1CGME

Structure determination of cucumber green mottle mosaic virus by x-ray fiber diffraction. significance for the evolution of tobamoviruses
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
160
structure length
160
Chain Sequence
AYNPITPSKLIAFSASYVPVRTLLNFLVASQGTAFQTQAGRDSFRESLSALPSSVVDINSRFPDAGFYAFLNGPVLRPIFVSLLSSTDTRNRVIEVVDPSNPTTAESLNAVKRTDDASTAARAEIDNLIESISKGFDVYDRASFEAAFSVVWSEATTSKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of cucumber green mottle mosaic virus by X-ray fiber diffraction. Significance for the evolution of tobamoviruses.
pubmed doi rcsb
source organism Cucumber green mottle mosaic virus
molecule tags Virus
molecule keywords RNA (5'-R(P*GP*AP*A)-3')
total genus 18
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1993-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00721 TMV_coat Virus coat protein (TMV like)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.70 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Tobacco mosaic virus-like, coat protein 1cgmE00
1EI7A 1RMVA 4UDVA 3PDMP 1VTMP 2TMVP 4GQHA 3J06A 1CGME
chains in the Genus database with same CATH superfamily
2Q9CA 5BQIA 3CEXA 4DRHB 1HW2A 3FAPB 3S9OA 1OKKD 4MS2A 1HW1A 2R7OA 4I1OB 4EUKB 3C63A 2KGOA 3EGXB 1LPEA 2H8AA 1OXKA 5L0CA 3HLZA 4ONSA 2AP3A 5BQHA 1VYIA 2NUPA 3SYNA 3DJUB 4O6NA 3F46A 2AWYA 1MMGA 5D91A 1KTMA 3HNIA 1NLXA 3A11A 5D92A 4XEVA 3U8VA 4F4BA 1SR2A 1ORJA 4EIYA 3AOUA 1Q0GA 4FESA 2JX0A 5KYNA 4XEFA 2J8WA 3DE8A 5KYXA 4H54A 3X1OA 3X2QC 2IXNA 4Z9IA 1FR0A 1YARO 2V26A 5F5FA 2WZLA 3C62A 3EPVA 3UNGC 4OIRF 2FFHA 4MVZA 3W8IA 1TQGA 2YLDA 3QVZA 3NYMA 4WGZA 1AVOB 4JRZA 1BBHA 1N1CA 4K7BA 5KYWB 4CBEA 2VB6A 2WZFA 2G62A 3JSZA 3M4CA 1CPRA 4EBKA 4YWQA 1V54C 1WASA 2CDQA 1YDIA 2WZGA 5JS5A 2HJ3A 4JTCB 2QY9A 4E18A 2L6FA 5E2QA 4E0HA 3S90A 1LI5A 3ABLC 1A7EA 2VH3A 4BJ6A 1TWAA 4C3DA 3ZTZA 4LERA 4ANJA 5AC5A 1C03A 1A0BA 1Z7Qc 256BA 2ZPAA 3V5ZA 4JW1A 4AE4B 3ASOC 3T6GB 4U5BE 2NPUA 4WABA 1EQ1A 1YVIA 3NG1A 4W8PA 1ZW3A 4CJGA 2HS5A 5B3IA 3ITFA 2D4UA 1J8MF 1OXBA 4XTKA 2F22A 1CGME 5L0JA 1NZEA 2YQYA 1BR4A 4M63A 5KYYA 1T01A 5A6AA 2VCBA 2YLGA 3B71A 1XZPA 2QLAA 3KKBA 3NKEA 2XL6A 4XQ1A 5E3CA 4E7ZA 2ETSA 2W45A 5AGFA 2IBFA 3DE9A 2EIJC 3M15A 5FZTA 5AC4A 2J45A 1ZHYA 3EG9A 1OR3A 2J46A 2J9VA 1OKKA 2A69F 3DMDA 4J32B 3EZHA 2R7TA 2W4MA 2JPUA 1J8YF 4BJ1A 5DS5A 2XSEA 3S0XA 1LVKA 2IYLD 1FFHA 2OG2A 2UUHA 3DAFA 3MLGA 1QPUA 1E85A 3DM5A 4R32A 2BL2A 2XLWA 5EGYA 4JKVA 5DQZA 1M57C 1Z5ZA 2D5RB 4NTBA 4XPXA 2X0CA 2LSEA 2PX3A 2WL8A 3T9OA 3U3BA 2J9BA 4O7GA 1VB5A 2R03A 3E9VA 3ZTMA 3RF3A 4RDAA 3PMRA 3QW1A 2H7VC 2P1AA 3VRCA 3UGOA 3KYIA 1LS1A 3TULA 2HMZA 3K6BA 1C17M 1U6HA 3O55A 3V5XA 3DKAA 3FHDA 4OD5A 4YL1A 3BRJA 3A9CA 4YL3A 4JEBA 3CSKA 2X51A 4CS8A 3SZRA 1Q0DA 1FMVA 3AG2C 3HNLA 3LEVA 2XLEA 4L6RA 3S28A 4EWCA 4LDKA 3TQOA 4YT2A 5L3VA 2MWQA 3IEEA 1T9KA 4O6MA 2HZ8A 3J06A 3F47A 3AJMA 4FAPB 4AL0A 5JVEA 4MQ9F 1G8XA 4JE9A 5COGA 4E17A 3H65A 3L8JA 2P6VA 3FDQA 2XLVA 4EHPA 1OCOC 2LIGA 3AG1C 2R7RA 5L0DA 4NQFA 3RFYA 5CI9A 1C02A 1PD0A 4DRJB 1HE1A 1ZHZA 3US6A 2H7OA 2A68F 1QQ3A 4XPYA 4PJLA 4CDYA 3HKKA 1JR8A 4CSAC 1R4TA 1WN0A 2RSEB 1WOLA 2WB7A 2P0NA 3JRMO 4LLEA 2LQGA 2CNWD 5F28E 1LI7A 3RYLA 2J9UA 3IQCA 2OCCC 3OA1A 4JCZA 1RKEB 4JTDB 1MQVA 5TJ5E 2OQMA 4KNVA 1TWCA 4JCHA 1QLEC 3MX3A 4DRIB 2XLHA 3C18A 5KYXB 1PV3A 3B9QA 3RW0A 3TJ6A 1E83A 2W4BA 5KYUB 4BPMA 3AQCA 2Q00A 1M6TA 3M79A 3QVYA 3DJNB 2WVNA 4G0HA 1IZMA 4MTFA 1JOGA 1OR2A 5K0IA 3AG4C 3B0PA 2EPLX 1TWGA 2J7PA 2KSFA 2R02A 2VASA 3U9MA 4IARA 3LLKA 3EGDB 3H2VA 1BDJB 2TMVP 4JVSA 4MVQA 3JZ0A 1S05A 2YWAA 3ZQVA 4LDRA 1O5HA 1YA9A 3L34A 3WAQA 2NUPB 2G3VA 4QI0A 1QZXA 2CGEA 3C8GB 3W2VA 3U9JA 1Z63A 5JT4A 3IQ6A 4ULWA 2DI3A 4JJFA 2LCHA 4OINF 5L0FA 2ICWG 1H9TA 4LDQA 2OOCA 2NUTB 4KC9A 3Q7GA 5KYUA 4PR9A 4ER9A 2GWWA 2KK1A 2AVKA 3DD7A 3GEIA 1Y6DA 1BZ4A 3G4XA 3RIPA 1AEPA 4E7SA 3FXHA 3ZQYA 2NG1A 1TKNA 3O6XA 2R7UA 3U2MA 3W4YA 2XLDA 1OW6A 1K04A 2OJED 1YJGA 3BEHA 4NCQA 4CDAA 2XXAA 1D1BA 4DJ9A 1TFOB 4X0RA 5JSLA 3K1HA 3SXZA 2KNHA 3UMKA 1SMYF 2R7QA 4AX2A 3N2ZB 1CGOA 4WJ0A 2VC9A 3OWTA 3C8GA 4RBNA 4NTFA 3N24A 4BG0A 2DYRC 2L6HA 2Q9AA 3ABKC 1TWHA 2HFIA 4JEAA 1M2VA 4GEHA 1ZW2A 4JJGA 1QVXA 3NDBB 1WATA 1PD1A 1OCRC 3JRTA 1APCA 5JRAA 3ECSA 4J7TA 1JMWA 1MNDA 2KYHA 5A6KA 4U5DE 4OD4A 5E3AA 2MYSA 4MVOA 3GEEA 1ST6A 4AE4A 2A6EF 2ZXPA 2Y3DA 2YHSA 3G50A 1IW7F 3ZIBA 3LS0A 4J30B 4EKWA 2IXOA 1JAFA 2M4EA 2HV6A 3MYIA 4JC7A 2R7XA 1T5OA 2JD3A 3HTKC 4I3MA 2LFDA 3PHF2 4QI2A 5KYYB 4IAOA 2UUIA 2A0UA 3RH3A 1O87A 4BEJA 4BJ5C 1JPNA 2P7VA 4YJWA 3PDMP 3K7DA 1I4ZA 1MMDA 4YT4A 3C7JA 2ASRA 5B3SC 4G7ZF 3UGPA 3DXJF 1YZAA 2B0JA 1ZU5A 2EIKC 5L3QA 2XM0A 3EH1A 4WGYA 5EK0A 3FMSA 3T6JA 3GORA 2WVOA 4PJJA 4PFPA 3RQGA 1UFBA 3LAYA 2XRHA 3QMKA 1ZHTA 4YK5A 1H9GA 1H6GA 4JZAA 4ULVA 3SXKA 1E2XA 2HSQA 2NSGA 3IQTA 2C03A 2DGJA 1I5NA 1ZHWA 2KQ9A 2Y3BA 1YA7O 2EILC 3IHUA 3IQ5A 1UG7A 3K66A 3DZAA 1MMAA 3LEOA 1A41A 3M4BA 4KI2A 1NFNA 2BC5A 4N4WA 5CI8A 4XEKA 2ZXOA 3U5SA 2LP4A 1M56C 4G7OF 4U5CE 3I5QA 5F5HA 2XL8A 3H2UA 3AGTA 2YKZA 2KW3C 4PJMA 3VYWA 2A0BA 3DWWA 1WTYA 2GAQA 1L3PA 1DOVA 1U89A 3EHMA 1EI7A 1GQAA 3LLIA 3TOLA 1Q0KA 4PACA 2EPKX 3NKDA 1FMWA 1ZZPA 3LNRA 5A6BD 2LK4A 4HEAJ 1V4AA 2P61A 3OEOA 4HFFB 1RXQA 1XWJA 2HKVA 2NSFA 3EH2A 4IWBA 4YN0B 3VF0A 2WVQA 3EJNA 1HMOA 2DB4A 1LM3B 3ATPA 3JTLO 4JURI 3TJ5A 2CYDA 4IJJA 1VMAA 1RJ9B 4KNWA 3Q6MA 3KH2A 3EQLF 1O3UA 4GQHA 1FNTc 1HY5A 3K1IC 3RVYA 5JP7A 2EPMX 1MMNA 1W2WA 4XWJA 3KPHA 5DVWA 4OIOF 1VK5A 4LLCA 5HV9A 2B0HA 1TR2A 3EZIA 1BR1A 3LS1A 4JIOA 1T6UA 1RMVA 4DBQA 4B6IA 3R7CA 1L7CA 2YL1A 3SP1A 4ZLDA 4MTOA 3EGDA 2PP4A 3GM2A 3L0IA 2KJGA 2PFDA 4O6YA 3DI5A 1JRAA 4BEMJ 4RD9A 4Z9HA 1LS4A 5L0HA 1Z23A 2EPNA 1YAUO 4CS9A 1RJ9A 1K05A 4MVMA 1WWPA 1NSGB 2L9JA 2Z15A 4U5EE 4ZLCA 1D1CA 1ZHXA 3NYJA 4U9EA 1GM5A 3CAXA 2J0WA 4P6IC 4C3BA 2Q4FA 1KNYA 2EPOA 3EG9B 4FWVA 4A4AA 2HV7A 2BE5F 3K1IA 3T6BA 3ZVRA 1LIHA 3FAJA 3VM6A 3DAGA 3S27A 2R7WA 3GM3A 3GM1A 2HSBA 1Z3IX 2YEVA 3GANA 1Y4CA 5BUOA 2PBEA 4CSAA 3LNMB 3RVZA 3K33A 3IPMO 3VAYA 2XXAB 1JPJA 3CQZA 2OU6A 2W9YA 3JSEO 3QW0A 1T6IA 1LE4A 3NMIA 2GDCA 2VCAA 3R2PA 3Q6NA 4K0DA 1VLTA 3GEHA 3V7OA 3NMKA 4FX5A 4CS9C 4I1MA 1A7VA 2L6GA 2MHRA 2Y3GA 4CS7A 4Q7CA 5A69A 2A1DD 3AG3C 2HMQA 2PX0A 4OIQF 4Q4ZF 2OEXA 4IAQA 4EBJA 3WHNA 3EGXA 2YL7A 4AK9A 2R7VA 2OKUA 4XLPF 5IY5C 1VLSA 1XZQA 5T1DB 4CS8C 2GFHA 4MVUA 4IGGA 1G4WR 1QKRA 1SF8A 1T6QA 4W8KA 4YT5A 3GWNA 5DQTA 4OIPF 2DYSC 4MW3A 1CGNA 5DS6A 3CZ6A 3PCVA 2PF4E 4JTAB 4LACB 4P9FA 4P9TA 1NU9C 3ABMC 3TD7A 2IXMA 3V5YA 1B68A 1WGWA 2J0XA 3W2WA 2FGYA 2IXPA 3JCUQ 3AQBA 4CIHA 5COMA 4EBBA 1YYJA 5FCLA 3JYYA 1GGQA 4MW8A 2ZXWC 1ZVZA 3MFNA 3TOMA 2GA0A 1E86A 1LE2A 4AL1A 4XPWA 4CDVA 3C8ZA 4CX9A 2RD9A 1NFOA 1OW7A 2VCCA 3UR3C 3B0UX 3ASNC 3RQFA 3M1CB 5L0GA 1MNEA 4IRUA 1Q0FA 1RKEA 4MVRA 3U2LA 2HJMA 1OCZC 3AGUA 2YVKA 3I4UA 3JT1A 2R25A 3KYJA 2J7PD 4BJ6C 2Y39A 3GODA 1Z6AA 5B1AC 3E70C 1DOWA 3ZSUA 1FAPB 1I4YA 2XS8A 2QE9A 4D4NA 3FVYA 1V55C 1TFKB 1NG1A 2OEVA 5EHHA 2Q3TA 3N0TA 2QTVA 5E33A 2OJQA 5L0IA 1KU2A 1BR2A 1D0XA 2Q9BA 4HFKB 4NC3A 4PJNA 3ZC4A 1V74B 3FOPA 3EHNA 3U0CA 4A2NB 1G5ZA 4U5GA 2LFFA 2XM4A 1NU7D 1S7ZA 1F1MA 2LD6A 2YZSA 3MBGA 2ZD9A 4N6HA 1QSPA 5HSWA 1ZYRF 3POVA 2H7BA 4GYTA 4U5HA 3UMIA 2R7SA 3DM9B 5KYWA 3C8GD 2YLIA 3L8IA 3LUTB 3HNKA 4PK4A 2PNOA 4U9DA 3B0VC 3ZG1A 2AWCA 1HE9A 2Y69C 3JYHA 4XLNF 4K1OA 5CIVA 2NUTA 4MVSA 5COFA 4D4XA 2G3KA 4J7YA 1YYXA 1ORYA 2IM8A 3T4RA 3W8HA 4DXWA 4G78A 2YL0A 3LJBA 2AU5A 4KBLA 4O79A 4PFOA 1U0BB 4H4KC 1D0ZA 2CCYA 4YL0A 2YL3A 2YRFA 3HNJA 1HMDA 1EKYA 4N6CA 4Q5SF 3B29A 1D1AA 5DLJA 1G4US 1AUEA 3U3FA 4BJTA 3KMIA 1GS9A 4NTAA 1ZU4A 1E84A 2R9RB 1CPQA 2R05A 4HE8D 2Y3HA 3RQEA 4I44A 4N06A 2J9WA 5JUAA 3Q7LA 3WG7C 3FOOA 2I15A 1NBBA 3I5PA 5DS4A 4MNDA 1M2VB 2XLMA 4DVYP 1D0YA 1RKCA 1RCPA 3NMJA 5BQGA 1VTMP 3ZWIA 2KC3A 2L7AA 3O39A 1YLMA 2M64A 1YZCA 1PCXA 1FTSA 2O9XA 4C3EA 3LESA 1SZIA 2FAPB 1LKXA 4U5FE 4DVZA 2XS1A 5A6BA 3UMHA 3SNHA 1EA8A 2XLOA 1FFTC 4DBRA 3NYLA 2XL4A 3O10A 3RKOF 4C7OA 2EINC 2QUPA 3SXYA 1OQCA 3EFOB 4IB4A 4QDLA 4Z9JA 3TK0A 4DOZA 5JLIA 2L81A 1Q0MA 2ZXRA 3HJCA 3SEOA 3WODF 5A6JA 2C04A 1M2OA 2CNWA 3L1MA 3S29A 3NRHA 2I8BA 4MTGA 3MYFA 5B1BC 2IOQA 2Q7RA 2V3CC 1OW8A 4E0IA 1OCCC 4CJOA 2EIMC 1H7IA 2CW0F 3QZCA 1ORSC 3S84A 1SYQA 4YT8A 1R5ID 2E87A 4G7HF 5T3WA 2HUJA 4CIPA 3ZDLA 3KL4A 5GPGB 3U8PA 1VOMA 1VYKA 2QNLA 3QTHA 3G4ZA 4BJ5A 4UDVA 2A6HF 4C7OB 3SXMA 3GWLA 1A7DA 1K40A 4NY3A 3EFOA 5T3TA
chains in the Genus database with same CATH topology
1EI7A 1RMVA 4UDVA 3PDMP 1VTMP 2TMVP 4GQHA 3J06A 1CGME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EI7 A;  1RMV A;  4UDV A;  3PDM P;  1VTM P;  2TMV P;  4GQH A;  3J06 A;  1CGM E; 
#chains in the Genus database with same CATH topology
 2Q9C A;  5BQI A;  3CEX A;  4DRH B;  1HW2 A;  3FAP B;  3S9O A;  1OKK D;  4MS2 A;  1HW1 A;  2R7O A;  4I1O B;  4EUK B;  3C63 A;  2KGO A;  3EGX B;  1LPE A;  2H8A A;  1OXK A;  5L0C A;  3HLZ A;  4ONS A;  2AP3 A;  5BQH A;  1VYI A;  2NUP A;  3SYN A;  3DJU B;  4O6N A;  3F46 A;  2AWY A;  1MMG A;  5D91 A;  1KTM A;  3HNI A;  1NLX A;  3A11 A;  5D92 A;  4XEV A;  3U8V A;  4F4B A;  1SR2 A;  1ORJ A;  4EIY A;  3AOU A;  1Q0G A;  4FES A;  2JX0 A;  5KYN A;  4XEF A;  2J8W A;  3DE8 A;  5KYX A;  4H54 A;  3X1O A;  3X2Q C;  2IXN A;  4Z9I A;  1FR0 A;  1YAR O;  2V26 A;  5F5F A;  2WZL A;  3C62 A;  3EPV A;  3UNG C;  4OIR F;  2FFH A;  4MVZ A;  3W8I A;  1TQG A;  2YLD A;  3QVZ A;  3NYM A;  4WGZ A;  1AVO B;  4JRZ A;  1BBH A;  1N1C A;  4K7B A;  5KYW B;  4CBE A;  2VB6 A;  2WZF A;  2G62 A;  3JSZ A;  3M4C A;  1CPR A;  4EBK A;  4YWQ A;  1V54 C;  1WAS A;  2CDQ A;  1YDI A;  2WZG A;  5JS5 A;  2HJ3 A;  4JTC B;  2QY9 A;  4E18 A;  2L6F A;  5E2Q A;  4E0H A;  3S90 A;  1LI5 A;  3ABL C;  1A7E A;  2VH3 A;  4BJ6 A;  1TWA A;  4C3D A;  3ZTZ A;  4LER A;  4ANJ A;  5AC5 A;  1C03 A;  1A0B A;  1Z7Q c;  256B A;  2ZPA A;  3V5Z A;  4JW1 A;  4AE4 B;  3ASO C;  3T6G B;  4U5B E;  2NPU A;  4WAB A;  1EQ1 A;  1YVI A;  3NG1 A;  4W8P A;  1ZW3 A;  4CJG A;  2HS5 A;  5B3I A;  3ITF A;  2D4U A;  1J8M F;  1OXB A;  4XTK A;  2F22 A;  1CGM E;  5L0J A;  1NZE A;  2YQY A;  1BR4 A;  4M63 A;  5KYY A;  1T01 A;  5A6A A;  2VCB A;  2YLG A;  3B71 A;  1XZP A;  2QLA A;  3KKB A;  3NKE A;  2XL6 A;  4XQ1 A;  5E3C A;  4E7Z A;  2ETS A;  2W45 A;  5AGF A;  2IBF A;  3DE9 A;  2EIJ C;  3M15 A;  5FZT A;  5AC4 A;  2J45 A;  1ZHY A;  3EG9 A;  1OR3 A;  2J46 A;  2J9V A;  1OKK A;  2A69 F;  3DMD A;  4J32 B;  3EZH A;  2R7T A;  2W4M A;  2JPU A;  1J8Y F;  4BJ1 A;  5DS5 A;  2XSE A;  3S0X A;  1LVK A;  2IYL D;  1FFH A;  2OG2 A;  2UUH A;  3DAF A;  3MLG A;  1QPU A;  1E85 A;  3DM5 A;  4R32 A;  2BL2 A;  2XLW A;  5EGY A;  4JKV A;  5DQZ A;  1M57 C;  1Z5Z A;  2D5R B;  4NTB A;  4XPX A;  2X0C A;  2LSE A;  2PX3 A;  2WL8 A;  3T9O A;  3U3B A;  2J9B A;  4O7G A;  1VB5 A;  2R03 A;  3E9V A;  3ZTM A;  3RF3 A;  4RDA A;  3PMR A;  3QW1 A;  2H7V C;  2P1A A;  3VRC A;  3UGO A;  3KYI A;  1LS1 A;  3TUL A;  2HMZ A;  3K6B A;  1C17 M;  1U6H A;  3O55 A;  3V5X A;  3DKA A;  3FHD A;  4OD5 A;  4YL1 A;  3BRJ A;  3A9C A;  4YL3 A;  4JEB A;  3CSK A;  2X51 A;  4CS8 A;  3SZR A;  1Q0D A;  1FMV A;  3AG2 C;  3HNL A;  3LEV A;  2XLE A;  4L6R A;  3S28 A;  4EWC A;  4LDK A;  3TQO A;  4YT2 A;  5L3V A;  2MWQ A;  3IEE A;  1T9K A;  4O6M A;  2HZ8 A;  3J06 A;  3F47 A;  3AJM A;  4FAP B;  4AL0 A;  5JVE A;  4MQ9 F;  1G8X A;  4JE9 A;  5COG A;  4E17 A;  3H65 A;  3L8J A;  2P6V A;  3FDQ A;  2XLV A;  4EHP A;  1OCO C;  2LIG A;  3AG1 C;  2R7R A;  5L0D A;  4NQF A;  3RFY A;  5CI9 A;  1C02 A;  1PD0 A;  4DRJ B;  1HE1 A;  1ZHZ A;  3US6 A;  2H7O A;  2A68 F;  1QQ3 A;  4XPY A;  4PJL A;  4CDY A;  3HKK A;  1JR8 A;  4CSA C;  1R4T A;  1WN0 A;  2RSE B;  1WOL A;  2WB7 A;  2P0N A;  3JRM O;  4LLE A;  2LQG A;  2CNW D;  5F28 E;  1LI7 A;  3RYL A;  2J9U A;  3IQC A;  2OCC C;  3OA1 A;  4JCZ A;  1RKE B;  4JTD B;  1MQV A;  5TJ5 E;  2OQM A;  4KNV A;  1TWC A;  4JCH A;  1QLE C;  3MX3 A;  4DRI B;  2XLH A;  3C18 A;  5KYX B;  1PV3 A;  3B9Q A;  3RW0 A;  3TJ6 A;  1E83 A;  2W4B A;  5KYU B;  4BPM A;  3AQC A;  2Q00 A;  1M6T A;  3M79 A;  3QVY A;  3DJN B;  2WVN A;  4G0H A;  1IZM A;  4MTF A;  1JOG A;  1OR2 A;  5K0I A;  3AG4 C;  3B0P A;  2EPL X;  1TWG A;  2J7P A;  2KSF A;  2R02 A;  2VAS A;  3U9M A;  4IAR A;  3LLK A;  3EGD B;  3H2V A;  1BDJ B;  2TMV P;  4JVS A;  4MVQ A;  3JZ0 A;  1S05 A;  2YWA A;  3ZQV A;  4LDR A;  1O5H A;  1YA9 A;  3L34 A;  3WAQ A;  2NUP B;  2G3V A;  4QI0 A;  1QZX A;  2CGE A;  3C8G B;  3W2V A;  3U9J A;  1Z63 A;  5JT4 A;  3IQ6 A;  4ULW A;  2DI3 A;  4JJF A;  2LCH A;  4OIN F;  5L0F A;  2ICW G;  1H9T A;  4LDQ A;  2OOC A;  2NUT B;  4KC9 A;  3Q7G A;  5KYU A;  4PR9 A;  4ER9 A;  2GWW A;  2KK1 A;  2AVK A;  3DD7 A;  3GEI A;  1Y6D A;  1BZ4 A;  3G4X A;  3RIP A;  1AEP A;  4E7S A;  3FXH A;  3ZQY A;  2NG1 A;  1TKN A;  3O6X A;  2R7U A;  3U2M A;  3W4Y A;  2XLD A;  1OW6 A;  1K04 A;  2OJE D;  1YJG A;  3BEH A;  4NCQ A;  4CDA A;  2XXA A;  1D1B A;  4DJ9 A;  1TFO B;  4X0R A;  5JSL A;  3K1H A;  3SXZ A;  2KNH A;  3UMK A;  1SMY F;  2R7Q A;  4AX2 A;  3N2Z B;  1CGO A;  4WJ0 A;  2VC9 A;  3OWT A;  3C8G A;  4RBN A;  4NTF A;  3N24 A;  4BG0 A;  2DYR C;  2L6H A;  2Q9A A;  3ABK C;  1TWH A;  2HFI A;  4JEA A;  1M2V A;  4GEH A;  1ZW2 A;  4JJG A;  1QVX A;  3NDB B;  1WAT A;  1PD1 A;  1OCR C;  3JRT A;  1APC A;  5JRA A;  3ECS A;  4J7T A;  1JMW A;  1MND A;  2KYH A;  5A6K A;  4U5D E;  4OD4 A;  5E3A A;  2MYS A;  4MVO A;  3GEE A;  1ST6 A;  4AE4 A;  2A6E F;  2ZXP A;  2Y3D A;  2YHS A;  3G50 A;  1IW7 F;  3ZIB A;  3LS0 A;  4J30 B;  4EKW A;  2IXO A;  1JAF A;  2M4E A;  2HV6 A;  3MYI A;  4JC7 A;  2R7X A;  1T5O A;  2JD3 A;  3HTK C;  4I3M A;  2LFD A;  3PHF 2;  4QI2 A;  5KYY B;  4IAO A;  2UUI A;  2A0U A;  3RH3 A;  1O87 A;  4BEJ A;  4BJ5 C;  1JPN A;  2P7V A;  4YJW A;  3PDM P;  3K7D A;  1I4Z A;  1MMD A;  4YT4 A;  3C7J A;  2ASR A;  5B3S C;  4G7Z F;  3UGP A;  3DXJ F;  1YZA A;  2B0J A;  1ZU5 A;  2EIK C;  5L3Q A;  2XM0 A;  3EH1 A;  4WGY A;  5EK0 A;  3FMS A;  3T6J A;  3GOR A;  2WVO A;  4PJJ A;  4PFP A;  3RQG A;  1UFB A;  3LAY A;  2XRH A;  3QMK A;  1ZHT A;  4YK5 A;  1H9G A;  1H6G A;  4JZA A;  4ULV A;  3SXK A;  1E2X A;  2HSQ A;  2NSG A;  3IQT A;  2C03 A;  2DGJ A;  1I5N A;  1ZHW A;  2KQ9 A;  2Y3B A;  1YA7 O;  2EIL C;  3IHU A;  3IQ5 A;  1UG7 A;  3K66 A;  3DZA A;  1MMA A;  3LEO A;  1A41 A;  3M4B A;  4KI2 A;  1NFN A;  2BC5 A;  4N4W A;  5CI8 A;  4XEK A;  2ZXO A;  3U5S A;  2LP4 A;  1M56 C;  4G7O F;  4U5C E;  3I5Q A;  5F5H A;  2XL8 A;  3H2U A;  3AGT A;  2YKZ A;  2KW3 C;  4PJM A;  3VYW A;  2A0B A;  3DWW A;  1WTY A;  2GAQ A;  1L3P A;  1DOV A;  1U89 A;  3EHM A;  1EI7 A;  1GQA A;  3LLI A;  3TOL A;  1Q0K A;  4PAC A;  2EPK X;  3NKD A;  1FMW A;  1ZZP A;  3LNR A;  5A6B D;  2LK4 A;  4HEA J;  1V4A A;  2P61 A;  3OEO A;  4HFF B;  1RXQ A;  1XWJ A;  2HKV A;  2NSF A;  3EH2 A;  4IWB A;  4YN0 B;  3VF0 A;  2WVQ A;  3EJN A;  1HMO A;  2DB4 A;  1LM3 B;  3ATP A;  3JTL O;  4JUR I;  3TJ5 A;  2CYD A;  4IJJ A;  1VMA A;  1RJ9 B;  4KNW A;  3Q6M A;  3KH2 A;  3EQL F;  1O3U A;  4GQH A;  1FNT c;  1HY5 A;  3K1I C;  3RVY A;  5JP7 A;  2EPM X;  1MMN A;  1W2W A;  4XWJ A;  3KPH A;  5DVW A;  4OIO F;  1VK5 A;  4LLC A;  5HV9 A;  2B0H A;  1TR2 A;  3EZI A;  1BR1 A;  3LS1 A;  4JIO A;  1T6U A;  1RMV A;  4DBQ A;  4B6I A;  3R7C A;  1L7C A;  2YL1 A;  3SP1 A;  4ZLD A;  4MTO A;  3EGD A;  2PP4 A;  3GM2 A;  3L0I A;  2KJG A;  2PFD A;  4O6Y A;  3DI5 A;  1JRA A;  4BEM J;  4RD9 A;  4Z9H A;  1LS4 A;  5L0H A;  1Z23 A;  2EPN A;  1YAU O;  4CS9 A;  1RJ9 A;  1K05 A;  4MVM A;  1WWP A;  1NSG B;  2L9J A;  2Z15 A;  4U5E E;  4ZLC A;  1D1C A;  1ZHX A;  3NYJ A;  4U9E A;  1GM5 A;  3CAX A;  2J0W A;  4P6I C;  4C3B A;  2Q4F A;  1KNY A;  2EPO A;  3EG9 B;  4FWV A;  4A4A A;  2HV7 A;  2BE5 F;  3K1I A;  3T6B A;  3ZVR A;  1LIH A;  3FAJ A;  3VM6 A;  3DAG A;  3S27 A;  2R7W A;  3GM3 A;  3GM1 A;  2HSB A;  1Z3I X;  2YEV A;  3GAN A;  1Y4C A;  5BUO A;  2PBE A;  4CSA A;  3LNM B;  3RVZ A;  3K33 A;  3IPM O;  3VAY A;  2XXA B;  1JPJ A;  3CQZ A;  2OU6 A;  2W9Y A;  3JSE O;  3QW0 A;  1T6I A;  1LE4 A;  3NMI A;  2GDC A;  2VCA A;  3R2P A;  3Q6N A;  4K0D A;  1VLT A;  3GEH A;  3V7O A;  3NMK A;  4FX5 A;  4CS9 C;  4I1M A;  1A7V A;  2L6G A;  2MHR A;  2Y3G A;  4CS7 A;  4Q7C A;  5A69 A;  2A1D D;  3AG3 C;  2HMQ A;  2PX0 A;  4OIQ F;  4Q4Z F;  2OEX A;  4IAQ A;  4EBJ A;  3WHN A;  3EGX A;  2YL7 A;  4AK9 A;  2R7V A;  2OKU A;  4XLP F;  5IY5 C;  1VLS A;  1XZQ A;  5T1D B;  4CS8 C;  2GFH A;  4MVU A;  4IGG A;  1G4W R;  1QKR A;  1SF8 A;  1T6Q A;  4W8K A;  4YT5 A;  3GWN A;  5DQT A;  4OIP F;  2DYS C;  4MW3 A;  1CGN A;  5DS6 A;  3CZ6 A;  3PCV A;  2PF4 E;  4JTA B;  4LAC B;  4P9F A;  4P9T A;  1NU9 C;  3ABM C;  3TD7 A;  2IXM A;  3V5Y A;  1B68 A;  1WGW A;  2J0X A;  3W2W A;  2FGY A;  2IXP A;  3JCU Q;  3AQB A;  4CIH A;  5COM A;  4EBB A;  1YYJ A;  5FCL A;  3JYY A;  1GGQ A;  4MW8 A;  2ZXW C;  1ZVZ A;  3MFN A;  3TOM A;  2GA0 A;  1E86 A;  1LE2 A;  4AL1 A;  4XPW A;  4CDV A;  3C8Z A;  4CX9 A;  2RD9 A;  1NFO A;  1OW7 A;  2VCC A;  3UR3 C;  3B0U X;  3ASN C;  3RQF A;  3M1C B;  5L0G A;  1MNE A;  4IRU A;  1Q0F A;  1RKE A;  4MVR A;  3U2L A;  2HJM A;  1OCZ C;  3AGU A;  2YVK A;  3I4U A;  3JT1 A;  2R25 A;  3KYJ A;  2J7P D;  4BJ6 C;  2Y39 A;  3GOD A;  1Z6A A;  5B1A C;  3E70 C;  1DOW A;  3ZSU A;  1FAP B;  1I4Y A;  2XS8 A;  2QE9 A;  4D4N A;  3FVY A;  1V55 C;  1TFK B;  1NG1 A;  2OEV A;  5EHH A;  2Q3T A;  3N0T A;  2QTV A;  5E33 A;  2OJQ A;  5L0I A;  1KU2 A;  1BR2 A;  1D0X A;  2Q9B A;  4HFK B;  4NC3 A;  4PJN A;  3ZC4 A;  1V74 B;  3FOP A;  3EHN A;  3U0C A;  4A2N B;  1G5Z A;  4U5G A;  2LFF A;  2XM4 A;  1NU7 D;  1S7Z A;  1F1M A;  2LD6 A;  2YZS A;  3MBG A;  2ZD9 A;  4N6H A;  1QSP A;  5HSW A;  1ZYR F;  3POV A;  2H7B A;  4GYT A;  4U5H A;  3UMI A;  2R7S A;  3DM9 B;  5KYW A;  3C8G D;  2YLI A;  3L8I A;  3LUT B;  3HNK A;  4PK4 A;  2PNO A;  4U9D A;  3B0V C;  3ZG1 A;  2AWC A;  1HE9 A;  2Y69 C;  3JYH A;  4XLN F;  4K1O A;  5CIV A;  2NUT A;  4MVS A;  5COF A;  4D4X A;  2G3K A;  4J7Y A;  1YYX A;  1ORY A;  2IM8 A;  3T4R A;  3W8H A;  4DXW A;  4G78 A;  2YL0 A;  3LJB A;  2AU5 A;  4KBL A;  4O79 A;  4PFO A;  1U0B B;  4H4K C;  1D0Z A;  2CCY A;  4YL0 A;  2YL3 A;  2YRF A;  3HNJ A;  1HMD A;  1EKY A;  4N6C A;  4Q5S F;  3B29 A;  1D1A A;  5DLJ A;  1G4U S;  1AUE A;  3U3F A;  4BJT A;  3KMI A;  1GS9 A;  4NTA A;  1ZU4 A;  1E84 A;  2R9R B;  1CPQ A;  2R05 A;  4HE8 D;  2Y3H A;  3RQE A;  4I44 A;  4N06 A;  2J9W A;  5JUA A;  3Q7L A;  3WG7 C;  3FOO A;  2I15 A;  1NBB A;  3I5P A;  5DS4 A;  4MND A;  1M2V B;  2XLM A;  4DVY P;  1D0Y A;  1RKC A;  1RCP A;  3NMJ A;  5BQG A;  1VTM P;  3ZWI A;  2KC3 A;  2L7A A;  3O39 A;  1YLM A;  2M64 A;  1YZC A;  1PCX A;  1FTS A;  2O9X A;  4C3E A;  3LES A;  1SZI A;  2FAP B;  1LKX A;  4U5F E;  4DVZ A;  2XS1 A;  5A6B A;  3UMH A;  3SNH A;  1EA8 A;  2XLO A;  1FFT C;  4DBR A;  3NYL A;  2XL4 A;  3O10 A;  3RKO F;  4C7O A;  2EIN C;  2QUP A;  3SXY A;  1OQC A;  3EFO B;  4IB4 A;  4QDL A;  4Z9J A;  3TK0 A;  4DOZ A;  5JLI A;  2L81 A;  1Q0M A;  2ZXR A;  3HJC A;  3SEO A;  3WOD F;  5A6J A;  2C04 A;  1M2O A;  2CNW A;  3L1M A;  3S29 A;  3NRH A;  2I8B A;  4MTG A;  3MYF A;  5B1B C;  2IOQ A;  2Q7R A;  2V3C C;  1OW8 A;  4E0I A;  1OCC C;  4CJO A;  2EIM C;  1H7I A;  2CW0 F;  3QZC A;  1ORS C;  3S84 A;  1SYQ A;  4YT8 A;  1R5I D;  2E87 A;  4G7H F;  5T3W A;  2HUJ A;  4CIP A;  3ZDL A;  3KL4 A;  5GPG B;  3U8P A;  1VOM A;  1VYK A;  2QNL A;  3QTH A;  3G4Z A;  4BJ5 A;  4UDV A;  2A6H F;  4C7O B;  3SXM A;  3GWL A;  1A7D A;  1K40 A;  4NY3 A;  3EFO A;  5T3T A; 
#chains in the Genus database with same CATH homology
 1EI7 A;  1RMV A;  4UDV A;  3PDM P;  1VTM P;  2TMV P;  4GQH A;  3J06 A;  1CGM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...