1CGSH

Local and transmitted conformational changes on complexation of an anti-sweetener fab
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
214
structure length
214
Chain Sequence
RVQLLESGAELMKPGASVQISCKATGYTFSEYWIEWVKERPGHGLEWIGEILPGSGRTNYREKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCTRGYSSMDYWGQGTSVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Local and transmitted conformational changes on complexation of an anti-sweetener Fab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2B-KAPPA NC6.8 FAB (LIGHT CHAIN)
total genus 26
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1993-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgsH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgsH02
1W72A 5F6HI 4JPVL 1ZGLM 4PY8I 4JO3L 2F74A 3LDBB 3PL6B 4NIKB 3MNZB 1RUKL 2OTUB 1Q9OB 1T0MA 4JFEB 2F53A 2IC2A 2AJ3B 4KUZL 5FYJD 1KLUB 4DUXA 3HRPA 3D69B 2OTWA 1YQVL 1KNOA 3IDIB 3ZTNL 3RGVC 1WJ3A 2HKFH 4IRSA 4NO5B 3RHWF 4K71C 5EZLB 3T8XB 5C7XL 3T08A 2YEZB 4H25B 5DGRA 4LFHD 1M05A 1IM9D 3O2DH 1SJHA 3KLAA 3QP3A 4BFBD 2P5EE 3MJ8B 2H32B 4LLMB 5IVZA 4TVPL 2Z92B 4XMKL 1I8IA 1ZA6B 3MV8A 3SE4A 2XZQH 1U8MB 3DRTB 2W1NA 2XQBL 5GGQL 1BJ8A 2DB8A 5JHDD 1A6ZA 2AJUL 3BUYA 1MCSA 1MCEA 1AP2B 3MTRA 1BM3H 1GOFA 3MQIA 4L9LC 3DIFA 3CPLB 4Y4KB 1MCWW 1F4WL 2IQ9H 2Q7YA 3DV6A 4OGXH 4UUJA 2HH0L 3WFDH 2BVEA 1A64A 2KUTA 4G42A 1A4KB 1U92B 5DFVD 4EI5D 5ESQB 4POYA 3MXWH 4UT7L 5E7BA 1LEGA 2FZ3A 2HLAA 4DKDC 2R2EB 1HKLH 3BHBB 2Z8WC 3TO4D 1DQQA 5F9JB 2D7OA 2WANA 2IAMB 3RUGB 3IDXL 4MGXA 4HS6A 3I6GB 1NKRA 5KW9L 4LEXL 2A9MH 2J8UB 3MV7B 4CNIA 3HRZB 5DEGB 3ROOA 1WEJL 2JJSC 2B2XL 1NCBL 5H37G 2Z93B 3MLTA 2IALA 4HIJB 4N0YH 3RY6C 5L0QB 1YECH 3D85D 5F70A 1NCWL 2X4QA 1N59B 2NY0D 4PLJC 5GHWL 5BQ7A 2IWGA 4FQHA 4MD0A 4JM2A 2BMKA 4M62L 5F7HA 1YY9C 2XWTA 5DD5L 3NCYP 4U6HB 2RFXA 4WUUB 3VFVA 2YC1A 3X14A 3WN5A 1A3RL 5C0DA 1X5ZA 1A6TB 2NY2B 3A6CL 1TQBC 3RWEB 3W2DL 4H25A 5JW3H 4G6JL 5KVGH 3HPJA 4HDIA 4CL7A 5CHNA 2OTWB 4RFEA 4RGNB 3MRGA 1I7ZA 3V2AR 4LHUA 4LDLB 2I9TB 5IB4A 4PRDB 3VWKC 5FM4A 1I3GH 1A7RL 1FBIL 2AV1A 3EW3B 3OKLB 3K4ZA 5D1XD 3BGAA 1WBZA 2BP3A 4YC2C 4WTXA 4XP4H 2X9XA 1FV1B 4NC2B 4NQED 1FO0H 5T1KA 3K3QA 4FQ1L 3SJVB 4EUPA 3B2UC 3JWOH 2HVJA 4TN9A 5GXBB 3GMLA 3U30B 3SGDI 5D7LA 1RZ8A 1QBAA 3K1DA 4HWUA 4J8RA 2NY3B 4RIRB 4GXUM 2XXCB 1V7NH 3PWPA 2H9GA 5IBUB 3V4VH 3CVIL 2VABB 4LOUC 5FUZL 3U4BH 1PDKA 2VITA 3V4UH 4P4KB 4PD4K 5IG7A 4GG6A 1FFQA 3KPMB 4ZXBA 1D5IH 1M1SA 1Z9LA 2D7TH 2ICWI 5E8NA 4F8QA 3MUY1 1N3NA 5ACZB 3U9PL 3ARDA 5JIKA 4E5XA 2IMNA 3MRPB 5C6TL 1KN2H 2JELH 4HCRH 3SQOH 4KGLA 3UBXA 3KPOB 5BVPH 3GBNH 3ARGD 5KSAD 2OQJB 5F96L 4JPKL 5F9AC 3MLYH 4AG4L 2DI9A 4DFIA 4NO2A 3ZDXF 3ZHLA 4TRPH 3BDXA 5IB3A 2UY6A 3LH2L 4P5TA 4EI6A 5I1DA 2CKBH 3NFPB 2NY2D 5C0JA 4AM0B 3U36B 2QHRH 5TGBA 4FQLH 3V5DB 4JR9L 4DAGL 1UM4L 3IDJB 1VB9A 1S5IL 3OXSA 3S4SB 2NNAA 3L5JA 4L9LB 3T2OA 2XRAL 1OPGH 1UENA 3UTSD 2P7TA 4YFLF 3EDDA 3QFJE 3M8OH 3LQZB 4U0QB 1AQKH 4KC3B 2GY5A 2DMKA 5FYJU 4GW1B 5B39B 3SY0A 5DVLA 3UTTD 5CBAA 1QNZL 3UTTA 1TJIH 1TCMA 2Q76A 1MLBB 3PV6A 3RZWA 2E9IA 2SEBB 1KCSL 2PXYB 1CD1A 3HE6D 2GTWA 2E6PA 5F9DC 3L5IA 5SX5H 1TVHA 3S7GA 1A3LL 3S96A 4KTEL 4N90E 4N9OB 4MQ7A 4FA8A 1G7IA 4HHAA 2NY6B 4JQIH 1C5BL 7FABL 3LAFA 1IZKA 3RKDC 1RZJL 3H42L 2VH5H 4I8DA 1VFUA 3M1BB 1PKQA 4UIMB 5D8JH 3BGFB 4GAJL 5BV7B 1FLRL 4KROC 4ONHA 4RAVB 5HY9A 3VFTA 4BA8A 2FB4L 1TZHB 1GL4B 2X89D 1QLEL 1WIUA 5I6XB 1M7IB 3ECBA 2E7MA 4FQCH 4ONFH 2DD8H 3UTPD 1S3KH 4AENA 4ZXBB 1RUAH 5E8OA 3VMOA 3ULUD 1RZFH 5C0CE 4IOIA 4M1GH 4MNQE 3FFDA 5SWSA 2H2SC 5EC1B 2GSGA 1AGFA 4PGCA 32C2B 2C7UA 3CH1A 4HGMA 5E95B 3W81A 4M6ML 4K7FB 2CUHA 3UDWA 1HZHL 4OZHB 4DZ8B 1NJ9A 3BPCA 4S1RH 1CI5A 4GLRH 3D3VA 1XIWB 1EFQA 3ZDXE 2C4XA 2DQIL 3PDOB 3QA3A 4TSBH 2H41A 4XMKH 3S97C 5AUMA 4HUWA 2PW2A 3OPZL 1IM3A 3S5LA 3TT3L 4R0LB 3I3DA 3KXFA 4OBRA 2IPUK 1I3VA 4HH9B 5C08E 4JQIL 4OUUB 3U30C 1NGXA 5DUMH 4K7PY 1FE8L 5HVFB 3L7FB 4G6AD 2AABH 4KKAD 5DXWA 3O9WC 4R2GC 5EG6C 3RWHA 2Y5TB 4NQEA 5D8JL 1CGSL 2IG2L 1TVDA 1KFAL 1YMMB 2FB4H 5F93C 1N4XH 1E4KC 3S35H 2RB8A 3S3JA 5EU6B 3GSRB 1JWSA 5B8CB 3K2UL 2I5YH 3IS1X 2DQFB 4R4BB 5DHVH 2G2RA 5IHUH 1JK8A 2E27H 4I2XA 5TE6H 1JE6A 3MLRH 4F9PC 5C0IB 4JB9H 1RZKC 3ZYOA 5K9QG 4U6YB 2JF1A 2A9ML 4NQUA 1XAUA 2B5IC 3MODH 1FNSH 1JGEB 3P3YA 3QQNA 1PD6A 3GRWL 4PJIE 4BFIA 5DZNA 5DJ6A 2VDOH 4MDJB 3HR5B 1U8NB 3QIBA 3MRBB 4JVPA 1E4XI 5MEQA 3AB0B 4H0GA 3V5HB 1P7HL 1Z5LB 1X5KA 1SY6H 1I1AB 5EU7C 2V7NB 4LSSH 3P77A 4XH2B 2CK0H 3G04A 3TNMA 3QDHA 3C8DA 2A6JB 3IU3B 5C0EA 2C3WA 2RHEA 5DJ2B 4APQC 4E41B 1PVHA 3MGTA 1XGTA 3Q1SH 1ZS8A 4G6JH 1EEYA 1KFAH 3GIZL 4ZFOA 2OK0H 4HC1A 2Y7QB 3QNZA 1HHIA 1YN6A 5F7UA 5DF0A 5HHXH 3CFIC 4ZUUB 3BRDA 3VFOB 1CTOA 1J05B 2HRPL 4HAFA 1MFDH 4JDVA 4O9HH 2ZUTA 1MREH 4QF1B 3F7VB 2FEDC 3WEXA 4LVHC 1LNUB 3RIFF 3BQUC 2P1YA 3QUYB 5FYKH 2XACC 2NW3A 5I1GH 4UT6H 2FEEL 3SDAD 1D6EB 5I1AA 5T3XL 1ZLWK 2PYFA 3D25B 3MO1B 1E27B 4I9WD 4MSWB 4KKBC 4BFEA 3UO1H 1OLLA 2ZCKL 2UYLB 3GSOA 2X70A 3HCVA 4XNYL 5C0AD 5HHMD 4M7LL 1HILB 3MV8D 1S9YB 5BS0A 1HOCA 2GJ6B 4LCCB 4D8PB 4XPHH 1UJTA 1V7NL 3I6LD 4M4RA 4QGTA 2DL2A 5ANMB 1KENH 3X3GL 3L1OH 2WNGA 3MSPA 3UJTL 1I8MB 35C8H 1CDUA 4XP6L 5GGSB 5DJCA 1HWGB 3B6SA 4WI5A 3TCLB 4MHHI 3RWIB 4P2CG 1VPOH 4KI5C 3S8WA 1BGXH 5CS7A 4JG1H 1AO7A 2W91A 1GRWA 5EUOA 1NCNA 5FF6B 1UJ3C 3NFSH 5E2UL 1U3HB 2E9WA 4IS6B 3I6KA 5A2IH 5A2LH 5HGBA 1XGTB 1I1RA 2R4SH 5IK3A 1MJUL 2VLJB 4Z7WE 4L1HA 4L5FL 4N8CL 5D7IB 5HHMB 5GQBA 5HGHB 5C7XH 3SO5A 1OAYH 3FT4B 4BZ1L 3B9EA 3KWWB 4H8WH 5INCA 2AJSL 4KMLB 2B20A 1CR9L 4Q6IB 4JR9H 4DAGH 1CT8A 4QOKB 5HI3C 4TULH 3PXJA 5IBLC 1BJ1H 3BH8B 4ZD3H 2IQAA 5HXMA 1D6EA 5J6GB 4OZIF 2VDMH 4WEUD 3QPQD 4WEMB 2L7UA 4R0LC 3RX5A 4WUKH 3QI9C 3LQAL 5IMMB 3MBXL 1FN4B 4NFBA 4Y1AE 3QEGL 1LO5B 4DK6A 4JZOB 1CDIA 1W8OA 2OJZL 2ESVD 3OKMB 5KVMC 4PY7A 5F88B 5T1LB 1H5BB 4HQQH 1C12B 3EDKA 2B2XH 5L2JA 5FYLL 3IFOB 4Z7VF 4FMKA 5F7KC 5JTWA 3QUMB 1C5CH 5AD0B 2GCYA 1S7VA 3CFJA 3V79C 4U49A 3FOMB 1DANT 3MV9E 3JVGA 2AQ3A 2O5ZL 4JFOB 5F9OL 5JPNB 1IC7L 4PGDA 3DHJA 1KEGL 4I18C 4UDTA 4MA3A 2VL5A 2DD8L 4MX7B 2BNQB 1ZT1A 4QY8B 2AXGA 2HLFD 3QHTC 1DQJA 5KSUB 3NFPA 1QFHA 4LCYA 5TGBB 3V5DA 3OXSB 2F58L 3DARA 4YZFF 1OAZL 3LQAH 5BOZG 3I2CL 1MJ7H 3QYCA 4HFWA 1CD9B 4U6VH 1ZA3A 3RWFA 5GS0D 5H94B 4P2OD 4KDWA 1YMMD 4P46A 3LKPA 3QIUB 3RVWC 2ICWJ 3VXMA 3F12A 4RGND 2P44B 4DVBA 1J0JA 1JZ5A 4H20H 4LIQH 3WS6A 3G5VA 1INDL 5C0RH 5K9JL 3NPSB 1ETZA 4PTTA 2HWZL 2M2DA 3IDYC 4X98A 5CSGA 1J0IA 1JHTA 2JIXD 3ZTJG 4O51A 2N7BA 4IIQC 5EN2A 1FC2D 1VFAA 4D3CH 2IADA 3GJFA 4BK4A 4U1JA 3VXRD 1Q38A 2WBKA 5CBEB 1N4XL 4UBDC 1DSFL 4DGYH 2FZ3B 2HLAB 3QDGB 1F6AA 3HS0B 3B9KC 4ZS6C 3A67H 2DBLL 1ZHBB 3VXSD 5F44A 4PRPA 4G7VL 1UM6L 5D1XC 3DVFA 2BNQE 1XGUB 2GK2A 1MAKA 4LNVA 4X6EA 3N85H 3MLTB 3ARBB 2EZ0D 2ADIA 2QL1A 3CFJB 3MODL 3BPOC 1OAZH 4LU5H 5B8CC 2ICCA 3LKSA 2VDNH 5IJVB 2VXSH 3BO8A 4NZRH 1G1CA 2J8UF 5T1LA 1T4KA 3QEUA 2C1PA 1JHKH 4HKJB 4PJGA 3PNWB 5E0QA 4OIAA 1G9NH 5ITBL 3MMEB 4NQEE 1T03L 5HD8D 1CFVH 2MWCA 3JV6B 1I3GL 3L5WB 1AD0B 5GS1A 2R29H 5DD0L 3EYOB 4YHLH 2ATPA 4ODHH 2EO9A 1FNHA 4WI8A 5CHNB 3QB7C 4YPGB 5J13C 1HXMA 1EMTL 5FDWB 4LPXA 3MUGA 4HXAL 1RD6A 5SV3A 1T1YB 1A7OL 3D48R 3QUZB 2EKJA 4KRPD 1QO3B 3QDJE 5BO1L 5FYKU 3RWJA 3L7FA 2ED7A 1PY9A 2O5YL 5AEAA 4XPBL 4AQ1B 5FYKE 1GZPA 1Q94A 4POZC 5GJTL 2X4OA 1FL3A 3PQYB 5ADOH 1DVFA 1GGCL 4QOKE 1P2CA 3SDXF 5ESAA 1L6ZA 1EPFA 1JWSB 3AY4A 4KUCD 2JB5L 4R4FH 4HT1H 2M1KA 3IDIA 5ALBL 4BJLA 3T3MF 2A83B 4XBPB 2CRMA 5AZEH 1CG9A 1NFDF 4PJHA 2BDNH 3B8SA 1A3LH 1HHKA 1U8JA 2D31A 4N0UB 4TOYH 1IL1B 1VSCA 3BD3A 3R4DA 1NBZB 4QTIH 4H26B 3FO0H 2EIBA 1L9MA 4HKZA 3OAZH 4QHUB 1ZHNB 4BZYA 3VXRA 3HR5A 1MAML 3C08L 1AY1L 4WI7A 5EBMA 4R26L 4JM4H 5K9OA 1VCAA 4NDMB 1AH1A 3NGBC 3HZKA 2DAVA 1T7YA 4DW2H 4Y4HC 1VESA 1HYRC 1ZSDB 2DQUH 2PF6A 2XTJC 4G6KH 4PUBH 4R3SB 5D7JC 2BNRE 1AP2A 3HI6H 1MRDH 1R3IL 1T22A 3C9NA 1V7ML 4OZFA 1G9EA 5DQDL 2DWDA 3UBXB 4YDLB 2A73B 4NZDA 2ATPB 3CLEL 3SDXB 2V5RA 4K7PL 2OR8A 2WV3A 2GJ6E 4M00A 3H9SB 4I1NB 1N26A 2BNQD 1A6AA 1EEZA 1E28A 5L6YH 5FKAB 1RZ7L 3ARED 5IBTL 2BERA 4QEGA 3H7BB 5F7YC 5E00A 2RCSL 2V9TA 3ULUE 1KPVB 1FJ1A 4NWUL 2W60A 3FOLA 2FJFB 1XMWA 3LS4H 4JGUA 4H8WL 1NCDL 2VRAA 2IALB 4WFGE 3CH8A 5D7KE 2JCCF 5BZDB 1J5OL 4MLIA 3DUSA 3S34L 4I0PB 1ZOXA 4QTIL 1BZ9A 5IFHH 2V2TB 1LD9A 5B39A 2K9UA 4NN5B 2ESVB 3L3JA 3PGDA 3B9KB 5IW1B 4P3CL 1JMZA 4JFQA 4ISVB 1OAXH 4JM2D 32C2A 3UTPE 2BJMH 3JWDH 2QTEA 4AEIH 1K4DA 2X4OB 3B2VH 3V4PH 1LO0H 2DMBA 3S35L 4NNPL 2G5BA 4KY1L 4MQXC 5MERB 1U8PB 1KCVH 1J7VR 1M7DA 2FBJL 2XG5A 4OF3A 4UV7L 4NM4L 2NZ9D 1RZFL 5DTFB 2OJZH 1JUFA 1Y6MR 2OLDA 1JZ4A 4PJEF 5EOCL 3RVTC 3P9WB 5KW9H 4H1LG 3CFEA 4HQQL 1FVDB 2RCSH 5D93B 4F7MB 2DQHL 3LRSB 1HKFA 5D1QB 4G6AC 3RDTC 4YXLH 2NY0B 3U46B 4CDGC 4LSRL 3MYJB 1KXQE 1FFNB 3MZTA 3Q6GL 3BP4B 3PWUA 1KLGA 3C5ZD 1SY6L 1CXEA 4QRSB 1ZTXL 1TDQA 4L29B 5I18H 3IDUA 3SKJL 2RR3A 3ZE1E 3BSZH 1T89A 3HMXH 1QKZH 4I5BB 4MD4A 4ALAL 4YHOL 2DWDB 4P9ML 3O8XC 3BE1L 1TMCB 3MRFA 2PR4H 5KANI 3RKDD 1MI5D 2FYYA 5C8JA 1VGEL 1U8KA 1A6WL 3TBYB 4K8RC 1V05A 2H6PA 3GEWB 3GIVA 3OKDA 3RNKB 5HD8C 4GAYA 4LIQE 1GHFH 1FG9C 4AY0A 4Y4KD 1XFPA 3H3KA 1WZ1L 3QHFL 4NQDE 1NGXB 3FN0H 1TTFA 2R0KH 4UT9L 5FYJH 5I1EL 5IW1A 3MRHB 2JJUA 3V9FA 3QUZC 3DV6B 5FGBC 3REVB 1FBIH 4OD2A 3RY6A 2C26A 5DD1L 3K0WA 5F72S 4P46D 2DQHH 3TC9A 1A4KA 4D0CA 2V5YA 3BUYB 1IEBA 1ZEAL 5I19H 1YDPB 2ZJSL 3LEYL 4O4YL 5BV7H 4WY7L 1NMCB 5FA3A 3WN5C 1S5HB 1T7XA 4U1NB 4WFFD 4U1HA 2NXZD 4L8BA 4JZJA 1IGTA 4IEFB 4NT6B 3T2NL 3QUML 2X44D 4OCRL 3WDHA 4FRWA 1EGJL 3QCVH 2VISB 3H9SE 3QQ9D 3U46A 2LE9A 3CIQA 3GUTA 4WFHD 3SDXE 1RIVL 2CLRA 1J1PH 3O6FA 3PL6D 5GIRA 5GRJL 1NBVL 2YA2A 1EXUB 1F6LL 4GG8B 1UXWB 3MRLB 3BGFC 1NANH 3BP6A 3HCVB 2X70B 1X4ZA 5DJYA 3W0WE 1CS6A 2R0KL 5CINL 5E9DB 2L7JA 4Y89A 2R56L 4HJJH 3FO2B 4WHYG 4JHBA 3VU2A 1XGPA 1UB6A 2BZDA 3G5YB 4GXUN 4F8TA 4X6CF 4ZFOB 2O93L 3ULSB 1X44A 4LMQE 4XXCA 1KCKA 3BQUD 4EZMA 5T3XH 5I76A 3IVKA 5C0FB 1PQZA 5BV7L 1IAIL 4DJMA 3PWVB 4QYOA 2FATL 5DURB 2Q86B 4XNYH 1J1XL 1F90H 1CK0H 3L95A 4LOUD 4LLQB 4H0IA 4OD2B 4BUGA 3Q3GB 3CX5J 3QDAA 4NWTL 1KELH 3C09B 2BOCA 3V8OA 2ILLA 3PQYE 5DEZA 3BKYH 3SGJC 1OTUC 3I3EA 1RIVH 3N06B 5EU6D 4QTHA 4GW5B 3WBDA 4ELMA 2VL4A 5AYUH 3T65B 5JQHC 3QDJB 5EZJB 2YEZA 4JANA 3H6JA 1Z3GL 1T7VA 3L6FB 5D72H 1CXHA 1OW0C 3FL7A 5DVMA 1JPST 4DVRH 1NBYA 4Y19B 1PKQE 3L7EB 1P1ZA 4S0SD 5J12B 5I8CB 1U8MA 3DRTA 1QOKA 1VHPA 4XC3H 3D0LB 4GJTB 4DN4L 1MAMH 3C08H 3LN9A 3BMWA 1F3JA 3WFCL 2Z31D 4J3UA 4BZ1H 1IGTB 1YEFL 3GSVA 3V6ZA 2X4SA 3RWHB 2B5IB 5EZOH 3LN4B 1J1XH 1F90L 3G5ZB 5D6CA 2CLZA 5HYQB 3QWOA 2O5ZH 4DK3A 3K8MA 4JY5L 2C3HA 3RI5F 1J12A 1EHXA 4KU1A 4Y4HD 4PJBF 4LVOB 1FORH 2XXMB 1ZANH 3OKMA 4Y2DD 5IP4A 3TVMD 1WBXA 3O41A 5GGTL 3MV7A 4CNIB 2F58H 5E2VL 4WWKD 4QYOB 3ROOB 2FBOJ 3LOWA 2X4RB 2J6EH 4OCYL 2YPLB 1BIIB 4ZPTA 5LGJB 1KJMB 3CFDA 3NIGF 3SJVE 5H37H 3PWPE 5GGUB 3X3FL 5KG9A 1HSAB 4KKAC 1FRGL 3PQYA 4R97C 4XHQA 4XB8A 4JFZH 5DFVC 5ESAB 5BRZE 1B0WA 3IDJA 3TZVB 4I77L 4M5YL 2GSIA 4G8EB 4MJID 2JB6B 2WLYA 1YNLL 4XCFH 4U1SA 3JZ7A 4DN4H 4PRHE 4Y4KA 3PP4H 3EJYC 1K6QH 1FE8H 3JTSB 4NSKB 4LKCB 3VFWA 2ED9A 2ICWB 2OL3H 4RGNE 1MQKH 2IBZY 3HPJB 1CGWA 5TF1H 1H8OA 1UWXK 3BKML 1RFDL 3GSNH 4EKXA 5JXEA 4HG4J 4KY1H 2CO6B 1EBAA 2FECI 5EU7E 4HKXB 1J11A 4PLNC 3PXHA 3MACL 2YBRA 1JZ6A 1KPRB 1MFNA 2ADFL 3I9GL 3EDJA 5IQ7L 2WZPD 3DI3B 3FQTB 4YFEA 2ZSWA 4XVUD 3ZT7A 4XBGA 4G9FA 2J6EL 3MPCA 4OCYH 4KJQD 5BW7C 3O81A 4I4WB 1T5XA 4L4TA 3MV9B 3X3FH 1FRGH 2EDTA 5E5MB 4G43B 4MJIB 2WQ8A 4LKXB 1NGWA 3SGKA 3GMLB 3MV7E 2GSGB 1KN2L 4WHDA 5C6TH 4MVBD 1RY7B 4N8PA 5KSAB 2EDBA 3ARGB 4HEPG 2AKRB 2Y07L 1NEUA 4AYFA 2UV3A 4FQJL 5D5MA 4JRXD 1J9CT 1QBMH 4ODHL 3H9ZA 2WSKA 3MLYL 4ZFGL 4QRTA 2W65B 4QHLB 1RU9L 3LS5L 5I1KH 4Y5YA 1CLOH 1YEEL 4XBEH 3RGVA 1A6WH 2Y6SC 4NFDA 4OJFH 2VLMD 4C57C 5IR1B 3KYKH 3LB6C 2NMSA 4X9FA 3C5JB 5E08L 1WFOA 3ARYA 3OKKA 1UM6H 4EN3A 3QEQD 5FYJL 2HT2D 5I75B 1MFDL 1BQUA 2BC4B 2NY3D 3QG7L 4QWWD 2HP4A 3HE6A 4PRIA 3TPUB 2I9LA 4UOW1 5DD1H 1XR9A 1S7RA 4GRWF 1IGCH 2X9YA 4G8EA 5D70L 2D0FA 5ACLA 3T0ED 4JO4L 4CVUA 3FAWA 1JGUH 2Y06L 4OCNC 2CR3A 1Q0XH 3BDBA 3R06A 4NNXA 4ZOBA 5IMOA 4Y4FC 1LVEA 1QR1A 4TSAL 3PWPD 3UPCA 5DMJB 1ZT7A 4CU6A 2EDDA 4I9WE 1C16A 4YO0B 5CJOL 3FFCD 5D7IE 4APQA 5DQJB 1IEHA 1DE4A 2VXUH 3VW3L 2R29L 4UQ3A 5TE7H 1CBVH 1P4BL 4TUKH 2PXYC 2PKDA 3UJTH 3WS3B 1BBDH 5E2WL 5CEXB 4ERSH 5ICZB 2YD1A 3WL9B 1IEAA 1TJGH 4HIIB 2LVEA 2GT9A 4D9RE 2SEBA 1BD2B 1A7OH 2VMFA 3MJ7A 3ULVL 5KSAA 3BISA 1S7WB 1TJHH 3CX2A 4XMPH 5AAMA 5IJKC 2P5WE 3TNMB 5C71A 3QZWG 5IBUG 1U8JB 4OZGB 1QBLH 4MJ5A 1HIML 5FUOH 5C09A 4MNHA 1TETL 3OKDB 4Y5XC 4DN3L 1DLHB 3UBXI 5FGCE 4NJAH 3ESUF 3O3DA 3QFDA 4ODUB 4KUCF 4X6BA 1AI1H 1EEQA 3CNKA 4LHUD 3BVNA 5CGYC 4JO4H 1IAKB 1YNKL 4XPFH 4BSVA 3NABH 1H5BA 3QH3A 2HTKC 3GRWA 1X4XA 3UPRB 5IM7B 1FL5A 3RFZC 2V5TA 3VRJB 1M7IA 4TSBL 4NUJB 1X5HA 2R1YA 3QI9D 3QUYA 3FO0L 3PWLB 3JWDC 4F3FA 3TO4B 1OD7A 2YN3A 4MXQD 1P4BH 1NLBL 4PGDB 1U6AH 1R6VA 4OV5B 2UZYB 3KG5A 2APXA 1MCIA 4ZTPL 5ICYB 4PJHB 2WAHA 2GUOA 3TYFB 2ID5A 4G6KL 2AXFA 1T83C 1BQLL 5DJDA 4LEOB 1G9MC 2VLLB 4PJDB 1W72L 4PS4H 5CSZA 4DZBA 5TH2A 1IQDB 3RL2B 3GMPA 3TJEL 1XH3A 3O3BA 5TDPA 3TA3B 1DANU 3KXFB 3TCLA 4LCUA 5EOCH 4S11A 3SDCA 3V6BR 2D7NA 4U1GC 5E6IB 3CSYA 3T3PF 4NWUH 3G6JA 5D1ZD 4PP2A 5KSBA 1U3HA 2KKQA 4RBPK 3DO3A 4WTZA 4H5SA 1IJ9A 4FQQA 5E8OB 2Y23A 1QR4A 3KPSE 5EBGA 2MQCA 4JKLA 4GKZA 1QSED 2XZQL 1R3HB 5HHVL 3NCYS 3F58L 2VN4A 4ALAH 5L2KB 1SJHB 4S1QL 4TNWF 2LU3A 3MJ8A 1XF5A 5JDSA 3LRSA 5DRWB 3ZYZA 5D1QA 2E9JA 2XN9E 1P7QB 4FQ2H 1JF5A 3WO3B 4OGXL 4AQOA 3GI8H 4JZNB 4F15B 1E4XL 4NNPH 4KZDH 5HYJD 5E5RB 3TVMC 5HHXL 4CADB 5DC0A 1YMME 1VFOA 2NR6D 4OZFH 4YUEL 2Z92A 1CL7L 2AVGA 4PJ7B 4U3HA 3UJJH 5FEBA 1BAFL 2JTDA 3O2WH 3EO9L 4L3EE 5CJQL 4HCRA 3EYVA 2YOCA 1FGVH 3G5XA 4PGBA 4UB0H 3MMEA 1WWBX 4JANB 8CGTA 4NHUB 1QSFB 5CP3A 1S7UB 3DOSA 1EHAA 1IT9L 3H9YA 5DHVB 1I7RA 3KPSB 4O5LH 3UZEA 3U6RB 2PUQT 4OLUH 2D2OA 5DMIL 3LEYH 3PGCB 1HE7A 1EEYB 4UZGA 2DLTA 5IEHA 2ORBL 5IB3B 4XX1E 4G9DA 4PJ9A 1EX0A 2GTZB 4RDQF 6FABL 1BD2D 5F3HB 1YJDH 2DQEL 3W2DH 4NQDD 5D6CB 5DJ6B 3MLWL 2Z8RA 3P73A 5CILL 3IFOA 5KVGL 5FCUH 5C0GA 1L7IH 4AH2B 1DVFB 3GM8A 2YD3A 1J1OH 4X80L 2VDLH 4F7EB 1RUQL 3WHE0 1PW3A 5L2KE 3LMJH 5ISZD 3RWGB 3GGWA 1OTUD 2Q87A 1TFHA 5I8OH 1ZVYA 3MO1A 3FFCB 1UM5H 4LCCC 2BHYA 5ISZB 5I1IH 3UXFA 4HC1L 4TUOA 4FQHB 2J12B 4AZ8A 3F5WA 5GRWA 1OGAD 1I9JL 3EO9H 4L3AA 1FGNH 2DQTH 3C2SA 2XN9A 3DUUA 1S9KC 4HWBH 3HE7C 2VSCA 8FABA 3C60A 3FRUA 1SMAA 4B41A 2YUVA 5DD0H 4ZDHB 3VD3A 1P7QA 4MQ7B 5DVKA 3V5KB 5KBNC 3QJHA 4F80A 3GUTB 2EEDA 3O6FD 4LLWA 2R8SH 3HUJE 3HZKB 1VERA 2PO6A 2JB6A 4HFWB 1UQSB 3MOAH 3SCMC 5DMYA 4B0MM 4Z7NE 1ED3B 4KZEL 3SKNB 5HTSA 1PX3A 1WBZB 1AO7B 2CXGA 2VERN 3WEXB 1I9IH 1CICB 2BXZA 3C9NB 4FG6D 4L4TE 2OI9B 4ETQB 2AEQL 3H7LA 3BWAB 1R5IA 3BKYL 4PJHE 4QGYA 4HFUL 3MLSL 1ZHBA 5I73C 2JB5H 3FFDB 1JPTH 1AGFB 3F8UB 1NAKL 4PGCB 2DLFL 2R0WL 2F8XC 1QUNA 4IRJD 4U1JB 5D72L 1DL7H 1JGVH 1KPRA 2PNDA 3U6RA 3PP3H 2UWEF 1BWWA 4MDIA 4K71B 4DKFH 3EYQC 2VAAA 4N0CD 1AQDB 3SGJA 4HWZB 3F7YB 2CMRH 4L8SB 1WC7A 3VFNB 2FX7H 4YHYC 5I1HL 3OKNA 3KJ4B 4PB9H 3BKJH 4KRPC 2HKHH 4X8XA 1T1WA 1I8LA 1MRFH 4ENED 5IMMA 5GS3A 4KZEH 4OZGE 2NX5B 4MB4A 4I48B 1F97A 2HRLA 5C0GB 1Q9WB 4Y5YB 3GGWB 1MCKA 1FDLH 2HTKD 1DQQB 5F9JA 3RBGA 4CMMA 3GBML 5HGAA 3DYPA 2H1PL 2CIKA 3MJ9L 3WXVL 5F1NA 4Z7VB 2FRGP 3WIFB 1A1MB 3DO7A 2XZCH 3DBXB 3OJVC 4N8VG 1UZ6E 2EE9A 4GFTB 3QFJA 2OXGA 3QBTB 4YHML 4OSUL 4HS6B 4PBXA 4X6DA 4KJQC 1OM3L 4DVRL 1HYSD 3S4SA 4GKNA 3BWAA 5IW3A 4K7PX 5JOPD 4IMLB 3CGTA 1S9XA 1H3PL 4XAWH 2Q7YB 2BNUA 3SCMA 3GMNA 3IJSB 1VEMA 4PB9L 3SKMA 3BQUA 4PIRF 4MJIE 5A3IC 1LO5A 1QSVA 3G6AA 4UTAL 4Y16C 3JWDL 4AEIL 2A83A 4XBPA 3T0WA 2FYYB 1DSFH 1QLEH 3BZ4B 4U7SA 1Q1JH 4KVNH 5IOPB 3RDTD 4AIZA 4C4KO 1LHZA 1LO4L 1IVLA 2IH3B 2VZ3A 4HWEH 4YHKH 2NY5L 1NMAH 3VXTB 4R3SA 4U1SB 1I7UB 5GGTH 1IGIH 4X5LA 2Z31B 1J88A 4A6YH 5BZWB 1GGBH 3ECBB 2AK4D 4O51B 1A2YB 4M1CC 4U0RC 5GRUL 4XCEA 1S7SB 1AXIB 1LE5B 2ARJA 3MBEA 1A6AB 4L1DA 2YWZA 4JRWA 1FZKB 5ITBH 3ES6B 4HK3J 1AR2A 3CC5B 1P5VA 1X5FA 3LB6D 2VQ1A 1MIML 1F11A 4KK6D 4X4XA 1HINL 4OB5L 1NJ9B 1QFUH 3ZYJA 4OI8A 1QKZL 2PETA 2YWYA 4GW4B 1OL0A 5E6ZA 4CRPA 3BW9B 1IGJA 2NLJA 5IJVA 3PWPB 5IESL 2C3VB 4DTGL 4PRDA 4ZO6A 5BO1H 4ORZC 1JHLL 2VDKH 3N1MC 4ONGH 2OL3B 3DECA 1UZ6F 3QA3B 4I3GA 4OV5A 4I0PA 4RFOH 1MUJB 3LD8C 4K07A 5CJQH 3QG7H 5KSBE 3UBXG 1WLHA 2H2PD 3ARWA 4NUGL 5DJYB 4NQCE 1T21A 4DGVL 5KJRL 1D5BB 1LK2B 4HLJA 4LVNC 4PJCF 4I3SH 2ZOKB 3FQUB 2Q8BL 3B4NA 4S1DC 2VWEC 2ERJC 5DMIH 4F2MA 4YDKH 1Q9LB 5T1LD 5JLZA 1NFKA 3RU8L 4JN2B 1TCRB 1INEL 3BD4A 5F7LB 3U7WL 5EO9A 5ICXA 4ODVH 2GIYA 3GMNB 2P8MA 1SYVB 2XOTA 1F4AA 2UUDH 3KLAB 1FYTA 2W9EL 4NCC2 1MCCA 4Q6IA 2C1OA 1ZGLP 4Z7QE 5JHLH 5HI5C 3T8XA 4MCZB 5C1MB 2G75A 1T2XA 4PJ9D 5ACMA 2HT3D 4JFEE 2AGJL 1KGCD 2F15A 1BOYA 1FVDA 4ZAKA 1BBDL 5E2WH 5HHOD 4F7MA 1PFCA 4WFHE 4WU5B 1NBQA 3MROB 3EJJX 5I8EB 2FGZA 4RMTA 3O8XA 2DWEA 1V7MH 4GW5A 4HBCL 4JRYD 4ELMB 3ZE0E 1AXTH 1OCWL 2QADC 2R23B 5FOBB 1Y0LB 2PN5A 4P57A 4IRZL 5D5MB 3MR9B 4K7PH 5DK2A 1IL1A 5HVGB 3NACL 3LEXA 5TPWL 1F4XL 1MLBA 3PV6B 3QIWC 3C6LD 5BV7C 5KJRH 1LO3L 2Y9RT 4QXGH 4H0HB 2VIRB 4EDXA 2A6JA 1AR1D 3VXMD 4LVOC 3QUZA 2J8UA 1GVIA 4ZFFA 4NQSA 4WNQB 3LKQA 1IILE 5IF0B 3ROLA 3UO1L 4LRIC 2XNAB 3HI5H 5T33H 4NBZB 1Q94B 5F1IA 1DQDH 3L9RB 3U0TB 3OR6B 1N6VA 5EUKA 1FNFA 1FL3B 3VDBA 4JFFA 1BMGA 2W9EH 4ZUVA 4LASH 3L3KA 3L3GA 5E9DE 1DBAL 1OAXL 3EFFA 3QCUH 2X4QB 1IRAY 5AZ2L 1FH5L 1FYTE 2CK2A 4IRJB 4XVSH 3V4PL 4G6MH 4QRPE 3QUXB 1NAKH 1D5BA 2IPUG 2A6KA 1G7IB 3C5ZB 1Z2KA 1NDGA 3OZ9H 4MAUL 4GQPH 3VXNB 3IDNB 4LSDA 3RWFB 2EXWD 5GGRY 3EBAA 5I1JL 5IROC 4IRSC 5C92A 3CMOL 1G7JA 1Q0YH 1HH6B 3AMLA 2GT9B 4NKIH 4N8CH 5L9DL 4Z5RA 1IKNA 1GGUA 4S2SA 3MRJA 4NBXB 3ZLQC 1XF2A 4GAJH 1GPOL 1WAAE 3B6SB 2AXFB 3BX7C 1GCFA 1S7XB 4V1DD 3FO2A 1SJXA 2HFEB 5DLMH 4Y2DA 1M71B 3MRIA 3DROB 2P24B 3P4NA 5B39G 2HTLC 5MERA 3TWCL 3L3IA 5C2UB 4ODWA 4F58L 5DJ0A 2DIAA 1NLBH 1IC4H 4S1QH 3RQ3A 4J7RA 4K8RL 4KRMB 3D39E 3SKNA 3CJJA 3U1SL 5IM7A 5FK9A 1ONQB 1U3HC 3U0WL 2A74B 1SBBA 3RIAF 3TBSA 1FFNA 1DVFD 2MHAB 4S1RL 5C0IA 3QDJD 2EYTB 1N7MH 4WENB 4XCNB 3P0YL 1DQLH 2YPKB 3R0MA 5JUEH 1JP5A 3BH9B 1N3NB 4HIXH 5ACZA 1FG2A 1U8NA 4XNZB 3LDBC 2XPGB 5ID0A 3L5WA 2IH1A 5F7EH 1YMMA 4M1DL 2KZ1B 4GRWB 5I19L 4HUXA 3W5MA 4M43H 4PLJD 1JV5A 5CFHA 3VXPA 3FRPA 1R3JB 4QRTB 4WI3A 2F54D 3UTQB 3TO2A 3X12A 3L3GB 3V7MA 1YYMH 1WZMA 4GT7A 4LFHG 5FUCC 2Z4QA 4CVXA 3H3PL 3IU3A 4M62H 5C0EB 2YHGA 4PGZA 1IC7H 5KVDH 4AMKL 1U8IB 3ZKSD 3UX9B 3V0VA 5GZOC 4PJHF 2E27L 3G5XB 4PGBB 5EO1A 4TTDC 1OP5K 3IB4A 3SE4C 3BFOA 2P7TB 3FOMA 4XI5C 5FB8B 1OT1A 1G6RA 1CTNA 1P2CB 1JRHL 4P2YA 1NBVH 4N5ED 2D0GA 2GCYB 3RJDA 4QNPE 1K2DA 2X4SB 1L0QA 3NIFF 2A1WL 4WGWB 3QWOB 1IMHC 4LQFL 5CJ8A 2I07B 4X9IA 1FVCB 3CXHJ 2FX9H 1RZKH 3MCKA 3ILPB 3KJ6H 4H8WC 1KYOJ 2KZWA 1CLYL 4GRWE 4FQJH 4BYHA 1GJIA 3Q2CA 2NTFB 1D9KA 4OKVB 5DEFB 1F4HA 1VEOA 4UAOB 4JJHA 4FFVC 5HHOA 3FCTB 1YNTA 3I75A 2XTJE 4N0CC 1CLOL 3CFKA 4XCNA 5T3ZD 2K7QA 4LCCA 4P2OC 1A6VL 3WJLA 2OMBA 5MI0B 1J05A 1NMBH 5B3NA 3HN3A 5JA9A 3PUCA 4XWGL 2DBLH 4IRJC 3DETC 4QXUH 3IJSA 1MFBH 2GSIB 3WDIA 1IAOB 1XZ0B 3KPRD 3DVIA 4POUB 3WHXB 5C0BB 2VUYA 4LU5L 5IOPA 4IRSB 3VWKB 5CLTA 5D7IA 4L4TD 3RY5A 3NPSC 1MCDA 3WO4B 4DFHA 1XGUA 3P4OB 3PWVA 2WWKT 2GTZA 4TSAH 3MRDB 5ABDE 1INEH 3KPTA 4L4VB 2VLJA 5ALCH 3H0TA 3IDMA 2ZUVA 3SQOL 4XVTH 4Q9RH 4RA0C 1ZT4B 2FH6A 4LCWA 2ARJB 5SX4I 2YBRB 1ZXQA 3T1FB 4PJXF 4HULB 2P5WA 4FQPA 5I1HH 2DYPB 5EU3B 5I30H 4LKXA 4NO3B 5KVEH 3L3JB 1UH2A 4X7SH 2R69H 4X7FC 1EO7A 2IANB 3CPLA 2CGRH 4BQCA 1DEEB 2W0LA 2EH8L 1VPOL 4PREA 4NBYB 1S9WB 3M07A 3VG9C 1CYGA 2C4FU 4E5XB 2Z91B 1H3UA 1NBYB 1ZANL 2Y5EA 4HPYH 5BS0D 2DKUA 1FDLL 4FFWD 1P1ZB 1DFBL 2DS4A 5D71H 3RI5K 3MOBL 4XPAL 4LLWB 3S37X 4NHCH 3WIHH 3MNVA 3RKPA 4CU7A 2AK4A 1AI1L 4HWNA 4OZIE 1R3KB 2D4DA 4U6YA 2KQMA 3P0VH 4HEME 4G7YH 4I18B 1KJ2L 2IFFH 4MNQA 2DQFA 4R4BA 1U58B 3Q3GA 3DVGB 3G6JB 4ODXA 3GSNA 1YC7A 4OZ4A 2EC9T 1HEZB 5K9KB 3WNOA 1UXSA 2VL5B 2IPKA 5D2NE 3BAEL 1JGDB 4JCLA 4JQXC 3PWJA 1KPUB 1WQVT 1BFSA 4MCYA 4X7SL 4Z7VA 2A9NL 5TE4L 5CWSA 3C2AH 2BFVL 4OQ1A 3AU1A 4NJ9H 1N0LA 2PYEA 2CR6A 4W6XB 4G6ML 5D5ME 5ETUB 1CXLA 1OT2A 2NY2C 1DLFL 1F02I 3P77B 1GAFL 1B0RB 3IDYB 5KVFL 4PY7B 3D0LA 1FZOA 4FNLL 4YHKL 5IB2A 5HDOA 4G8FB 3DX8A 3WSQL 4YEFA 1G7MB 4YQXH 5I8EA 5L6YL 4UQ3B 4RFNB 3IDXH 3NN8B 3H9SD 3WXVH 5IMKB 1D5ZB 2MCG1 5EPMA 4ZYKB 4BH8B 1F58H 4URTB 4HBQA 4G80B 3R1GH 1S7UA 2NY5C 5DJXB 4FQXC 5D1XB 4JPWL 4FZEH 4WCYH 5FV1L 3QDMA 4Q9CA 2Q8AL 4AEEA 2XWJA 2JCCE 4NO3A 3MFFA 2AERT 4MNGE 3GI9L 4FP8L 4YC2B 1A0QL 5GS0H 3BAEH 2IF7A 1RHFA 4CN6A 3WNPA 4U1HB 1QP1A 3EYQD 5T5FL 3ROLB 2ZPKH 4LCIH 1S9WA 3GK8H 3HAEH 5E8DL 4X6BB 4EQ2A 4N5UA 4UIKL 5DMKA 3W0WA 3HC4H 1MCPL 1B88A 4OZHA 1J8HB 2Z8VC 4DTGH 1XCTB 5T3ZL 5D6DA 1Q1JL 4KVNL 5E08H 2MNUA 4QNPF 4F9PA 2ITDB 5KVFH 5FA4A 2RIKA 2H2SD 2AJYL 5B3JF 5IKCA 4J1UA 3GHEH 5IB5B 1WAAA 1U3ZA 4GRMA 3NCMA 3ULUC 4DGVH 4LEOA 2BSED 1LEIB 1H0DB 4PLKD 1BHGA 4M3JA 2E7LA 5JNYB 4ZS7H 5SWZB 5DC9B 3MUGB 2GJZB 2R39A 1FAIH 1MWAH 3O3AB 4ZUWA 2IMMA 5GSVB 3SO3B 3KPPA 3W9DA 5CSZB 3X13B 4L4VD 2HFTA 3KAAA 4WDIB 3O2VH 2H32A 4LLMA 5IVZB 1FNLA 3K46A 5TDNB 4FZ8L 1B90A 1ZHLB 5BJTA 1T1YA 1JZ2A 4M8VA 2D0HA 3QXDA 2BK8A 1IBGL 1H3TA 3KLSA 3AVEA 3ZYIA 4S1SH 3MLWH 1CFNB 3C8HA 3PG2A 2LABA 4U1LA 2DL9A 3V4UL 3IGAA 3PGFL 3K4DA 3F65A 5JW4R 1AD9B 1EJ6A 4GRWH 4GLRI 1U36A 2APVA 5C0AB 4J12A 1LK3L 4Y1AD 1KB5A 5TFSH 4XI5D 1QBLL 4IDJL 5BXFB 1XF4B 1HIMH 3ARBD 1DBML 43CAA 3NACH 1FGNL 2HFFA 1A8JH 4HHAB 1QSZA 2YD6A 3KYOB 4RA3A 1ZHNA 4ESKA 1IGJB 4KJYB 5CD5D 4JO2H 1P7KA 4YDIH 2D31B 4N0UA 4KI5D 3QULB 2FDBP 3OG4B 3BEWB 1J0HA 3KPNA 4RMVA 3O8XB 5GGVH 3IJHB 4C56D 5CLWA 1SMOA 4ZNEE 4XWGH 1INQB 5MENA 4LLYA 4UAOC 3MV01 5IVXE 1EH9A 1A1NB 1WK0A 1YYLH 3G6JE 4IOIB 2WINA 5EC2A 1MSPA 5IMOB 5EC1A 2EIZA 2CRYA 1I7RB 3KPSA 4OZIB 1IGFL 4Z95H 2EC9U 3DETD 1Q9KA 1VFBB 3RY4A 3ZDZF 1KPVA 2J4WH 5DDHA 5GRJH 4LAJH 1E27A 3BIAX 4APQB 1K5NA 4OLWH 1NGZB 1MJJB 3MZGB 3CU7A 5DYOB 5D2NC 1GOGA 1YPZF 2GK0A 3V52L 2FJFA 4PJ5D 4XXDA 2IANE 5CGYD 2AJXL 3VMNA 1CD8A 3WLWD 4FTVD 4DQOL 5DURD 1S7WA 2E3VA 2R69L 4KXZH 3IAPA 1U9KA 1K4DB 1ZHLA 3EJZD 5BJTB 4HUKB 3BQUB 3MLUL 4FQXA 2DN7A 3I02A 3B5GA 4OT1L 4TQEL 3SPVB 4O02H 1Z6JT 1FYTD 4TULL 3QFDB 3TNNB 2A0LC 4NWTH 4HPYL 2BSRA 1RUAL 4JRXE 5HI3D 1NFIA 3MRRA 4TVPE 2V9QA 4JM2F 4XPAH 4OLZH 2NXYB 3ARUA 5IMLA 3NAAH 5MENE 4GBXB 4Z5RB 2Z0BA 3IJHA 3E3QE 3DVNA 3HS0A 2EH7H 2VLME 3ILQD 1BECA 1L0YA 5C08A 1D5MA 2WUCH 3QIBB 1F2XK 2IFFL 5HDBF 5BMFH 4HJ0D 4ZG1A 1S7SA 5JUEL 1M4KA 1FL6B 1I4FA 2VXVL 1WCBB 4G43A 3FT3A 2FH8A 3HUJB 2BVOA 1HQ4B 4Z7OE 3ZDYF 5I15L 2HJLA 3QZWA 1RMFL 2B0SH 5DUML 5FYLH 3SE9L 1XCQA 3T4YB 1RSFA 5D2LE 1NCAH 1J0KA 1JPSL 3W0WD 2A9NH 1V8HA 2FO4A 5HPMA 2VKWA 1EV2E 4X0KB 5D96B 5EZOL 4LVNB 2DQCH 3RGVB 1LO0L 3JV6A 1K8DB 4G6FD 4JPVH 4PTUA 3I50H 4OZIA 4ZUUA 5JW5A 4YX2H 2J3SA 4OF8A 5A2FA 3EO0A 1N8ZB 2DJ4A 2XKNB 4NNYB 5T5NG 3HFMH 4FQXD 1T3FA 4M9OA 5EIIA 7CGTA 1AGBA 5DI8A 3MBED 4XNXL 4E9LA 1ODAA 3H8NA 3ZTNH 4M5ZH 2BVPA 4P46C 1IEBB 4G9FD 1QLFB 1WT5C 4XP9H 5DT1H 1LK2A 5D2NA 1KYOK 3N1FC 4I3RL 5I8OL 5KAQG 3GJFH 2OR9L 4UV4H 5EOQL 5EH1A 5JMRA 4MA8H 2WUBL 3O41B 4JFDE 4JHZA 4P23A 3O45A 3HZVB 3DPBA 4GMSH 5LKNA 1FZMB 5HYSA 1MCRA 4FQXB 1I1CA 3QXVA 1QFUL 4WEBH 2VC2L 4P9MH 5J89A 3HNSL 4OFIA 1JPSH 2ATKB 4X4ME 4Y7MA 4LAQL 4U1IA 5GGSA 1UXSB 5FYJE 5C2BL 1JGDA 5L8LB 4PJ7E 2HH0H 2I27N 3MROA 2BNRD 2FLBT 5DR5L 1KB5H 1CE1H 5ANMA 1L7TL 2PTUA 2XPGA 4FFZH 3VFWB 3F5WB 3HUJF 1J8HD 2W9LA 1XT5A 2XN9B 2AEQH 5E2JA 4N5EC 4ZODA 3VE0B 1IAIM 3SCMB 2NZIA 3FHAA 3DGGB 1MCOH 1H15B 2MFNA 4WWKA 1A9EB 4LPVA 5FGBA 2P46B 2UZIL 4CJ1A 4GRLA 2V2XA 3OHXB 2WBJC 1KC5H 3RU8H 1G7HB 1RJLA 4ZFFB 1CZ8L 4ORGA 1D5ZA 4POZD 1CQKA 1YEDB 1CFVL 2J8OA 4NGHH 4CW1B 2BVUA 4GXVH 5GJSL 4RGNC 4OZHE 4Z0BH 3IFNL 3GMOB 2V2TA 3AM8A 1HNGA 3JTTB 1RV6X 5BRZD 2QHLA 4K2UH 2ZSWB 1HHJB 4ZUSB 4XB7A 4X5XA 1H3XA 4G8GA 3RAJL 1LE5A 2BOCB 2BVQA 1EFXB 2N7AA 5DR5H 5ADPL 1A6UL 2R9HD 1ADQA 4M4PA 4B50A 3STBA 3CC5A 3N0PB 3T0XA 5GJTH 5T3XE 4LGPB 4X4XB 1F4XH 5F6IB 1A7RH 1AFVL 3IDNA 3IVKB 2EDLA 3CFKB 3HZMB 3JWNC 3E2HB 4PV8B 3N1PC 3VFMB 2BY3A 5CKGA 5L2JB 1NGPH 3VFNA 4OD1H 1Q0XL 3DLQR 4XZUA 3EO1A 1FO0L 1KG0A 4PG9B 1JGEA 1G0XA 4KPHH 4CVZB 4Z7UA 4ZTOH 1IAOA 4OF5A 4I2XB 2YXFA 4G8IB 2BY1A 1CK0L 3LV3B 4EN3B 3GHBL 5F7FA 5GJSH 4P3WA 1L0XA 4Y4HA 1XF1A 1A14H 1ZT1B 4QY8A 1TVBA 1U91A 3MUZ1 1YEGL 1BF2A 3CXHK 3O0RL 5KANG 4NN7C 4NYLB 1UFUA 5FGCB 5ENWB 4PJ8B 2HT3C 5AWNH 2ADJA 2J5LC 2A38A 3QFJB 1OB1B 1TJHL 4MDIB 1DLFH 5D7SH 3WE6A 3QT2A 5DQDH 1HN1A 5J4MA 4BSJA 4ZFZB 4OFVA 3JTTA 4PJCB 1KJMA 1A3QA 4FFYL 4QHUA 2Y1VA 5GGUA 4IMKA 4WI9A 2DWEB 2WP3O 2H6PB 4NHCL 3WIHL 4N8VA 4R97B 4YGVB 3WFCH 2V5SA 4OD1L 3D5OF 3KS0J 4YDVB 4JQVA 1TQCB 1YEJL 2DQJH 1KCUH 1LGVA 3NGBB 4YIQA 5CEZH 3PJSB 4KTDH 4NSKA 1P7KB 2FJGB 5ITFA 5IFHL 2Z31C 5E1HB 3TYGL 2CIKB 2XRAH 2W38A 4NKDA 1P4IH 4LRIA 1BBJB 1B4RA 1FIEA 5HVHC 1E28B 1TTGA 5J11C 2NY6D 3UYPA 4YNYA 4JZJB 2PYFB 3L9RA 5EPMB 2BJML 4LLAA 4MSWA 4ZYKA 1QRNB 5EOCJ 1XF3B 1NPUA 5GGSY 1BQLH 1QEWB 3LKQB 4AEHL 1MJ7L 2H9GB 1QFWM 3JUZA 3VFMA 5H2BA 4NKOB 3KYNA 3U4AA 1I7TA 1RI8A 3BYYA 5C6WH 1KACB 4NM4H 5CCKL 4YH6A 3VGAB 1IM9B 4Z77A 1IGYA 5IIEB 4LGRB 1AC0A 4QXWA 4ISVA 4HMCA 1IQDA 3RL2A 3CK0H 4H88H 5JORA 1UB6B 3G5YA 4MZ3A 4TTGA 3FONB 5F7DB 2DM4A 5DJDB 3WNMA 4GSDL 1RFDH 3U0PB 4J4PA 1T89C 4ODVL 3RZCB 5DFWH 2X9WA 3A67L 3SKUD 1MIEL 4HUMB 2FD6H 1WZKA 2J8UE 3O4LE 5F8RC 1QFWL 4RAUB 4KV5E 4NCC1 4OBSA 3RUGF 5EFIB 1KN4L 1CICA 5C0FA 4Z78B 3SGEH 4BK5A 4M5ZL 4LRNL 4QT5B 4OCSL 4F7TB 1CCZA 5E70A 1X7QA 1AKJD 3U2SA 4YWGH 2IJ0C 3WYRA 2FL5A 5I17A 2ADGB 3QNYA 1Z9SA 3W82A 4PRAB 3PHOB 5DJ0B 2C1OB 2B7DT 4HGKC 4NZTH 3QDJA 4KMTL 5D2LF 5E8EB 3CK0L 3GO1H 3S96B 4N90D 3VA6A 5IR1A 3F7YA 2C3VA 3LHPH 4OLVL 1BBJA 1ONQA 3X11B 1MVUB 1TPXB 2BVOB 3LQMA 2A74A 5C0CA 4GSDH 1ZWIA 3WFEL 5IJKA 2ORBH 1J10A 4BQ6A 1ZLVH 2V2WB 5BRZB 5FAAA 5MEOA 1WWWX 2P5ED 1CE1L 2FD6L 2IGFL 1WICA 4LSVL 4OLYH 1I75A 3TN0A 4O2CA 4J2XA 2VJXA 3UTSA 1FYHB 3FQXA 3V4VL 4KK9C 2XYCA 4MNHB 4UMGA 3D3VE 3QCVL 3VJ6A 4CUCA 4GQ9H 3FMGL 3GMQA 3QUMA 4G9DB 5AD0A 3U9UA 5CD5C 1C16B 4L8CA 4HT1L 2CLZB 5HYQA 3PGCA 4YPJA 1YEHL 4NNYA 1RK1A 3OZ9L 4MAUH 4HC1H 1KTDB 1CFTB 3JV4A 4MAYC 4CVXB 3FB7B 1LILA 1OP3H 3QIWD 4HZLB 2R56H 4KKCD 1JPFB 2NX5E 5FHAH 1VGKB 3F7QA 5A16B 2AJZB 1JYVA 1CWVA 2V7HB 3IYLW 3CCHA 3ZE2F 4HDIB 4U7MA 2B39A 4PRHD 3D9AL 3RTQB 4DCQB 5GS2H 4RFEB 3SDDD 4KI5F 4TUOB 1MPAH 5LQBL 1J8KA 1NDMA 3LKPB 3VFPA 2EDNA 3H2WA 3WFEH 3LN5A 4Y19E 5FM8A 5J3HD 3L3HA 2OP4H 5E8PA 5C09B 1OGTB 4OZGF 1GH7A 4FXKA 3WUZA 1DDHA 4X9GA 1U8PA 2OJEA 3WS6C 5I0DA 4PJIA 3QUXD 2K7PA 1U93B 5BVJB 3IKKA 1K3ZA 5EIQA 1PSKL 2DLGA 1U8LA 2P45B 4X7TA 5E1AA 3ULVE 3QH3B 2HFGL 2OBGA 4PGEB 1OD9A 5KSBF 3CFEB 1R5VB 4LHJB 4X7EC 4LDOB 5IF0A 3D69A 5HGHA 4P3DA 2XNAA 2IEPA 4WO4A 3U0WH 1HXYB 1W0VA 3KWWA 5IK3B 4WW2B 5E94B 4ETQA 1OAKH 3P0YH 4L4TB 1PEWA 1LQSR 4FFWC 3DROA 1RZIB 2AI0L 2R0ZH 4U1GB 3VA2C 1CGXA 5JHDB 3KPRB 2V2XB 2IBBA 3MV8B 2BHZA 5JPMB 4KRLB 3BZEA 1E4KA 1YN7A 4OQTA 4NC1C 3RGVD 1U0QA 4GS7C 2VLLA 3KPLA 2BFVH 3GIVB 2DLHA 3QJFB 5EA0H 2O26U 4LPCA 4GAYB 1F4WH 1LO2H 2IQ9L 1T2JA 3W0WB 1N64L 3M45A 3RGHA 5FDWA 5MEND 4JHWH 2ZSVA 3MRFB 4M6AA 5JDSB 3T0DA 2E6QA 5ISZE 4PJEB 5EBLB 1HNFA 3EJYD 4P9HC 5B22A 4PV9A 6CGTA 3RVXD 3EIFA 2D03H 2E7HA 1IKFH 4Q6IC 2QQQA 1SJEA 5DQ9B 3RA7L 3DX7B 5F8QC 2AJVH 4KJPD 4TYUA 1FO0A 5DT1L 3VGFA 2I9LB 2YN5A 5E03A 3FTGB 3SBWA 1DN2A 3F7VA 4J6RL 5FYLD 3QQ4A 1AGCA 3HZMA 3EOAA 1MH5B 2AI0H 2R0ZL 3MCLH 2E8ZA 2Z91A 1RUML 4G9FE 4GW1A 3GKZA 3OF6D 2DIJA 2EDEA 3C8KA 1DVFC 3QCTL 5JPNA 5GGQH 4DWHA 1I1AD 1HXYA 1W0VB 4M7KL 5LWYL 1P4LA 3BP7B 1OOAA 2AJUH 3S36L 2MPAH 4LCYB 4M9PA 1G0YR 5K9OB 2WW8A 3NOIA 1MF2H 2VLRE 1N64H 3TIDA 1GHFL 4OV6F 4Z9KB 1WVZA 2HJFA 4L3EB 3WDJA 4OFPA 4JFFD 1JNLL 2XZAL 3E6HB 2W0FB 2NY5H 4JLRB 1G84A 2V17L 1ZV5A 2XKUA 4KI1A 2B4CH 1ETZB 3C60B 3FRUB 1DQMH 4D0DB 4MXVE 2FO4B 4DVBB 4LEXH 1JTPA 2OYPA 4LKCA 4OGZA 3FZUC 5I6XC 1OP5H 1T22B 4OZFB 1A4JB 3CDGA 1OHQA 5IGXH 1T7ZA 4LLDA 3TFKD 2WP3T 3IT8D 2A6DA 2JK5A 4X9HA 1EDQA 1NCWH 3VMPA 3H9SA 5C6PB 3T4AA 3IF1A 6FABH 3WCYA 3D1MC 3O2VL 4M3KB 4BSVB 1A1NA 1PKOA 3L95B 5D2LB 5DUPL 1V3LA 4HXBL 4XBEL 1T20B 4CGTA 3INUH 1HI6A 5T1KD 5CD3A 2YMXL 3RAJH 1BZ7A 3I2CH 2DLIA 2QQKH 4K8RD 5EU5A 1SYSA 1WISA 4NQVA 3S3PA 1EERB 4HKJA 1MCBA 4PJGB 5JXEC 2MQ0A 1R3LB 3RUGA 2XZAH 4EI5A 4PJDA 5IVNA 4ZXBD 1ZT4A 4H20L 4LIQL 1AGEA 3N9GH 1XCTA 4JFYA 2EKSB 1IGCL 4EOWH 1SEBA 3CZFA 4GW4A 4JO2L 4UT6L 3CSPA 4XXDB 3O2DA 4F57L 4CJ0A 3KLHC 1G9ML 1KIQB 3EOBB 4JRXB 3UYRH 5B3JE 2IAMA 2BCKB 4GRMB 2NXYC 4F7CA 2G9HA 3ARBC 3MRJB 5TDPB 3IU4H 4XP1H 5GGVL 4DGYL 3VXSA 4C56E 5CJOH 1JPGB 1S78D 4O58L 4LSVH 4OLYL 4XNMA 1KLGB 3ISWA 4G7VH 1J0YA 3RJQB 3LKRB 2BC4A 1TCRA 1GZPB 1C1EH 3N85L 3CFCH 2MJWA 3EYFA 3SCMD 5KSAC 4K2UL 1XR9B 3JUYA 3NVQA 4MAYD 3VXUD 1SJVA 2BMKB 2A6DB 5FHBH 3LD8B 3NCJL 1MLCA 2PXYD 3JSSA 4PJXA 1ND0A 3DV4B 5AYUL 3FO9B 5IBLD 4D0DA 1YEHH 2GJZA 2KDGA 3UTTB 2P5WD 2BHUA 3IF1B 1A6UH 2VLKB 5HYJE 3MRNA 3UTZA 1C5DB 1JF1B 3NPZB 3SDAC 2BNRB 4ETYA 2P5WB 2LVCA 2XWBA 5JOEA 5K33A 3N9GL 3U2SB 4PJ5E 1WCBA 1A47A 3MRHA 1SVZA 5JW4M 2W92A 3TZVA 4MAYB 4GKNB 4TSCH 5EBMB 4DQOH 5ICZA 5EU5B 5HHQA 1KJ2A 4DEPB 1ITCA 1NUNB 3LH2H 2MKLC 4J8RB 1KEML 3TZVD 5IEHB 4JFYB 1QHOA 4PJ9B 3IKCA 5D9SA 3SJVA 3R8QA 3QULA 1SVCP 3BEWA 2YZ8A 3O0RH 4AENB 3BPLC 3QDGA 4XC1H 5HSFA 5BRZA 5IHLB 3QO1A 5E00B 5EDXA 2HA1A 4XP5H 5EIIB 5D7KD 2XZCL 2E7CA 3H7BA 4XCEB 1OY3B 3MGOA 3WUWG 4JY4B 5DWUH 2WMPA 3GSWB 1OAKL 1ES0B 2Z31A 1MOEA 1KGCE 5HHOE 3TJEH 3MXWL 4OGYH 3GHEL 3P9LB 4D9QD 4GG8A 1UWGH 4JKPH 3WFZA 1P69B 4NQXB 3O6FB 4LSQH 2CH8A 4AL8H 5DS8A 5HI4D 3IXAA 4KH2A 3DMMD 3CAFA 1RMFH 2B0SL 3SE9H 2EE3A 4D0BA 1K6QL 3EFFB 3WKMH 3TH3T 1YY9D 4NN6B 5TF1L 4NQEB 1LO2L 4PJFB 5I76B 3WXWH 1FFRA 1HCVA 4RWHA 4DZBB 3TYGH 3KHQA 3HB3C 4M93B 1EVTC 1UWEH 4Y16A 1KNOB 2I5YL 3PP3K 3DX6A 3KLDA 1T2QL 3W11C 1TITA 4KDTA 5SWZE 4P99A 3C5ZC 3K8LA 4GBXD 1TLKA 1BZQK 4ZNEA 5E6IA 3TJHC 1H0DA 5F89B 4YDJA 1ED3A 3O4LA 3SDAA 5C0BA 2NYYD 1I1YB 1JCKA 4R9HA 3BIBX 5DSCA 3VRIB 3QDGE 1CL7H 1RURH 3E1F1 3SPVA 4K3DH 3UJJL 1SYVA 5F6HJ 3ARTA 3ZO0A 1QFWI 4RX4D 1IQWL 1KIUA 3B3IB 1X6LA 3MBEC 3QRFM 4MWFA 5E94A 3MREA 4LLVB 5M7QA 3OKYA 4X4YA 2AABL 1FN4A 3OJMB 3WKML 4I5BA 4MD4B 4U2ZA 1AIFA 3THML 4U1LB 4L8SA 3GSXB 1YYML 2AAVA 2OK0L 5D93C 4CAGA 3L7EA 3EZJB 2HJKB 2IANA 2NY4C 4MNGB 2YPKA 4JDTH 3K8KA 1KTLA 1UWEL 1ZK9A 1QA9A 2NY0C 4HWZA 4UNVA 5IWLA 4WRLA 1AHWA 1QFWH 1JWUB 1S7QB 4F15C 3HUJA 4G3YL 3N1QC 1BD2A 4X0KA 1FFOB 4K9EH 3FMGH 3U4BL 4DGIH 4WHYH 4JGMA 4P57B 5DO2C 4WVRA 1J1OL 1NC4A 3OBAA 4ZUWB 3LMJL 4R6UA 4WFFE 4Z7NF 5EULV 5FECA 4D0CB 3MX0A 2F54A 1MHCB 4Y5XB 5LJYH 4Y0GA 5HHPB 2VIRA 1X5LA 4K3DL 1G9NL 3D39D 2G75B 3TN0B 3KJ6L 4MQTB 2XKNA 4F3FB 2P8PB 2M26A 3MLXL 4WI4A 2FLRT 2KH2B 4KMTH 1UACH 3QUXC 1RIUH 2CK0L 2RGSA 2X42A 3PDOA 5CGTA 3DTXB 1KPUA 4OLVH 2NX5D 3Q1SL 4BH7A 3TYFA 2R4RL 3OKEB 2CDFA 5D2NB 5DMGC 5DGQA 5T1MA 3TBVA 4X9BA 3U82B 4EIZC 4FG6C 1K8IB 4PJ8A 2QQKL 1NC2A 5DJZB 2J88L 1TQBB 3HI1A 3C5ZA 4HWBA 1YNTB 2P49B 3I75B 4PJIF 4LLVA 3HC3H 4NM8H 4NC0B 4PRPD 3U4EB 2B8OT 2C5DC 1FZOB 3G6AB 5GISH 3EGSB 4M8QB 3VD9A 3LRGA 3GSUB 4LK4A 5F9WC 1MNUH 2ICES 1N5AB 1WIOA 1MVFA 2VDRH 4IBLT 3MNWA 4KJPC 2BDNL 4WWKC 2P24A 3P4NB 2A77L 4GUPB 3VJ6B 4Q7DA 2B1AH 3GMQB 1IE5A 4GAFB 1AY1H 3LKNA 3SGEI 1UACL 4QXTA 2VQ1B 2XKSA 4ENEC 1RZJH 1M71A 5J1AB 2VH5L 5D1QD 4U1KB 4X99B 1BQHA 3QEUB 2N1KA 2YK1L 1CN4A 3QISA 2Q1EA 1EA9C 2DQCL 4LCWB 3VXRE 3ARGA 1RUPL 4MD5B 5DJ2A 5KS9F 2F19L 3QPQC 1G7JB 1RZIA 3LZFH 5GSRA 1EEUA 5CINH 3P0GB 1OQOA 4P9HH 1QTYT 3RNKA 1K3IA 4JZNA 2W07A 2GKIA 4S10A 1HWHB 2B4CC 1HXMB 5FOJA 5ANME 1DBJH 4E0RB 3KNBB 1ZLVK 4FTVA 1KXVC 4M6MH 1RVFL 1CLZH 5D7JD 2FGWH 4RNRB 2Z35B 3FRPG 3UTQA 4X5WA 3QJFA 1C5CL 1MHEA 4J6RH 1R0AL 4YXKL 4PD4J 2ZNXA 1DP0A 1K8IA 3F58H 5A3ID 2NY4B 3DJ9A 3A6CH 3NCBB 4LP4A 3DVNB 3ZTJH 4XTRD 3VXQA 1QQDB 3SBWC 1HHGA 1X5JA 3PDDA 2QR0A 1BX2B 3QEQB 5D5MF 3QO0A 1E4XH 3VWJD 5EUOB 4QO1A 5JHDA 1JF6A 1KCVL 4I0KA 4PRBA 4XCYB 4ZAKD 4PLKC 4N68A 3KPSD 5E99H 5I8KH 4HK0B 2CQVA 1U95B 4Z18A 1PBYA 2AEIT 4YQXL 1QSFD 1Y0LA 2R1XB 2OZ4L 3VI3E 4BELD 4IMLA 3MR9A 3DX9B 3O6KH 4HGWB 5IB4B 1F58L 1I1AC 4GUPA 4XWOC 5DVNA 5CZVL 1JHTB 4EDXB 2D3VA 4JY6A 2FGWL 3TLRA 4IMKC 1MWAB 2VSDA 1OAQL 5HGDA 1RPQA 1ZA6A 3OSKA 1FNGB 3ULSA 4QHKI 2FWOA 5F7NC 4YFLI 4GXVL 3RWCA 5DI8B 1F6AB 4YHZH 5MEOB 4AMKH 2VLRD 5ID1B 5J6GA 1QZ1A 4XPGL 4A2LA 4Q9QH 5IQ9B 1UQSA 4RMWA 9CGTA 2FX8L 4PB0L 2AV7A 3SKOB 2XWJB 4RNRA 5SX5K 3S36H 4X8JB 1N0XH 5ITFB 3C5SA 3HE7D 3F7PC 5I9QB 4LPUA 1URLA 1NC4D 5F1IB 4NZRL 3T0AA 1NH6A 5EU6E 3QUYC 3W5NA 2FSEA 3RHWK 5E6ID 5KOMC 3GKWL 4YZFE 5DD6A 5I1EH 5J0BA 1K5NB 2VDQL 5I73B 1KTDA 1DTUA 1F45A 3MGOB 4JO1H 3OR7B 2VN7A 2AKRA 3GNML 4JDZB 1WFTA 4I3SL 3D39B 5B21A 3TM6A 3PP4L 3AFLA 1HHJA 5EUOE 2WK2A 4PPTA 3QEQE 4IJ3C 3TV3L 5SWQB 2FIKA 5GRYA 5DTFA 1NUDA 1CDCA 4WFGD 3VXQB 5JIPA 2ZP0T 2VE6B 3ZSSA 4JDTL 3GHBH 1FSKB 4JFHE 2ZG2A 3KJ4C 2W0KA 4GMTH 1OPGL 5JHLL 3T0EE 3WJLC 3HMWH 5F7DA 4CMMB 1NEZG 4WWKB 3VWKD 2F5AL 4JJ5A 2EIEA 4HXBH 4XCYA 4OGAC 1LDPH 3PWUB 3AB0C 4OZHF 2JK5B 1UJ3B 3R06B 1S7RB 2VDNL 1N2RB 2XQYK 1G0DA 4WIQA 4JN2A 2NW2A 1KCSH 4PG9A 3VXUA 5LXGH 3JV5A 3IS0X 4IRZH 4M03A 2APTA 5DK0B 3W9DB 1A7PH 2UWEA 2OZ4A 5E4EC 2G5RA 3O6LL 4OFYD 1U8OA 3BP5B 4FFYH 3IGAB 4JO1L 3C5SB 4QXGL 4BFGA 1QBML 1FFPB 4YHNA 3MYZA 3VGEA 3QNYB 2FX7L 3QNZB 4Y5VC 2EYTA 1EHNA 2DDQH 5JPMA 5E2TH 4R90L 2QQLL 3QFJD 3O6ML 3LEVL 1WCQA 3MJ7B 4OJFL 3IU4L 1IEAB 4XP1L 1HYSC 2DQDL 1AJ7H 3QQ9C 4HIIA 4RIRA 2J88H 5DA4A 1ZGLB 4N0UE 2HT2C 5D1ZC 1PGRB 2JKXA 1JZ7A 5CP7B 1SY6A 4N0FB 2AP2A 4MJ5B 2O61B 5FUZH 2DOCA 2R2BA 2WWMD 3V0VB 3ULVD 1YUHB 1QFOA 4N8VB 3P2TA 1VA9A 3SE8H 4RQQB 4UTBH 1LE9B 4MAYA 4OF0A 1QD0A 4N1EA 4LP5A 4KV5F 2YRZA 5LGKA 3OR7A 1ZWIB 1BQHG 2GY7B 2HYMA 1F4YL 2R1YB 4OGYL 2DQIH 3BZFB 3HPLB 2O5XL 4ELME 1UYWL 4C83B 4AL8L 2EECA 3P4LA 5DJCB 3D18B 4R26H 3FO9A 3VCLA 4TSCL 3MGAA 3GMMB 1QHPA 5ISZA 1EFXD 2X4UB 1KB9J 2DLEA 3O6MH 4FXLA 1C8PA 2NY4D 1QEWA 4MNQD 2EXYD 3R0NA 2F9BT 3GJEB 2YA0A 5DRXB 1KSRA 3S88L 3ILPA 1KEMH 1T66C 3ARFC 4XHJC 1M6OB 2F19H 4OFYA 1FORL 5AG8A 1EO8H 4JFXB 4OFDA 3UZQA 4LLUB 4G80A 4MD0B 3UJIL 1F3DJ 2G2RB 1A7NH 2HAZA 1YQVH 1V5JA 1K85A 1EJOL 5FA4B 3HI1B 1DBJL 3L3OA 1Q72L 3GB7B 3RX7A 4PP2B 5KSBB 3AS0A 3EDEA 4JREC 3HB3D 1FPTH 4JPWH 3MV9D 3GSQA 5J6HB 3RVTD 4N0FA 4M5YH 3ZKNC 2VXVH 1VDGA 1R5IB 1MHHB 1G9NC 3ZZ1A 1B6DA 3S34H 3RVWD 5F21B 3WHXA 4LSSL 1NL0L 1INDH 5C0RL 2NZ9C 5K9JH 2PYEE 1UKQA 5GS0L 2XN9D 3BSZL 4LCWD 4L29A 3T3PE 2D9CA 1GC1H 5F3BB 3GK8L 3STZA 3TA3C 4XH2A 2VLJD 3GMOA 1FLRH 2VZSA 1XGYH 5H2BB 2MPAL 2F53E 1G7PB 3HC4L 4HS8L 4WW2A 2YRLA 1HI6B 1IC5L 5IESH 1T1WB 4UOJA 3TH4T 2P42B 5C0AA 1EK3A 1CFNA 4FTVE 3CUPB 3D18A 3VCLB 4FXGB 4QRRB 2GJJA 5B38A 4HX1A 5TQ2H 5FM5O 4DGIL 2AK1H 4PTUB 3R8BB 1YZZA 2UY7A 4QKXB 5JDJA 5L7XL 2X1QA 4PJEA 3ZE1F 1FPTL 4NO0D 2NW3B 1EEZB 2VITB 4MA3B 2A1WH 4XZUB 4HUWB 3OX8B 5J13B 4Q58C 1T0NA 3NZHH 3ARDC 4RZCA 1UWXH 4X6CE 5GGVY 3TT3H 5F3HA 3TVMB 4YHLL 1PZUB 4NQCD 1EBPA 1CXKA 4QT5A 4YHOH 2F74B 4Z7WF 2D4FA 1RU9H 2GEEA 4OQTL 3X3GH 2GYSA 2AGJH 3EOAB 3PL6A 5JW3L 5CP3H 2EIZB 4G6FB 2YUXA 3RUGE 4PP1C 4TVSa 1VGEH 1DBKH 4K55A 1KIPA 1OGAE 5KS9B 2PCPB 2PW1B 4W6WB 4LLUA 1FZMA 4JQVC 1JBJA 4IDLA 2ADJB 2HFFB 4Y8DC 1OCWH 4JG1L 5J56B 1EXUA 4JRYB 1DBMH 4H1LH 3ARPA 5I9QC 1NKOA 2VLKA 3QUXA 1YJDC 5D1ZA 4XGZB 3VD7A 1JF1A 4GOSA 4A6YA 2IH3A 4OUOA 1UADC 4JVWA 3CLFH 3O11B 2R4SL 2RJMA 5HHOB 3RTQA 2WIIB 4DCQA 3NMEA 2V2WA 4KAQH 4V1DA 3VGHA 2MKWA 5FV2A 2PO6B 2UVEA 5JO5B 4NRXB 3LQAC 3RVUD 1T1ZA 3LPGA 4FXGA 4QRRA 1DQDL 1YPZA 3MRQB 2EIDA 3SDYH 1CQYA 4KQ3L 3QDMB 1F3RB 4FHBD 3LKOB 4JG0H 3ARRA 2GTWB 4B53A 1BFOA 3HMWL 3IETB 5L8KB 4IJ3B 5D9SB 1G6RH 4DW2L 3CFCL 3LIZH 4ERSL 5HHME 4Z7WB 4NP4L 1DBKL 4UILH 5FIEA 5AZ2H 2CGRL 3F6IA 1YN6B 2WBJD 4HH8A 1T6WA 2NY3C 4QWWC 3S5LG 5JXAL 4R96B 5KSVA 3BT2L 5FO8B 1AC6A 2FCBA 3REVA 4APQD 1I9JH 2HN7A 4PJ5B 3UZVB 5D71L 3PIQB 4KKLD 4P4KC 1XIWC 1BZ7B 3BW9A 1YDPA 1IGYB 5E9DD 5F96H 1SYSB 4NQVB 2AJXH 1NGPL 1T66D 1T20A 3ARFD 3L3HB 2EC8A 4TRPL 3T0EA 5SWSB 1TZIB 3LEVH 2CKBL 2DI7A 2CD0A 2FHFA 4TVPH 4X6FB 2Z4QB 1HOCB 3ARSA 1XCQB 3D39A 4TQEH 3T4YA 5L2KD 4D8PA 4N1CA 5EO9B 5F9OH 4GG6E 2P8MB 1R3JA 5HI4C 3A6OA 1UH3A 1UVQA 1A14L 3CXDH 3VG9B 4Y4FB 3X14B 3ZDYE 2AK4B 4RMUA 2YK1H 3MLSH 1E4WH 4YXHH 2CUMA 2CKBB 4ELKA 3ZHKA 1L4IA 5D1ZB 2ED8A 3WV0A 1RUPH 1ZMYA 4LSTL 1HQ4A 4RDQG 4LPYA 3ZSTA 4KRPB 1Q9OA 5FB8A 3RDTB 5H94A 3EAKA 4KTEH 3QZWB 4PJGF 5HGBB 3ALPA 4P46B 4TTDD 2MMXA 5ESVA 1EVUA 3S4SG 1UYWH 4NRXA 1T5WA 3KGRA 1UCBH 5C0CD 1E6JH 3QG6A 1MCNA 3LEXB 2BNUB 1CFSB 2H26B 4HK3N 4K9EC 5KSVB 1X5GA 4U3CA 3RBSA 2W0PA 1UGNA 3O2DL 1PG7X 4W81A 5A43C 1OB1A 1OAUL 2RQ8A 3AS2A 3SGDH 5GHWH 5IB1A 2RAMA 1WAAF 2VZUA 4KQ4L 4KXZI 3AC0A 4H1LA 4FP8H 4YGVA 4Z7WA 1QG3A 4OLXH 2HVJB 5ERWA 3QIWA 3W9EB 1OWWA 1PQZB 5C70A 1S9VB 5M94B 1G1YA 3NIGE 2R1XA 5T5FH 1A7NL 4K3JL 5FO8A 5CSBA 5MI0C 3PHQA 3ARDB 5DHYA 3DGGA 4XHJD 1P53A 1QSFE 3L6FA 4EUPG 1NFDB 5BZWA 1A9EA 1JRHH 1A2YA 3FQRA 4XAKD 4P4KA 5IG7B 2W59A 1H8SA 4JZOA 3QDGD 5GGRA 5CIPA 3ES6A 2FJGA 4IM8A 1O0VA 1FZKA 2A6KB 2VLKD 2GITB 1NGZA 4OD3L 1XF3A 1NCCH 1RZKL 4QRPA 3UP1A 3O6KL 3HC0A 3OHXA 1E6JL 1W0WA 3K2MC 1I1FA 1VKXB 3EOTH 3EYUL 1ES0A 3SKOA 1DUZB 4GG6F 3ZE2E 2AW2A 3TIDB 2XG4A 4HV8A 4O4YH 3THMH 1NFDE 2NXZC 4G8GB 2VLRB 4HS8H 4C58B 5HJ3A 4EBQL 3GSNL 1GGYA 2EICA 5C9JA 2P8LB 4PJBA 4U6HA 1LEKA 4NRYB 4XPTH 1HH6A 3D2UD 5EORH 4X4ZA 1T6VN 4XPGH 5E6IC 5IHBA 3MCG1 1XGQA 3BMVA 3O3EA 3ULVC 4M6OL 4U6TA 3MACH 4MA1B 2AEPL 4K9EL 5I2IA 5KOVC 3RDTA 3MRCA 3NCJH 2AK1L 1G7HA 1FNSL 3MRGB 4R8WH 4ORGB 3GRWH 3TF7C 3KXFE 3FONA 3K74B 2QSCL 4MNQB 3TNNA 1BWMA 1FNEB 3BGMA 3O3UN 1LK3H 1N5AA 2APFA 2GFBB 5TFSL 2BSTA 2H8PA 2XY2A 4FMFA 4MLSA 2VZVA 2AV7B 4EDWL 2Q6WB 2VNCA 5AYQA 2IPKB 5HY9B 1FP5A 1KG0B 3QXUA 4Z7UF 1BOGB 4K3EL 1KIRB 1EHLH 5CD3B 3O4OB 2Y72A 4AG4H 4TUKL 4OZ4B 4QHMB 2X10A 3B9VA 4CADA 4XWOD 5HDBE 1NGYA 3JWOL 1G7LA 1ZVSB 43C9B 2AS5M 1DEDA 2DQDH 3MREB 4BQ9A 2AK4E 4XPTL 5DHYB 3FB8B 3ABZA 1E6OH 2X05A 3KLHD 1KTRL 1ULVA 1II4E 4OGAD 3C6LC 5DC4B 2EYSA 3OJDB 3IFPA 2MOVA 4KRNA 1U8HA 1B9ZA 3VWJC 1CT8B 1UCTA 2F5AH 4NUGH 1OARH 1KLFA 4HUUA 4PJBE 1IGFH 3BIKA 2Q8BH 4X6CA 5CJXC 3VFGL 1BLNA 3DX8B 4G8GD 4GKSA 3QWRA 3BJ91 4YE4L 3HLAB 4KPHL 5F97E 4A2MA 4XBGB 1ZVHA 1AGBB 4KTYA 2VXQH 5HI5D 2DMCA 5JQ6L 4KKBD 1OGAA 1Z9MA 4XNUL 5LGHH 3D85B 2VLRA 4KHTH 3PQYD 5F7MC 4XC3L 5IV2A 1C5BH 4HIEB 4CMHC 7FABH 1FNAA 3KYMA 1GOHA 1JN6B 5IEKA 3MFFB 2VYRE 3B9KA 5DMKB 5D7IF 4OIBA 5C09E 4NP4H 5DA0B 4GAGL 3ZMRA 2A0LD 2OP4L 4R7DB 4O02L 3NTCH 5IHZA 1QRND 1NDGB 1EO5A 3KYNB 5K59F 1UKTA 2EEAA 1IFHH 2WWMC 5DYOA 2J7LA 1CE6A 2NTFA 5DEFA 4P9HL 1SEQL 1OARL 3QDME 4MXQC 4ZS6D 5CEYB 3NAAL 1K9TA 1OSZA 3NBNA 1FVEA 4B7IA 3DTXA 4PYHA 3QPXH 3R1GL 2IBZX 2LAAA 4Q2ZA 5C07B 3VGAC 4OSUH 2YPLD 1QYGL 1PX4A 4FABL 3P30H 4JKKA 4XGZA 3DGCR 1CGTA 1A5FL 3A0OA 4BSWB 4TOYL 2ZOKA 3O11A 5HGDB 4Y2DB 2QKIB 4C59B 5CEZD 5GS0C 2BSRB 3OF6A 3DX6B 2GW5A 3HNTL 4BKLB 12E8L 4CW1A 3T65A 2X4TB 4K94C 1HSBA 1BLNB 2ZPKL 4LCIL 5HYSG 2ZCHH 3MRKA 2X5PA 4NQDA 3SDCC 5EBWB 4B5EA 2AXJA 4P59H 3RP1A 2FNBA 1KV3A 1U8HB 4MMZC 2VDPL 3KPRA 1IGML 4ODBD 3BDYH 5J9PB 2OS7A 4BZ2H 3IDGB 4GKOA 4WU7A 1IFHL 1KB5B 4ONFL 3QHFH 1WZ1H 1WWAX 1F00I 1XF4A 3IXAB 4F37F 4JAMB 1MY7A 1QSEA 4YHYB 4G3YH 4GKSB 5TE6L 2FSEB 1SEQH 4XX1G 2D03L 2EEBA 4XNXH 4Z7QF 4ZUTB 4FN0A 1FSKC 4IOFD 5CZXC 1GGBL 1NQBA 2YSSB 1S8DA 5IW6B 4XP9L 1Q72H 3G5ZA 1IARB 2XICA 4R7DA 4JDZA 4RSVA 5DUBA 3OB0K 3TO2B 3X12B 4N0YL 1QYGH 3D0VB 4FABH 1JV5B 4PRIE 4WUUE 1ADQL 3MFGB 3BPNC 1MI5E 1KTLB 3KNBA 3KPQA 3WD5L 2EDKA 4OUUA 2OXHA 3HNTH 4PV9B 2D7PA 2VC2H 2CLVA 3O4LB 5IHZB 3U0TA 1IBGH 1YEEH 1NAMB 4LLYB 1BFVL 1NGQH 1RIHH 4S1SL 4X6DB 1XGYL 3SDDB 3GSQB 4PRHB 1T7WA 4PR5A 2ZUWA 2F53B 3VWJB 1T1XA 2YPVL 5DDHB 2F54B 4AT6A 4UU9A 1M7DB 1XH3B 4YHIA 4FFZL 3PABB 5HDLA 2YKLL 3BP7A 4UV7H 3O45B 3HC3L 4LCUB 4QRPD 2CJUL 3U83A 2HRPH 2V17H 1U8QA 4RRPG 5BOPA 2Y36L 5DZLA 5CWSB 4FQIH 4XNQB 2XWBB 1NLDL 5F7EL 3HZYA 3CDCA 1MCOL 4XP4L 5MP6L 2ZZUT 4OLUL 3RL1B 1NCUA 3VXOB 3MOAL 5HHQB 1I1AA 3VG0H 5A1AA 4EBQH 2JJSA 4QRSA 1AR1C 1VENA 3NZHL 1Y6KR 1FFOA 1JNJA 1U2HA 2YD2A 5L2KA 1CIDA 1I3UA 2P5EB 4P23C 5EOTA 1XZ0A 4UUJB 2NXZB 3CVIH 1U8KB 3TBYA 3LIZL 4DUVA 35C8L 1YPZE 2FWOB 4YIQB 4Z6AT 3GIZH 2NY6C 4Z95L 5M95B 4V1DB 3S37H 2OTPA 3QSKB 5HPOA 1KCRH 5DRZB 4MB5A 1PKQB 3VFOA 5LXGL 1JFQL 2X1WL 3HRZA 5DEGA 3ZDZE 3ZL4L 3RVUC 2B1HL 2J2ZA 3D2UA 3CCHB 2CPCA 3V0AC 3FT3B 1NFDA 3DNKA 4PG2C 3TBSB 1V3JA 3CLFL 3IRZA 2DKMA 4KDTC 5KS9A 1FL6A 4ZUSA 4UU9B 4X99A 4P2QE 4X5XB 2BNQA 3FJTA 1L9NA 4F7PB 4NRZB 5HDQH 4GRLC 5JNYA 4PRID 3CVHB 3CZFB 1S5IH 3SDDA 2BX5A 3ZHDA 4JKMA 3RZCA 4GS7B 4IHOB 3RZCD 2AXHA 4L9DA 3NZ8B 3M8OL 4RISH 3T2QA 1A7BA 3OWEA 5HHNA 3RPIB 2H1PH 5GIRB 5C9JB 3E6FA 1GYAA 4UILL 2DM3A 2HVKA 4UTBL 4UDUA 1AKJA 4PP1D 2C9AA 3C6LB 3LKRA 2WUCL 3BKCH 5AZEL 2FJHA 5E9DA 5I74B 2ZUUA