1CG9A

Complex recognition of the supertypic bw6-determinant on hla-b and-c molecules by the monoclonal antibody sfr8-b6
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
277
structure length
277
Chain Sequence
b'GSHSMRYFYTAMFRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-35 B* 350
molecule tags Mhc class i
source organism Homo sapiens
publication title Complex Recognition of the Supertypic Bw6-Determinant on HLA-B and-C Molecules by the Monoclonal Antibody SFR8-B6
rcsb
total genus 74
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cg9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1cg9A01
3P77B 3UTTA 4UOW0 3R4DA 1ZGLB 5GSRB 3O6FC 4RNRB 1F2XK 3HPLB 1W0VB 3RGHA 1XR9B 3LN4B 2HMIC 2QKIA 2XA8L 4KMLB 3NCYP 1H9VA 3HE7C 2IH3B 4JFHD 1PGRB 4NNXB 4G5ZL 1NCCL 3SDAD 3UJTL 1MEXH 4P48A 3SY0B 2VLJE 2PTUA 4D8PA 1FE8H 5D7JB 5TDNB 1TPXB 1JHLL 4P2RA 1PQZB 4CU6A 3VD9A 1CFQB 2SEBB 1R3JB 3JV4A 3FB7B 3LS5L 4N5EA 5HHXL 1NMAH 5C08B 3ULUD 1X5LA 4HS6B 1PLGL 4OSUL 4RIRB 5HHQA 1OLZA 2GAZB 3VFUB 3ZHLA 1J12A 1T22A 4HJJL 3P0YL 3QO1A 5FYLH 8CGTA 3QDJB 2V17L 2DLEA 5DVNA 3VFMB 4JQXC 4YDJB 4KRLB 5CMAA 2F54D 4UINL 5L6YH 4F7EA 5E95B 1HYSC 2MKLC 3R8BB 3ARFC 5IBTH 1DQML 1A3LH 4HG4K 5IWLA 4U1MA 4JJ5B 4I9WE 2IF7A 2PXYA 3I6LD 3W9EB 3NTCL 4FN0A 3IFLH 4JFQB 4PUBL 3C60B 1CLCA 4RQQA 2X4UB 3TN0A 5CKAA 4Z7VB 3OL2A 3HR6A 1CIUA 3V4UL 2ZZUT 3IKCB 5FOBB 3RY5A 4PJGF 3HN3A 4HXAH 4Q9QH 3UZVB 4P46A 5F3HB 3VWKA 5JMRA 3GHBL 3TT1H 4G43B 1NFDA 2VAJA 1SVZA 2YD8A 1VHPA 5F1IB 3GGWB 3VJ6B 5FOBA 4NT6A 2X70B 2MWCA 5CSGA 2D0HA 1D9KB 5MHSD 2E6JA 5I1DA 4KU1A 1INQA 2IQ9H 3T4AA 5AG9A 5T1MB 4NN5C 4HEPG 2VMFA 4H0HB 2EKJA 3KNBA 1TENA 1GOFA 3PHQA 4XP6L 4R0LC 1S7WB 3MFGB 3DRQA 3VCLB 3L9RB 4GG8A 2AXGB 1RAMA 5HPMB 3GSVA 4NDMB 3W82A 4G8FA 5E70A 4HULB 1YJDC 4HS3A 2WY3A 4FZ8H 1J1XL 4W6WB 4H88L 3R1GL 4ZPTA 5DR5H 4KTEH 4KZDH 5DRZA 3WN5A 1C7SA 1FNEB 4LEXL 3PQYA 4LLVA 3B6SA 1DFBL 2QADB 2F19L 2QHRL 4PJEF 3TVMB 4M6OH 4NJAL 4PJXA 5IVNA 5FO7A 5B39A 1IAIM 3IDMB 1T20B 3I6KA 5IG7B 1QACA 3QDHA 4ZYKA 1V8HA 1EGJA 5IFAH 1D6EB 3WIHH 3VXPB 3RDTC 4PG2C 5C1MB 1OSPL 3L5XH 4JFQA 1S7XB 4IS6B 4NWTL 2Q86B 5I8KL 4PLJD 3CNKA 2Y36L 4Y19B 5CGYD 5DMGD 3EFFB 4JO4H 5AEAA 3RWHB 3WFZA 1I9IH 2A83B 4AM0A 2FIKB 1MLBA 1M7IA 1KCUH 5EOCJ 4CMHB 5F9JB 4MJIA 1Q9WB 3G5XA 5IQ9A 3O2VL 4Y16A 1GGUA 2GJZA 1NCAH 15C8H 3V9FA 1MCOH 1MHPH 2JJVA 3TV3L 4UIKL 5IKCB 3MRFA 4HAGA 4FA8A 5CJXC 3FCTB 1CI5A 5GS3A 4G7VH 1I7RB 4MQTB 2XYCA 5JR1L 1CGSH 4N8CL 2ZUXA 3ZHKA 4M4PA 3K8LA 4OM1H 5DI8B 1II4E 2C1PA 1ETZB 4RGMB 3V6FB 2NY1C 4BQ9A 4NWUL 4JKLA 4JRWA 3VW3H 4PP2A 4PJBB 4ORGB 1NMBH 4PJ8D 1KGCE 4HK0B 4M3KB 3UTPE 1S7TB 3FONA 4PJ9B 5EU7C 6FABL 3E2HA 3QFDB 1QBMH 5C0IA 4YDIH 1MRDH 1JTPA 4BSWB 4NYLB 4LU5H 3BN9D 2CPCA 3MOAL 4DN3L 1LNUB 1NC4B 1QEWA 2ZNWA 5KANG 5J12B 1U8JA 4C56B 1PX3A 3QA3A 4ZMAT 4P5TD 2CUMA 1IJ9A 3EAKA 1ZA6A 2X40A 5F88A 4OQTH 1MIML 5CLTA 1U8OA 2DWEA 3MLUL 4JVPA 2DQHH 4B41A 4RFOH 2DI9A 4LSPL 5TGBB 4AEIL 3VGAC 3RWDB 2XNAB 3ARRA 4K9EC 2F8XC 3OSKA 1JGEA 2CLZB 3I3DA 2G60H 3OQ3B 4L5FL 4EXPX 3N1GC 4NOBA 4OQTA 4HIHB 4EEEA 5FM8A 2IPKB 5C0CD 1MRFH 3BXNA 4Z7UB 1ZLWK 4QXWA 1SYVA 4LQFL 1J5OH 2WSKA 2EDYA 2OMBA 4MD5B 2DAVA 2OTWB 5C0AD 2NTFA 1AHWC 2H2SD 3CDFA 4PV9B 4HXBL 4UBDC 5GGRA 1EZVY 4ZDHB 2DMBA 3FFCE 2VZTA 2JCCB 3K80A 2X4NA 2D03L 4QXUL 4POZD 5DJDB 2CK0H 1AR2A 4H5SA 5HD8C 4XP4L 5DC9B 4OTXL 1QZ1A 3EYFA 4N0FB 1MAKA 1R3LB 4RRPA 2EE9A 1UXWA 2WBJB 3VRIA 2ESVA 2IANB 3ZKXC 3DXAB 4I0KA 3H3KA 3C5ZD 4WY7L 5AYUH 3E6HA 3EBAA 1ZT1A 1JYWA 3O8XC 5GZND 1CYGA 2X4PB 3AC0A 2ZKHL 5E4EC 3I2CL 2J5LB 4YDVB 3SDYL 2Q7YB 1I8LA 5K93A 1PG7H 5B3JE 4D9QE 1I7ZA 4KMTL 5IVOA 3FQXA 1N3NB 1UB6A 3FT3A 1LP9B 2QSCH 1V3KA 2MQCA 4ODSL 5EB9A 5DRXB 3B4NA 1FO0L 5DRXA 1A7NL 2HWZL 2V9TA 3HKFA 3MOBH 1BQHG 4HZAA 2EC8A 4YFLF 4JRXA 3ZSTA 3SKJH 2YS4A 2P24B 2BNRA 3OTTA 1YC7A 4ZOAA 4IDJL 4NCC1 5GGUA 5D7KD 4E41E 1AKJD 4IHOB 1E27A 3O2DH 1KIQB 1B0WA 2VR4A 3ARED 5ALCL 2EDLA 4X6DA 1NBYB 1NAMH 1UXWB 2APXA 5C2UB 4FZEH 4DEPC 1KIRB 1CICB 2YSSA 4QCIB 2PTVA 3MUHL 3SKMA 4LPXA 4HIXL 1H15B 1GZPB 3SDDB 1S5IH 1GGCL 2VERN 1CF8H 1T83C 3HMXL 4KRPD 4MNGB 4RDQF 5K59E 3QEHA 1FFOB 4I3RL 3I85A 4LCIL 4EI6B 1BOGB 1DUZB 4U1GC 2ZUVA 4JGUA 3A6OA 3AM8A 3EUUA 4YE4L 1FZMB 2J12B 3QAZB 4NZRH 2Z91A 3VXMB 3WBDA 5J1AB 2JB6A 4HIHA 4LSRL 4H8WC 5FF6A 1R5VA 3FQXB 5JW4Q 5FDWB 4PY7B 2CK2A 5H35A 3SJVD 1A4JB 2E9IA 1G7MA 2ZSVB 4WNQB 5DD1L 4TUJA 3ULUF 3GHEL 3OR6B 3S35L 1L8JA 5L2KD 4JPVH 4UU9A 4MQSB 3RUGB 3SDXB 2A1WL 3DV4A 3QR2A 1P9MC 2AP2A 1OT1A 3BPOB 2HRPL 3O81A 1TXKA 4XNUH 2P8LA 3Q2CA 1RURH 1HHJA 3C5ZA 5I1CL 2A6DA 4ONFL 4XAKD 5FOJA 4KROB 4WUKH 3EYFB 3H0TB 3GJFH 2NW2B 3T1FB 2LU3A 1V3JA 1VEOA 3UXFA 3WN5C 4HKXA 1GYAA 3CC5A 1AC6A 1NGYA 5MEQB 3D85D 3UDWA 1BREA 2VDRH 2PO6D 4FMFA 4GQPH 3BH9B 4PLKC 1UWXH 3L3HB 4X0KA 4XNYH 3ARBB 2YC1B 3QWRA 2EYTA 4HT1H 4GRLD 2NYYC 3UBXI 4HWBH 3QUML 5E24E 5CHNA 2AKRA 1YEFL 1U3HC 4U1LA 3WNKA 4F7TB 2YD5A 3CVHH 5IB1A 5I71B 3EO1B 2UWEE 3H9YA 4L4TA 4Z7QF 1JJUA 3NABH 1DBJL 4HPYL 2Q20A 2B0SL 5IV2B 1JNHA 2X9WA 1YMME 1RY7B 5CSZB 4P2QD 1KOAA 3KJ4B 1NFDF 4KK8D 4OD3H 5E2TL 2AJUH 1F4YL 4TVPL 2WQRA 5IB4A 1AP2B 2QR0A 4ONHA 2YN3A 3Q5YA 5DHVH 4LSSH 1I8KA 1VENA 2WIIB 1GGBH 3MRPA 4GRMB 1SJVA 3MGOA 4U7SA 1RJZB 3E6FA 3CFBB 5EU4A 2NY6C 5H2BB 5DVLA 3Q5TA 2GSIA 1KJ2B 2X4TB 1D6EA 4DN4H 1MWAA 3O3EA 2FATH 5IW1B 1FC1A 2WP3T 3Q3GA 2BHUA 4NJ9H 3GNMH 3ARBC 3HG1D 4LIQL 3UAJD 2AV1A 2DN7A 2CO6B 1I4FB 3IDNA 2IFFL 5IHUH 1QRNA 3D69B 5FGBA 5EUOB 5I1IH 5JNYA 4PRHD 3ROOA 3QISA 4PJ5A 5KSAB 1B4JL 3KXFA 5KSUA 3I50H 4APQD 5T5FL 2GJZB 4JG1H 2BSED 3BPOC 1WEJL 1Q9LB 3VDBA 3X14B 2GY5A 4OT1L 4W6YB 5TF0A 4UDUA 4G8GD 4X6DF 1TETL 3TO4C 4HUXB 5IB5B 3TH2T 2HN7A 4O2CB 1RZKC 1HHKA 4MS8C 4YXKL 4FQIH 1AD9A 4KDTC 5JHDE 3BP7B 1AI1H 4M6NH 3DI3B 4KTEL 4LF3A 5HYEA 4KZDL 2DQGL 1T2JA 4WCYL 4HEME 4EJ1C 1BD2B 4MCYA 1J87A 5E2VL 4OIAA 3ES6A 2FNBA 5F1IA 3MODL 4PJ5E 3QXUA 4A6YA 1NKRA 2JCCF 5IUSA 5AAWA 4L8BA 3H7BB 2J5LC 3G5ZB 4LLYB 3OXSB 3QUMB 3TVMA 3O8XB 2DLTA 3KYOB 4I2XB 3IKCA 2MKWA 4F37F 4FTVE 1NL0L 3CLEL 3FQRB 5DK0A 2VN4A 2PTTA 3L1OH 4JFDA 3DHMA 1SEQH 1OHQA 3O0RL 2ICES 2W59A 5IR1A 4X8XA 4JO4L 4P3CL 1Q72L 3GB7A 4UOJA 5TQ2H 1OQXA 4UT6H 1HXYB 1Z5LB 4HIIA 5B22A 1TMCB 3BDYH 3BW9B 2JJSC 4HWUA 3TO2B 3VFNB 5L9DL 4LP4A 5DSCA 3BKJH 4KJYB 2Y5EA 3PWJB 3T2QA 4YHZH 3RZCA 2AXHA 1M7XA 3FAXA 1FNAA 5TPWH 3RUGF 1I85A 5ACMA 3U0TB 3L3GA 2E7BA 3AY4C 2EIZB 2I07B 4K3HA 3EYVB 1AO7B 1JTTA 1QSFE 4LVNC 4NKIH 3FOMB 3FHQA 1JNLL 3SDCB 2ITCB 2JIXD 4JFDE 5JOPE 3KYNB 4NO5A 5F3HA 1HI6B 1WZLA 2W91A 3NZ8B 3EO9H 2E7LE 3Q1SH 2MCPL 4P2OC 1V7NL 3BP7A 1N59A 3U36A 4YWGL 2R2BA 1NBQA 5E8NB 4WFED 2ENYA 3KPPB 1ZGLM 2V7NB 5T5NF 5F9OL 3BUYB 2PKDA 1ZSDB 1C16A 2YMXL 3GSNL 3I6GA 2QBWA 2R56L 2G5BB 3W5NA 3SN6N 4F7EB 1VGKA 1YPZF 3EYUH 4M1CD 4QRUA 4LHUD 4HX1A 5FYKL 1SYSA 4MCZA 2Q8AL 4F2MB 1E4XL 2NXZC 4OKVA 1U8IA 3E8UH 2CUIA 1Q1JL 1FCCA 1CDUA 1WWBX 4OLUH 4FFWD 3RJDA 2Y06L 3TEUA 4X6BA 5KG9A 5I9QB 2HFFB 5C08D 4KI5F 5EBLB 5D7IA 1CWVA 4OCLC 4UQ3B 5DEGB 3NFNA 4AIOA 2PW1A 4LARL 2Z9TA 3H42L 1DR9A 1K8DB 2EYSA 5IMMA 1R3JA 5LJYH 3ULSB 2X4TA 4NQCE 1H3TA 1QFWI 3QDJD 5MEOB 5JIKA 1UWXK 3HB3D 1BX2A 2CRIA 2YUZA 1K8IA 3GMMB 4D8PB 3BGAA 3OAUH 2NY0B 5DF0A 3BWAB 3B9KC 1F3RB 4GS7C 1XF2B 2C4FT 2UY6A 4QHNA 5F7DA 4YXLL 1J8HB 1YNLL 3PL6B 1MJJA 1KEGH 1REIA 2ZCLL 3MRHA 2VLRA 1G6RA 3M45A 3VMNA 1KLGA 4U3XA 1JFQH 4GG6B 5E03A 4N5EC 4K8RH 2P8PA 5I8EA 4XPBH 4FFYL 3CH8A 5E00B 1DBAL 1KCRH 1OP3H 1MCWM 4AQOA 2O5XH 3C60D 2AQ2A 3K0WA 4WU5B 3IJYA 2DYPB 1G6RH 1TZHA 2H32B 3BD3A 5IB1B 3EYQC 3I75B 1FZJB 3H9HA 3OZ9L 4TUKL 3GIZL 4C83A 1MNUL 4X4YB 1F3DH 1WAAE 1KPUB 4KVNH 1AC0A 4PR5B 2ED7A 1OWRM 5DD1H 1FO0H 2PYEB 1IGIL 2R69L 5GJTH 3IFLL 4NUGL 3F7VA 2DICA 3VRJB 1JTOA 3AS3A 1JF1A 3TO4D 3SKJL 4IJ3B 4YQXH 3F8UB 1FBIH 1DDHA 5CJ5A 3GJFK 2H9GA 4RX4A 2YD1A 3DO7A 4DZBA 3QXTA 5CEXA 1K2DB 1A02N 5DDHB 1EH9A 5IESL 1T7XA 5D72H 5C6WH 1XGUB 3E3QE 3BKML 3S3SA 2KDGA 3FQNB 3QQ3B 4I77H 4OUOA 4WJ5B 5EOQL 1FYTA 1TIUA 5BW7A 5CD3B 5LCVH 4UU9B 5BZDB 3B3IA 4PJFA 3BI9X 5D70L 4K23H 1OTUD 4FTVB 5CILH 4QOKA 2A6JA 2EDWA 4JO2L 4OJFL 4OCNC 4XNQA 3MLZH 1NGZB 1SJHB 1KTLB 2QADD 4TRPH 5JPMA 3GSRB 4KJWD 2F74A 3W39A 2JJWA 1S7UA 4L3CA 1PKQB 1I75A 1TJGL 4YGVA 1S7UB 3LV3B 4L3CB 4N8PA 4NO2B 4OUUA 4Q9CA 3FAWA 2B0SH 2CUHA 4ODHL 4WIQA 1K4DB 5DR5L 1Q0XL 1U93B 4J8RA 3EW3B 1SQ2N 3HC3L 5IEHA 2P5WA 2KZWA 5EG6C 4WU7A 5I17B 1I3RB 2GJJA 2PN5A 3MRGB 3V6ZA 4G5ZH 5ACZA 3JXAA 1CCZA 2NXYD 1MCIA 4GAGH 4RZCB 1LQVA 5H94A 4KK8C 2D9QB 1H15A 3CDYA 2ESVB 2IANA 1VACA 3RY6A 1U6AH 3OKLA 1AXTL 1UKQA 1OGTB 3LPWA 1CR9H 2BRQA 4PJGB 1GGIL 4GSDH 4MNGE 4S2SA 3AXLA 1NGQH 4DZBB 3QDJE 2R0ZH 5EWIH 3DO7B 2BVQB 4JQXA 3JWOL 3MUY1 4PY8I 4Y8AA 1JHKL 5ESAB 3QEGH 4LAJH 2RAMA 3R06B 4L4VA 5A2IH 1EJOL 4HUMB 2F8OA 4BFEA 2IG2H 2GJ6D 1LQSR 3OXRA 3RX5A 1BFOB 4JM2B 4ETQB 4W4OA 4E5XB 3MCKA 1FSKB 5JA8B 2DLGA 1FZJA 3RZCD 3DBXB 5JOFA 1KTLA 2FD6H 1IARB 1NGZA 3OKNB 3MRIA 4O2EB 3GMOB 3ARFB 1F45A 1I7TB 4KVCH 4R0LA 2VXTL 1K3ZA 2DWEB 4G6JL 4WW1B 4WFFE 5AWNH 4PJ9D 3KDMA 5L0QC 5D1QD 3OGOE 3QQ3A 1T3FA 4KHTH 4QHUA 2Q3AA 3MRJA 3T8XA 3ZTNL 3T0WA 1FDLL 3HE6B 3OJDB 4C56D 2HVKA 3OAYK 4MS8A 1NUNB 3G5VB 4AZ8A 2P44B 1CGXA 2X4NB 4PYGA 3FTGB 4OLXL 4MAYA 3SKUD 4Y8DC 4YDIL 4F15B 1UACH 1WFOA 2BNUB 2UYLB 2IEPA 5JZ7C 5FUOH 1RZJL 3MSPA 1NMCC 1RZKH 1YN7A 3ABZA 1T83A 2RJMA 1AH1A 4XVSL 3WSQH 2O61B 3VWJB 2IPKA 4YPJA 4K8RC 3RVWD 1PG7W 2A77L 1A6ZB 2YA2A 4NN6B 2J6EL 4PJ7A 2XTJC 4EXKA 4G3YL 1QVOA 1ZLWH 1PD6A 2CIKB 1NJ9B 2VDQL 4J6RH 5FHBL 2DQJL 5E6IA 3SGDI 2I24N 4JFFD 4Y4HA 3WHXA 3X13A 3IXTB 4MJ4A 1UH2A 4LASH 4UT6L 2VZ3A 1EAPA 4NZJA 1TJHH 3FO0H 1DQLL 4WTZG 1KELL 1J9CT 3L7FB 1XF5A 4YHYB 4BH7B 3EOAA 2NX5A 3O3AA 4UINH 5I66B 3T0AA 5L6YL 1U8JB 3BDXA 1MCDA 3ARDC 1DBML 4OI8A 1MFEH 1FNGA 3P4NB 1ZT7A 3MBEB 3NIDF 2WBJD 4X6EA 1A3LL 2R1XB 3S5LA 4WDIB 3DXAD 5IBUG 2CDEA 1TQBB 5CJXA 3ZE1E 4PP1D 1BAFH 4WWKA 2JJTC 1YEDB 5IQ7H 1HEZB 3EGSA 3QSKB 1J8HE 1IM9D 1OAXH 3NZ8A 2BCKB 4M6NL 3FT2A 1K4CB 2HT2C 1FPTH 5KZCD 1IRAY 2VDML 3NN8A 3NOIA 4Y88A 3EJYC 5IFAL 3D25A 5FGCE 2HTKD 2CKNA 4M43H 4FRWA 3V7AE 5I8KH 2P47B 3X12B 4GKNB 1A5FL 5D7LD 3F7YA 4YZFF 3PP3H 4M5YH 3QG7L 3V5DB 1KULA 3RVVC 4LSTL 2F54A 1BM3H 5D1ZB 4NKOB 2VWEE 4KRPC 4PPTA 5BVPH 3MV7A 4OF3A 3K4AA 5ICYA 3OJMB 4G8FB 1KCVH 3CFCH 4EBQH 1PZUB 1FH5L 3NA4A 3MRMB 5DUBA 3QNYB 1FC2D 4MLIA 1MCWW 2ICWI 4DKAA 2FX9L 4G6ML 4UQ2A 3P9LB 5I1JL 2X10A 1CXEA 4ZS6D 2BMKB 2K9UA 1BD2E 2V7HB 1CVSC 2MHAB 1QBLH 3FFCA 1JMXA 5DK0B 4RGMC 1TVDA 4DTGH 1NC2B 4D2NA 5IG7A 3RPIA 2EO1A 3T0EB 1CE6B 1K6QL 5F9AC 3GJEB 1S7VA 3MNVA 1GGCH 2F8VA 4P46B 3RTQA 3SGKA 1EV2E 5KVGH 1AO7A 1I9RH 4X99A 1DQTA 1NC2A 2V6HA 2CIIA 4PJBE 1S8DB 5DJ8A 5J13B 1EGJL 3HUJF 3RWEA 2FL5B 1YNLH 1JPSH 4M48H 3WFHB 4KJQC 4HCRA 1BWWA 1XT5A 2ZCLH 3K74B 5BOPA 2ZUUA 4M7JH 4MZ2A 4NDMA 4XVJL 2G75B 3DUSA 3TYGL 1QSEB 3E1F1 4LSRH 1HSAA 4WI5A 4OD1H 5ETUB 2C3VB 5I16A 2G60L 2EDKA 4WWKC 3RVTD 4JO3L 5GS0L 4UBDD 3MRLB 2BFVL 1MFDH 2J8UE 1EHXA 5CBEB 2ERJB 4NHUA 3G6JF 1CL7I 5DRNB 4NKOA 2NY1D 1LO5A 2B4CC 2CIIB 4MWFB 4Q0XL 4R9HA 3ROOB 4NT6B 4R8WH 5IT2H 5JNYB 3GBNH 3QIBB 1G7HB 4HF5L 2ZOKB 4HUWA 3EYSH 1LE5A 1KJ2H 3ARZA 1A6VH 4WUKL 5HHQB 4JPWL 4C4KT 1FVCB 1NAMB 4I0PC 4UT7L 3VFSB 4WI2A 2WUBH 4ZPVB 1R3KA 1AQDA 2FHCA 4DQOH 2E6PA 2X4RB 2EEBA 5ANMB 1IGCL 1B0GA 1QSZA 4YHKH 2XOTA 1J8KA 4MJ2A 3AU1A 1KJ2A 4KQ3L 4YH6A 4HWZB 2X4SA 1FAIH 1UT9A 3GK8H 3V7MA 2V7HA 2DF3A 4C56E 2FYYB 4Y7MA 4I77L 1SHMA 4EDWH 5A3ID 1AGEB 4K7FA 5F6HI 3JSSA 5E8EA 3BAEL 3LIZL 2XPGA 4PG2A 2JJUA 3OAUL 4OFYD 1OWWA 3MBEA 1RZFL 4S0TD 1JRHI 2LABA 1AP2A 2DTMH 2I9TA 4B7IA 1PG7L 3AUVA 3SPVA 5J6GB 3V4PH 1P7HL 2H6PB 5DFTA 1MFCH 5EU5B 5DC0A 3D0LB 4ODSH 3WDJA 5LQBL 4HCRL 3MNWA 5C7XL 5D1ZA 3LKQA 3DV6B 3CX2A 4ODTH 3QHFH 1D6VL 2GW5A 5FXCH 1EO8H 4L9DA 5TH2B 1G0YR 3NH7H 1T22B 5SWQA 1RVFH 1RIUH 4JFOA 3VXSD 4LCWD 2E27L 1T0MA 4OF7A 4OF5A 3M1BA 3DNKA 1YN7B 2J88L 2R4SL 1QFUL 5I15H 3NN8B 4YBLC 4M7ZC 5KVDL 2YZ8A 2Y4SA 3FOLB 4XCEB 1NGWA 3MGTB 5C8JA 1SVCP 1HEZA 1MJ7H 4XMPH 1P9MA 3EYOA 4J4PD 1N6UA 2K1MA 3S3JA 1R5WB 4P23C 2CDEB 1RJZA 4Z7WF 4Y5VA 3WUWB 3JWOH 1CLOH 4KDVA 1QPPA 4Z7OE 2P8LB 3X3GL 1X5XA 3ORJA 3GRWA 3L5WA 2WUCL 4N0UA 2RB8A 5I66A 4Y1AA 2HLAB 1NCNA 3B43A 3E3QC 4NIKB 5C0AA 1HWGB 3PDOB 3QIWA 3UDWC 1RK1B 1LD9A 5EBMA 5FYKD 2FJGA 4V1DE 4PY7A 2OL3H 1XGQB 3ARWA 2OMNA 1FGVL 4JY5H 1M1SA 4K9EL 3QHTC 4P59L 1QVOB 3MJ9L 4X4XB 2VSDA 4WI9A 2XZQH 4NM8H 1BD2D 5J1AA 1CXFA 1ZLUK 2UZIL 1FRGL 5EU5A 3CMOL 2LQRA 2XV6B 5CSBA 1QYGL 2PW2B 3L3DB 2VAAA 4LCYB 1T0PB 4NQDB 4YXKH 1RHHB 4AJ0A 2DMKA 3WUZA 2NQCA 4M6MH 1T1ZA 1LK3L 2CRZA 2DD8H 3RU8L 3ZDZF 1ND0B 3U1SL 3S97C 4Z7WA 3P4MB 4GXUN 4I2XE 2XPGB 3Q0HA 4YHLL 1FO0A 4QRSB 1M7DA 1QQDA 4Z77A 4ZOEA 3F5WB 1RMFL 4U1IB 4Z78B 2X4SB 1S9KC 3OPZL 3BZ4B 3HMWL 2P46B 1NANH 1CGUA 3PGCA 2EE6A 5C6TH 4EN3C 1NBYA 1ZHKA 2AEWA 1GZQA 4KJQD 2JELH 2UVFA 3PHOA 4MA8L 4XNYL 5C0JB 2AXFB 3VXUD 5FKPB 1LE5B 4LPUA 4YXHH 3KPQB 1OARL 3VXNA 4I48A 3UX9B 5JORB 4AMKL 3C2AH 1H8OA 4BZ2H 5HGHB 5KSVB 2VITB 4R26H 4JY6A 3TCXA 4NHUB 4ZTPL 3DHJA 4OZIE 4RGNB 3TZVC 4NQXA 1QOKA 2JIXB 3GBMH 3C8HA 4MSWA 3FFDA 5E2TH 3REVB 3T65B 3BVNA 2RCSL 1A6UL 1RHFA 1TCMA 4IIQB 4MXWH 3DIFA 1QSFD 4NO3A 4WW2C 4BFIA 4S1DD 2BVOA 1T1WA 4Y4KC 2JE8A 4M6AA 2WANA 3SDAC 3ZZ1A 1N6VA 2E8YA 4OLZH 4HAFA 2JJSA 3KVQA 1NCUA 1FYTB 1L6ZA 1NLDL 4MQXC 1HK6A 3QYCA 3UZEA 1AGFB 4YZFE 1T7ZA 3IFPB 3TWCL 3UEZA 1E28B 4GG6E 1AGCB 1TVHB 4HJ0C 4JFDD 3UYPA 1T5XB 4IMKA 5HHMD 2MCPH 3PQYE 3T2NH 3QUZC 2VL5B 4EDXB 4O58H 4YNYB 1VERA 3U7AA 3W0WB 3KPLB 5HHME 1UJ3A 2AEPL 1I3RA 3KJ6L 2LAAA 3NGBC 4MD5A 3O45B 3NIGF 4RBPH 4YDLC 1MCHA 1P69B 3AM8C 4FQCL 4CVZA 1NSNH 4UV7L 5BCAA 4KJPD 5BW7C 3JTSB 3TVMC 2R39A 2ADIA 25C8H 3U0PA 4LLDA 1XF3A 3QULA 1AR1C 5DWUL 1KN2H 3NIGE 5JQ6H 5ILTH 1QFWM 2IANE 4JDZB 1LO2L 5JORA 2DM7A 5LGHH 3UTSB 4EN3A 3SGEH 3ULVD 2VDQH 1JZ5A 3E8UL 3D85A 3ZL4H 1A9BA 4TNWF 5ECJE 5SWSD 5MI0B 4GUPA 4P49A 3B5TA 2JCCE 2P8MB 5DD5L 3U48A 3T04D 4LAQH 4P9HH 2NY0D 1IM3B 4E0RB 1INDH 1HQRB 2UWEA 3BFOA 5E8OA 5L88H 4S1DC 4WHTB 3QPXL 4QHNB 1J8HD 4HKBB 1YY8B 2XQBH 1DJSA 4U1IA 2Y07L 4QNPF 1RZIB 3F6LA 5IF0A 3MQIA 1OVZA 1U91A 1K6QH 5AZEL 3GSWB 5F7WC 3M8OH 2RBLA 1H3PH 1RJCA 4MB4A 3X11B 1K8DA 1ZHLB 1IKNA 4OB5L 3C09C 4NQDA 2VO5A 3RNQB 5D7IB 4P99A 5DMYA 5HHOA 5IFJA 1MHCB 1IKFL 1LO0L 4P2OA 5FO8B 2LAGB 1EVTC 4TYUA 5F44A 1ZT7B 4Y5YA 4ODWA 4M7JL 3D2UD 3DUUB 4ZSOB 1MCPL 1O7VA 3RWDA 3RBGA 2X1XR 3ZE0E 4QRUB 4YHOL 1DLHA 1MNUH 1DVFD 4OGYL 4ZAKC 3LQAL 3PWVB 3TCLA 3UTQA 1JYVA 2VDKL 1KEMH 3WKML 1MLBB 4QXTA 5EIQA 4HKJB 1BIIB 2YZ1A 2W65A 1A14L 3BOVA 4XCCL 1YZZA 4LNRB 4NOFA 5IT2L 2FLBT 2DQDH 5DJ6B 4FQ2H 4XHQA 3FHAA 5CZKA 3DVNB 5F7EH 1S7XA 3F65A 4IS6A 2AJVH 2NW3B 5D9SA 2AGJL 5GRJH 5LAXB 2FEEL 2F53B 3GUTB 4FTVD 4WI4A 5F9WB 2DDQL 2DIJA 1WSST 5KSBB 4NC0B 2D7TL 3MV9E 4ZYKB 3O6KL 4Q74A 5FA4A 1MH5B 2VXSL 1B6UA 1AR1D 5CEZH 1HI6A 1UGNA 5E2VH 1V7MH 4RAHA 4XT1C 4M5ZH 4P5MB 5EBLA 4A6YL 4I4WA 1CD0A 1WFNA 4ZTOL 1J1OL 4YWGH 5C6PB 1W0YT 3O3BA 1KCGC 3FO9A 4YDKL 3IDXL 5FYLD 5IKCA 3QDMD 5D5ME 2DQEL 2AJXL 3C5SB 3PWJA 4GG6F 3H7LA 4QRPB 1JPSL 2X89D 5D1XD 4PS4L 1WZKA 4QTIH 4XH2A 5DEZA 5E5UB 2XWBA 2DQUL 4U1SB 3TO2A 4Z7OF 4QHLB 2NXYB 5CEZE 2R2HA 5DHVB 3K2MC 1WZ1L 5DJ0B 3SE3A 2OZ4A 5K9QG 1CBVH 4X6CA 2ESVD 3PNWA 1KENL 2M26A 2FIKA 1E4XH 5I1GH 3RVXC 3QXDA 5ABDE 3IXAB 3DVFA 3TYFB 2OTUA 4M8QA 5HY9A 4LEOB 1T89C 5EZLB 5D2LA 5C3TA 1N2RB 1YUHA 1KACB 3N1MC 1AQKH 4GAYB 4Y4HD 3G9VA 4DUXA 2E27H 1SY6L 4JZJB 4AG4H 2R4SH 2NR6D 3MGAA 4O51A 4CRPA 3MLWH 3O8XA 1AXTH 2ARJQ 5JHLL 2OR7A 1NBVH 3KPLA 3ULUE 1M71A 3FO2B 3H9ZA 1IBGH 1JI2A 3QWRD 4HF5H 1VSCA 4HWNA 5J3HC 4G8EB 5EA0H 2NNAA 2DM3A 3GIVB 3EYVA 1YEHH 2R29H 1Q94B 4UTBL 4I8DA 3B6SB 3LB6D 4JZNA 2R15A 4MA1B 3Q1SL 4X7EC 3QI9A 3K2UL 1KB5A 5FYJL 4P5TC 2Y6SC 3B2VH 5EH1A 4O2CA 3LDBB 4RGNE 4Z7UE 1C5DB 2BVOB 1QLRA 4TSCH 5F7FA 5A2KH 1XEDA 4TTDD 5FA3A 3BN9C 1RZFH 5D1QB 3GB7B 4TULL 5KOMC 3NCCB 3REVA 3TBYA 2D7PA 5FK9A 2NY3C 4I3SH 1F4HA 4BK4A 3ILQD 4L3EB 4N8VG 2XZZA 5DRWB 2WLYA 4PB0L 5ISZE 4ZD3L 5F7HA 2OK0L 5CD5D 5A16B 3NCMA 3S35H 4F7CA 5EFIB 3QDJA 3RL1A 5F96H 4GRWH 2Z93A 4Y2DC 5CLWA 1F3JB 4YK4C 3L7EA 1MI5E 3R0MA 2NNAB 3KPRA 1H0DB 4NCDA 4HIJA 3IDNB 1C8PA 1FBIL 4RGOL 4ETYA 4A6YB 4GW5A 1PZ5B 3AB0C 4GKSB 5I73C 1LEGA 4K7PY 2HLFD 3O6FA 4WWKD 3MACL 3FQNA 4HGWB 3C6LD 4OFYA 4LDEB 1C1EL 4JFFB 4JO1L 1LO3L 1KTDA 2AI0H 2ZP0T 4B7LA 1A2YB 3CFKB 2BOBA 3QXAB 5T1LB 5DD0L 4V1DA 1UVQB 4MA8H 2YBRB 4R4NC 4MGXA 1T7WA 4JO2H 1D5ZB 4K7PX 1U95A 3M17B 5CZXC 2R2HB 2VLLB 3LPGA 1IMHC 3GI9L 2HT4C 4F7PA 3OB0K 5C0NC 5F1NB 3IFOB 3WUWG 1E4KC 4L4TB 8FABA 4DCQB 3TA3C 2O5XL 4PJ8A 2WM0A 4RWYH 1PDKA 3DX6B 4WV1C 4WHCA 1CFSA 4N90D 1YEIL 4AT6A 4G8IA 4PJCF 3U2SB 1U2CA 4GG6A 4QRRE 1F4WH 4MA7L 3RA7L 1FIEA 3W2DH 4XP9L 5MP6H 4OFDA 1K4CA 3TBVA 1CD9B 1CLZH 3BP5A 1OAKL 3L5JA 5DHYB 2MOVA 1U6AL 2GSIB 4NN5B 3BIKA 3W9DB 4V2CB 4DGIL 4ERSL 4WDIA 2ATKA 4PJAE 2Q6WB 1NCBH 1DEDA 5DMIH 3DJ9A 1A5FH 4XCEA 1FNGB 1CD8A 4K3EH 3EDFA 5DMJB 3MV9D 3JV0A 3PXJA 5SV3A 3WXVL 1N6QL 1OAQH 1WF5A 3ARGC 1G1YA 3VFGH 3OV6A 4YLQT 1RIHH 5CIPH 3MNZB 1EAPB 4MB5A 3JWDC 1AJ7H 2YKLL 4QWWD 4Y5YB 3LKQB 5CIPA 2ICCA 5I73B 2OP4H 5F7YC 2EYTB 2OL3A 5I6XB 2FBJL 3OGCA 3NBNA 5IB2A 1SEBA 5ICXA 5ADOL 4URTB 1B2WL 3CC5B 4JFYB 3BP4A 1CT8B 3LEXA 1IAIH 2ATKB 2BOBB 3MODH 1ZHNA 1YY9D 3BPNB 3QDMA 5IBTL 1DVFC 4JFFA 4XCYA 1BGXH 1DANU 3HE6A 5EO9A 3BRDA 4WW2F 3LZFH 5B8CC 4QCIA 1J7VR 5GSVA 4QTHB 1WBXB 2UWEB 5E8OB 4U3HA 4GH7B 4F9LC 1FVDA 3GSNA 1IGYB 3RGVA 3VFOB 1MCFA 3QPQC 2VXVL 5KS9F 4HQQL 2YUWA 4AEFA 2DI7A 1T6VN 2XTJD 5CGMA 3TP4A 1EHLH 1XGYL 4JRXD 4X5XB 5EU7E 4L1DA 4O2EA 3DX8B 3DROB 1SJEA 4JDTL 1FFRA 1RK0B 1G9ML 2A74A 1LO5B 2BXZA 3Q6FA 4PRHA 3QIBD 1T5WB 4IRJC 3BW9A 5I2IB 4JM4L 4B53A 2Y9RT 2RR3A 2P5EE 1BVKB 3ZSSA 3DX9A 1LO2H 2DJUA 1Y6NR 3WLWC 2X4PA 3RGVD 3P73B 2E7LA 1WFUA 4KVCL 4XNXH 1I7UA 1TTUA 1J11A 4LPTA 2YUVA 3WE6B 1O0VA 3P9MB 5E1AB 1CDCA 4H1LH 1S8DA 2Z31C 1CICA 1UYWL 1X6NA 3CFJA 4PJIE 1ZAGA 1D7FA 4MDJA 3TF7A 5ALBL 4HMCA 4JKPL 4U1JA 3L3IB 4Y4FC 1CFNA 5C92A 1V7ML 4DFHA 1B4RA 1UFUA 3BISA 1FZOB 3D3VB 5SWZA 3MJ8A 4JFFE 4JZJA 3EIFA 1EXUA 4J8RB 5MHSE 3RL1B 1CGVA 3AFLA 2JIXA 2PYFB 3FFCB 4ZXBA 1RZKL 4F9PC 2BSRB 1KJVB 4CADA 2DQEH 2DQFB 3TYFA 1I1FB 3GSRA 4KROC 3U7WH 5FIEA 1SM3H 4HUXA 3GO1L 3NPSC 4S0SD 2XWJB 1SJHA 5F8QC 1A6WH 4OZHB 1TVBA 4QOKB 3HE6C 3LMJH 1GZQB 3MV7B 3FO0L 5IW3A 2GCYB 1IC4L 3MLRL 1U8NB 3TBWA 1NGXA 3RGVC 4PJ5B 5KSAA 1PBYA 5BOZG 4RX4D 4AH2B 3L6FA 5D2NA 4XC3L 2EDJA 4GKNA 3OJVC 1QTYT 3LSOA 4NPYB 5L2KA 4G8EA 4CU7A 1FO0B 4QRSA 1LDPH 1DN2A 4Z7WB 2NX5E 4PV9A 3REWA 3V5HB 3HCVA 1VGEH 1MH5A 3MRDA 1YYLL 1JF1B 1G7PA 3Q3GB 2B7DT 2BX5A 1FPTL 2EDQA 5DFVC 4LL9A 1JV5A 4N9OB 3VE0B 2ICEA 2ICWA 4Z9KB 1FZKB 2CDFA 1KPVB 1TCRB 4I3GA 4BELD 4NGHH 2NX5B 1FGVH 3O3AB 4JY5L 3NGBB 2FIRT 2D31B 4QHLA 2H26B 4Y16B 2R9HD 4DEPB 5TF1H 4QEGA 5GQBA 2UZIH 1ZA6B 3QIWC 4L3AA 5JDSB 3IDUA 3BEVB 3VXTA 4HD9A 2C5DC 4RFOL 4PGEB 4H25A 2CRYA 3JTTB 1KXVC 1M4KA 1NEZB 3GSQB 4YQXL 2RQ8A 2XA8H 3AROA 4JFHE 1R5WA 3HNTH 5DO2C 4GOSA 3ARPA 4ZNCD 3WS3A 1A1MA 1V3MA 2EDRA 1ZOXA 2NY7H 3VXUB 1NGWB 5C8JB 3MUGB 3ULSA 4WW2B 1JN6B 3VGGA 4IMLA 4WV1A 1SY6H 2JJTA 4PJHF 4FG6C 4JRXE 2Z4QB 3ZHDA 3LQMA 4PRDA 2F53A 5KS9B 3ZYJA 1ORSA 4M1GL 5I76A 1X5KA 3VWKC 4LNRA 2F15A 4ONOA 4AH2A 5HHXH 2B2XH 4PRPA 3CSYB 3SGEI 1A4KB 3KLSA 5HYSB 1HDMB 2HFEA 3RWJB 1QBAA 3PWVA 4XHJC 5FDYA 1R24B 1MJ8L 4WW1A 3DTXB 3B5HA 4ZTPH 4MVBA 4PRIE 1FNLA 1JBJA 3A0OA 5GS2D 3SPVB 3MRIB 4TSCL 1FYTD 1T03H 2Y25A 3BUYA 3PWNB 3U4BH 4X7SH 4ODTL 4OD1L 4DN3H 3SDYH 5E6YA 2DBLL 3QULB 3D2UA 4JM2A 4ETQA 1LEIB 5GS0H 2XKNB 4GAGL 3RNQA 3ZLQC 4N1EA 4M02A 4OQTL 4PJHE 1OY3B 2AS5M 3UTSE 2BRRL 4KK9C 2X4RA 2BJML 3V5HA 3REWB 4EUPB 3OKYA 5LWYH 4RGNC 3TZVB 4IRSB 5DJAA 2COQA 1G7HA 2WINB 4S2SB 4DW2H 2CKBL 3NACL 1ITCA 2HG5B 5IVXB 3L3GB 5JW3L 4YHKL 1U42A 2CLRB 4CVWA 2X4UA 5HHPB 3I9GL 1IC1A 2AK1L 2NY3B 4J1UA 3PABA 3IU3A 4JO1H 3CVHB 2ZCKL 1HINL 4U1MB 1MCQA 3P73A 3OBAA 4OD2B 2ZJSH 3TGXA 4MD0B 4EN3B 3FB8B 5DD6A 1I8MA 2VH5H 1CD1A 1T21A 3D0VA 2MCG1 2OL3L 1QSFA 3NMEA 3OKEB 1JWUB 1HHIB 2Y5TA 2ADJA 3DOSA 3Q48A 4NHCL 1A7OL 5ISZD 1KJVA 2PTTB 1HKLL 1LWRA 4P3DA 5FKAA 1INDL 2VJXA 3C08L 4OLYL 1FZOA 3D3VA 1S9YA 2ZKHH 2PUQT 2ID5A 3TJHA 2EH8H 5F7KC 4JFEB 4MVBC 43C9B 1KNOB 1DN0A 4JPKH 4EDXA 2A9NL 1ZVHA 3BDBA 3L3IA 4IOIB 4JFZL 5JPNA 3WFBH 1BBDL 3IFNL 5H37H 3RUGE 1D5MB 3B5GA 4NQED 4ONGL 2IQAA 3QDGE 2X1OA 1ZA3A 4HFWB 4ZFOA 3WFCL 2DTSA 1BFVL 4XVTH 5E1AA 2BMKA 4MMXC 3WHE0 2MTPA 1ROWA 4XI5C 4ERSH 3RP1A 4P4KA 1IKFH 1WFTA 3VXME 2CQVA 2AQ1A 1OARH 1WIPA 3TF7C 1FL6B 4OF0A 1P5VA 1MCBA 2YN5A 4RNRA 1TJIL 2D7QA 4M7LT 1HH6A 1TJHL 2QV2A 1KELH 1I3GH 2VITA 1TZHB 2H32A 2W60A 4FS0A 2WIMA 3ESVF 4HWBL 1RUQH 4XGZA 1MFEL 2ERJC 1WIUA 2MJWA 1S9VA 2IH1B 1F4XH 3BGMA 1G9NL 1YYMH 1U41A 4ODXA 3PWUB 1XCTA 2XXMB 2HFGL 5D4QA 4EI5C 3RKDD 1KGCD 4Y0GA 1ZHKB 4DKDC 1KC5L 3HNVH 1MJJB 4LNVA 4QXGL 3BYTA 5DJ2A 1OAXL 5J8OA 1KTRL 5SV4A 4OM1L 2Q6WA 1WLHA 4X9BA 2D4DA 3OKOB 1F6LL 5TDNA 3QDMB 4DKFL 1E4JA 4NQDE 4QRPD 1FNSL 3CFBA 1K8IB 2DQIL 2K7QA 5D1XB 4GRMA 4U0QB 2BK8A 3SO5A 4ZUWB 4TPRH 4BZ1L 3P4NA 1QRNE 4NRZA 2IH3A 5DLMH 4APQC 3HZVB 3LHPH 3NA9H 2OL3B 3SCMD 3JVGA 1XIWA 4PRNB 25C8L 2JK5B 3GNML 1BQUA 2MSPA 4L9LB 1DTUA 4Y4HB 4XGZB 1NUFA 3MZTA 5DJYB 4BSVA 1TQCC 4WFGE 1I9EA 5IHUL 2DQHL 5I1KL 4KTYA 2JKXA 3P30H 2X1WL 2JK5A 1A1OB 3B9EA 3D0LA 2DKMA 1D5IL 5LGJA 2Q76B 4P4KC 5EO1A 5C0AB 5DO2D 5ID0B 4RFEB 1PVHA 3WO4C 4M62L 1LE9A 1BIHA 4RDQG 3UC0H 3K46A 3V0AC 5IHZA 4G42B 1CFVL 1K3IA 2APVA 5HDBE 4PJ7F 1YN6B 4F8TA 3MJGX 4U6XB 2WMPA 3ETBF 5E8EB 5JOPD 4O9HL 3BYYA 3EYOB 5D5MA 4NZDA 3C5ZB 1NLDH 4PD4J 2RGSA 4YUEL 3O9WB 1YDPA 3NTCH 3N06B 3O6FB 3UPAA 1JWMA 4YBQD 1P4BL 3ULVF 3AGVA 1LO4L 4EQ2A 3VGEA 4L3ED 2XY2A 3LD8B 1PYWA 1QO3B 4U6HB 4D0BB 2F5AL 3TYGH 2Z93B 2RIKA 3PV7A 4KK5C 4PLKD 3GSXB 5AD0A 1RULH 1Z6JT 1MCLA 2IFGA 4DCQA 2HYMA 3N1FC 1F13A 3HPJA 2Y7QA 2FATL 1L9MA 2J3SA 1P7QD 5BRZA 1KF9B 4HS3B 4NJ9L 1EBAA 1A7PH 1Z3GL 4NRXA 2ADJB 5D7JC 3QCVH 5EC2A 5FUCC 5CJOH 3TPUE 1AKJB 2CRMA 4ZS7L 4PJAA 1S78D 5DFWH 1GOGA 2OYPA 2C4FU 3EKCA 4UDTB 3P0YH 3A6CL 4QT5A 2V5RA 1CICD 4XCCH 1KTDB 4JPWH 2PCPA 5EBGA 1VFOA 5HHPA 4FQQA 3O6LL 5M94B 4PP8C 3EHBC 4FQ2L 2VDPH 2WUBL 5I1LB 3SDDD 3D87B 1EIBA 3RWGB 5GRYA 1IGFH 4HKZA 4DQOL 3QRFM 1WEJH 4X6FB 5ADPH 3O2DL 3H9SE 1RUAH 3CAFA 3PGFL 4R7NB 1R3KB 1NBZA 4LGPB 2R4RL 4M1DH 5JHDB 2F19H 43C9A 4XCFH 2ARJA 2QHRH 2GITA 5GGUB 1JGDB 4WU7B 5DD0H 3M8OL 1X4YA 3HMXH 4ISVA 1KN4L 1IGTB 3VGHA 1HHGB 3VXMD 2BHYA 2IADB 4OB5H 1UJTA 4F7MB 2O93L 2DQGH 3V4PL 3MA9L 4OUUB 1QLEL 1XAUA 2GK0B 4NC1C 4LCCB 4OM0L 5FGCB 4UTAL 3P9LA 3HAEH 4MNQA 1LP9A 4U6YA 3KPOB 4YHIB 5ETUA 1DE4B 1MCSA 4KQ4L 4FABH 5DXWA 4Q6IB 4KXZH 4O2FB 3D39A 4NRYB 4Q58C 4XWOD 1DUYA 5CMAB 1UEMA 4FTVA 3HAEA 5DVMA 4DOHB 3KPMA 2F5BH 4PJCB 3AS1A 3CXDL 2NXYC 2BVTA 1QNZL 1QSVA 3LQAH 1AD0A 1O5DT 3D5OF 1XH3B 5TQ0H 4C59B 3MV9B 4JPVL 2FR4B 5HGBB 1R0AH 1Q72H 1MJ7L 5CP3A 2HJFA 5JIHA 3QP3A 1S7VB 4KHXH 2PO6B 4HS6A 1DDHB 1LDSA 3T3PE 3OHXA 5FO9A 3STLB 5AYQA 1S5HB 1J86A 3ZDXE 5C07A 2BCKA 1J1XH 5K9JH 1OP5K 3O6KH 4LARH 4HG4J 4Z76A 2FLRT 3PWLB 1WBZA 1CK0L 1JPGB 2ED8A 2VWEC 3SY0A 4GRLA 4ZTOH 3QPQD 2CLZA 2B2XL 2X5PA 4P2QB 2GTZA 4OAWB 2F58H 5C0RL 4NNYB 4PJDA 1KLFA 3SE9L 2LU4A 3FN0L 4X4ME 5CZVH 4EZMA 4PGDB 1MF2L 2QQKH 3ZE2F 4PB0H 4OIBA 2VZVA 3KYAA 1QYGH 3EHBD 4P2QA 3DRTA 5DMKA 3PL6A 3CZFB 4OCRH 1AIFB 1F02I 1E4KA 2BOCB 4PJ7B 5F9OH 1WV7T 3DLQR 4X9IA 2CLVA 5I8CB 1OM3L 4M8VA 2EH8L 2B5IC 3SE4C 2YC1A 3HI6H 4XMKH 5T33H 4FXGB 1NCCH 3IJSB 4JFZH 5HYFA 3A6BH 1A7RL 4RFNC 3BD5A 3BHBB 2AQ3A 3LZFL 4LCWA 4BQBA 1MRFL 3MA7B 2C1PB 1AFVL 4WI7A 3WS3B 2QQNH 1IQWH 4OFVA 4BKLA 1MVUA 3SCMA 2HJFB 3V79C 5IF0B 5KSAD 2NW2A 4KK5D 4D94A 5DS8B 5D2NB 4MYWB 5FM5O 2VZUA 4HKBA 1MREH 3CGTA 3WXWH 4HC1H 1CDIA 2BNQD 4D0DB 2GCYA 3DV4B 3UTZB 2ATPA 4NKMB 3MUJA 3IB4A 1IE5A 3I9GH 2V2TA 1TVBB 4NRYA 4UUJA 3I6GB 3MO1A 5D7IE 4WY7H 4FNLH 3GMRB 4XRCB 1MRDL 3IVKB 1A6UH 1C08B 5HVHC 2YXMA 3GMLA 3DSFL 1WAAA 5F72S 4EUPH 1JFQL 1HKLH 4K55A 1CE1H 3D3VD 3X11A 3R06A 4X98A 1DBBH 3AY4A 4Z8FH 4Z7NE 2ARJB 4UILL 1CFNB 5FHAL 5GZOC 4PJXB 1PG7X 3V4UH 3G6AA 2VLRE 4KFZC 5E94B 3WS6C 4Q7DA 4LOUC 3PL6C 1NCBL 4NP4L 2AW2A 2YD3A 1IGIH 2R69H 2OJEA 3OKDA 5D8JH 5TDPB 2EDNA 1C12A 1KIQA 3GJFB 1MPAL 1RUPH 3QFJB 4QT5B 1T1WB 4UDTA 1OW0C 4NO3B 3CCHA 3CSBA 4NM4H 5JO5A 5BZWA 5L8JB 3SOBH 1EEUA 2C3HA 2ESVE 2J6EA 4NO2A 1F8TL 1EJOH 3IDYB 1T7VA 5TQ2L 2LV4A 4JB9H 1EZVX 3KLHC 1ZK9A 1Q9OB 1IC4H 1BMGA 3MLRH 4OLEA 4I0CC 4JFEE 5E8PA 2VISA 4I2XA 4H88H 1XCQB 3MJ7A 4H26A 4KK6D 4RMSA 5CBAB 4G6KL 2BVQA 5TE4H 4OFKA 3UO1H 2A2QT 2CMRL 4AIZB 1BGXL 2VC2L 3FMGL 3CDGB 5ACLA 5C07D 1FNHA 1K2DA 4UZGA 4FMKA 3HC3H 4LLMA 4Y16D 3CK0L 3QEUA 3OR7A 1JZ2A 4NUJA 5IEHB 4LHQB 3GMQB 1JGVL 1X5AA 3DGGB 1AKJA 2HKHL 2J8UB 3FQTB 2C3WA 4NGHL 3QUYD 5CAYB 3RWCB 2CR3A 1XZ0B 1JIBA 5GS0D 2FO4B 4DWHA 3HC4L 1ZVYA 4JKKA 4KK6C 4G9FB 2ZUSA 3LS4H 4TSBL 4CW1B 4K3DL 1KUMA 4LK4A 3DSNA 2W9DL 4PGJA 3DROA 1UXSA 1YNTA 4L9LA 2P8PB 3VFUA 4GFTB 1CL7L 5F88B 4MS8D 3HRPA 3HZVA 4WJ5A 2NY7L 3UBXB 4YE4H 3O9WA 2D7TH 2R1WB 1KIPA 1M6OA 5T3XH 3LEYH 2XTJE 3QUYA 1WGOA 3RJQB 1Z2KA 2EYRA 5EPMB 2DRUA 4PGCA 3TJEL 3ARDB 3DX7A 1MHHB 1I85C 3U30C 1T0NA 1KIPB 1M6OB 4PJBA 4XBEH 1JPFA 2J4WL 2VXUH 3BWUC 6FABH 5AWNL 1UQSB 1HH9B 2D3VA 1BJ1H 1XMWA 1ZKAA 2ZUTA 5ESVA 2FB4H 2VQTA 2PW1B 2DS4A 4PLJC 4O00A 3BE1L 4PV8A 4WENB 1KPRB 4R90H 2DYPD 5KG9B 1KEGL 1GAFL 4C83B 4JLRB 1MCJA 5J6HA 3MCLH 4PJHA 5HYQB 2FWOB 2AKRB 4KQ4H 4U1LB 4FABL 1H8SA 2PYED 4XPBL 5CHNB 1OGAD 3DVGA 3BP6B 1MLCA 5INDB 5FUOL 1D3CA 3NIFF 3TO4B 2ITDA 3TBTB 1A7PL 1FL6A 3QNZA 3I50L 3MRHB 5J6GA 1UQSA 1XGTA 1GIGH 3QJFB 4ZS7H 4Q97A 2V7NA 1YEFH 3G08A 4HKXB 4L4TE 4DKEH 1T2XA 3WUWA 3HG1E 4HUUA 1DEEB 4GXUM 4LLUB 4LPCA 3U36B 2P7TA 3OKOA 3VXOB 4HWZA 5K9OA 4LASL 4PRPD 3S5LG 2R0LL 1WQVT 3FO1B 2FZ3A 5EOCH 3QUXB 3IDMA 4KGLA 3SE4A 1RUKH 1KB5L 4YAQA 1F90L 3QIBA 5DQJA 3T08A 4LOUD 4DUVA 5FKAB 1BAFL 3LKSB 3VGDA 1QP1A 1U8LB 1R3IH 4RISL 1XIWC 1I9RL 3KPSE 3TPUB 3IDGB 4LKXB 4IRSC 1JZ4A 4JQVA 3HI1A 2W0FB 2VDMH 2I60L 2C3VA 1EVUA 4OLVL 2OXHA 2BERA 4NQEB 4Z7NF 1QLFA 3MBEC 1FFOA 2JB5L 3L9RA 4OBRA 5JXAH 3MOBL 4OLYH 4H1LB 2AJYH 1C5DA 2H8PB 5FAAA 4NSKB 3BPLB 4XXDB 5DJXB 1RZ7H 2FYYA 5BMFL 1MRCH 3QIWD 1T1XA 5I71C 3HAEG 2FRGP 4JJHA 2EDFA 4HFWA 4LHJB 2EO9A 1F42A 1A7RH 4YGAB 3CXHK 3ARDA 1FIGH 1AQDB 4GKSA 2L0DA 3MNVB 4IHOA 5E6ZA 1OAUL 1AFVH 3EJJX 2W92A 5T1KD 4HIXH 3IDJA 4Z0XA 1A6VL 2EIZA 5D1ZC 4G9FE 4QRTA 4JM2D 3KPRD 4FQIL 5HI3C 1BF2A 1AI1L 4JHWH 1A3RH 4S11A 4MNQE 3RZCB 3ME0A 2AABL 3QCUL 3IDYC 1QFHA 2V2XB 3BZFB 3FB5A 1E0OB 4R96B 4UI2A 4ZNEA 2XY1A 3FB6A 3QUZD 1T21B 5C3LD 4PJAF 1ZV5A 4KV5E 4Z7VE 2XG5A 4OV5B 3NCJH 3H3BC 5HDLA 4MZ3A 3K7UA 3QH3B 4Q2ZB 3HE6D 3QZWG 5DURB 5FM4A 1BZ7B 5I75C 2CLRA 4HFUL 1WBYB 4Y4KD 5FCUH 4AEHH 3QEUB 4OZGF 1QFWH 3HNSL 4YO0A 4MHHI 2FECL 1OF2B 1U92B 4XWOC 2GAZA 4IRSA 5DJAB 1MVUB 3SCMB 4YBLB 35C8L 1FJ1B 3KYKL 4U1KB 4LRIC 1VEMA 2VZOA 1S7SA 4UNTA 3O3EB 5IW1A 4FQJH 4LF3B 3RI5K 3VXUA 1EK3A 2XG4A 1U8KB 1YNKH 3P9WB 4DGYL 4M8QB 5HY9B 1DQQA 1NEZA 4XTRD 4JFPA 5ENWB 3T4YB 1NDGA 2AEIT 2B20A 2XWTB 4J3WA 3N50A 1MREL 3S36H 3HRZA 1I1RA 2VQ1B 3PNWB 4NM4L 3VFRB 3WXWL 5J0BA 4UDUB 4R6UA 3H2WA 2Z0BA 3RWIA 5TGBA 1WUNT 4S1RH 3SKNA 4U1SA 3T0DA 1TZGL 1VFBB 3D1MC 3P4LA 1ZVSA 2H26A 4D9QD 2UUDK 4U6VH 5JLZA 1D5IH 4NKMA 4OAWA 5HYSA 3B8YA 1ZTXL 2ZUQB 1TTGA 1NEZG 2DQCH 3HZMB 1G1CA 3O9WD 1B2WH 1T80A 4P2OB 5FO8A 3VD4A 3U83A 3RY6C 2HJKA 4FQXA 5B8CA 1KSRA 2B1AH 2AEQL 3KYMA 4NQCD 2FX7L 1I4FA 1YMMB 2DBLH 5KZCB 2VIRB 1UENA 2OBGA 4XVUC 1ZHLA 5HHNA 1ADQA 4Z5RB 4WI6A 3TPKA 2HT3D 3MRDB 3JWOC 3GI8L 1TZIB 3C6LA 4HJGB 3G04B 4L8CA 5D7LB 1DBBL 4ZXBD 1BJ1J 1I3VA 4XC1H 4XPGL 4KI5E 1P7QB 5D93B 5D1ZD 1IFHL 4X6EB 4UB0H 1U3HA 1L0YA 3U1SH 1G7QB 4KKCC 2N1KA 1HHJB 4KTDH 1A22B 1NGPL 4FOMA 1OCWL 4NZUL 5GS1A 2C9AA 2FJFA 3NZHH 4MJ5A 4PLOB 3GEWB 1TJIH 1A9EB 3U79A 4L29A 5EUOE 5H35B 3BJLA 1TDQA 3QCVL 2VQ1A 5CJ8A 1M05A 3O6ML 3UTOA 1FZKA 5E08H 3KPOA 4YHIA 3LKPB 2JB6B 3KLAA 5I8OL 3AAZB 3MLTB 4IMKC 2DQFA 1MHCA 1BBJB 2E7HA 4E5XA 4FFZL 1GSMA 3CLFH 4QHKI 3UTZA 5DVKA 3RX7A 3JTSA 4X0KB 4ZQKA 3T0ED 4WEUD 3G9AB 4GXVL 1XF1A 3V5KB 2V17H 1Z0NA 2W0PA 4U2YA 3OF6A 1A6TB 4V3EB 3QCTH 4ZUTB 1RUAL 1INEH 5JMOC 5DD3H 1G6RL 5EOTA 1MQ8A 2OI9C 1NKOA 3NIDE 4ZUUA 4PJGA 5HHNB 1XH3A 2P45B 2DLIA 2OX5A 3IJHA 1KXQE 5JXED 1T66D 4XBEL 5IK3B 1YMMA 3MFFA 4OZFA 2IAMC 2E3VA 1Z9OA 1J0KA 5E6IC 1NL0H 2LU7A 2YPLB 5FUZH 2MPAH 1IC5H 4NFCA 5J12C 2GHWB 3IYLW 4PUBH 1S9WB 1A64A 3MV8E 3ZKXB 4PJAB 5EWIL 3VXRE 4NQEA 4CNIA 4U4BA 4LCUA 2HAZA 2ENSA 3KJ6H 1B0RB 1FYTE 4MA1C 1YEEL 5DUPH 2AERT 1H3WM 1FE8L 1IEBA 5C0FA 1FYHB 1QSEE 4FQCH 1ZANH 2DB8A 1JI1A 4LVHC 5EIIA 5ID1A 2BC4B 2GFBA 4K3JH 4TVSa 5IP4A 3TLRA 3D9AL 3LEVH 3U9PH 2V5MA 3CFEB 3CSGA 3VRLE 3VFOA 5HHOD 3L3KB 3RPKA 1BZ9B 3CFJB 1BJMA 4ODBD 1TJGH 1E28A 2QSTA 1MSPA 4YR6B 1YYLH 1QA9B 5DD5H 3QRGH 1FJ1A 4GW4B 5IMKA 2O5ZL 5E56A 4P9HL 4BH8A 5CEXB 1H3GA 5HGBA 4FZ8L 1CN4A 4KQ3H 2XZCL 4OQ1A 5B38A 5JW5B 2VSCA 3W11D 4ELMB 1DFBH 1XR8A 4FFVC 1XGTB 2FCBA 4IIQA 4JDVA 1DQMH 4Y16C 5HDBF 1KBGH 1VA9A 2RFXA 5T3ZH 2PW2A 3IRPX 3SHSA 3HI1B 4P5KA 3RTQC 3TIEA 4LKXA 1XGRB 4RWHA 5KSAC 4X4YA 3S88L 2BSTB 4PRAB 1HIMH 4JY6B 2YK1H 3LH2H 5AD0B 1U8PA 3TFKD 5T3XD 2OXGA 4HBQA 5HYQA 2EH7L 2C7UA 4YIQA 4O58L 5EBWA 3VXSB 3QO1B 1L9NA 1SBSH 5GISH 1WIOA 3C8KB 4EIGB 5EBMB 3TBSA 4HW6A 4NC2B 2AXFA 4GBXC 4X7DC 5D2LF 5HXMA 3F6IA 4F15C 1G6RB 2W9EL 1NLBH 4X5WB 3MREA 5K9QI 2YRLA 2XT1B 1KCUL 2CDGA 4JKMA 4P2RB 4GO6B 4ZUWA 4X6CF 1UM6L 4XBPA 1MHHA 4J3XA 4N0CA 1IAOA 4L4VD 4ELKA 5JHDA 2XN9D 5C0IB 1QQDB 4Z0BH 5ICZA 3ZL4L 4M1GH 4YX2H 4Z95H 4FFVD 4X6FA 1OAUH 2NTFB 2R1WA 2B4CH 5IB2B 5C9JA 3C8DA 4U31A 5IQ7L 1EJ6A 1KN4H 2ITDB 2Q1EA 4JGJA 5JA9A 1B6DA 1P4BH 3R1GH 3K4DA 2HFFA 2OSLB 3MV7E 1H3XA 4K3GA 1HILB 2H3NA 2XICA 2F54E 1NCTA 3GMPA 2XKSA 4KY1L 3TPUA 4LMQI 3AS2A 5I18L 2E9BA 3DSFH 3FQTA 3MOAH 4TUKH 3QO0B 4G7YL 4QTIL 1J8HA 1A3QA 3ELAT 4KDWA 1PEWA 1JF5A 2YPVH 1FVEA 4G3YH 5DTFA 5GGSY 1MUJB 4F37K 1E6OL 4JZOB 4MQ7A 4K7FB 3A6CH 2HTLD 1JFMA 3UMTA 5F9DC 5J7CC 4ZFOB 4P9ML 3O6LH 4DW2L 4WO4C 3SQBA 2XKUA 2X9YA 4AIZA 3QDGD 5D1XC 1DEEA 4GMSL 2YRZA 3U2SA 5CBAA 1FVCA 1NAMA 1DN0B 5CUSL 3WFEH 3PG2A 5SWQB 5C0EA 1CFSB 1CK0H 1NBVL 2E9JA 5FGRA 4XNMA 1IBGL 4QHMA 3TNMB 1LE9B 2P4AB 1U9KA 4PREA 3MRFB 4RGND 5KVFL 2BHZA 2Z8WC 2BSTA 2DDQH 3BPCB 2C3GA 4HX1B 4N1CA 2WBWB 5EN2A 5CKGA 2YEZA 4Q9BA 5JDJA 1WT5A 2VXSH 1HQ4B 4C4KO 5D71L 1TZGH 1R3HB 1OAZL 1VGKB 1QSFB 4Y19E 1ZHBB 1OP3K 3GMQA 3OB0H 5EC1A 5L7XL 5GJSH 5I0DA 5JO5B 1NDMB 5FA3B 1DBKH 5GGVH 4XVJH 1FN4B 1P7KA 4L8SB 3KPPA 4N9GA 1GJIA 3WIFB 3IDIA 4TOYH 3PF2A 2F5BL 4JFDB 2YWZA 4I3SL 2WK2A 1F58H 3LAFA 5HHMB 3T77A 4NRZB 4ONGH 5MERB 1CFTB 4X7FC 4ELME 5HGAB 4EVNA 5I1AB 1BZ9A 4DGVH 3W0WD 1LEGB 2X89A 5DHXB 3X3FL 4JVUA 1KENH 1NFDB 3QUYB 1JYXA 3HR5B 1H0DA 3GBNL 3MRBA 2FHFA 3U9UA 1NQBA 3TIDA 1EHNA 2XQYG 2X1PA 1F3JA 1LK2B 2VNCA 4G9FD 1VKXB 5DK2A 3FQUB 5EZIL 3CMGA 5B4MD 1VFAA 1GC1C 1QBLL 1PFCA 2J8UF 3PWUA 2E6QA 2Z8VC 4GLRH 5DFVD 4HV8A 5EZLA 4AG4L 3U7YH 3SGJA 5DJZB 2M8XA 4IM8A 3IS1X 1RV6X 5C09B 2EDEA 1NAML 1W0WA 4XRCA 4EIZC 4ALAL 4EDWL 2AXGA 2KL6A 2LE9A 3BKYL 3P2TA 1S9WA 2X44D 4HXBH 5EUKA 4OD2A 4QXUH 5HVWA 1AY1L 3T3PF 4KPHH 2A0LC 1R24A 3VD3A 5EIVA 3WIIH 3EOTH 1BVZA 4LKCA 2NY5C 4TNVF 5FYJU 3HC0B 3K2UH 4QYOA 3QEQE 4CMMA 4JZNB 2Q8BL 3RQ3A 4PJ9C 3VXQA 4HS8L 5JW5A 4OCRL 4TVPD 4AYFA 4X99B 5E9DB 5ICZB 5DS8A 2VN7A 2AXJA 3S36X 1UCBL 3R8QA 1C5BH 4XBPB 1XF4B 4AL8H 1N0XH 4YHMH 4LVOB 5AUMB 1MFAH 4HDIA 3FN3A 4OLXH 3D39E 2K3TA 2H2PC 3C60A 4RQQB 2NW3A 4KZEL 3FRUA 2LTQC 1Y18B 4KKAD 3D2UB 1FP5A 1MWAH 3JWNC 2VDLH 4KI1A 4Z7VF 1OTUC 3CUPA 5E8PB 2MQ3A 1C08A 2DLHA 3SKOA 1VFMA 3WEXB 1QBBA 1ZGLP 2EIDA 2ARWA 5DGQA 5D7SH 3PIQB 1DVFB 2NZ9D 2IWGA 4RAVA 3LRSA 2NY2D 3ARYA 3GHBH 5F89A 4UV4H 3X3GH 4CU8A 2B39A 2W1NA 5F3BB 2WUCH 2CH8A 4FZEL 3U30B 3Q6GL 3VFGL 5E6IB 1KPVA 1XR8B 3WLWD 4PRPB 3LRGA 1ACYH 2YPKB 2UZXB 4PJIA 1CDBA 1E6JH 3KPTA 4PGBA 3RVUD 3QUXD 4BSJA 4J1UB 3MBXH 3PWLA 3SGJC 1T4KB 3D9AH 3LEVL 2O61A 1Y0LA 4X8JB 3ARBA 1QHOA 3B8SA 3G04A 4L8CB 3T3MF 4YR6A 5TJWK 3G6JE 3QUZA 4QKXB 2ED9A 4ZO8A 2BNUA 2UYLA 5I1HH 1FRGH 5A2LH 2WBKA 1DBJH 1OTSC 2BSSA 4R4FL 3ALWA 3O2WH 3QUKB 2C26A 2CR6A 4NBYB 5EU6B 4LEXH 4PGEA 2APTA 5ID1B 3T8XB 2XZCH 4A6YH 1G0XA 5C86A 4LPVA 2WZPD 5BXFA 2I9LB 1N5AB 4E0RA 3SDXA 4FXKB 5C70A 1KBGL 3KPMB 2P8MA 3QG7H 5F97E 2BY1A 4K7PL 1HWHB 2ZSVA 4WNQA 5C6TL 4ODUB 1FG2A 1BQHA 3PIQA 4UUJB 1IEHA 1PY9A 4P23B 3TT3H 1CICC 1KB9K 3LS4L 1XGYH 3VE0A 3N85L 2IGFH 1JPGA 4LCCA 2NY5L 1XF3B 4PB9L 3U0PB 4JN2A 3B9KA 1S7RA 2ADGA 3DVIA 3QQ4B 3SE8L 5KN5A 1HHGA 5HDQL 4N0RA 4XCNB 1MRCL 2A73A 3N0PB 2W9EH 5IM7B 1EFXD 2A9MH 5SWZB 1U8QB 1DP0A 1P7QA 4U1KA 1JZ8A 3TFKC 1L7TL 1ORSB 4LLWA 1ZLVH 5T3XL 1Q9KB 4GKZA 4TUOA 3MA7A 4K07A 4HJGA 4G6KH 4R7NA 4WUUE 3RTQD 3OJDA 5JHLH 3EJZD 5DQDL 3QUZB 2AV7B 3WS6A 1VACB 3ZE0F 4YEFA 2B4CL 2EICA 2FBJH 5GS1C 2PCPB 1ERNA 1I7UB 3ARGD 5HHVL 2HJKB 4FQXB 4XMLL 1DQDH 1BQSA 1EGJH 3B9KD 1G7MB 4NQCA 3WIHA 4OI9A 5I17A 4R7DB 3CZFA 1Q0YH 3OKKB 1MQKL 4WCYH 4Y4KB 4U6TA 1GGBL 1A9EA 3N9GL 4J4PC 5J11C 3HB3C 3MLXL 3EJZC 4XPHL 1W72L 5F21B 1MY5A 4FQPA 1EMTL 1H3VA 3OXRB 3RAJL 2WLZA 1JHLH 5I18H 2XIDA 2H1PH 1IGTA 2XWTA 1WCQA 4AK1A 2CGRL 1I1AA 3U82B 1SJEB 1WBZB 1JGDA 1UJ3B 1SBSL 1QFWL 1SEQL 1U8KA 2EXWC 1ZT1B 1A7NH 4LSPH 5C0ND 1TZIA 3C6LB 4R2GB 3UJIL 5AG8A 3SBWC 2K7PA 1S7SB 1BP3B 1AGCA 1TVHA 4M93B 2Z31B 1AGDB 1ED3B 1TQBC 1XF4A 12E8L 3LMJL 5T1LD 4JM4H 4ZG1A 3IU4L 3VGAB 4K94C 2XZAH 1ND0A 4JY4B 4J12A 4R4ND 3WFEL 3V52H 3DIFB 1NGXB 5ICXB 1KXTB 5IHZB 4LKCB 3BAEH 1DQJB 4MSWB 3UJJL 1P6FA 5GRVK 5F3BA 2BNQE 2Q87A 4Z7UA 4P2OD 4IRJB 2YEZB 4RISH 1KJ3L 2CO7B 5AAMA 1U3YA 4RAVB 3QHZH 2F74B 1MF2H 2QQKL 4RSVA 1YMMD 5CEYA 1U8LA 2CKBB 1JZ3A 4JKPH 5DJYA 4FG6D 1X5HA 1D5BA 1W0WB 4K2UH 5FYJE 2E9WA 5C09A 3PJSB 1OSZA 4Y2DD 4WTZA 4HV8B 5HYJD 2VE6B 4ZXBB 3KAAA 3PHOB 1MI5D 5BZDA 2VLKB 4ZO6A 2YOCA 4RBPK 4F33B 2FX7H 1KFAH 4XWGL 2ORBL 4QRTB 1CG9A 3CLEH 2WBJA 4MNHA 1FGNH 5BMFH 2GITB 1H8NA 4Z78A 4MA7H 3D3VE 3RA7H 4ESKA 3VGBA 3BWAA 3O4LD 2VL4A 3NVQA 4QRRA 1D5XA 5E9DA 3TV3H 1PX4A 4L8SC 2PXYC 5F71A 3ZKNC 2IBBA 1OQOA 3KHQA 2NZ9C 4XNUL 2O5YL 5I1CH 4FQQB 2D2OA 1RHHA 4ONFH 3WO4B 5HI5C 4XZUB 1OCWH 5IB3B 4ZFFA 1WAAF 5FV1L 3JUZA 1QRKA 2Q76A 1U58A 5ALCH 4XTRC 1A3RL 1N5YH 4AT6B 4KKAC 2Q7NA 2A6KA 3JZ7A 3DX9B 2B1HL 3MLSL 4GMTL 1UA6L 1UB5B 3MZGB 3ULUC 5HYSG 5EC2B 1LDPL 1ZS8A 3BO8B 4ZODA 4ALAH 3QNXB 2IPTL 1SYSB 2XNAA 4M6OL 4NJAH 2WWKT 5BRZB 3BUTA 4WFHD 3QIUB 2Y7QB 4X80L 1RK1A 4JPIB 1AY1H 4DFIA 1MAJA 4JN1L 3Q6FB 4KPHL 3LKSA 3P11H 4TNWK 3THMH 2YD2A 2G5RA 4D0BA 4WO4B 3CU1A 4JM2F 2M1KA 3L95B 4Y5VB 2D9CA 1YMHB 1HYSD 5C0DB 3MLUH 2VLJA 2A0LD 5FHAH 4LQ1A 1IAOB 2FX8L 4U0RC 5E2UH 1OAYL 1CFTA 3IF1A 4H0IA 4O5LH 3UBXA 1L4IA 3GZKA 4K94L 4U0RB 1D5MA 1MFAL 5MI0C 4PDCE 1RMFH 2VLJB 3QBTB 4QRPE 3IETB 1OLLA 4FQJL 4KKLC 3SDCA 3MXWL 3X3FH 3QDME 3G08B 4F57L 1CT8A 2MPAL 4NUGH 1EEYB 3BESR 3DECA 3QDAA 5C71A 5EC1B 4ZFOL 5KBNC 3G5YA 2AGJH 5A40E 1JUFA 5DRNA 5J3HD 4PRAA 1PLGH 2BVPA 3R0NA 3VH8G 1ZEAH 3TJHD 2BVPB 2C3XA 3F7PC 4KJYA 3GMPB 4P5KB 3ZKMC 3G6DL 4PREB 4WWID 4OZGA 1UB5A 3DGGA 1O7SA 1D5ZA 1UC6A 2ZUQC 1EDQA 5DQJB 4QRQB 2OSLA 4UMGA 3DUSB 4PRNA 2ZJSL 5DA0B 5F6HJ 3QUMH 1DL7H 2NY4D 1P4LA 3QB7C 5C08E 5TE6L 1S7QA 1ONQB 5LBSH 3B9DA 4LDOB 1H5BB 2CMRH 4TVPE 2Q3ZA 5D1XA 1AHWB 4ZPVA 5LG1A 2ZPKH 4JREC 4ELKB 4Q6IC 5D2NC 4JFEA 1A1NB 1UCBH 2VZ1A 4HUWB 4MXQA 4WO4A 3BGFB 3FFCD 3TBVB 5I1EH 4S1QL 1N0XL 2BVUA 4YHML 5LGKA 4O02H 1QKZH 3QIUC 1DSFL 3VFTA 4KXZI 2HJLA 3EZ8A 3GIZH 1BBDH 1UM5L 3IFNH 4JPIA 4GAYA 1MLCB 5INDA 1N7ML 7FABL 4BM7A 2ZSWA 2PO6C 1UZ6E 5KSBF 4K71C 2Y23A 1ZS8B 3BO8A 3GSVB 3WYRA 5H8DA 2C7UB 5I30H 4QOKD 3LH2L 3PWPD 2CXGA 3VMPA 4KUCF 4P2RD 3MV7D 3NPZB 3EO0B 1NGQL 5E08L 4UTBH 3CVHA 3VFPB 3O9WC 3GJFA 5DJCA 1D9KA 1HNFA 4U6VL 3BQUC 4MD4A 4GS7B 3INUH 2CXKA 3FQRA 5T1DL 1X5GA 2EEDA 3BQUB 1A2YA 1FFQA 3DETC 3GIVA 1IAMA 4PGCB 1E6JL 5SX5H 4PLNC 4HWBA 5FGBC 3JUYA 5KW9H 1RFDL 3UTPD 4Y5XA 2EE2A 1CG9B 2H45A 1G9EA 4ZQKB 1A1MB 2XRAH 2VABA 2FB4L 3MJ7B 4H0GA 5F6IC 2R8SL 2KH2B 3PJSA 3MRPB 4R90L 1OOAA 2NX5D 2VZSA 3L3OB 1MHEB 3SDXF 3PWNA 4QGTA 3WIHL 4ONHB 3MO1B 2X09A 4Q9QL 4ZO9A 5DHVA 3HLAA 3HUJE 1UWGH 3L7FA 3MR9B 2HRLA 3ZDYF 2V2TB 2D31A 2J8UA 3ECBA 5GS1B 4POZC 5IVXF 1HDMA 5DD6B 3IRZA 5BJTB 3S8WA 3DUUA 4FQXC 2VDRL 4R7DA 2IC2A 3MYJA 3AREC 3O6MH 3RNKA 1OP5H 5ANME 1U8MA 3H9SA 3QDGB 4W6XB 3IU3B 3BPLC 3QI9B 3HS0B 1JE6A 15C8L 1NCAL 4G80B 2X7LA 5D7LA 3IJHB 4EI5B 1AGDA 1S9XA 5HDQH 4ZO7A 1HZHH 4XP1L 5GHWL 4POYA 2IG2L 5F7EL 1ODAA 1JGUL 2DI8A 3BDYL 3QIBC 1ES0A 1Q9KA 4GKZB 3BKJL 4JVWA 4TUOB 3BZEA 3DVNA 4F58H 1M71B 4WGVB 2WWKO 3U0WL 3LSOB 5TPWL 1RIVL 2W07A 3RL2B 1I1AB 1EEZA 1OW0A 4NWUH 2IPUG 5FYLE 4MX7A 3LKOB 3VMOA 4J3VA 1ORQA 3O3DA 3W81A 1B0RA 1HN1A 3SKNB 2GYSA 3E0GA 4I1NB 4NNYA 3IXTA 5F7MC 2EZ0D 3WHXB 5D71H 4DN4L 3VI4F 2PF6A 5FDWA 1J0YA 5DJ0A 1YJDL 2YK1L 1FLRH 2XWJA 4GLRI 1V7NH 2EH7H 2JB5H 5JXAL 2KBGA 1EFQA 1MIMH 3SO3C 1BFOA 2BSRA 1JZ7A 3NCBB 4Y5VC 1N5AA 1ZLSL 4CGTA 1G7IA 4EI6A 4CVZB 1KFAL 1YPZB 3TZVD 1RUMH 4IRSD 3QZWA 5BO1L 1AQKL 5JUEL 4OCSH 1QUNA 2EKSA 4NNPH 1XIWD 3DYPA 4MJ6B 5F8RC 4X6DE 4U1JB 3T0VA 1F6AB 1PW3A 5FYKH 1QRND 2Q8AH 2BJMH 1YPZA 4Z5RA 2XXCB 2NY3D 4G7VL 3MUGA 3KR3L 2GT9B 2P5WE 1T3FB 3QQ4A 4U1HA 5KN5B 5F1OB 3L5IA 4G80A 4X6DB 2FBOJ 5DJ6A 4TSAH 2D03H 5I1JH 3DWTA 2WNGA 4EN3D 5ACZB 1CFVH 4I18B 4LLQA 4PJIB 3HAEB 5D72L 1GC1H 1IAIL 3K3QA 2P5WB 3OKNA 5ISZB 4L29B 2KPNA 3ECBB 5GRUL 4XCFL 4HH9A 4KH2A 3SDCC 2EDBA 4N1HB 1PKQA 5BXFB 3DYMA 4MX7B 1X5FA 3QEQD 1B3JA 4KC3B 1WC7A 4JFED 1IT9L 4ZSOE 4ZD3H 5FCUL 3SGKC 1DQQB 4LCCC 4L4JA 1KTKE 3GO1H 4JDTH 1F2QA 4LRIA 4NKQB 3WLBA 1JK8A 5J1TC 1J0HA 1J10A 3BT2H 1GZPA 1FVDB 3ROLA 1UADC 3MROB 4LSTH 1RU9H 3JV6A 1UKSA 1BM3L 3OKLB 2BDNH 1R3LA 4FXGA 3TFKA 3CXDH 2NMSA 3P9MA 5C07E 4HLZH 3WFBL 1E4WL 4PYHA 4Z7QE 1B88A 1QR1B 2NY2B 1MFDL 2FR4A 1KG0B 4MXVF 1LILA 3RNKB 2Y1VA 4F57H 1C1EH 2AVGA 2R1YA 2OQJA 1J0JA 5IOPA 4NN7C 4Q0XH 1X5ZA 1L7IL 2ZNXA 2AI0L 5E6ID 1U8HA 1VFUA 4F9LA 3KPSA 4JRYA 5A3IC 4F80A 2QEJA 5I2IA 3ESUF 4GW1A 3K4ZA 3RDTD 1DUYB 3HLAB 1NH6A 3GRWH 5GZOD 2DJ4A 2I26N 3VFRA 5IWLC 3H9HB 2GIYA 3P4OB 4S0UC 4GQ9L 1XGQA 5IBLC 3WEXA 1N8ZA 3DX8A 3D18A 3CXHJ 3LQZB 1Y18A 1UZ6F 5KSBE 4F7MA 4X80H 3FQUA 1VKXA 1EXUB 2HFTA 5D7KE 3S4SG 2PR4H 9CGTA 1P1ZB 3O45A 3PGDB 2W9LA 1S5HA 2UVEA 5IGXL 5CZVL 4RAUB 5HPOA 1ADQL 1G6VK 1FFNA 5EU6E 1CXLA 4V2BA 1NBZB 3PV6B 1T2QL 2EDDA 1EUTA 4YO0B 3BQUA 5HGAA 4EVNB 2ILLA 2LFGA 5IMMB 5I1EL 2VOTA 4JO3H 4K94H 4HIEA 4M93C 3M1BB 4KKNA 4K3EL 3EO0A 4G8IB 4N0YH 1YQ2A 1KPUA 3H42H 1N4XL 1CQKA 3CVIH 3T65A 3LKNA 3KXFE 3CX5K 3WJLA 2QQNL 4HHAA 2R0KH 4D0CB 1UCTA 1GPOL 4B50A 1EFXB 4XX1E 1IILE 1CF8L 4LVHB 3VD5A 1BHGA 2GTWB 1IL1A 4EUPG 4CAGA 4XAWH 2Z35B 5ESVB 1IGCH 3WIIL 1CLOL 2HLAA 2RHEA 3MRKB 4LGRB 2D7OA 2AK4E 1JYNA 3WHE1 4D9LL 4ZS6C 5GRVL 4X5XA 3KJ4C 1RQ5A 4N68A 2OI9A 2A9ML 3RVUC 2YWYA 3CSPA 5GGVL 2DL2A 4LSUH 4X7TB 1KIUA 4LPYA 3QFDA 4D9RD 3GMMA 4FNLL 1INEL 2J2ZA 3OKMB 5F93C 4FQXD 4XBGB 3O6FD 2OTPA 1KCRL 1F4YH 2IAMA 3LVEA 4PJDF 4PJFE 2D7NA 4XPTL 3MGTA 4ENED 5FUCE 1H5BA 4HKZB 4ORGA 4HGWA 4A2LA 4OZHF 1J88A 5K9OB 1IAKA 4O9HH 4LDLB 2EYSB 5C9KA 5ESQB 4NM8L 4LBEB 4LLUA 5C0DA 5T5NG 1MFCL 1ZHNB 5DEGA 2H8PA 4WFEE 4L8SA 5AZ2L 4CUCA 2BRRH 5HHVH 5C7XH 1DQDL 2EXYC 3DMMC 1QLFB 2APWA 1MWAL 2I07A 4UT9L 3MRKA 3QHFL 1WWCA 4UILH 4KJPC 1ZWIA 3EJYD 3L3DA 3RY4A 1GOHA 5GRXG 3IFOA 3CIQA 5EN2B 5LXGH 5B39G 5FECB 3BPCA 2VRAA 1N7MH 1X44A 3QNXA 3RWCA 5JW3H 2FWOA 4GRWF 4HK3N 2EIEA 5IJKC 3PE9A 4DAGL 4HHAB 1A0QL 4M5YL 2N4IA 3AMLA 1TITA 5A43C 5INCB 4M7KH 1HINH 2DBJA 2Z31D 4AM0B 5MEPB 4E9LA 4PV8B 4AY0A 4V1DB 5HYJE 2C1OA 4NKDB 3MNZA 3CFKA 4PTTA 2A77H 4K23L 1IGJA 4XZUA 5CILL 2N7AA 1EA9C 3CVHL 1NCDH 1C5CH 4WI8A 3WO3B 5C0BB 1ZA3B 3MLZL 5BS0A 4CKVX 5JHDD 2HVJA 1WZMA 1B0GB 1WTGT 4DZ8A 3QUMA 1PZ5A 4IOFD 4J23A 1LP9F 4JZOA 3BN3B 4X7TA 1JGUH 3KYNA 5KJRH 4X4ZA 4N5UA 4H26B 4IRJD 1CVRA 4LVNB 4HIJB 4KRMB 1UYWH 4X7SL 3WD5H 3QJFA 2CDGB 1U3HD 2PETA 5HDOA 5EZOL 2R4RH 3JBG7 4RFEA 4LLVB 2NYYD 5EO0A 1FL3B 1IL1B 2VXQL 4DVBA 1BWMA 3S98A 4OCWH 3KPNB 3MRNB 5FB8B 1UXSB 1YNTB 5TH2A 1EFXA 3DX6A 2VLKD 3HA0A 4WGWB 3S88H 2W60B 1CD1B 3DV6A 1OGAA 4LIQH 4GG8B 3PWPE 5TFSH 2EC9T 3OAZK 4P57A 5F1SA 4M48L 4YHLH 1SM3L 4B0MM 5CP7B 5DQ9B 4X83A 2VKXA 1JNNH 4Y4FB 2VLLA 1YEJH 3LPFA 2H6PA 1KB5B 1CTOA 2IGFL 2VDNH 4KKBC 1A6WL 2BNRD 4J4PA 5C9JB 3HMWH 5JIPA 3S37H 4P2YA 4W4NA 3SQOL 4ZAKD 3WNMA 1T0NB 5B38B 1V05A 1SJXA 1NANI 4KAQH 4YHNA 3OF6D 2P49B 1RUML 4DUWA 4ACPA 1KN2L 4ZOBA 4NNPL 3MC0A 3FO2A 1FFNB 3D25B 5BVJA 2Z31A 5J13C 4XC3H 1YQVH 5ANMA 3F58L 1Q38A 2X2YA 4JZJC 1MWAB 1YYML 5HI4D 4GW5B 4QWWC 2QHLA 2MHAA 1WISA 3QJHA 4ODXB 4G6JH 2OTUB 1TPXC 3QIUD 4M61B 4L3EE 3C8KA 3D18B 1V3LA 1FORL 1Q0XH 5J1SC 3SCMC 3ZE1F 3MTRA 4MWFA 4C55A 2DQTL 2OR8A 1FV1A 3WFDL 3MV8D