HJ 4K71B 3VFUA 4OLWL 2MKLC 15C8H 2MHAA 3D39A 5I6XC 4PB9H 1FVDA 4NZUH 2AK4E 1QSVA 3LSOA 3SE8L 3OKDA 1U95B 5SWZE 3V8OA 1VDGA 1K2DB 4YE4H 2DDQL 1NSNL 1KNOA 4XTRC 1W72B 5J12B 1UG9A 4MA1B 4FTVB 4EUPG 3UBXB 3TZVA 2EIBA 5GGTA 1R3JB 1S9WA 5B39G 4NRYB 3OKNB 5T1LB 2VR5A 2YS4A 3SJVD 3QEGL 1UCBH 3MNVA 4N9GA 5EU6B 1RULL 4ONOA 3BZEA 4JKMA 2C3HA 2I25N 3P0YL 3T0AA 3MA9L 5JOFA 1I4FB 4U1LB 1BAFH 1V7MH 4P4KA 4X7CC 2XA8L 3Q5OA 1MY5A 1T7WA 2ORBH 2NXYD 1M05B 2QKIB 2UZIH 4G9FB 1EUUA 1U8JB 4MQ7A 4D0DB 1H3PL 3QIWC 3BAEL 4HG4K 1QFUH 5T1KD 3B9KB 5JO5A 1WBXA 1AO7E 3OB0H 4LCCA 2EH7H 4JE4B 3I9GL 2OQJB 1UXWB 2NZ9C 4PBVC 3H6JA 4EQ2A 2ERJB 3MRQB 3DRTA 5ICYB 3D9AL 4Q9RL 4CBPA 1FAIH 1EHAA 1XIWD 2ICWJ 1W0VA 2QSCL 1HH9B 4ZUWA 1C5BL 2G5RA 1BOGA 4G5ZH 1N5YH 3HS0B 1MCHA 3C60B 3DX6B 4U1NB 1CBVL 5I30L 4H25B 4XNUL 3H42L 1DQJB 4L4VD 1I9JL 1U8NA 2VQ1A 1CTNA 1IEBB 3IFOB 4HKXA 5CP7A 5HBBA 2DLEA 3SY0A 1RZGA 1E4KC 1A14L 4U1KB 4APQD 4P46B 5J9PA 4I2XE 5LGJA 2BY3A 4LCWB 4H0HB 5IBLD 5JXAL 2PETA 3QEQA 4OBRA 3HC0B 2Q7YB 1QA9B 1KENL 4MWFA 4YBQD 2VSDA 1I9IL 1SHMA 4X7FC 1PBYA 4LSVL 5TF1H 4PJAA 4ZOEA 3DYOA 1IJ9A 3FT3B 4PGCB 5DUBA 2F54E 2ORBL 4LSTL 1NSNH 3K7UA 4LASL 4DKEL 5E6ID 4NN6C 2OS7A 5C2BH 3NCFB 4WDIB 1P6AB 4LDOB 5BO1L 3OKKA 3VRLF 3C5ZD 1ES0A 3BRDA 4OQTL 1T22B 1YN7A 1LEGA 1AP2B 5CD3B 5JXEA 1KEML 1M7DA 2J8UA 1MVUA 3OWEA 2D0GA 1UGNA 4HZLB 1GGCL 3RX7A 5C09A 2NY0C 2DTML 1A1MA 1MCWM 3MGTA 2MPAL 2H26A 3QDGA 3DMMD 1NL0L 3P3YA 3MRFA 3PWVB 4TUKL 5J8OA 1T21B 5F7EH 3B8SA 3BXNB 4MS8D 3U9PH 1WICA 2E5EA 1FQ9C 1FG2A 3MLRL 5C0GA 3T0ED 2P45B 4XPFH 3TBTA 1II4E 5GGVL 3MV9A 3KYAA 4XHQA 4RGND 4O2EB 4RFOL 4ZSOB 1CLOL 1ED3B 1IGYB 1TQCB 1JWSB 4WWKD 3O9WA 1XCQB 1HCVA 2ZUXA 4XP1H 5J1AA 1EFXA 3P0VL 1UB5A 3NCCB 3WUWG 3V4UH 2MQ0A 2ZNWA 4FFVD 3TV3L 5T1LD 3OGOE 5TE6L 4AH2B 3QUMA 5H35A 4FQ2L 4ZQKB 4ZNEE 2YWYA 4LSQH 1DUZB 5FCSH 4ZUTB 3SPVB 5JNYA 4F7EB 5ANMA 4MVBD 1U8OB 4QGTA 1Y18A 1FVCA 4RFNB 2QSQA 2VXVH 2Z9TA 1KB5H 3SGEI 3VXOA 2CMRH 2NY4C 1KCSL 2JK5A 5EUOA 3TT1L 2QL1A 3QDJB 3TF7A 3PGFL 4Y4HA 2AERT 2KZWA 2DN7A 3E6HB 2OTWA 4YQXL 4GRLA 1NBVH 5J12C 1DZBA 1FV1A 5KSAA 4K23H 3MRJB 1RUQL 3SDAC 4DN3H 1H3PH 4HS8L 4OGYL 4ODUA 5GRXG 4D9QE 1TIUA 1MI5B 4JREB 1H15A 1W2KT 5C08A 1R0AL 2ARJB 4GBXA 1FL3A 3I6GA 4PJ7E 4WU7A 1EHNA 4WFGE 5C0AB 4YHZH 1OTTC 3RL2B 4IDJH 1Q72L 2HT3D 1J11A 1U92A 3CVHA 3M1BB 3OKLB 3CC5B 1WBYB 3HG1D 1CTOA 5HXMA 3QP3A 3NH7H 3WDHA 4FQLH 3BP5A 1YNTA 3OXRB 4KV5E 1LEKA 1L7IL 4X9GA 1E4XL 1RQ5A 3LQAL 5A2LH 4PJXF 1K4CB 5I19H 4NQDD 3QIBD 4ZO6A 4N9GB 2W9EL 3VWJC 5IVZA 4ODHH 5MENA 3VW3H 5T3ZD 4PJ8B 5C2BL 4ONGL 4LHUA 1CCZA 4LK4A 3GIZL 4PJXA 1IARB 5ADOL 4NN5B 3JWOL 3W0WB 1NANI 4LF3B 1N6VA 1KPUA 5EZOL 4YHNA 5DD3L 3SKMA 4R0LB 3P4NB 4IHOA 4PJ9B 4NQEA 4FXGA 1TJHL 2R4SH 1IGIL 2PW2B 3WFEH 4MS8A 3LZFH 4KRMB 1JGLL 4UIMA 4BSJA 2QEJA 1N4XH 3DX8A 2VXQH 1AHWC 3QIWD 3S36H 1TMCB 4NWUH 4L9LB 1NUDA 3RAJH 4S0SD 3WN5B 2YK1L 2IH3A 4PREA 4LOUD 3IETA 2LAAA 1JPTL 2IG2L 4XXDA 4B53A 2C3VB 3QCTH 5JW4Q 1I9RH 4PJIF 1U2CA 5LXGH 1KCGC 4I3RL 5MEPB 4O9HL 3X14A 3QH3A 3D39E 1FSKC 2D0FA 3E2HC 3UAJD 5IHBA 1YDPB 5JHDA 1INEL 5F1SA 5DXWA 3O2VH 1CK0L 3TBWA 3VFMB 4FTVD 2C7UA 1SJEB 4AZ8A 2R29H 5F3BB 3M1BA 3OKLA 1JRHH 3HLAA 4PRHE 1E27B 5LGHH 2FH6A 5F44A 5EOCH 1OARL 4OZGF 2FBJH 4NKQB 4N1CA 1IEAB 1RZIA 4KROC 3UJTL 2R1XB 1SEBA 2DQHL 5IKCB 4IRSA 3P77B 3S7GA 2DD8H 4JRYA 4C56A 3RJQB 4I0PA 3L3KB 3ZKND 4PGJA 1KN4L 5IFJA 1I3GH 4KH2A 1JNNL 3KJ4C 4HGWA 2WIMA 1OTUC 5HGDB 1XGTA 4JVUA 4Y8DC 2E7LE 4M7LL 3KPQB 1DR9A 3GMRB 5INCA 4CN1A 5BV7L 3LD8C 1KLFA 1U58B 4JFED 1NCWL 3EIFA 3L3HA 2QBWA 4OZ4A 3SBWC 4PGCA 1RK1A 1Z0MA 4UT6L 4MNQD 5CLWA 1C5DA 3QCUH 1GPOH 1JGEA 1BAFL 2HMID 5DS8A 3QFDA 3GJEA 25C8L 4RSVA 5M7QA 1MCOL 2NY7H 2VXQL 2IANB 2UVFA 2YWZA 4AMKL 5FK9B 2GSGB 5DRWA 1VACB 4XWGH 5KW9L 1JJUA 2CPCA 4U1SB 1WV7T 4F7EA 2W92A 4OAWB 1YPZB 3QXVA 3G5XB 3HUJF 4O58H 4PRIA 1MIML 3BP5B 4JKKA 1XZ0A 1L0QA 1IT9H 3D2UB 5L2KE 1S5HA 4S1QL 4POYA 1YYMH 1X5HA 1XGYL 2E7HA 1ZVYA 4KY1H 4LGSB 3RVTD 1MCJA 2JJUA 1J88A 1YMMB 3HUJA 5CZXC 4OSUL 4YX2H 3PWLB 3HE7B 5E6ZA 3VXRB 1HILB 3GMOA 4GUPA 1UVQB 5GSVA 4D9LH 5TH2A 4PV8B 1NGZA 5DF0A 1LNUB 5LG1A 4S1DD 5IW6B 3MV7E 3MRQA 5AG8A 1FZJA 1YY8B 3IDXL 4D8PB 3IKCA 5CMAA 4ZSOA 1NGXB 1AHWB 2AVGA 1GIGL 1TXKA 5FM5M 1SJHB 2B1HH 4ACPA 4JRXD 1JWMB 4O5LH 2E8ZA 1J5OH 3H0TA 3WDJA 4DEPC 2VMFA 1NAML 4R0LC 4MD4B 2VZVA 3MX0A 5CIPA 2VLKE 5D8JL 5ID1A 2C7UB 4HAGA 3UEZA 2DQEH 1PEZA 3FFCA 4P2OD 5T3ZH 1JK8A 3IGAB 5I0ZA 5I30H 1QSFA 1QBAA 5F96H 3S98A 3D18B 2E7LC 4UB0L 2VNCA 1PQZB 5DSCB 4YXKL 5ANMB 3V9FA 1UM4L 1YEFL 3LPFA 4QT5A 2J2ZA 5I8CB 1YZZA 1T22A 2D7MA 4Q6YA 4R2GD 2EO1A 4C54A 3V4PL 4RWYL 1U41A 4HS3A 1BZ9B 3ARGA 2B4CC 4OGZA 5GGUA 3AXLA 3RHWF 2CKBH 1LO3H 1P2CB 5E99L 2OK0L 1QPXA 4WW1B 4MYWB 2WWKT 4LLYB 4OZHE 1I3RA 4JR9L 4PV9B 1CDBA 3PWPA 4XPBH 1CDJA 4E0RA 2D7TH 3IU4L 3QG7H 5ACZA 2QSTA 1MRDH 1AR1C 2DLHA 2FX7H 5HDBE 3NCBB 3FRUA 4UAOC 3LRHA 5DK2B 4HS3B 3QDME 3W9DA 4YDJB 1FFNA 4EXPX 2BC4A 2WZPD 1PKQA 3SKOB 4WNQA 1J1OH 2WUBL 4QHKJ 3SDAB 1DVFB 1VFOA 3QXDA 2V2XB 3EFFB 5DQ9A 3VFOB 3H9YA 1S7RA 3RPIB 1X4ZA 3OR6B 3D3VB 2XTJC 3AMKA 4K7FB 3S5LG 1F3RB 4PGEB 4LCWE 3V4PH 1S9VA 2LU4A 2NY4B 3S96A 4PJGA 4Q2ZB 4UDTA 3T8XA 4BQ6A 2IPTL 1PZ5A 5EOTB 2CQVA 2A74B 4L8CA 8FABA 4HK0B 1FO0B 4HWZB 4IMLA 1FH5L 3U36A 5LAXB 4Z7UA 1PY4A 3TVMD 4HWEL 2UVEA 4JM4H 4ZO8A 1B6UA 1WCBB 4HBQA 4GS7C 5EFIA 5F7EL 2YD1A 5F88B 3BZFA 5FM8A 3UXFA 3FFDA 1UA6H 5JLZB 1QHOA 2BXZA 5CMAB 2ICEA 3QWOB 5IB4B 1J86A 1U8QA 3QNYA 2R0KL 1KFAH 5KOMC 3U1SL 1XF3A 4Y0GA 4FQXC 4YWGL 4D0DA 3WKNA 3G08B 2ICES 3OJVC 5MERA 5GSRA 2W0LA 5I1JL 3BMWA 2V5RA 6FABL 1QA9A 3PHQB 2BMKB 1CFVH 2ID5A 3OF6A 5CSZA 3WNNA 4EVNA 1IC4L 5FA3A 1KELH 5IVOA 4JHZA 5F93C 4LSTH 1G9EA 4KUZH 6FABH 3MJ7B 3PIQA 4UI2A 4L8SA 2VO5A 1A9EA 2DLTA 4JRWA 4JPKH 2FX8L 5GGQH 3TZVB 5FDWB 3L7EA 1HN1A 4KQ3L 4XC3L 3S35H 4DCQA 3DX6A 3C60A 4LAQL 5ESAA 1E0OB 2RGSA 4JO1L 3DTXA 3TA3C 3GSNH 4X9HA 5AZ2L 1U0QA 5D7SL 4UBDD 1M1SA 4NHCL 1ACYL 4YFDB 1AR2A 3NZ8A 3UROR 5DZOA 1S7VB 4KC3B 1X6NA 4U6HB 1I7UB 1NANH 4L29A 1FNSL 2XTLA 2AK4D 2XWJA 3QUML 1IEAA 3MLTB 1D6VH 3V7AE 4D9RE 1J0ZA 2EDHA 1NMBL 3BN9C 5JDSA 1RFDH 3B9AA 4G6AC 4M43H 3BP6A 5GRVK 3ECBA 2PCPB 5IROA