1CGME

Structure determination of cucumber green mottle mosaic virus by x-ray fiber diffraction. significance for the evolution of tobamoviruses
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
160
structure length
160
Chain Sequence
AYNPITPSKLIAFSASYVPVRTLLNFLVASQGTAFQTQAGRDSFRESLSALPSSVVDINSRFPDAGFYAFLNGPVLRPIFVSLLSSTDTRNRVIEVVDPSNPTTAESLNAVKRTDDASTAARAEIDNLIESISKGFDVYDRASFEAAFSVVWSEATTSKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(P*GP*AP*A)-3')
publication title Structure determination of cucumber green mottle mosaic virus by X-ray fiber diffraction. Significance for the evolution of tobamoviruses.
pubmed doi rcsb
source organism Cucumber green mottle mosaic virus
molecule tags Virus
total genus 18
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1993-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00721 TMV_coat Virus coat protein (TMV like)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.70 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Tobacco mosaic virus-like, coat protein 1cgmE00
1EI7A 3PDMP 2TMVP 1VTMP 1RMVA 3J06A 4GQHA 4UDVA 1CGME
chains in the Genus database with same CATH superfamily
4K1OA 4BPMA 2HV7A 2RD9A 4PACA 3EZIA 1T6QA 5A69A 1FMVA 1RCPA 2OEVA 4GQHA 1WWPA 2NSFA 2OU6A 3C63A 3LAYA 3Q6NA 4YT4A 2P1AA 2HUJA 1OW6A 1WTYA 5E3CA 5JUAA 3HNJA 3B0PA 1NSGB 4O6YA 4AE4A 3QW0A 3N0TA 2EPKX 2VB6A 1BZ4A 4LERA 3DWWA 3MX3A 2DYRC 2W4BA 1TWGA 2G3VA 2JPUA 1JRAA 2QUPA 3UNGC 4DVYP 4YJWA 1E84A 1S05A 3DAFA 3DJNB 1WATA 3K1IA 2R03A 3K66A 3GWLA 2UUIA 3EH1A 4JJGA 3OWTA 4KNVA 4LDQA 3SNHA 4C3EA 4CDAA 4AK9A 4ZLDA 2Y69C 4W8KA 1IW7F 3EPVA 3ZSUA 2R7TA 1ZHXA 3L1MA 1MNEA 2F22A 1LS1A 2YVKA 4LLEA 3M1CB 1A7DA 2R7XA 4H54A 5AC4A 4JZAA 5JT4A 3C18A 4IB4A 4M63A 1UFBA 4C7OA 3ZC4A 4HEAJ 1QLEC 2EIMC 3QMKA 4XLPF 3EGDB 1A0BA 1G5ZA 3K1IC 3NMIA 2L6HA 3JYYA 2V26A 1DOVA 4I3MA 2HMQA 1D0YA 2YLGA 3KKBA 4MVQA 4MW8A 2A69F 4Z9JA 2CNWD 3TOMA 1F1MA 4J7TA 2VCBA 1D1AA 2FAPB 4OD5A 2A0UA 4RBNA 4A2NB 1OR3A 2YKZA 2XLWA 4PJJA 2GWWA 3W2VA 4YL0A 2KGOA 4WGZA 3EFOB 1LM3B 1Z6AA 3JRTA 3HNLA 5AGFA 3UR3C 1ORSC 2YRFA 3X2QC 3C62A 4JW1A 2NUPB 1NLXA 5B1AC 1NG1A 2VASA 2XXAA 3M4CA 4IJJA 1R5ID 256BA 2J7PA 3S9OA 3SXMA 4Z9IA 3K33A 3GM1A 4P6IC 1I4ZA 1EQ1A 1KTMA 3EFOA 4FWVA 4IARA 2L9JA 4MS2A 1PV3A 4J32B 4NTAA 4PR9A 5BQIA 3TULA 4G7OF 4BJTA 5EHHA 1PD0A 1ZHYA 2HFIA 1T9KA 3CZ6A 2NUPA 1K05A 2FFHA 1QZXA 4Z9HA 4LDKA 1Y4CA 1JAFA 4XPXA 3FAJA 4CJOA 1YVIA 3T6JA 4BEJA 2YWAA 3AG1C 3ATPA 4JJFA 1QKRA 2DI3A 1Q0MA 2KYHA 4CIHA 4YT2A 1TFOB 2L7AA 2HSBA 4G0HA 4MW3A 2Q7RA 4G7HF 5D92A 3CSKA 3V5YA 2XS8A 4NTFA 2G3KA 3DKAA 4GEHA 2XM0A 4BJ1A 4Q7CA 2A1DD 4EIYA 1XZPA 5KYUB 3G4XA 2YZSA 2LFFA 1FMWA 4NY3A 3K6BA 4ULVA 1WN0A 4DVZA 1HMDA 1U89A 3RH3A 2YLDA 4DJ9A 3LS1A 1CPQA 2ETSA 2W45A 1NFNA 2R25A 3CEXA 3GM3A 4YT8A 3ZIBA 1QQ3A 5BQHA 4LACB 3ECSA 2R05A 3C8GA 3LUTB 1M2VB 4YN0B 1I5NA 3DMDA 4P9TA 3PHF2 2XLMA 3VRCA 4YWQA 2H7VC 2Y3GA 1VYIA 3NRHA 1YARO 1A7EA 3LLKA 3PDMP 2WVNA 2OJQA 1WGWA 1LI5A 5IY5C 4DOZA 3U3FA 2XRHA 1T6UA 3G50A 3NKDA 2HJ3A 1CGNA 3UMIA 1K04A 2J8WA 2L6FA 1SR2A 2CW0F 4JRZA 4AX2A 5A6JA 2KK1A 1YYXA 1M2VA 2HZ8A 3B9QA 3JRMO 1E85A 1BR4A 3FAPB 4CS8A 3RF3A 2MWQA 1YA9A 2Y3DA 1VYKA 3N2ZB 3LEVA 1MMGA 2EILC 3ZG1A 1RMVA 1O3UA 2FGYA 2J9BA 2HJMA 5E3AA 5BQGA 2OJED 4KC9A 5COMA 5DS6A 4UDVA 1Z63A 5F28E 5A6BD 2PBEA 2TMVP 1BR1A 4HFFB 1LPEA 4H4KC 4BEMJ 4Q5SF 2AWCA 5DQTA 1J8MF 5E33A 3V5XA 3S0XA 4EBJA 4CS8C 1W2WA 2NUTA 1AUEA 3H65A 1MMNA 4L6RA 1DOWA 4P9FA 2HMZA 3TD7A 2EINC 1N1CA 1ZYRF 2OKUA 4U9EA 5T3WA 1TQGA 1OKKD 2WVQA 5COFA 2XL6A 2OEXA 2I15A 3FOPA 4JCHA 3UMKA 4JE9A 2DGJA 2PFDA 3BEHA 1D0XA 2V3CC 1YDIA 1VMAA 3U2MA 1TFKB 4CDVA 5L0FA 2EPMX 5DVWA 5DLJA 3F47A 3S29A 3SXKA 1ST6A 2KW3C 5E2QA 2I8BA 2BE5F 3LNMB 4U5FE 4YL3A 4CBEA 2G62A 3LNRA 3QTHA 4QI2A 4C7OB 1LE2A 1SZIA 3QZCA 3DE8A 3JSEO 3WHNA 4DBQA 3HTKC 1EA8A 4PJNA 1VOMA 1E83A 4JTDB 3VYWA 4N06A 4U5BE 5FZTA 2A68F 4JKVA 1A41A 5L3VA 1H6GA 3DJUB 1R4TA 3O55A 2M64A 4N6HA 2Q9AA 2PF4E 2GA0A 4G7ZF 3RVYA 4ER9A 1BR2A 3C8GD 2IBFA 2DYSC 4JC7A 1HW2A 1D0ZA 1O87A 1TKNA 3I4UA 1CPRA 2VC9A 3CQZA 3DXJF 1Z23A 2NSGA 2WZGA 3TOLA 4NTBA 4IGGA 2IYLD 4NC3A 4N6CA 1RKEB 2JD3A 2MHRA 2R02A 1YJGA 4U5EE 3U5SA 3SYNA 4E7SA 1OXKA 2WZLA 5K0IA 3V5ZA 4KI2A 5L0CA 3A9CA 3ZQYA 2XXAB 1OXBA 2W9YA 4ULWA 2R7VA 4CSAA 3R7CA 3GWNA 2QLAA 1UG7A 3N24A 3SXYA 4BG0A 1SMYF 4LLCA 1C03A 5CI9A 3NMKA 5KYXB 2H7BA 3O39A 3NDBB 4IAOA 1RKEA 2R7SA 5A6BA 4XPYA 1JMWA 2Z15A 3VM6A 3GEEA 3SZRA 4DBRA 3S84A 4BJ5A 2R7RA 4PFPA 5EGYA 5L0IA 4CDYA 4CSAC 1PCXA 4E0HA 1G4WR 3FDQA 5KYXA 2Q4FA 1OKKA 3TJ5A 4MTFA 2PP4A 4QI0A 2YLIA 3R2PA 4B6IA 2ZXRA 2XLVA 4YT5A 4U5CE 1M6TA 5COGA 3B71A 4YL1A 5A6AA 2XLDA 1PD1A 4A4AA 1EI7A 3EJNA 3KMIA 3OA1A 4QDLA 1LS4A 3U2LA 1S7ZA 1J8YF 3GODA 2YL1A 4C3BA 1TWCA 4BJ5C 1RXQA 1T01A 2Q9BA 3NKEA 3WODF 3LEOA 3TJ6A 1GM5A 3HNIA 1MNDA 2R7QA 4EKWA 4MTGA 1SF8A 3E70C 3C8GB 1BBHA 2KC3A 1O5HA 3H2UA 1H7IA 1JPJA 4LDRA 3DD7A 4N4WA 4MTOA 2Q00A 3IPMO 2IXNA 3C7JA 3W2WA 4MVOA 4FX5A 1TWHA 3AG2C 5T1DB 2LP4A 5CIVA 1QPUA 3GEIA 1RJ9B 1C02A 4W8PA 3T4RA 2J46A 2O9XA 2YHSA 4O7GA 2XS1A 4PK4A 2YL0A 1WOLA 5F5FA 4IWBA 3M4BA 3U9JA 3S27A 1VTMP 2J0XA 2P6VA 1OCCC 2EIKC 1FAPB 2R7OA 5JSLA 2DB4A 1VLTA 2J45A 4PFOA 4X0RA 4O6NA 5HV9A 5B1BC 2ZD9A 3O6XA 5AC5A 1LE4A 4YK5A 3DE9A 3Q7LA 5FCLA 1RJ9A 3PMRA 1H9GA 4R32A 4CX9A 5HSWA 4OIPF 1CGOA 3Q7GA 3LS0A 5DQZA 1KNYA 1NBBA 2J0WA 1ZHWA 2VCCA 3AG4C 3IEEA 4J30B 1Z5ZA 1M56C 2JX0A 3ASOC 2NUTB 3WAQA 1V54C 4ONSA 1Z3IX 3IQ6A 1HW1A 4U9DA 3S90A 2QNLA 3DZAA 3KL4A 4IRUA 4E17A 3GEHA 1OW8A 2Y3BA 2GFHA 2HSQA 1D1BA 1BDJB 1AVOB 1Q0DA 4XQ1A 4ZLCA 1A7VA 4OIRF 3HLZA 2LCHA 4JVSA 3AQBA 4CIPA 1LVKA 3EHMA 3AGUA 5KYWB 2HV6A 2J9WA 2H7OA 1G4US 3LJBA 5BUOA 4C3DA 4NCQA 1YZCA 1FNTc 3FVYA 1OR2A 4WABA 2P7VA 4I1OB 2HS5A 1OQCA 2IOQA 2P0NA 4F4BA 2IXMA 2WB7A 2J9UA 3S28A 3JSZA 1Y6DA 5L3QA 2QTVA 3DM5A 3EHNA 3RVZA 1FFHA 2LQGA 3KH2A 4JCZA 3U0CA 2R7UA 2NPUA 3FXHA 5KYWA 3AJMA 5L0JA 1G8XA 4AL0A 2VCAA 3MBGA 4K7BA 4O6MA 4Q4ZF 1RKCA 3VAYA 1M2OA 4RDAA 3AGTA 3U8VA 5DS4A 1AEPA 1Q0GA 2OQMA 4MVUA 4MQ9F 2XM4A 1ZVZA 1LI7A 3WG7C 3GANA 4D4XA 2OCCC 2CGEA 3AG3C 4IAQA 1VK5A 1C17M 2ZXOA 4WGYA 1YLMA 1ZZPA 2B0JA 3T6GB 2YQYA 3ZWIA 4JEAA 3POVA 3NMJA 5T3TA 4DRHB 3MYIA 2EPNA 2KSFA 1FFTC 1WASA 1ORYA 2VH3A 1B68A 3ABMC 4MNDA 3U9MA 4DRJB 4DXWA 4JEBA 5EK0A 3TQOA 1VLSA 3IQTA 1U6HA 3K1HA 4G78A 1LKXA 1SYQA 3RIPA 3US6A 3GM2A 1KU2A 2LSEA 3H2VA 1XZQA 3MLGA 4XPWA 1H9TA 3L0IA 2ZXWC 4K0DA 3B0UX 3ABKC 2AU5A 2AVKA 4U5HA 3EG9B 4AL1A 1ZU5A 3FMSA 3RQFA 5JS5A 3B29A 1T6IA 2KNHA 3PCVA 4OD4A 3VF0A 2LD6A 3NG1A 2ZXPA 3RYLA 3O10A 1LIHA 4DRIB 4EHPA 1XWJA 3L34A 5JLIA 5KYNA 2ZPAA 3HJCA 4U5DE 2XLOA 4E7ZA 1T5OA 2IXPA 3J06A 1YAUO 1I4YA 1TWAA 1MMDA 1GGQA 2AP3A 1OCRC 1U0BB 1JPNA 2Y3HA 4MVMA 2BC5A 3EG9A 4KBLA 3RFYA 2QE9A 2KQ9A 5D91A 1MQVA 3KYIA 3HKKA 3QW1A 1L7CA 4D4NA 2Q3TA 3QVYA 3MYFA 5F5HA 3EH2A 5L0DA 3I5PA 2BL2A 3W8HA 1Q0KA 4XEKA 2X0CA 1FR0A 3NYMA 2EPLX 2A6HF 1K40A 4JTCB 3QVZA 1QSPA 2HKVA 3EGDA 3IQ5A 2ICWG 2WZFA 3EQLF 5GPGB 3F46A 3ZVRA 4EBKA 1TR2A 1NU7D 2B0HA 2UUHA 3UGPA 5JVEA 2OG2A 4E18A 2D4UA 4HFKB 2XSEA 5B3IA 1ORJA 4PJMA 1NZEA 2W4MA 1L3PA 1M57C 2LK4A 4OINF 2YL3A 4XTKA 4GYTA 3JTLO 3NYLA 4EBBA 4XLNF 4FAPB 3JZ0A 4JIOA 3EGXB 3ZDLA 5TJ5E 2D5RB 3ZTZA 3MFNA 2MYSA 1V4AA 3KYJA 2X51A 4RD9A 3ABLC 3RKOF 4CS9A 3T6BA 4AE4B 5CI8A 3GORA 4HE8D 3M79A 3A11A 3LLIA 3RQGA 2L6GA 1APCA 3G4ZA 3KPHA 3EZHA 3TK0A 3L8JA 5JP7A 2XLHA 3L8IA 3EGXA 4XEVA 2WL8A 4XEFA 3X1OA 4OIOF 4BJ6A 1ZHTA 1MMAA 4NQFA 5KYYB 5L0GA 1JOGA 2QY9A 3RQEA 3UMHA 4CS7A 1EKYA 1Z7Qc 3DI5A 4CS9C 3JYHA 3I5QA 1Q0FA 1OCZC 4MVZA 1E86A 3BRJA 3IQCA 4WJ0A 3V7OA 3DAGA 2EPOA 1FTSA 1HE1A 3Q6MA 2XL8A 2OOCA 3C8ZA 3RW0A 3HNKA 2LIGA 2A0BA 5KYYA 4BJ6C 2XLEA 3M15A 1YZAA 4KNWA 1NU9C 3U3BA 4JURI 1VB5A 2WVOA 1GQAA 3JT1A 4OIQF 3E9VA 3SXZA 4PJLA 5L0HA 3ASNC 2Q9CA 5KYUA 4EWCA 3W8IA 1ZU4A 1QVXA 2YL7A 3T9OA 1V74B 2IXOA 2LFDA 3K7DA 3W4YA 2YEVA 3OEOA 2C03A 2R7WA 3B0VC 2CNWA 2C04A 2ASRA 3IHUA 1NFOA 3DM9B 4MVSA 2RSEB 3NYJA 1CGME 3AQCA 1HMOA 2J9VA 1ZW2A 3LESA 2PNOA 2GDCA 2P61A 2PX0A 2H8AA 2XL4A 1JR8A 4O79A 3JCUQ 3ZTMA 5DS5A 5A6KA 4I44A 3ZQVA 1OCOC 2CYDA 1HE9A 2CCYA 3FHDA 3FOOA 2GAQA 3SP1A 4CJGA 2Y39A 5B3SC 3ITFA 1V55C 4XWJA 1D1CA 1E2XA 1YYJA 2A6EF 1ZHZA 2KJGA 2EIJC 2L81A 4U5GA 1OW7A 5JRAA 2IM8A 2E87A 1HY5A 4FESA 3CAXA 1IZMA 2PX3A 2CDQA 3U8PA 4I1MA 3SEOA 2AWYA 2J7PD 4EUKB 2R9RB 4E0IA 1GS9A 4J7YA 3UGOA 2M4EA 1ZW3A 4JTAB 4MVRA 4ANJA 1YA7O 2NG1A 3AOUA
chains in the Genus database with same CATH topology
1EI7A 3PDMP 2TMVP 1VTMP 1RMVA 3J06A 4GQHA 4UDVA 1CGME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EI7 A;  3PDM P;  2TMV P;  1VTM P;  1RMV A;  3J06 A;  4GQH A;  4UDV A;  1CGM E; 
#chains in the Genus database with same CATH topology
 4K1O A;  4BPM A;  2HV7 A;  2RD9 A;  4PAC A;  3EZI A;  1T6Q A;  5A69 A;  1FMV A;  1RCP A;  2OEV A;  4GQH A;  1WWP A;  2NSF A;  2OU6 A;  3C63 A;  3LAY A;  3Q6N A;  4YT4 A;  2P1A A;  2HUJ A;  1OW6 A;  1WTY A;  5E3C A;  5JUA A;  3HNJ A;  3B0P A;  1NSG B;  4O6Y A;  4AE4 A;  3QW0 A;  3N0T A;  2EPK X;  2VB6 A;  1BZ4 A;  4LER A;  3DWW A;  3MX3 A;  2DYR C;  2W4B A;  1TWG A;  2G3V A;  2JPU A;  1JRA A;  2QUP A;  3UNG C;  4DVY P;  4YJW A;  1E84 A;  1S05 A;  3DAF A;  3DJN B;  1WAT A;  3K1I A;  2R03 A;  3K66 A;  3GWL A;  2UUI A;  3EH1 A;  4JJG A;  3OWT A;  4KNV A;  4LDQ A;  3SNH A;  4C3E A;  4CDA A;  4AK9 A;  4ZLD A;  2Y69 C;  4W8K A;  1IW7 F;  3EPV A;  3ZSU A;  2R7T A;  1ZHX A;  3L1M A;  1MNE A;  2F22 A;  1LS1 A;  2YVK A;  4LLE A;  3M1C B;  1A7D A;  2R7X A;  4H54 A;  5AC4 A;  4JZA A;  5JT4 A;  3C18 A;  4IB4 A;  4M63 A;  1UFB A;  4C7O A;  3ZC4 A;  4HEA J;  1QLE C;  2EIM C;  3QMK A;  4XLP F;  3EGD B;  1A0B A;  1G5Z A;  3K1I C;  3NMI A;  2L6H A;  3JYY A;  2V26 A;  1DOV A;  4I3M A;  2HMQ A;  1D0Y A;  2YLG A;  3KKB A;  4MVQ A;  4MW8 A;  2A69 F;  4Z9J A;  2CNW D;  3TOM A;  1F1M A;  4J7T A;  2VCB A;  1D1A A;  2FAP B;  4OD5 A;  2A0U A;  4RBN A;  4A2N B;  1OR3 A;  2YKZ A;  2XLW A;  4PJJ A;  2GWW A;  3W2V A;  4YL0 A;  2KGO A;  4WGZ A;  3EFO B;  1LM3 B;  1Z6A A;  3JRT A;  3HNL A;  5AGF A;  3UR3 C;  1ORS C;  2YRF A;  3X2Q C;  3C62 A;  4JW1 A;  2NUP B;  1NLX A;  5B1A C;  1NG1 A;  2VAS A;  2XXA A;  3M4C A;  4IJJ A;  1R5I D;  256B A;  2J7P A;  3S9O A;  3SXM A;  4Z9I A;  3K33 A;  3GM1 A;  4P6I C;  1I4Z A;  1EQ1 A;  1KTM A;  3EFO A;  4FWV A;  4IAR A;  2L9J A;  4MS2 A;  1PV3 A;  4J32 B;  4NTA A;  4PR9 A;  5BQI A;  3TUL A;  4G7O F;  4BJT A;  5EHH A;  1PD0 A;  1ZHY A;  2HFI A;  1T9K A;  3CZ6 A;  2NUP A;  1K05 A;  2FFH A;  1QZX A;  4Z9H A;  4LDK A;  1Y4C A;  1JAF A;  4XPX A;  3FAJ A;  4CJO A;  1YVI A;  3T6J A;  4BEJ A;  2YWA A;  3AG1 C;  3ATP A;  4JJF A;  1QKR A;  2DI3 A;  1Q0M A;  2KYH A;  4CIH A;  4YT2 A;  1TFO B;  2L7A A;  2HSB A;  4G0H A;  4MW3 A;  2Q7R A;  4G7H F;  5D92 A;  3CSK A;  3V5Y A;  2XS8 A;  4NTF A;  2G3K A;  3DKA A;  4GEH A;  2XM0 A;  4BJ1 A;  4Q7C A;  2A1D D;  4EIY A;  1XZP A;  5KYU B;  3G4X A;  2YZS A;  2LFF A;  1FMW A;  4NY3 A;  3K6B A;  4ULV A;  1WN0 A;  4DVZ A;  1HMD A;  1U89 A;  3RH3 A;  2YLD A;  4DJ9 A;  3LS1 A;  1CPQ A;  2ETS A;  2W45 A;  1NFN A;  2R25 A;  3CEX A;  3GM3 A;  4YT8 A;  3ZIB A;  1QQ3 A;  5BQH A;  4LAC B;  3ECS A;  2R05 A;  3C8G A;  3LUT B;  1M2V B;  4YN0 B;  1I5N A;  3DMD A;  4P9T A;  3PHF 2;  2XLM A;  3VRC A;  4YWQ A;  2H7V C;  2Y3G A;  1VYI A;  3NRH A;  1YAR O;  1A7E A;  3LLK A;  3PDM P;  2WVN A;  2OJQ A;  1WGW A;  1LI5 A;  5IY5 C;  4DOZ A;  3U3F A;  2XRH A;  1T6U A;  3G50 A;  3NKD A;  2HJ3 A;  1CGN A;  3UMI A;  1K04 A;  2J8W A;  2L6F A;  1SR2 A;  2CW0 F;  4JRZ A;  4AX2 A;  5A6J A;  2KK1 A;  1YYX A;  1M2V A;  2HZ8 A;  3B9Q A;  3JRM O;  1E85 A;  1BR4 A;  3FAP B;  4CS8 A;  3RF3 A;  2MWQ A;  1YA9 A;  2Y3D A;  1VYK A;  3N2Z B;  3LEV A;  1MMG A;  2EIL C;  3ZG1 A;  1RMV A;  1O3U A;  2FGY A;  2J9B A;  2HJM A;  5E3A A;  5BQG A;  2OJE D;  4KC9 A;  5COM A;  5DS6 A;  4UDV A;  1Z63 A;  5F28 E;  5A6B D;  2PBE A;  2TMV P;  1BR1 A;  4HFF B;  1LPE A;  4H4K C;  4BEM J;  4Q5S F;  2AWC A;  5DQT A;  1J8M F;  5E33 A;  3V5X A;  3S0X A;  4EBJ A;  4CS8 C;  1W2W A;  2NUT A;  1AUE A;  3H65 A;  1MMN A;  4L6R A;  1DOW A;  4P9F A;  2HMZ A;  3TD7 A;  2EIN C;  1N1C A;  1ZYR F;  2OKU A;  4U9E A;  5T3W A;  1TQG A;  1OKK D;  2WVQ A;  5COF A;  2XL6 A;  2OEX A;  2I15 A;  3FOP A;  4JCH A;  3UMK A;  4JE9 A;  2DGJ A;  2PFD A;  3BEH A;  1D0X A;  2V3C C;  1YDI A;  1VMA A;  3U2M A;  1TFK B;  4CDV A;  5L0F A;  2EPM X;  5DVW A;  5DLJ A;  3F47 A;  3S29 A;  3SXK A;  1ST6 A;  2KW3 C;  5E2Q A;  2I8B A;  2BE5 F;  3LNM B;  4U5F E;  4YL3 A;  4CBE A;  2G62 A;  3LNR A;  3QTH A;  4QI2 A;  4C7O B;  1LE2 A;  1SZI A;  3QZC A;  3DE8 A;  3JSE O;  3WHN A;  4DBQ A;  3HTK C;  1EA8 A;  4PJN A;  1VOM A;  1E83 A;  4JTD B;  3VYW A;  4N06 A;  4U5B E;  5FZT A;  2A68 F;  4JKV A;  1A41 A;  5L3V A;  1H6G A;  3DJU B;  1R4T A;  3O55 A;  2M64 A;  4N6H A;  2Q9A A;  2PF4 E;  2GA0 A;  4G7Z F;  3RVY A;  4ER9 A;  1BR2 A;  3C8G D;  2IBF A;  2DYS C;  4JC7 A;  1HW2 A;  1D0Z A;  1O87 A;  1TKN A;  3I4U A;  1CPR A;  2VC9 A;  3CQZ A;  3DXJ F;  1Z23 A;  2NSG A;  2WZG A;  3TOL A;  4NTB A;  4IGG A;  2IYL D;  4NC3 A;  4N6C A;  1RKE B;  2JD3 A;  2MHR A;  2R02 A;  1YJG A;  4U5E E;  3U5S A;  3SYN A;  4E7S A;  1OXK A;  2WZL A;  5K0I A;  3V5Z A;  4KI2 A;  5L0C A;  3A9C A;  3ZQY A;  2XXA B;  1OXB A;  2W9Y A;  4ULW A;  2R7V A;  4CSA A;  3R7C A;  3GWN A;  2QLA A;  1UG7 A;  3N24 A;  3SXY A;  4BG0 A;  1SMY F;  4LLC A;  1C03 A;  5CI9 A;  3NMK A;  5KYX B;  2H7B A;  3O39 A;  3NDB B;  4IAO A;  1RKE A;  2R7S A;  5A6B A;  4XPY A;  1JMW A;  2Z15 A;  3VM6 A;  3GEE A;  3SZR A;  4DBR A;  3S84 A;  4BJ5 A;  2R7R A;  4PFP A;  5EGY A;  5L0I A;  4CDY A;  4CSA C;  1PCX A;  4E0H A;  1G4W R;  3FDQ A;  5KYX A;  2Q4F A;  1OKK A;  3TJ5 A;  4MTF A;  2PP4 A;  4QI0 A;  2YLI A;  3R2P A;  4B6I A;  2ZXR A;  2XLV A;  4YT5 A;  4U5C E;  1M6T A;  5COG A;  3B71 A;  4YL1 A;  5A6A A;  2XLD A;  1PD1 A;  4A4A A;  1EI7 A;  3EJN A;  3KMI A;  3OA1 A;  4QDL A;  1LS4 A;  3U2L A;  1S7Z A;  1J8Y F;  3GOD A;  2YL1 A;  4C3B A;  1TWC A;  4BJ5 C;  1RXQ A;  1T01 A;  2Q9B A;  3NKE A;  3WOD F;  3LEO A;  3TJ6 A;  1GM5 A;  3HNI A;  1MND A;  2R7Q A;  4EKW A;  4MTG A;  1SF8 A;  3E70 C;  3C8G B;  1BBH A;  2KC3 A;  1O5H A;  3H2U A;  1H7I A;  1JPJ A;  4LDR A;  3DD7 A;  4N4W A;  4MTO A;  2Q00 A;  3IPM O;  2IXN A;  3C7J A;  3W2W A;  4MVO A;  4FX5 A;  1TWH A;  3AG2 C;  5T1D B;  2LP4 A;  5CIV A;  1QPU A;  3GEI A;  1RJ9 B;  1C02 A;  4W8P A;  3T4R A;  2J46 A;  2O9X A;  2YHS A;  4O7G A;  2XS1 A;  4PK4 A;  2YL0 A;  1WOL A;  5F5F A;  4IWB A;  3M4B A;  3U9J A;  3S27 A;  1VTM P;  2J0X A;  2P6V A;  1OCC C;  2EIK C;  1FAP B;  2R7O A;  5JSL A;  2DB4 A;  1VLT A;  2J45 A;  4PFO A;  4X0R A;  4O6N A;  5HV9 A;  5B1B C;  2ZD9 A;  3O6X A;  5AC5 A;  1LE4 A;  4YK5 A;  3DE9 A;  3Q7L A;  5FCL A;  1RJ9 A;  3PMR A;  1H9G A;  4R32 A;  4CX9 A;  5HSW A;  4OIP F;  1CGO A;  3Q7G A;  3LS0 A;  5DQZ A;  1KNY A;  1NBB A;  2J0W A;  1ZHW A;  2VCC A;  3AG4 C;  3IEE A;  4J30 B;  1Z5Z A;  1M56 C;  2JX0 A;  3ASO C;  2NUT B;  3WAQ A;  1V54 C;  4ONS A;  1Z3I X;  3IQ6 A;  1HW1 A;  4U9D A;  3S90 A;  2QNL A;  3DZA A;  3KL4 A;  4IRU A;  4E17 A;  3GEH A;  1OW8 A;  2Y3B A;  2GFH A;  2HSQ A;  1D1B A;  1BDJ B;  1AVO B;  1Q0D A;  4XQ1 A;  4ZLC A;  1A7V A;  4OIR F;  3HLZ A;  2LCH A;  4JVS A;  3AQB A;  4CIP A;  1LVK A;  3EHM A;  3AGU A;  5KYW B;  2HV6 A;  2J9W A;  2H7O A;  1G4U S;  3LJB A;  5BUO A;  4C3D A;  4NCQ A;  1YZC A;  1FNT c;  3FVY A;  1OR2 A;  4WAB A;  2P7V A;  4I1O B;  2HS5 A;  1OQC A;  2IOQ A;  2P0N A;  4F4B A;  2IXM A;  2WB7 A;  2J9U A;  3S28 A;  3JSZ A;  1Y6D A;  5L3Q A;  2QTV A;  3DM5 A;  3EHN A;  3RVZ A;  1FFH A;  2LQG A;  3KH2 A;  4JCZ A;  3U0C A;  2R7U A;  2NPU A;  3FXH A;  5KYW A;  3AJM A;  5L0J A;  1G8X A;  4AL0 A;  2VCA A;  3MBG A;  4K7B A;  4O6M A;  4Q4Z F;  1RKC A;  3VAY A;  1M2O A;  4RDA A;  3AGT A;  3U8V A;  5DS4 A;  1AEP A;  1Q0G A;  2OQM A;  4MVU A;  4MQ9 F;  2XM4 A;  1ZVZ A;  1LI7 A;  3WG7 C;  3GAN A;  4D4X A;  2OCC C;  2CGE A;  3AG3 C;  4IAQ A;  1VK5 A;  1C17 M;  2ZXO A;  4WGY A;  1YLM A;  1ZZP A;  2B0J A;  3T6G B;  2YQY A;  3ZWI A;  4JEA A;  3POV A;  3NMJ A;  5T3T A;  4DRH B;  3MYI A;  2EPN A;  2KSF A;  1FFT C;  1WAS A;  1ORY A;  2VH3 A;  1B68 A;  3ABM C;  4MND A;  3U9M A;  4DRJ B;  4DXW A;  4JEB A;  5EK0 A;  3TQO A;  1VLS A;  3IQT A;  1U6H A;  3K1H A;  4G78 A;  1LKX A;  1SYQ A;  3RIP A;  3US6 A;  3GM2 A;  1KU2 A;  2LSE A;  3H2V A;  1XZQ A;  3MLG A;  4XPW A;  1H9T A;  3L0I A;  2ZXW C;  4K0D A;  3B0U X;  3ABK C;  2AU5 A;  2AVK A;  4U5H A;  3EG9 B;  4AL1 A;  1ZU5 A;  3FMS A;  3RQF A;  5JS5 A;  3B29 A;  1T6I A;  2KNH A;  3PCV A;  4OD4 A;  3VF0 A;  2LD6 A;  3NG1 A;  2ZXP A;  3RYL A;  3O10 A;  1LIH A;  4DRI B;  4EHP A;  1XWJ A;  3L34 A;  5JLI A;  5KYN A;  2ZPA A;  3HJC A;  4U5D E;  2XLO A;  4E7Z A;  1T5O A;  2IXP A;  3J06 A;  1YAU O;  1I4Y A;  1TWA A;  1MMD A;  1GGQ A;  2AP3 A;  1OCR C;  1U0B B;  1JPN A;  2Y3H A;  4MVM A;  2BC5 A;  3EG9 A;  4KBL A;  3RFY A;  2QE9 A;  2KQ9 A;  5D91 A;  1MQV A;  3KYI A;  3HKK A;  3QW1 A;  1L7C A;  4D4N A;  2Q3T A;  3QVY A;  3MYF A;  5F5H A;  3EH2 A;  5L0D A;  3I5P A;  2BL2 A;  3W8H A;  1Q0K A;  4XEK A;  2X0C A;  1FR0 A;  3NYM A;  2EPL X;  2A6H F;  1K40 A;  4JTC B;  3QVZ A;  1QSP A;  2HKV A;  3EGD A;  3IQ5 A;  2ICW G;  2WZF A;  3EQL F;  5GPG B;  3F46 A;  3ZVR A;  4EBK A;  1TR2 A;  1NU7 D;  2B0H A;  2UUH A;  3UGP A;  5JVE A;  2OG2 A;  4E18 A;  2D4U A;  4HFK B;  2XSE A;  5B3I A;  1ORJ A;  4PJM A;  1NZE A;  2W4M A;  1L3P A;  1M57 C;  2LK4 A;  4OIN F;  2YL3 A;  4XTK A;  4GYT A;  3JTL O;  3NYL A;  4EBB A;  4XLN F;  4FAP B;  3JZ0 A;  4JIO A;  3EGX B;  3ZDL A;  5TJ5 E;  2D5R B;  3ZTZ A;  3MFN A;  2MYS A;  1V4A A;  3KYJ A;  2X51 A;  4RD9 A;  3ABL C;  3RKO F;  4CS9 A;  3T6B A;  4AE4 B;  5CI8 A;  3GOR A;  4HE8 D;  3M79 A;  3A11 A;  3LLI A;  3RQG A;  2L6G A;  1APC A;  3G4Z A;  3KPH A;  3EZH A;  3TK0 A;  3L8J A;  5JP7 A;  2XLH A;  3L8I A;  3EGX A;  4XEV A;  2WL8 A;  4XEF A;  3X1O A;  4OIO F;  4BJ6 A;  1ZHT A;  1MMA A;  4NQF A;  5KYY B;  5L0G A;  1JOG A;  2QY9 A;  3RQE A;  3UMH A;  4CS7 A;  1EKY A;  1Z7Q c;  3DI5 A;  4CS9 C;  3JYH A;  3I5Q A;  1Q0F A;  1OCZ C;  4MVZ A;  1E86 A;  3BRJ A;  3IQC A;  4WJ0 A;  3V7O A;  3DAG A;  2EPO A;  1FTS A;  1HE1 A;  3Q6M A;  2XL8 A;  2OOC A;  3C8Z A;  3RW0 A;  3HNK A;  2LIG A;  2A0B A;  5KYY A;  4BJ6 C;  2XLE A;  3M15 A;  1YZA A;  4KNW A;  1NU9 C;  3U3B A;  4JUR I;  1VB5 A;  2WVO A;  1GQA A;  3JT1 A;  4OIQ F;  3E9V A;  3SXZ A;  4PJL A;  5L0H A;  3ASN C;  2Q9C A;  5KYU A;  4EWC A;  3W8I A;  1ZU4 A;  1QVX A;  2YL7 A;  3T9O A;  1V74 B;  2IXO A;  2LFD A;  3K7D A;  3W4Y A;  2YEV A;  3OEO A;  2C03 A;  2R7W A;  3B0V C;  2CNW A;  2C04 A;  2ASR A;  3IHU A;  1NFO A;  3DM9 B;  4MVS A;  2RSE B;  3NYJ A;  1CGM E;  3AQC A;  1HMO A;  2J9V A;  1ZW2 A;  3LES A;  2PNO A;  2GDC A;  2P61 A;  2PX0 A;  2H8A A;  2XL4 A;  1JR8 A;  4O79 A;  3JCU Q;  3ZTM A;  5DS5 A;  5A6K A;  4I44 A;  3ZQV A;  1OCO C;  2CYD A;  1HE9 A;  2CCY A;  3FHD A;  3FOO A;  2GAQ A;  3SP1 A;  4CJG A;  2Y39 A;  5B3S C;  3ITF A;  1V55 C;  4XWJ A;  1D1C A;  1E2X A;  1YYJ A;  2A6E F;  1ZHZ A;  2KJG A;  2EIJ C;  2L81 A;  4U5G A;  1OW7 A;  5JRA A;  2IM8 A;  2E87 A;  1HY5 A;  4FES A;  3CAX A;  1IZM A;  2PX3 A;  2CDQ A;  3U8P A;  4I1M A;  3SEO A;  2AWY A;  2J7P D;  4EUK B;  2R9R B;  4E0I A;  1GS9 A;  4J7Y A;  3UGO A;  2M4E A;  1ZW3 A;  4JTA B;  4MVR A;  4ANJ A;  1YA7 O;  2NG1 A;  3AOU A; 
#chains in the Genus database with same CATH homology
 1EI7 A;  3PDM P;  2TMV P;  1VTM P;  1RMV A;  3J06 A;  4GQH A;  4UDV A;  1CGM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...