1CGVA

Site directed mutations of the active site residue tyrosine 195 of cyclodextrin glycosyltransferase from bacillus circulans strain 251 affecting activity and product specificity
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLFDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Site-directed mutations in tyrosine 195 of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 affect activity and product specificity.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
total genus 235
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1994-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgvA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgvA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cgvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cgvA01
1XF1A 5D9OA 2Z9TA 1RURL 4JR9H 1YJDH 3VXOB 4OLXH 5DF0A 1AQKL 1F90L 3QUZC 2DQUH 1JWUB 3LEYL 3GIZL 3K3QA 2R0WL 3IKCA 2QKIA 4OD2B 3ZTJH 5A6SA 4OZFA 3U7YH 4ACZB 3EJRA 1G7JB 3W28A 1E6SM 5AYUH 4G9FD 1ACYH 5I8OL 3BUPA 1FA2A 4XC1H 4LAJH 4FFVD 2Z35A 3WH9A 5DJ6B 1I9EA 4FQHA 1A0QL 2Y07L 1K6QL 5C3LD 2MTPA 5BW7C 2XGBA 3H7LA 3STLB 1H11A 2V6HA 4JN2A 5T3XL 4D94A 4ZXBB 3TVMC 2ATPA 2NY0C 2J6EL 2DSVA 1IRAY 4B9ZA 3T0WA 1ROWA 3AMKA 1B0IA 5C0AB 1NOFA 1AD0B 5EB8A 2I9LB 4M82A 3VGEA 1YECL 5JQ6H 4XCCH 1T22B 1UD5A 1I1YA 3LKPB 2QEJA 5I8EB 4LCWD 4Q22A 2WWCA 1NDMA 3VFRA 2DKMA 1MPAH 5I2IB 4OLXL 5C0RH 4RMUA 3T1FB 4D8PB 3UX9B 3VXNA 3AMGA 5DRWB 1CECA 1E5JA 4IHOA 2F19H 4DOHB 2UY6A 3BAIA 2D24A 2CJUL 2RGSA 1ISYA 4PRIE 3SDXF 2AABL 1CGYA 4ZTOH 3ESUF 3QXAA 1U8LB 3OAUL 5T3ZE 1R6VA 4AWEA 5EBWA 2MPAH 3F5WA 1ZA6A 2GCYA 3GSNA 3TT1H 5A2KH 4ACYA 5ABHA 3MLWH 4OZFH 4X6CE 3THML 3HR6A 3E3QE 2EC9T 5IBUG 2I5YL 4RMVA 2EH7L 4ACPA 1OARL 4DN4H 1FJ1B 5B3JE 2Z8SA 5ISZA 4MA8L 3ARDC 4ZAKA 2R0LL 5F88A 4KJQD 2EKSA 5AWNL 4DKFH 3KR3H 1A47A 3MYJA 2PETA 3U46B 4M61B 4PP2A 1NWRA 1AQHA 4BA0A 5CEYA 1CT8B 2ITDA 4JY6B 5E9DD 2GUYA 4YLQT 5I1KH 2Y7QB 3QQ4B 1RK0A 1EQPA 5EFDA 2A1WL 1J8HE 4WFFE 3VH8A 1N2RB 2BVYA 1KIUA 5DMKB 4ZNEE 4FQJL 1CVSC 3LMJL 4PGZA 4HP5A 3VNZA 1EV2E 4JFTA 4NBXB 3KS0H 4M43H 1BLNB 1UZ8A 1RJYB 2Z92A 1RI8A 2PW1A 4PRNB 3RY4A 3CSBA 5IF0B 5GSVA 1DUYA 4OJFL 3TBTA 4K8RH 1J12A 1KJ2A 3HS0A 4I18A 1CDYA 2P5EE 2IH3B 4YPGB 3VWJC 1LVEA 1FZMB 5DWUH 1AHWA 3FB7A 3MRJB 1T1WB 4YGAB 4ZNCD 5CIPH 3CK0L 3EYFA 1KTBA 4RL3A 2GITA 5LBSH 3WIHL 1TTUA 3RWIA 3PN8A 2XWBB 4D9QD 1F11B 1QFHA 1ZANH 4F80A 2FIRT 1YMME 3QH3B 1H3XA 5I1AB 4CADA 1CTOA 4FMFA 2XQBL 2YDSA 1V08A 4GMTH 1S7QA 1HKLH 4E42B 5C8BB 3RUGA 1K85A 4LHUG 2J7CA 4YXLL 3BPOC 4F9PA 4CVXA 5ICYB 2CBIA 4B0MM 4PJ7A 3TTQA 5KVGL 1A5FH 3RM8A 1FIGL 1P2CB 4UQ9A 5HGHA 3A3HA 3EYVA 2BFVH 1JV5A 4JRYA 3BPLB 4PB9H 3TCLA 1QBLL 4H20H 1FAIH 1GZQB 3ARZA 4D6IA 1R7AA 1FOBA 5ESQB 4MCZB 2DSWA 2Z31A 2B5IB 2XSBA 4HW6A 4BA8A 1B0WA 1KN4L 2GFBB 2ICWA 4IRJA 4XB7A 1UD8A 3D25B 3AMDA 2QF8A 2UVEA 2BSRA 3M8OH 8A3HA 3QWQB 3DJ9A 1JXKA 1HZHH 3CDGA 3KPMB 3E1F1 2XWJA 3VI3E 2Z31D 5D8WA 2V7HB 2VAAA 5IWLA 3CDCA 1IGIL 3GBML 3VXOA 4PRBB 1E28B 4DQOH 4MNGB 2PYEE 5AYBA 4G9DB 2XTJE 3JV6B 5A69A 1E1FA 1VFAA 3STZA 3CFKB 4FQXA 4MD5A 5C09B 5TQ2H 1GGUA 1Q9LA 2R29H 4OGZA 1MWAL 4H25B 1UGNA 2LV4A 4QXGH 4DGVL 2WMHA 3HNSL 1RJCA 4UOZA 4L3EB 3GMPB 4M7JH 3O45A 35C8L 4O2CB 2UZYB 3D85A 4ZPVA 4OI9A 1OCQA 3TBYA 2QLYA 2D0HA 5T1LA 3MRBB 3IDIA 3VUPA 1YEEL 4P2OD 1H09A 1OAXH 3VVGA 1OP5H 4AD1A 3OZ9H 3IFLH 5BXFA 4ZUSB 1JXJA 3ULVH 4ZFFA 4P2RD 3T3ME 1P7HL 1LO4L 12E8H 2PBOA 3BEVA 1G7IA 4Y5YB 5JNYB 5KBNC 4GS7C 4WHTA 1KENL 4U1MA 5D71H 3DUUB 3HMWL 1CT8A 2ITDB 2AK4D 3ZZ1A 1I1RA 3OZ9L 2QV4A 1CWYA 1UWQA 3C8DA 5JXED 5EU4A 4JPIB 1OAXL 4H8WL 3TIEA 4GT7A 3AHYA 3QFJD 2V5TA 4L3ED 4LSRL 2ICEA 3FFCD 1MI5E 3QUXB 1B30A 1F13A 4GAYB 1MAJA 3UJIH 3NBNA 5E9DA 3HNSH 4RDQG 2FHCA 1E73M 5D5MB 3UBXB 4JFED 3BN9D 3EO0B 4RE4A 2R29L 4CGTA 4MX7B 1EJOL 2A9NH 1XIWA 4H26A 5TQ2L 1C91A 1EXUA 3PABA 5KSAC 4GQ9L 5GIRA 4YIQB 3PZNA 3ARQA 4FQLL 1YUHA 1NJ9A 4PLOB 2ZCHH 4UINH 4HPYH 2EDTA 4JZJA 3UBXG 3VRJB 3T0XA 4KK9C 4UT6L 4YHLL 4PCSA 1RHHB 3SE8L 1NFDF 5TE6H 1HP4A 4ZXOA 4EIGB 1NCNA 4XH2B 2Y5TB 4AEHL 3MUHL 4GZJA 5JHDA 5F1NB 1G9HA 3QFJB 3QO0A 1QSFB 5J13B 5EU6B 3QISA 1KTRL 3DETD 2H2SD 2X2HA 2GTZA 5AG8A 4U1GC 1NEZB 2NT1A 1TVHB 2IALA 1N5AB 5SX5K 1RMFH 2X2JA 1CR9L 4M1GH 4XPGL 4JFUA 1WLHA 4XVTL 2IBZY 5CSZA 2VDRH 1UD2A 4QRRD 2YUXA 1OM0A 2Y2WA 3LRKA 4YPGA 1MJUL 1LL6A 1TETL 1U8PA 5IKCA 4AG4L 1T1XB 4AH2A 5F21B 5GXBB 5F89A 4F37K 4M56A 4I2XE 1JF1A 5FM4A 1MQKH 4HZ8A 1MVYA 1KTLA 2KUTA 1L7IL 4YUEL 3WEXA 3Q5OA 4YDJB 5BOPA 1ONQB 3V8CA 3QIWC 1ZSDB 1G0XA 3DIFA 3VXRA 2HFEB 5DYOA 4PTWA 4AQ1B 4WW1A 3D9AL 5E94B 4MDIB 2EIZA 4UQBA 4AZ5A 5DWUL 1KB3A 1X9QA 1XR9A 4JM4L 2GJ6A 3SUTA 1KIQA 4FG6D 1X5LA 3I02A 2YIHA 4QRPE 1ZHBA 2H9GB 2VXVL 4ODSL 1T6VN 4M48L 3RWDB 3VWKC 3A21A 3IFPB 1EAPA 4FXGA 4OB5H 5KVFH 4AIUA 5FUOL 3SO5A 1PLGH 5I1KL 3ISWA 3MGTA 1HCVA 1EVUA 1HT6A 1UOKA 2FSEB 2ICWB 4IRJB 3LD8C 1DN2A 4PGDB 3CDGB 3OMZA 2Q86A 4JPWH 1DBKH 3KPPB 5F7YC 3OQ3B 1GCFA 4FLQA 5IHLB 1MEXL 2PTVA 3M6DA 4NQXB 1FFOA 1I9IL 4K3DH 3VXNB 1B0RB 4B15A 4WI8A 5C0DB 4X5XA 1BF8A 1D5IH 1T0OA 1ZT7B 3VFNA 2HLFC 5CD3A 1CIDA 3GKWL 3BQUD 3O2WL 1D2KA 1YNKH 2IMMA 4JY5H 4JZ5A 2VLRE 5GJSL 5J1AA 4DFIA 3W0KA 4OIFA 3U7WL 5EMYA 2HJFB 3VDAA 1KEMH 4NWTH 1B90A 4X6BA 4TNVK 5DUPL 1U9KA 1W0VB 3O4LB 4G43A 3VXQA 1YMMB 4GW5B 4MWFB 4W86A 3RUGE 4Z7OF 4UOW1 1EHLL 1V0MA 3FY1A 4HQQH 4R90L 2A6DA 4HF5L 2ERJC 4BK4A 4MHHI 4MXVF 5GGTH 5I1CL 3IJ9A 1UM5L 4MXQC 1EDGA 2DJUA 3EW3B 4AZIA 3PHSA 4WFED 4ZS6D 5C0RL 1ZLVH 4NSBA 4TTDC 3AAZB 2ZX9A 1NWUA 3T8XA 3TN0A 1FNGA 2Y5TA 4L4VD 2PTTB 3JV4B 4MAYA 5KVEH 2YR3A 2W59A 2AK1L 4WCYH 3G6AB 2NX5E 2P8PA 2XN0A 4O51A 2NNAB 3DVNB 5FV2A 3BMWA 1UZ8B 4NQDD 4Z2GA 5CJOL 4UNIA 2NW3B 4OT1H 3QI9D 1ZLWK 5ICYA 3F7YA 2DIAA 1GGBH 3MNWA 3IJHB 4MNQE 2V7NA 5T3XH 4K94C 3U7WH 4XPTH 4QGYA 1HSBB 1QLRA 3OKDB 4PPTA 1CQYA 3F65A 4PJIE 5EUKA 5DSCB 2J47A 2X4UB 2WCAA 3QIUC 1IM9B 4PGCA 4PJIB 3T77B 5DQDH 1MAMH 4WSKA 5M5DA 1JGDB 4LBEB 4JFYB 1R5WA 3WMCA 2LAGB 1JPGB 1WP6A 1UA3A 3DDGA 5IFHL 2H26B 2VERN 3FQXB 1INDH 4AZ8A 4Z7UF 1J0JA 1XCQA 2J8FA 3E2HB 3HA0A 2DWDA 2EYSA 2D3NA 4YHMH 1CENA 3OA5A 2P8MB 3FT4B 4MVBD 3MREB 5C7XL 1R47A 5FIPA 5JW4M 5IVXE 4IMLA 3CTTA 1B6DA 1VERA 1XD0A 1Q0YH 4E5XB 4OKVB 5ALCH 4H0IA 1NOUA 2BY1A 4FQIL 2XHYA 2EIZB 3K4ZA 4Q2ZA 2NY7H 4WEBL 3L3OB 1GAFL 2JIXB 2X4TB 3WQWA 4D3CL 5FYLH 1FL3B 3W2DL 1NBZB 1IC5L 4QRRB 2DIBA 4NNPL 2VDQH 1ZXQA 3QG6B 4DVBB 2AJ3B 3QNYB 5GS0H 2MKWA 1XIWD 2E7HA 1GOIA 3CHFA 3ORJA 5C3TA 5IV2A 4WEBH 4X9YA 4WDIA 3L7FB 1OF2A 3UJJL 1CS6A 1E4XH 4M6OL 5M7QA 5CMAB 4ETYA 4YHZL 2EO9A 3M07A 5FIEA 1RUQL 4X8JB 3STZB 5I16A 4AK1A 1W72L 1Q72L 4BZ2H 1Q0YL 2ZWZA 3I3BA 1EEQA 5DK0A 1AKJA 4P4RA 4GAFB 4R4BB 2ZUWA 1CE6B 1MCPH 5F9OL 1ZHLA 1U8NA 5E0FA 5EIIA 5D72L 4A3YA 2R1XA 2H6PB 3GRWL 5IB4A 1Y6NR 4ZMAT 4KXZH 4HA1A 1Z0MA 3WH7A 2EDNA 2UUDH 4FXKB 5FF6B 1A14H 5L2KA 1BD2B 1UCBL 3TZVD 4XP9H 1WWBX 1HTYA 4QRTA 1HKFA 5ICZA 4HWEH 2WBGA 1MJJA 3DX6A 4R4FL 5F1KC 2VCAA 1SZNA 1KG0B 1KPRB 4CVZA 4S2SA 1YEIL 2KQNA 1OOAA 3DX4A 2GJRA 4LRIC 3EFDL 5MP6L 5IIEA 2EDOA 1ZJBA 1CNVA 1VGEL 1U92B 1V7ML 4N0CD 4IPLA 2NLJB 4W6WB 4FXLA 5ANMA 1T03L 3IK2A 2OWWA 2ZCHL 1EQCA 1FNSL 4E41D 3GZAA 3OLDA 1NMAL 3ULVD 1GW1A 5ACLA 1W9BM 1J1PL 3OKEA 3CVHH 4JQVA 1U3HD 4EK7A 1R3JA 4OF8A 1HWHB 3CZ8A 5IJKA 1KXVA 3OR6A 2XTJB 5DJZB 4JFHD 2UUDK 3H3PL 1BFTA 4NUGH 3BIKB 4P23C 4LF3B 3D48R 2VURA 1UWSA 1D5XA 1T1ZA 4HQQL 3UJIL 2WCSA 1F42A 5DJ2A 3S5LG 4NN6B 4LHUB 4EUPA 2F54A 4NJAL 3QXDA 4XPFH 1KPUA 3TBTB 1LEIA 1TTFA 2HFGL 2NY3C 3BN9C 3MJGX 5EWIH 3FW6A 1FO0L 5D70L 1YNKL 1ZTXL 4M5YL 4OTXL 2QBWA 1KCSL 1T20B 2E5EA 2EYSB 1TJGH 4N5UA 3LEVH 4PJ9D 1RP9A 3AXLA 5EZIL 4OI8A 5L2JA 2OJEB 4OZFG 4LU5L 3EDFA 1CF8L 2DDQL 1H15B 3KJ6H 3UTTB 5IFAH 5GRVL 4AD0A 1BFOB 2OTUB 4ORGB 3NN8A 2XN9A 1QNZH 1P53A 4CU7A 3SDDA 2GK0B 1ADQH 3TGXA 3OLIA 3W24A 3CU1A 3VGHA 1S7TA 5A95A 4TUKL 4ELKB 1HHJB 3LV3B 1A1MA 2D9CA 4NZDA 4PRPA 5F89B 2EYTB 4U7SA 1K3IA 2XVPA 3PZOA 3QHFH 4P8XA 4UQ3A 3ULUC 1NCWL 1K8DB 1O0VA 5KVDH 1NM9A 5FCUL 4JHAL 3PIQB 2Z31B 3EAKA 5FYKH 5EOQL 3WE6A 3S36H 1E0WA 3BJ91 3LN5B 4ZFMA 3O2DL 4JGMA 3A23A 1E6XM 4PJHA 5ALBH 1MFAL 1V3JA 3M8OL 3QUYA 1L7IH 2YRLA 4Z7WE 4CADB 4P2OA 1KN4H 5JR1H 1TZGL 3FQUA 3MBXL 5GGRA 4GRMB 1AR1C 1MNUH 3VNYA 3RY6C 2HFFA 3RUGB 2EPNA 4QO1A 1NKRA 1S7UA 4YWGL 2FGWH 2IQ9H 1HSAB 4P5KB 4CW1B 3MJ7A 4J3UA 5DJCA 3QZWG 1DBML 5ESVB 2Y72A 2W91A 4JCMA 4PMOA 4J3TA 4KJPC 3WFBL 5GS1B 4GBXC 1T80A 2NT0A 3MV9B 2F1BA 1NBZA 3QZWA 1LO3H 4RAHA 3IXTB 1GHFH 4JANA 1OGTA 4M5ZL 3T4YB 4XHQA 5I15L 5INDB 1A21A 3NZHH 3WFCH 1I7RA 4F8XA 1I1FA 3MLXH 3CCHA 4Y1AE 4PRPE 4UT9L 4ZFOA 1UM4H 3EGSA 3H9SA 1FH9A 5HD8C 3KLHD 4S1QL 4AD5A 4CD8A 3U7BA 3PL6D 4X7SL 3L7EB 4UT6H 4YHLH 4P57A 2UY2A 3WFDL 5I71C 4PLJD 1KELL 1VIWA 2C3VA 3N85L 1W2VA 2JALA 1I75A 2CO6B 4GQ9H 3TLRA 1J8HB 1ULVA 1I7ZB 2Z91A 1QNQA 3OXSA 2A83A 5EU3A 1Y0LB 3HPLB 4L4VB 1JPFB 5DSCA 4APQB 5LWYL 5F8QC 4QCIA 1I9RL 3S3SA 1TFHA 1HQ4B 4XPHL 1BQHA 3LPWA 4K94L 4L29A 4A2LA 1VEOA 1SJXA 3ECBA 1UCTA 1INQA 2XPGA 3GNPA 1CICA 1YEGL 3QSKB 3RIAF 2OZ4H 5BZWA 3ROOA 3C60D 5HYJA 4GJTB 3CUFA 1SBSH 1JPSL 4FZ8L 5IW1B 1WBYB 3PHOA 2YJQA 4KRLB 1QSEB 3MLTA 5C0JA 1LO5A 3MACL 4ZUTB 4AEFA 4JE4B 1DLHA 4WUUE 1LE5A 2IPKB 2YS4A 3QRGL 4P0DA 1CLXA 1OAUL 4M1CC 4ZO8A 1A1NB 1XSKA 5M94B 1B3YA 4P9HC 3FMGL 3EO9L 3KWWB 3CXDH 4JHZA 4PREA 4U1GB 1GSMA 1R3HA 1H8SA 2VABB 3QI9C 4K3HA 1U2YA 1BHGA 2L7UA 3FFCE 2IPUK 5GRWA 5FO8A 4CVXB 2GTZB 5A8NA 3PP3K 2WW8A 1FNFA 4EDXB 5HSFA 3CUHA 35C8H 3KDMB 1SYVA 3P4MA 3FO1B 2F19L 2ZPKL 3M1BB 1NL0L 3KLKA 1A9BB 4LCYB 3FO1A 3SQOL 1KEGH 2JB5H 3NA9L 3VIHA 4WKAA 2AEPL 1U93A 3HG1D 1VADB 3F12A 4YX2L 5I5RA 2DQDL 1MPAL 1PDKA 3VI4E 4JL2A 2HVKB 4XVSL 3QPQD 1L9MA 3GMQA 2E9JA 3GJFA 2GIYA 3QXVA 4UIMA 4XUYA 3QI9A 4DEPC 4BH7B 3ZKQD 2J8UE 4F33A 4PJEB 1NFDE 4NQDE 3KPPA 2APBA 2WBWB 1BEYH 4HMCA 2YD5A 5HHOB 3AYSA 3SDXA 5SX4H 4IBLT 4NO3B 1NGPL 2DD8L 2R1XB 4LKXA 4CBPA 1GZPB 2IAMA 2VDOH 3B8YA 3EOAB 4ATLA 5C0BE 5ISZE 5JW3H 2O61A 1CFTB 1DQJA 4H5SA 4U05A 4LLUB 1DN0B 1RZIA 4LLYA 3UERA 3NN8B 3O81A 1U8KB 3BWAB 3RVXD 2WVSA 1AGBA 4P5TD 3RNQA 4OLWH 1BQSA 2FDBP 3CVIH 4EN3D 3BSHA 5A6MA 1MCHA 2OZ4A 4S1QH 4DW2H 3OZPA 3EJYC 4TNVF 4G7VL 4RNRB 1A2YB 3VXTA 4TOYL 3ZE0E 3HCVA 4Q74A 1HH9A 1M6OB 4ZNEA 3MLXL 1A5FL 3MJ8A 3DXAD 1K4CB 4YHOL 5DHXB 1F90H 5I3DA 4JAMA 1FFPB 1EDQA 3CZFB 4LGSB 2FRGP 4DO6A 1MWAA 1CEOA 3PGDA 4Y5YA 2O5XH 5JNYA 3CHCA 2P5EA 4IM4A 3LDBB 3VGAB 3NCYP 4XNXH 3VWJA 1XYZA 1RZ7L 4JQVC 1TMCB 3QXUA 3VXRB 3AJ7A 4HHAA 1E4WL 5DMKA 1HI6B 3IDNB 4E41A 2R8SL 3WSQH 1KFAL 4LF3A 5C9JA 4OCYH 4ZO9A 3VD7A 5CBEB 3HZKA 1Y6KR 4L4VA 4R2GC 4H1LG 5GS2D 5GJTL 1R5VA 2I27N 1RUPL 3LKOB 1DEEA 2NW2A 3IDXL 3L3IA 4J12A 5HHNB 4YBHA 1JGVH 3RZCC 4H1LA 4NPYA 3BD3A 5B38B 2CK0L 4M00A 4D9QE 2XA8H 3JZ7A 3QAZC 2AQ3A 3IXAA 4V1DB 2ZG3A 3NJ3A 3O6KL 3CZLA 2IPTH 4U6VH 2DTSA 4ZAKB 3MA7A 3HNVH 3EYUL 4JRYE 3E6HA 3WL0A 4NOFA 3Q48A 4HUXB 3TJHC 1FNEA 2WC7A 3I6KB 4R8WL 3DYPA 1JF6A 2J88H 2P47B 1RHHA 2MQ3A 1ZHNA 3AIRA 4KVNL 4UU9A 2XG5A 1OGAD 4MAYC 3PWJA 5AWNH 4DKFL 2JFEX 4Z7VE 2DLTA 3FB8A 1LEKB 5E08H 1MJ7L 4WJ5A 4QLKA 3C09C 3RWHA 4WJ5B 3VXSB 1XGZA 3THMH 2E8ZA 5T3ZD 4LSUH 2PBGA 4FQ1H 2IALB 5EZOH 1YNLH 2XTKA 4PG9B 4Y16B 2OMNA 2ZOLB 3WNMA 5DTFB 3L95A 3QDJD 5TE4H 4R96A 5LCVL 1NLBL 5HHVL 1ZTXH 4OTXH 5D70H 2ZNWA 1NWSA 3WXWL 4X0KA 2OQJA 5JPMA 5H35A 5D1XC 4PJCE 4Y5VA 4X8JA 4M1DH 3BYYA 3L5XL 3QIUD 4O58L 2OW6A 2BERA 5FKPA 1P4BL 1AO7E 3FQUB 2BVPA 4UUJA 5GGRB 5HHXH 4M9PA 5DZNA 3CC5A 4NZCA 4N8CL 5JQ6L 4XXCA 2H3NB 2YA2A 3UTZB 1OAZL 2XNAB 5CINH 5DQ9B 2YPKA 3QDGE 4JO3L 5FHAH 3GSWA 1V6WA 2DF3A 3CLWA 4PV9A 3RWFB 4NO2A 2OSYA 3GSUB 4OFYA 2NX5D 2RGMA 2FD6L 1EIBA 5B39B 5IFTA 4YDKL 4F58H 4DKEL 1T03H 2XFXB 4NQSA 5IFPA 4LKCB 2Z8WC 5IMMB 2CDGA 1A7PL 2H45A 5IB5B 3BKJL 4UQAA 4QRUB 1JJUA 5D7IE 5IVOA 3FQXA 4M3JA 2VN4A 2VT0A 3RMEA 3QPQC 2ARJA 3CUJA 2QMJA 5A6LA 5LVEA 3O6FD 1I8IB 2ZOKA 2CBUA 5C0AE 1FH7A 4FN0A 2FYYA 1FAKT 2R0WH 1OINA 5D2NB 4X6FA 3MZTA 3K0WA 4MD5B 5C09A 1YYML 3O3DA 5D9PA 4ELME 5I78A 1NANH 1WFUA 5CGTA 1DQLH 1FGVL 3MYZA 4P2RE 4FRWA 3HG3A 1BYCA 4OV5B 5C70A 2YA0A 4Q58C 4LVOC 2XGIA 3R06B 2NR6C 3QWRA 4JFDA 1W0WA 3L9RA 4ORZC 3CZJA 4QHKI 5SWZA 4LP4A 3T0EA 2CUIA 5CEXA 2VQUA 4EN3B 3GMMB 4GKNB 3PZTA 1U8JB 43C9A 1ZKAA 2ZSWA 4LAQL 4W6XB 1LILA 4P8WA 5BS0A 5JBEA 5A6JA 5HNNA 4H04A 2BX5A 3AIBA 2W62A 5IVXA 1FCCA 3Q1SH 3EJTA 4Z5RB 1NDMB 3VFRB 1VFUA 3UCRA 4G6MH 3P0VH 2Q6WA 5JBDA 15C8H 1U8HA 3UEQA 3U7AA 2WWKO 4MNHA 3CDYA 4HX1A 3PWVB 3F5KA 3QFJA 1T21A 3VDCA 1NBYB 5JPNB 5T1KB 3D5OF 3O8XB 4ZS6C 1HN1A 4FFWD 3SKJH 3KXFB 5FO8B 2VRJA 4R27A 2XIIA 3V0VA 1W1PA 5C07A 3X11A 1LQSR 4NHUA 2DLFL 2CRMA 4L8SB 1HJWA 5DJXB 1F4YL 3RTQA 1A3QA 1F2XK 5I1LA 5C7XH 2IBZX 2QADB 3MRKB 4W6YB 5HYJB 1KGUA 2IADB 1E3ZA 1VACB 2A6KB 4OGYH 1RUKL 5T1LD 4NHCL 4MQXD 1T04A 3PABB 3HE7B 3ZYZA 1HF6A 2WHMA 5M17A 4GI8A 2EJ1A 1MHHB 1FGNL 3E3QC 3VD4A 4LRIA 4AW7A 3K8MA 4EI5A 2IAMC 1MW0A 3F5JA 4HIXL 5CBAB 1VCAA 3PHAA 1MFBH 4MYWB 1UB5A 2MANA 3RNKA 4M6MH 5I8CB 1PZ5B 3QG7H 5JTWA 4RAUA 1ZVSA 1TQTA 1A6VH 3ZKND 5ADOH 3MRRB 1EGJA 1B0GB 3ZSTA 4EDWL 1TQWA 4G7YL 3VPLA 3S37H 1R34A 2BVUA 2XFXA 4NQSB 1JPTL 4MNQB 5D1QB 1U30A 4P2QD 2ZX6A 3CUIA 4QRRA 2FJFA 3GKZA 3DWTA 1KJMA 2FJFB 1TNNA 2Z8VC 3L1OL 4MJ5B 3BGFC 4UOQA 1UM5H 2DTMH 3MFFB 3EMQA 1WIUA 3QEQB 4NQTA 4HF5H 1CLYH 5F7KC 4XPAL 4NO3A 5HI4D 2R23B 1RK1A 3L5WA 4UTAL 4BS0A 1JF1B 4XV0A 2QQLL 1L9NA 3T04D 3OJDB 2BHUA 1MIML 1UYWL 5DVMA 5GJSH 1OPGL 3DXAB 1S7XA 3VFMB 1SJHA 4PJXA 5I1DB 4OF0A 3JV6A 2DSUA 2QTEA 1YY9D 1U2HA 4GW4B 1JZ7A 1IBGL 1GRWA 3AQUA 4UR9A 1I7UB 4OM1L 3MLZH 3MNVA 4PP1C 4TSAL 3DO7B 2XICA 2I9TA 4YEFA 2E6JA 4QHKJ 4RZCA 5FM5O 2N7BA 2IQAB 3KYKL 5D2LA 4G43B 3DX6B 1MUJA 3S4SG 1YEDB 4QRTB 5ICZB 1WTGT 4YEEA 2VVNA 1F97A 1QFUH 1NP0A 2ICWI 5CZXD 3WE6B 3RUGF 5BRZA 5TF0A 4C59B 3I85A 3QQNA 3DO3A 4QAWA 2YOCA 1OTTD 2CIKB 4QHNA 2X89D 5L88H 4GXPA 3P4NA 5FGBA 4QXTA 3T2NL 4S10A 2HKFL 1ZBWA 2VDKL 4LVHB 4KHTH 4QTIH 1QYGL 2VSDA 1BQLH 3QNZA 4DN3L 4A6YA 3ARWA 3O6FB 3SO3B 2GAZB 1A1OA 4OCXL 4ZD3H 4AD2A 3HUJE 5DZLA 3V2AR 3O2VL 1RJLA 4TUFA 5T3ZH 1HCFX 2OSLA 3LQAC 3R4DA 4JFSA 4Q7DA 4NZRL 5K93A 4U0RC 4LARH 1RIVL 1UENA 4NZUL 1US2A 5J1AB 3WDRA 5DD6A 3U4AA 5LGJA 3UR8A 2NY6B 2G3IA 4AZCB 5GS2H 3QCTL 5FV1L 2CERA 3TYFA 1K5NA 3MOAH 2CESA 4JHBA 1UB6A 4J6RL 2G60L 1L4IA 4HUKB 1KOAA 5BQ7B 1MFDH 4MQSB 4OLYH 4YAQA 4OZIF 1T66D 4V1DE 5SWQB 5CLTA 1EO8L 1ES0B 4XVTH 1KJVA 3VFUB 5SWQA 1KJ3L 4KROD 3RQ3A 3MLTB 3QFDA 5C0JB 1QHZA 4Z78A 5C86A 3JUZA 3IU4L 3GUTA 1W2KT 5EZJB 4HUNB 3TC9A 3VWKB 1F6AB 2B4CH 2NXYB 1BFOA 2OTUA 3EOBB 2FCBA 4ORGA 4WWKD 4UILH 4AC1X 5ADPL 3VD5A 3CLFL 3X12B 1MSPA 3RIFF 4JKWA 1ISVA 4MJID 1X5HA 1NUDA 2FATL 4HZAA 3U9UB 2Y8KA 4X0NA 3ELAT 4KV5F 2IG2H 1CZ1A 3IRPX 3P9LA 1H3VA 1E40A 4Z76A 3NCOA 1EO8H 1DBAL 4KRUA 4TNWK 1NCTA 4GG6B 3HPJA 4HPYL 1CU4L 1NGQL 5A8OA 3IRZA 3PZ9A 1JI1A 2XZAL 3OG4B 3LKQA 4GG6E 5F71A 1H4PA 2XTJD 4L3AA 2A9NL 1VEPA 4RFEA 4ODXA 2XKNB 3LQZB 2Z1SA 1T0NA 3Q6FA 4ZPTA 1HXKA 2IMNA 1BZQK 1CXEA 3AREC 4WTZA 5CGMA 2ENSA 1UJTA 5C0EB 1II4E 3WQ6A 4GZIA 3WIJA 4LSRH 4JJHA 2AKRA 3SDXB 2F53E 1NGYA 4TULH 3RGVC 2FECL 3P4OB 5FECA 1NFKA 1KFWA 3GMOA 3NTCH 4JPVL 5DC4B 3FQRA 2ZXDA 3PV6B 3D3VB 1X5XA 6A3HA 3QFJE 4OZIB 5E8PB 2X6MA 3SBWA 1JNLL 5HGHB 5IVNA 5GNZA 2A74B 4PJAB 5BXTA 1LG2A 3QUXD 4IIQC 3VXQB 5IFJB 3GDBA 2VIRB 1O7AA 2BDNH 4NQEE 1FPTL 1W9VA 2F9BT 1C5DB 4PJDF 3UYOD 1E5NA 2ZJSL 3RKDC 2R2EB 5I1EL 2ZSVA 2E40A 3BKYL 3U82B 4DZ8A 3BP5B 1IAKA 1KT2A 2JJUA 1IGCL 1WAAF 1L8NA 2APFA 3KYKH 4XMPH 2YPLE 4NX0A 1YMHA 2XRAL 3GNMH 4PRIA 2YC1A 5E4EC 3PWUB 4KK8C 2Q7YB 2FGLA 4OCMC 5F1IB 4BH8A 4JPKH 1BYAA 4IIQA 2ZUVA 5DDHB 5EO9B 1I8LC 1E4IA 3MLZL 3MSDA 4XMLL 5BVPH 1Q6DA 2XM1A 1FFOB 2ORBL 1BIIB 1IBGH 3CH8A 5SWZB 5FCSH 3IS0X 1HHHB 1JTPA 1JRHL 1BQHG 2PW1B 3UC0H 4L9LC 5IK3A 1MCNA 5E2UH 1E4MM 3DYMA 4P9HL 3D0VA 3UYPA 2Y1VA 1Q1JL 1X7QA 3REVB 1EO7A 1FFPA 3REVA 2EC8A 4AT6A 4KJWC 4WSJA 4F7TA 1CBVH 3GRWA 2BVQA 3T3MF 2OLHA 3RVUD 1T2QL 2FH8A 5IMKB 1JRHI 4M03A 4HUWB 4K68A 2QADD 5ITFA 3O6AA 4U1SA 2DLGA 4Y1AB 5ANMB 1CGWA 3RI5K 3GXTA 4PJBA 4X80H 2QHRH 5CSGA 1CZ8H 2Z1KA 1IC4H 5I79A 1P69B 4BZYA 2Q76B 2V5RA 1OAKH 1NAKH 1MFBL 4FS0A 4ZYKB 3BIKA 3KXFE 1YN7A 3LKSB 1ZANL 1HHIA 4GMSL 1HYSD 2A0LC 5C07B 1AGCA 2CIIB 3VFOB 1JZ5A 1U8MA 2WLZA 3MUZ1 5KS9B 5LGJB 3WIHH 4AZBA 5FUZL 5E2VL 2DQHL 4U6HB 2R2CA 5HI5C 5ABEA 5GS0C 1RUKH 5E56A 2I07A 4GBXA 3GTNA 1VADA 1DJSA 3F12B 1YEJL 2HH0H 1JFQL 3PP4L 7CGTA 2WYSA 1T22A 1FSKB 1KIPB 5D2LE 1CLVA 3UTQA 4K8RL 5EFIB 1CK0H 1AFVH 5B22A 2ATKA 2FWOA 4QT5A 2HKHL 4AMKL 3UG3A 4MJIE 1B4JH 3T4AA 1NGZB 4NZTL 3X13B 3HI5H 4I77L 2DMKA 4GKLA 1GZJA 1Z3GL 2AV7B 4WUKL 3V5DA 5GSRA 1LHZA 3VO0A 2I25N 3PG2A 2UYLB 4MLIA 4GW4A 5I19H 1ZT7A 5E9AA 4FQJH 5A6BD 2EECA 3B9VA 4PBWD 5D7SL 5E8PA 1KV3A 3ILQD 1BD2A 3HUJA 1CGVA 1DLFL 3UEZA 1KXVC 3ZDYF 15C8L 3TO2A 5INCA 2D3VA 5FA3B 4UQCA 1YEDA 4G6ML 2FLBT 4TSCL 3LS4L 1NFIA 1FRGH 2E9WA 4X7EC 2LE9A 4C7DA 4I0PA 4OF5A 4XI5D 5C08B 4A6YH 2D73A 3AFLA 2I5YH 1L0PA 1FNHA 1VFBB 2DJSA 4WY7L 5HVGB 3RWEB 2B1HL 1NUNB 1WJ3A 4KAQL 1WAWA 3N17A 2E9LA 3HR5A 3GJEB 2Q8BL 5HD8D 1BVKA 2ESVB 1C5BH 1OGAA 2A77L 5JMOC 3QUKB 4Z6AT 4Z7QF 5AY7A 3RAJH 4M93B 1P4IH 3QJFA 2Q87A 4J3OC 4JPIA 4ZFZB 5ABFB 1QO3A 4Q0XH 4YHPA 4UMGA 2NY2D 2C1PB 2PYEB 5CP7A 1OWQA 1CFQA 2H2SC 3I02B 1EPFA 4KFZC 3MBEB 1PGRB 3D69A 3KPRA 2FX7L 4PRNA 1W2PA 1P4IL 3IDIB 1HJQA 3EO1B 5IMMA 2A77H 1I4FA 3GBLA 4ONFH 1RULL 1YECH 1E55A 2YD9A 2E9MA 3QPXH 5DEGB 2BXZA 5DGRA 4ZOEA 1TFVA 1KWGA 3IXTA 2X4SB 4DAGH 1TCRA 4UIKL 1K2DA 4P8UA 3RDKA 1AJ7L 4MPKA 2CMRL 3QQ9C 1GYAA 3RP1A 2EZ0C 1JWSB 1DTUA 3OKEB 5I74C 1QA9A 4NKQB 4YHKH 5IXEA 1HWGB 2EDBA 5D93C 5CEYB 1IC1A 1KQZA 1KLUA 3MV7B 3LS4H 4PG2A 3T1FA 2NY1D 5E1QA 4PMYA 1HQRB 1N0XH 5KANI 3MRDA 4ELMF 5IESL 2VOTA 4FFZL 5AYUL 4NN5C 3WELA 3TWCH 3S5LA 4CMMB 1ZB5A 3MRGA 3B2VH 1B3JA 1NBYA 2B20A 1IGFL 2ZZUT 3BGFB 2CGRH 1MHEB 4HIIB 2IFFL 4U6YA 4LQFL 1VKXA 1KCKA 3GSXB 4ZSOB 1MREH 1U8LA 4P3DA 3IJHA 5MEND 3EJZC 3BT2H 2EE9A 1AI1L 2DQUL 1BGGA 5FO9A 1J1XL 3JBG7 4OAWB 4HKJB 1QBBA 3ZT5A 2XI9A 5ABDE 5FOBA 1F02I 1HDMA 1KG0A 1KPRA 4F9JA 4M1DL 1A3RH 4N0YL 1K3ZA 1WZLA 3V7AE 3IAQA 5D6CB 1FBIH 1R3IL 4YE4L 1W9DM 1OSZB 3LN5A 2HWZL 4MJIB 3DX8B 5IQ7L 4P5TA 2WAGA 2DM7A 4XTRC 3LQZA 4BM7A 4XCYB 3VIFA 4HIEB 4F8QA 4P2QE 1XH3B 3W39A 1TQUA 3AZRA 2W0PA 2MHAA 1TDQA 5C0CD 2OXHA 3S35H 4MNLA 4HX1B 4X83A 2CD0A 3BAKA 3A47A 3O8XA 4GMSH 1LE9B 1EGZA 2V5MA 1IC7L 3SOBL 2VZ3A 4JFZL 5EC1B 4HOWA 1CG9A 4PRHA 1ETZA 1SEBB 1HXMB 3DETC 1LF1A 4M6NH 3SEPA 4MS8C 2D03H 3KNBA 4B3KA 4ZXBA 2ICES 5DO2C 2VDPH 1IQWL 3IYLW 3QYCA 4NM4H 1X5AA 3PIQA 4RFOL 1FL3A 3VD3A 1V03A 3SE9L 1Z5LA 4MD4A 3HNVL 4V1DD 1KNOB 5KS9A 2HAZA 5B21A 1T1WA 1N6QL 5IT2L 1D5MA 3I50H 3KLHC 1ACZA 1BJ8A 1W3JA 3LIZH 1T20A 1A6PA 3JWDL 1WFOA 1MQQA 3BQUB 3L3HB 3V0WL 1REIA 2FLRT 5C71A 4HS3A 3UDWC 3T2QA 1A7OL 1T5WB 3VE0B 5ECUA 3RKPA 4R0LC 3KEHA 3OR7A 4NM8L 2EEDA 4RMWA 1TXKA 5DR5H 1M7DA 3MZGB 1S7SA 4CJ1A 5EBLA 3WJJC 2V5CA 4H41A 2W5FA 4O2EB 1CFQB 2VSCA 5HDBF 3I9GL 2VX7A 4XVJL 4PEEA 5D6DA 2W9EL 1S7RB 1WZKA 5F93C 4RNRA 3AM8C 4N5ED 1R8LA 1AY1L 5EFFA 1Y0LA 3BIAX 2BXYA 4JDVB 2EPMX 5IR1A 3FN0H 3CO4A 4J1UA 3UPRA 3KPQB 1LP9E 3RZWA 3UJTL 3SN6N 4OGXH 4LCUB 3S88H 3LS5H 5SWZD 1EX0A 3CXHK 4W89A 4RCAA 4YHNA 3TZVC 1KTKE 2VLME 5GRJL 4U5IA 5EBAA 5IHUL 3FN9A 3IVKA 2VKWA 2J7EA 2HLAB 25C8L 3E8UH 3SURA 2CIKA 2W92A 1FORH 4TOYH 1NC4A 5MERA 5I75B 3B8SA 2C3HA 4G7VH 2QPSA 3J7HA 2EDXA 4XAWH 1B3WA 4WKFA 4CCCA 2MQCA 4OM0H 3ZYOA 3UBXI 3WNPA 1X5JA 3KGRA 2BCKA 4D72A 2IAND 3TPKA 5F3BB 1JNJA 3FOMB 3MV11 5JPNA 3MRMB 2CLVA 1HKKA 4QF1A 2FEEI 4KI5E 1ZT4B 5HGDA 1X4YA 5F9DC 5HTSA 2IEPA 5E8EB 2VDOL 1NOWA 4M62L 4GW5A 5D2LB 1QHOA 1BEYL 4YC2B 1HEZA 2DMBA 4NRXA 1U3HC 3D3VE 1HJVA 3VX0A 4PG9A 3VFPA 1HIZA 1OLZA 3K2MC 3ARRA 4L9DA 4AY1A 4F9LA 5T3XE 1WC7B 3DX2A 1LK2B 3MA9L 3DX8A 3RWIB 4Z18A 4NO0A 5GRUH 5D96B 4QFUA 2NX5A 4OFYD 4C56B 1ZS8A 4AIOA 2MHAB 2EDRA 4XH2A 3WBAA 1QP1A 2V5YA 1CU4H 4XMKH 2YBRA 5ETUB 3FO0H 2HG5A 1MLCB 3SO3C 2ZPKH 4EOWL 2OK0L 1JHKL 3VFVA 1V0NA 2X2YA 4NFBA 7FABH 2CKRA 2X70A 2J77A 5JW4N 1IAMA 1T1YB 4G6JL 3SGDI 2ZCKL 2QKIB 4F9LC 2AEQL 3AU1B 1MIEL 2G5RA 3BZ4B 4RIRB 5ADPH 4UILL 3QCUH 4KPHH 2XOTA 1ZK9A 2D23A 1OGAE 1I7TA 2BMKA 4NQCE 5DJDB 1AE6L 3F7RA 5FCZA 2UWEA 1EBAA 3IGUA 2AJXH 1EO5A 4K23L 1H3WM 5DS8A 1RZKH 1LD9B 5A3IC 2HVJA 2YA1A 2OI9C 1LD9A 3MLUH 1UFUA 4JFEA 4O4YH 2V2XA 4HKBB 4QYOB 4UNTA 5J6GA 1IKNC 1P6FA 3PNWB 4P9ML 2DQFB 4HUVB 4J6RH 1SMDA 3W6MA 4G9DA 1PY9A 3TV3H 4N90E 3MX0A 4MGXA 3BDBA 3D4YA 2UY7A 3OR7B 4HGKC 5E94A 2VLLB 4FLRA 3ZR5A 4XZBA 2DLEA 4ZAKC 2EH8H 5BVJB 1RUMH 3DX7A 1RIVH 4E41B 1LJYA 1W9UA 4PLJC 4LARL 4OUEA 4I3SL 4CN4A 4KK5D 3UTZA 4OCNC 2AW2A 4WWID 9CGTA 1ZMYA 5I1HL 5T3ZL 3O4OB 1J86A 2VITB 1XD1A 3QT2A 4JEGB 5D7JC 1CLOH 3KPNB 2XZQH 2FIKA 5GGTA 1BQLL 1TVDA 4KRMB 3LX9A 2VR9A 4QTIL 2OL3H 1AD0A 1YEFL 5DMGC 3T2NH 3ZR6A 4YHGA 5DUML 4CUCA 1HH9B 3KJ4B 4KQ3L 1I1YB 3GMRA 4O9HH 1EFXB 5IOPB 2JEQA 3AHTA 5K9KA 4MXVE 1C5DA 3BLPX 5C09D 3GZKA 3X3GH 1H0GA 3K1KC 1LO3L 2VAAB 4GXVL 2CIPA 5D7IB 43CAB 5D7JA 3IDMB 2O5YH 3VFNB 5F7FA 1KLGB 3CFCH 2J8UB 4GFTB 4P2QA 1TVPA 3ZT7A 3SE4C 3DSFH 4PREB 5D2NC 1ZBVA 2V9QA 4TVPE 3PV6A 3S5ZA 3B5TA 4DGIH 4TUJA 2SEBA 4L5FL 4OV6F 3BSGA 2R4SH 2SEBB 1HHIB 2V2WB 2F53D 5FAAA 1CLZH 5CWSB 3G6JB 3UP1A 3RL2A 4NWUH 5IHBA 5C92A 3ZE1E 3BVNB 4LSTL 3N06B 4MQ7A 3UBXA 3HC0B 2BC4A 3C2AL 2YD8A 2I07B 1CLYL 1G9NL 3FL7A 4YFLI 3S9DB 3VD9A 1I3VA 1YPZF 4L3CA 3ARDD 4BQ6A 4M02A 4WFEE 4NXKA 2QQKH 5L2JB 3DVGA 2CR3A 2BVQB 4U1MB 2BNRB 1W9PA 4DEPB 3SUUA 3DHUA 2NY1C 1ZA3A 4FFVC 1ZSDA 1BZ9B 2NMSA 4G7YH 3RVTC 5L6YL 1EUTA 1QNZL 1UXSA 3WIHA 4PJ5E 4PJIF 5IF0A 4BZ1L 2OXGA 4GRWE 4PJFA 1NSNL 1CL7I 4OLVL 1BLNA 3NCEB 1XCTB 3QUYD 5GSVB 3UETA 1QRNE 1S5IH 3DYOA 3WKNA 2AMGA 3O11A 1TVNA 4LU5H 1BQHB 1F45A 3V4VH 5EZIH 1C5CH 1INQB 3WFLA 3BUIA 2BVTA 4XGZB 4ZODA 1D5BB 5C0NC 1BBJB 1NAML 1MQRA 4LCIL 1UJ3A 3EJSA 5TE7L 5IBTL 1CPUA 4HUVA 1U58B 3CFBB 4B41A 1I8IA 3RM4A 4Y5YC 3DUSA 2W9DH 3GO1H 5JW5B 2V17L 4OD1L 3ZE2E 2PO6C 2X1IA 4Z0BH 4BQ5A 1UR1A 1PZ5A 4MDIA 4HZLB 4JG1L 1WZ1H 3WL9B 2Y36L 2ZG2A 1ONQA 3LZFH 4LIQL 4MNGA 4P5KA 4RISL 4EBQH 4HOXA 3FZUD 1EMTH 1MFEL 1QBML 2V7NB 2HFFB 4P3CL 3VMPA 4BFIB 4GKZA 4WW2C 1BFSA 1EZVX 4LLYB 5I73B 3OX8B 1WO2A 5KZ6A 2UZIL 4I3RH 2R2BA 3R8QA 4FLSA 5DMIH 4YHYC 2A38A 3JWNC 4M3KB 2O5ZH 3W0WA 5MP6H 1BBDL 3NOIA 1I3UA 1DWGM 2BNQD 2ENYA 1HXYA 3FNDA 4X98A 4YK4B 4UIMB 4Y5VB 4S1RH 4GRWH 2FZ3A 2R39A 1KT2B 2W60A 5E8OA 4ZXLA 1UVQB 1WCBA 1BPVA 4Y5XA 4UFJA 4R7DA 1XIWC 1R7OA 1IL1A 4J3WA 2WMGA 2RCSH 1GJUA 1J0KA 4XP9L 2L7JA 3SCWA 3U30C 4CMMA 3VFMA 3MLRH 5FYKD 5SX4I 4F7MA 5D9NA 1BVLA 1S7RA 1NQBA 4XBGB 1U41A 1OLLA 3BEWA 3BKMH 3QNXB 3QDGB 1I8MA 3ALPA 1OTUD 2AJ3A 5BRPA 1R5VB 2DQTH 4HUUA 3D0LA 3LRMA 3QEQD 4MVBC 3BXWA 1FVDB 5KOVC 1NCDL 5CZXC 2J7DA 3NSNA 2VL5B 3AZTA 2FX8L 3C08H 2R2HA 4KRPD 1EDTA 2P1YA 2X0YA 2MWCA 2VZVA 5DMYA 1PQZB 2YD2A 4PGDA 4KRNA 1ES0A 2BV9A 2OBGA 4EJ1C 2O5ZL 4KDTA 1KYOK 4NNPH 2BSTA 1A7QH 4Z7UB 4XAKD 1H15A 4HXBL 3RY5A 2X5PA 3AHVA 1CDUA 4MNKA 2AJUH 1UB5B 1QFOA 3EBAA 4YHPB 3AIEA 1VBUA 4KKAD 5TDNB 3P9MB 4BFBD 1UWXK 4CU6A 1Z9LA 3S7GA 4K07A 1T6WA 1UR0A 3QHOA 1WWCA 1V3MA 1NARA 3HZKB 3RDTA 3H9HA 4DCQA 4EUPG 1ISXA 5EUKB 3V95A 1ZL1A 3S96A 3C5SA 1IGJA 4OCSH 3TVMD 5ID0B 4W4NA 1N6VA 1U3YA 4FQPA 1R24B 1NCAH 3G6JA 1C8QA 3U57A 2WINB 4CD4A 3VDHA 4WHCA 4JO4L 4LLMA 3FO9B 4NGHL 3D25A 5MI0C 4CVUA 3NIFE 2XWTA 3FTGA 5IBTH 5TE7H 3QI9B 2JJTC 4PS4H 1UZ6E 1GOGA 1DP0A 4OCWL 1IAOA 3SGEI 5CSBA 2VDLH 3IDJA 4UOJA 4ODHL 5HHOE 1PY4A 4YO0A 4S3KA 3JV4A 4M6AA 2PW2B 4F33B 3V5DB 1VA9A 2IBBA 5A43C 1S5IL 5CZKA 4D6EA 4TVUA 1FN4A 1BWWA 1ED3B 2NY2C 3NA4A 4LVEA 4HBCH 4Y2DC 1DE4B 3RZCA 4HFUL 4P3DB 1IEAB 1RU9L 5E7FA 3UZEA 3DO7A 4X6DA 2WWMC 1GIGL 3EDEA 3QIBC 3T0EE 5FL1A 3O6ML 4XNYL 3T2OA 2FL5B 4U33A 2P5WA 4FQHB 3RA7L 3S34L 4GO8A 3FB6A 5FA3A 2EPLX 3DDFA 1U8JA 3U9PH 4PJGF 4ODTL 4CVZB 1EVTC 1KJ2H 3ZOAA 1RD6A 4FLOA 1DQDL 3O6KH 1ZVHA 1C90A 3ULVF 3RIKA 3L4ZA 1K9EA 4N0FB 4YDIL 3DGGB 3VXPB 1ZU8A 3HJEA 5BVJA 4JZOA 4D9RD 3MU7A 1XGPB 5C0CE 2D2OA 2AKRB 5D7JB 4PJ8C 2DL2A 1U0QA 4P3WA 4X5LA 4YXKH 4H8VA 1CFNA 4FFYL 3KVQA 3W38A 3RL1A 1IM3B 4XNQB 3WF2A 5J9PA 5GJTH 2NY0B 1W1TA 1NKOA 4M8VA 1YEKH 4CMHC 1A4JB 2Z4QA 3BAWA 3FQNA 5F9JA 2F18A 3B4NA 1ZHBB 2H9GA 3OBAA 3NIYA 4G6KL 1UADC 1C12B 3LQAH 3L6FB 3FB5A 4ONHA 2OS7A 1HVXA 3LOWA 3QNYA 3QUXC 3BDYL 1RZ7H 4X7FC 1X5YA 3WS3A 2O5XL 2AXHA 2EKSB 2APXA 1OSPL 2HT3C 5TPWH 4D9LH 4I4WB 2H2PD 3KLAB 3BEVB 4AYSA 4TTUA 3DHMA 3KYNB 4OSUH 1FL6B 4I48A 4XC3H 1I1AA 4PCTA 4X6CA 1V6UA 4KI1A 3GIVA 4HDIB 3GUTB 1BLIA 3QUZD 4W70A 3QUMH 2OYPA 4W4OC 5C6PB 4MMXC 1V8HA 2B2XL 3UO1H 4DOHE 5BWFA 3ARXA 4LDLB 5L7XL 1D6VH 2VNCA 5EO0B 4PMRA 1JAKA 1R3JB 3SGJC 5J3HD 1UZ1A 4RMRA 4ZENA 4I2XB 3TBWA 5JW3L 1N5AA 5DRXA 3V0VB 3WD4A 5MEPB 3ZTNL 1V6YA 4NN7C 2N4IA 5I1IL 1TVBB 5CSZB 3AISA 4XNUL 1G7QB 1WICA 5IK3B 2WHLA 1MFUA 3RZCD 1RUAL 4HH9A 3AS2A 3T77A 1CCZA 3V52L 1TETH 1XH3A 1CD1B 3C09B 3W39B 5L9DH 4Y89A 1CIUA 5DLML 5IJVA 3V6OA 4P5TB 1FIEA 1N5YH 3TH3T 1AQDB 4O51B 5D2LF 4K23H 4TVPD 3NIDF 2C4XA 4MAYB 1FZOB 3HE6B 4P5MA 4ACZA 2ARWA 2BCKB 3EYQC 3H42H 1J0IA 1DUZB 4ZUWB 1YY8A 1W0YT 5IEKA 3V6FA 1IARB 3HC3H 4LSQH 3ZMRA 4LYQA 4ZFGL 2AXJA 4PJXF 4DFHA 4ZG1A 4PRPB 2J1KA 5E9DB 2I9TB 4NXSA 3VFWA 4PY8J 4EDXA 1KC5L 1DQQA 1RZJC 4GBXB 4Y19D 4NCC1 2OK0H 3LXCA 1E6PA 1WV7T 4PJHE 1A9BA 2JCCE 3ZKNC 4JRYD 4FZ8H 4V28A 5DUBA 4D6FA 1KIPA 4BUHA 5I6XB 1U3HA 3N1MC 4FQLH 4PJHB 3JWOH 3OAYH 3G04A 3INUH 5IOPA 1E15A 3RJQB 3P40A 1UJ3B 3LN4B 3AXLB 4WTZG 2XTJC 2XYCA 1FP5A 2P5ED 1UZ4A 1ZHKA 2A6JA 4RGOH 2X1OA 2R0KH 2ZKHH 4WTWA 1WEJL 4X7DC 4UDUA 4BQBA 4YO0B 1QSFD 2IH1A 5EBLB 4OD2A 1XH2A 1B3VA 4XX1E 1B1YA 2HRPL 3ZSSA 3TA9A 3BMVA 1A6TA 5HHOD 4JKKA 3HAEB 1BYBA 3KPRB 2PXYC 3IANA 1SM3H 1P7QB 3SDDC 2LAAA 1EAPB 1KENH 1AD9A 5CP3H 5EIVA 5IR1B 4G6AD 3WS3B 3LCYA 1MCCA 3FT2B 3TM6A 1FCGA 1W91A 1J88A 2QSVA 1A6AA 4G8IA 4B7LA 1MCBA 4JFDE 3K8LA 5F7NC 4QYOA 3S2CA 4IOSD 4NQCD 1P4LA 4RFNB 3SY0A 2VLKB 4AENA 4PTXA 4S1SH 4HGMA 3U46A 3WFCL 1PIGA 3U1SL 3APGA 3MRNA 3QUKA 4P4KA 1LO0L 3WFEL 5HYFA 1YNTA 1K9FA 5GRVK 4UFLA 5F88B 1S9VA 1JI2A 3DX9B 2NLJA 3GK8H 2YEZB 5C1MB 1OL0A 1IL1B 4DGVH 2Q8XA 1P7KA 4KROB 4WW1B 2R9HC 1BGXH 5CHNB 2P45B 2X4OA 4UQDA 5J9PB 2PWGA 4KRTA 2EXYC 5C0GB 4JO2L 3HE7D 2V9RA 2GTWA 3GHBH 2VC2L 1UA6H 1B4RA 3QXTA 4L8SA 5DFTA 5C0BD 2FEDC 4LQ1A 1IGIH 3GBMH 1BJMA 4O00A 5FOBB 3WJLA 1G7MA 3TTSA 1TZGH 3MBXH 1R87A 4D0BA 4JANB 4KK6D 1YQVH 1NJ9B 3BHBB 4JVPA 2UWEF 1I3GL 3WFZA 5J1TC 1R86A 3RILA 4BELD 2PWFA 3VA2C 5F7HA 3EKCA 4RFEB 3JWDH 1F11A 5D4QA 4WGVB 4S1DD 1G9ML 4ZS7H 5AUMB 2WC3A 1JGUH 3B9KD 4PB9L 1X4XA 4OIIH 3B9EA 2GAZA 3MRGB 3WL9A 3IAGC 4ZUVA 5E2JA 2WUBH 1BGXL 1FFNA 1U8IA 3ARBA 4LPWA 4FQQA 2K9UA 5J06A 1HQRA 3KLSA 2L0DA 3MBED 3GB7B 3H0TB 5A40E 1HKLL 5TPWL 1OSPH 3IFNL 5JHDE 1TJHL 2VTFA 1H8OA 3L3OA 4LSDA 3ZKMD 1AGDA 2DIJA 4YDVA 1WITA 1U8OA 2Z93B 4UV4L 3RRQA 2YXFA 3V5HB 4D2NA 1Y7VA 1G9MC 1QLFB 4KZDH 4GLRH 1MOEA 4MZ2A 1EXUB 2X0HA 3ARFC 3BAXA 4JFQB 5A2AA 2VB5A 2BRRH 1E4NA 3FOLA 4XCEB 4JFEB 3W82A 5FGSA 5FM8A 1F2QA 2WMJA 1QWUA 1KXQA 5F9WB 3H9SD 5CD5D 3MUIA 4JDZB 2G2RA 3CIVA 5HOSA 3O3DB 4JDZA 3VMNA 4PUBH 4IOIB 2X4RA 4NQED 1I85A 3WXVH 1MQ8A 3W5NA 3DLQR 1GHSA 3I2CL 3MLSL 4NRYA 5E2TL 5EU6E 5HJ3B 2ZNXA 1S7WA 2C3GA 1GUVA 5CJXC 4U4BA 4PR5A 4DVRH 1VFAB 1MRCH 2HTLD 4NNYA 1OP9A 3V8OA 1DQDH 3EBVA 3AI0A 3BUQA 5C0BA 5HYSB 3O3BA 3WIIH 4IS6B 1RSFA 2ADFL 2JE8A 3TBYB 5KSAA 3B3IA 5C08A 4QHLA 3BAYA 3OGSA 1FNSH 1GIGH 2YHGA 1CFVL 1LP9F 1WT5A 4M7LH 4N0FA 4P99A 1D5ZB 3MUGA 2VL5A 1MCQA 5DVNA 5HYSG 5C0FA 1Y18A 1RAMA 1BZ7B 1PYWA 2P5EB 1JFHA 5B8CB 3AZSA 4PJEA 3UZQA 4DAGL 4U0RB 2R2EA 1VRXA 2JCCB 5JORB 1XGRA 3W4RA 4PJ8D 1XFPA 2A6JB 2YK1H 3SKUD 4ONGH 4JM2C 3OAUH 4JAWA 2ZWYA 1EEYB 1XF5A 4UV7L 4GAGH 2PF0A 3LKRB 3PDOA 4FQXB 2BRQA 5I30H 3O6FC 5CUSL 5KJRL 3QHNA 1HHGB 2Y5EA 3FQWA 3KPSA 3PWNB 1NUFA 3QUZA 4KHXH 4NGHH 4U1JB 5CCKL 3EFFB 4KI5F 4XAKE 1E56A 4Z7OE 3QULB 5AAWA 4LVNC 4ELMB 1VAHA 1S7VA 1BOGB 2CIIA 1GGCH 1R3KA 2P24B 1CWVA 1JTTA 3SE3C 5IB2A 1IKFH 1PX8A 5D6CA 3T0EB 1J5OL 3LSOA 5DFVC 5IB2B 2VLRB 3RPIA 4ZQKA 3ALFA 3GMMA 4GKNA 3RPKA 1N4XL 4TVCA 5F7MC 4Z7VA 5ID1B 2IPUG 2AQ1A 4G9FB 4M9OA 1YUHB 1JHLH 4HIJA 2N7AA 3W0WE 2OJZL 4LLVB 4LCWE 1N6UA 4TSCH 5A3HA 5JBFA 3H53A 3NFPB 4L1DA 4WV1A 4W7WA 2JF1A 5AZEL 4WW2B 1VKXB 2MNUA 3QQ9D 3VH8B 3FZUC 5DRXB 5I1AA 3UTTE 2W1NA 4LIQE 5E5UB 4N9GB 1WSST 2EO7A 4PJ5B 2J5LC 1RFDL 1MW1A 4CMHB 1WCQA 3LKOA 4OSUL 4AEIH 1FZMA 4WUKH 4HT1H 1YMMD 5CEXB 3EJYD 1YJDL 3EJJX 2B1AH 2BP3A 4YHIA 3P30L 5I2UA 4PJ7F 1X7QB 2B1AL 1F58H 1ZOXA 4GO6B 1D5BA 3FAWA 5BMFL 5T1DL 2E27H 3NABL 4OQTH 4OD3L 4QRSB 5BZWB 1KJVB 1AGFA 3VFUA 4FNSA 1X3DA 4LSPL 2VXUL 3MMEA 4QRSA 1ZEAL 4G80B 3ULUH 5IM7A 3SUWA 4KQ4L 2HT2D 4G6KH 4P49A 1FG9C 3NUKA 4U1SB 3CLEH 3TTOA 4K3EL 3TH4T 2P8MA 3WQ8A 1RIHL 4LPXA 4E4PA 4HS8H 4E5XA 4R26L 1NFDA 4TVPH 1ODAA 3S36X 5LXGH 2XV6B 5FYJE 2F53B 2BVEA 3CU7A 1A3HA 5EC1A 5F7EH 3CH1B 4OT1L 1JYXA 1IC4L 1L6XA 4WEMB 1NGWB 5DO8A 3S35X 4TYUA 5IBUB 1B2WH 1HXMA 4XP1L 3T0BA 1AGBB 2DB8A 1MXGA 2D7MA 3A0OA 4PJAA 5DJDA 1E1EA 5C0AA 2BSRB 1RPQA 1IQDA 3ARYA 4ODTH 5JOFB 4ZE4A 2YUZA 3ILQC 1HIML 3G6DH 5F9WC 3K7UA 3RA7H 3WHXB 1I7RB 1G6RH 2F15A 5J12B 1NPUA 5SWSA 3U0WL 5EA0H 2M26A 4LIQH 1I1AD 2BJML 2FX9L 2VH5L 2Y36H 3LZFL 1S3KH 4RISH 4EBQL 3PBGA 3MPCA 4I9WE 3O41A 3TJHD 2DMCA 2VXTL 3TA3D 4R5EA 1FZKA 3R8BB 2HTKC 4JG1H 4WNQA 2CDEB 4PV8B 4Z0BL 5F6IC 3LRLA 1WBXB 4NWTL 2UYLA 1LK3H 2MSPA 4JKPH 4AD3A 2W9DL 3GO1L 1DBBL 2HT4D 1KULA 1P6WA 2V3FA 4U1JA 2AP2A 4P2CG 4C54A 3D85D 1E6RA 3S4SA 4M7KH 1S7TB 5CJQL 4E41E 2MKLC 4OFVA 2J12B 5C2UB 2WZHA 3DBXB 3VFPB 3UCQA 4JN2B 2ZUUA 5BZDA 3WO3B 4NKIL 3M17B 2EACA 3L3IB 1GQJA 4CCDA 2JK5B 3A6CH 4LP5A 5I0ZA 3CHEA 5I1EH 1BIHA 1VENA 1P4LB 2W9LA 3WUGA 3WLBA 4DKAA 5FOJA 2J8OA 4OCSL 2B0SH 2LVCA 4Z78B 4KMTH 4P46B 4LFHG 2OP4H 3K2UL 1EH9A 4IRJD 4KRPC 2VXVH 4ODSH 3VWKA 1LE5B 1QNSA 3QUMB 1MW2A 4RRPA 4PMVA 1K9DA 4RWYH 1SQ2N 4MA3B 2Z92B 4NZFA 2ID5A 4OLUH 2XN9B 2X4OB 5GISH 4GRWF 3S96B 4BQ4A 1J0YA 3S98A 1QFWH 4AZCA 1BMGA 4TULL 4HK3N 5JUVA 5E95B 5CS7A 5KSBA 5C9KA 5DVLA 4C58B 1E0VA 1M71B 5F1OB 5C07E 1UWGL 3WH6A 3BZFB 1JN6A 2WBJB 3W0WD 3V4UL 1NLDL 1QZ1A 1XCQB 4S11A 3LB6C 3BZFA 1FG2A 2VDML 1BVNP 3ZHKA 4L5FH 4XCEA 4PSPA 4BSVB 2AAAA 3BWUC 4TUOA 5DD5H 2GJXB 2NY6C 4LBEA 1IGYA 2J7LA 1EEZB 4L3CB 4PRHE 3IDYC 4X8XA 3BAEH 3HE7A 4HC1A 3MOBL 3QR2A 3ZE2F 2DI7A 4F7PB 1M01A 1CGXA 5HBFA 3KYOB 2DYPA 1X5FA 4M1GL 4XPGH 3AU1A 1CR9H 4G9FE 1ZGLM 4W8LA 3UTSE 3BPNB 2NNAA 2EDJA 5CJXA 3N1QC 2ZG1A 2J79A 3X3GL 4KV5E 2GSGA 1FNLA 5IEHA 3MNWB 3EOAA 5LG1A 4K8RC 4LPYA 5K59E 4KQ3H 3RWHB 3KYMA 2AJVL 1T7VA 3I3EA 2B39A 4LPUA 1IT9H 5DD6B 4F7EA 2CH8A 4H88H 2GT9B 3O9WD 3IU4H 1LWJA 3FRPG 3MI6A 3SE8H 1CLOL 3QEUA 5IHSA 4HV8A 1CFSB 3JV0A 1QEWB 4LHUD 1BAFL 3UPCA 1AHWC 2AXFB 4HV8B 3BUYB 4N68A 3TO4B 4X4XB 3QEHB 2ATKB 3FRPA 4QRPD 4O5LL 4PJDE 5BJTB 3O9WC 4X4XA 2DQEL 2BY3A 2PO6D 2EH8L 3GGWB 1F4XL 5CD5C 1BM3H 1OF2B 2B7DT 4KKBC 2NW0A 1FNAA 3BN3B 1WBXA 3GMOB 1OD8A 3V4PL 1DUZA 4ZUWA 2D31B 4MNQD 4PGEB 5CILL 1PX4A 1U95A 1HKIA 3PP3H 5HVFB 2EC9U 2JELL 3WUZA 2IANE 3WFEH 3TIDA 1HL8A 1E6JH 1MCSA 3ESVF 1EFQA 4PJXE 4ODWA 4TTGA 3R1GL 1KBGH 3O2VH 3IGAA 1BSIA 4P7NA 3GBNL 1IT0A 3WUEA 4F7CA 3NCMA 4ZD3L 4LCIH 1VJZA 3B3IB 5CLWA 5K9KB 4UFIA 3DHJA 3EO1A 5J1SC 2AQ2A 3QCUL 12E8L 4KPHL 2CKBB 2YL6A 3LB6D 3PL6A 3H9SE 3BW9A 3CMJA 5T3XD 4J4PD 4YFEA 4G6JH 3L3GB 2ZOKB 4X6EB 1CDGA 2VISB 5TGBB 4R2GB 5IGXH 1R0AH 1QLEL 5CJBA 3MRNB 1JWSA 2VXQL 4HK3J 5E00A 5KTEH 5EU4B 5E6ZA 3WF3A 2VZSA 2PO6A 5I18H 1T89C 4U5KA 3ZJ7A 4XMKL 4L8DB 4Q7NA 3U2SB 3D39D 3IJYB 4RGOL 5J0BA 3HAEA 4K8RD 1A7RH 1XT5A 3RWGB 3MA9H 4UZSA 1H3GA 2LVEA 5F9AC 1RJZB 1NLDH 4JFVA 2AJZA 2KQMA 4LLQB 1EGJH 1T1ZB 4JJ5B 5HGAA 1TJIH 4Y8AA 3GJFK 1J0ZA 1KB9K 3VIIA 1DQTA 3DX3A 3WD2A 3SCUA 5MHSE 1XH0A 4E9LA 4HUUB 3MRKA 3BPCA 1TQCC 5DT7A 5FB8A 1B6UA 3MO1B 1T1XA 1RPKA 3EZ8A 3OKNB 1CTNA 2DBJA 5ABGA 3BIBX 4X6DE 5F8RC 4LSQL 4F79A 5FGCB 1JGEA 4RWYL 3WD5L 1QI5A 3KJ4C 3L1OH 3LAFA 3ZJKA 2C9AA 2GQHA 3DVGB 4WJXA 2A3BA 4M4PA 1HE7A 2XA3A 3MODH 4OF6A 5DD0H 1BX2B 3FONB 2DQIL 4KUCF 5FL0A 2D7QA 4XBEH 4BQ3A 3S6TA 2OSLB 3N9GL 1KBKA 1F4HA 2XACC 2WIMA 1FYTA 1YC7A 4HXAL 3DMMB 2HMID 2A9ML 4UQEA 1T2XA 2VABA 3STLA 1GHRA 3SDDD 3HZVA 5IUSA 2EBNA 4QXUH 1QNRA 2GJJA 3NPSC 4GQPH 1LDPH 1Q0XH 2R2BB 2XN9D 3VXMA 1LEGA 3ZYJA 5C2BL 4Q9RL 3BDXA 2Z35B 4N8PA 3U79A 3SDCA 2WV3A 2HVKA 4KY1H 5I1IH 2JEPA 5HDOA 3WHXA 5JOEA 1FVEB 1KPVA 5E03A 3MO4A 2HP4A 4BH7A 3WJLC 4UQ3B 2ZP0T 4X4YB 2WK2A 4LLMB 2FWOB 4QT5B 3SCNA 3EIFA 2G41A 4U49A 1IGYB 3B2UD 3BFOA 5IMLA 4AL8L 1E6JL 3K1DA 4KTYA 3ZO9A 1A7OH 3DGCR 5D2NA 5EFIA 4J2XA 3EMCA 4H8WC 3O4LE 4NUJB 5DK2A 2J8GA 4WI5A 4Z7QE 5CILH 4EKJA 2QL1A 1NFDB 5CFHA 5CJ8A 3VM5A 4LPCA 1IILE 1FN4B 4D0DA 4LL9A 3ZE0F 5CJ5A 3FFDA 4U1KA 2F53A 4LYPA 2CDGB 2FBJH 4D9LL 1P5VA 4OZHF 4XXDA 5DA4A 1RY7B 1DEEB 2NW2B 5D1XA 5EPMA 5EORH 1U8MB 3FHAA 3NFSL 4UB0H 3WY3A 5EU5B 1LP9A 1PJ9A 4HPHA 3NSXA 5A6BA 3D85B 1I1CA 2EDEA 3OL2A 3PGDB 1H0DB 4WFHE 3NZ8A 1YNTB 2WVTA 1WE5A 4DWSA 1RIHH 1YEKL 2V3GA 1YEHL 5SV3A 5DDHA 1OW0C 5EO9A 5T5FL 2R15A 4CKQA 2JJTA 4E0RB 2DWEA 3S35L 1BAGA 4G42A 3ZKSD 2A3CA 2H3NA 4JM2F 4GBXD 4Y19B 1W3KA 1BVLB 3X3FH 1RIUL 1LG1A 7FABL 3B6SA 2YPLA 2X1WL 2AABH 3QJFB 2VXUH 1XR9B 4MAUH 1QFPA 3CXHJ 5E5MA 4YDIH 1H41A 4G3YL 3P3YA 3TBSA 4M93C 3F62A 3WHE1 4JM2D 1S9WA 4P46D 2Z8RA 3FQNB 3D0VB 3QHZH 3F5LA 3H2WA 3BO8B 1MJJB 1XF4B 4IDLA 5DTFA 5LGKA 1FVCB 3P4NB 2XWDA 1AKJD 2IFFH 2DLIA 1DBJL 2VLRA 5D7LB 3V5KB 2EIDA 4QCEA 1QHPA 4XCYA 1FNGB 1A7NH 3MGAA 4Y4KA 3TESA 3U4EA 4HFUH 2W66A 3TJEH 4D1IA 2J6EH 2GUOB 3QIWD 2D1ZA 4MA1C 4JZJB 3EYOB 1FHGA 3POCA 2YBRB 5ETUA 5IQ9A 2EXWC 1FNEB 2XY1A 1K6QH 3DX0A 1E27B 1HHGA 3FQWB 3F6LA 3PWNA 4ODHH 4PJ7B 4TVSa 1JL8A 5EO1A 2HJKA 4XCNA 1Z0NA 1WTLA 1AJ7H 3OG6B 2HJKB 4XCNB 3TPUA 1TVBA 1TG7A 3Q5YA 1MHEA 1UG6A 25C8H 2MOVA 3SCMA 1AO7D 4B50A 1XHGA 3U4BH 2IGFH 4F3FA 4JO4H 3LEYH 4Y2OA 3P73A 1HP5A 1VGKA 1A9EA 2WMIB 4RQQA 4PLKC 3QEUB 4MJIA 4OGAD 43C9B 3HC4L 5D9SB 2FX7H 3EMZA 2OL3A 4GH7B 4OGXL 2ZXAA 5I1GL 5BS0B 3RIFK 3HG4A 3I6LE 1BBJA 3FO9A 5KJRH 2VX6A 4R4NC 4WFHD 3C6SA 3N11A 1B9ZA 2HT4C 4FQ2H 4C57C 5I30L 1NGXB 3ZKXC 1MHCA 2YD7A 2ZUQC 4M7KL 4GAJH 5MHSD 1F6AA 3EOBA 5J6GB 4WO4A 5EN2A 4YZFF 3IKCB 3QP3A 3GSNH 4M7ZB 5D5ME 2V2TA 3ARFB 1A7QL 5ITBH 3T1WA 4RGNC 2PB1A 2C0HA 3F7VA 3RDTB 1E6QM 5C0BB 4MNQA 3WEOA 5CEZE 3K4AA 3TNNA 3L6FA 3PGCA 2Y24A 5H94B 3VXUB 3GH7A 4NRZB 4J1UB 4HWUA 2VUOA 1KIQB 5K9OB 4Z76B 2BHZA 3FT2A 1DANU 2G75A 2YUVA 3GBDA 3LIZL 5L0QB 1UACL 2CKBA 3O0RL 3MFGB 3VXSD 4N0CC 2DQCL 4JFYA 2LQRA 1I8KB 4UDTA 4X0VA 2NY4C 2GK2A 1MRCL 4QOKB 4JLRB 4QRUA 3REWA 1XZ0B 1R33A 1BP3B 3JWDC 5D8JH 5FK9B 1Z3GH 1BG4A 3UDWA 4TTDD 4F15B 2CKBH 4PUBL 1Q9OB 3V6OC 4YDJA 1MWAB 3O6FA 4IRZH 3O3EB 3QUMA 5L8LB 5CP7B 5JUEL 2ADGB 4GI6A 4F66A 2D31A 4XHJC 2O93L 4HZ6A 3A6BL 2Q8AL 2F5AL 4LX4A 3QDHA 4GOSA 5FGBC 1NQ6A 4OZHB 2J62A 4OBSA 3X11B 4U1KB 3TNMB 4RGMC 5F9JB 2PR4H 5J89A 1C7TA 2DJ4A 4K7PY 3TEUA 5HYEA 4ELMA 5DT1H 2VIRA 5TJWK 3UTPD 1G9EA 3Q6GL 4M80A 3BVNA 2E27L 3OGCA 3GXPA 1OAKL 4IRSA 6CGTA 3VSVA 1MFNA 2I26N 2FR4B 1L7TH 3CIQA 1CBGA 1Y6MR 4FTVD 3IS1X 3OF6D 5D8JL 3BT2L 3SJVD 3SKNA 4LXFA 2OR8A 5FGRA 3A67H 4L8SC 2AI0L 5LA1A 5F6HI 4OIIL 3TWCL 1AXTH 2CUMA 4HKZB 3THCA 1T2QH 3CZSA 3IU3B 4Q6IC 4HFWB 4IEFB 5D1ZA 3V9FA 4GS7B 3WY1A 3MBEC 2Y06H 2V17H 3RJDA 1ZV5A 1KXQE 5GGSB 1DUYB 2GK0A 1HDMB 2PTUA 4RA3A 5GNYA 5DRZB 1G1CA 4PYHA 5DO2D 1B31A 4TRPL 1S78C 1MUJB 2PXYA 3O4LA 5K33A 4LCUA 1KB5B 1JGEB 1WFTA 4I4WA 5C2BH 3GHBL 1RZFH 1KXTB 4AD4A 3JV5A 4P7QA 4JO2H 4C55A 3MXWL 2AV1A 3W9EB 1J8KA 4J4PA 4ZFOL 2ED9A 5GGSY 5JXEC 3K8KA 1OP3H 4E2OA 4DUXA 4HLZH 3S97C 3QEQE 5F7UA 3GNML 3LRSB 3MODL 1UD4A 2RFXB 5IVXF 3N12A 5F6HJ 1M7DB 3V6BR 1YYLL 3LRHA 4RX4A 5FYLD 2ZUSA 1LO0H 3SGKA 4XWGH 4GAGL 3GSUA 1MCWW 4WWKC 2X4QA 1AGDB 3U4BL 1I3RB 2LTQB 1HINH 5I8KH 2R56H 2W0FA 3MRIB 4MNGE 1FPTH 3CXDL 3QXWA 2B1HH 3ZDZE 3WLWC 3MRRA 4HBQA 1MWOA 3PZUA 5CGYC 1H2JA 1DZBA 2AERT 3PHQB 2X4PB 4NWUL 4BQ2A 3KYAA 4WRLA 1R5WB 4QY8A 1CLZL 1JPSH 1ZHKB 4PJCA 2AJSL 2J25A 4L3EE 2HVJB 1FYHB 4Y4FB 4I5BB 1FLRL 3FOLB 1KTCA 4Y5XB 3O2LA 5DK2B 5DURB 3MLVL 2HTKD 1GOMA 1FZJA 2BY2A 1V0LA 4NJ9H 1F6LL 3CFCL 3GSVB 4OFDA 3WH8A 4HIHA 2W07A 5I19L 1OGBA 3K46A 1MY5A 4PBXA 2VXQH 5F7WC 4LPTA 1OGSA 3OLEA 1B4JL 2J74A 1R0AL 4LGRB 4C4KT 2OX5A 4DUWA 1GOFA 4NQCB 2IUZA 2FDMA 4F7EB 5DJ6A 1CXKA 4HAFA 1YEJH 4EN3A 3VRLE 4I1NB 1KC5H 2O26U 4X7SH 3FB6B 4J3XA 1H3UA 5EC2A 2DDXA 1BOYA 2E0PA 2FATH 1JZ6A 1BFVH 3K80A 1JK8B 2HN7B 2HLAA 4FQXC 1DVFA 1W72A 4KZDL 3RCNA 2F58H 4PP1D 3QIUA 4UV4H 5T5FH 3SKNB 2AK4E 2Q6WB 4KXZI 3RVTD 1BTCA 4IDJL 1XF5B 1U36A 4RRPG 2P8LB 1OD0A 2HVMA 3QUYB 2BK8A 1JZ4A 1GHFL 4XRCA 5ERWA 3UTTD 5JORA 1EA9C 2CR6A 1JFXA 1EEYA 2DIEA 3L5IA 5IBLD 3CMOL 1NMBL 4Y4HD 5EU7E 5MENB 5HHQB 2R69H 1F4XH 3TV3L 4WHYG 4P9MH 2EO1A 3KPNA 2UY5A 5C0GA 3R06A 4YWGH 3RTQC 1KPUB 1G9MH 1AGCB 1T7XA 4IRJC 3OV6A 4LLAA 1FL5B 3MROB 1YN7B 3HG2A 5D5MA 2XPGB 4XZUA 5DJYA 1PG7L 4GRLC 5DEGA 3WS6A 2PN5A 1X4ZA 1Q1JH 3SJVA 3QAZB 3C8HA 1G7HA 4J8RB 5DEZA 3ARED 2GJXA 2J7HA 1GGTA 2D7NA 1WIPA 4P4KB 2WUCL 4CNIA 5AYIA 4TPRL 5KG9A 3QB7C 4JY4B 1RZ8A 1BZ9A 1INEH 1H3PH 3V7MA 4PY7B 1V6XA 4P57B 1JHKH 5FKYA 2ZUMA 4WEUD 2CK2A 3PUCA 3C6LD 3F7VB 4EOWH 3C5ZC 2AJYH 2C3VB 5FDYA 1AIFB 4XMPL 1NEZA 4LMQI 1N8ZB 2O9RA 2IWGA 4BQ9A 3SCQA 5KEZA 2VDMH 2VWEE 4NKOA 5HPOA 3VFTA 1S78D 4L4OA 3BDYH 3GH4A 3N1PC 4G6AC 3VIOA 1NEZG 5D6DC 5B39A 2EEBA 3AREB 3P0YL 1T2JA 1MCOH 5FA4A 3MLVH 4HIEA 2WKGA 1U8PB 4AZ6A 3FQTB 1UQSA 1VESA 2H2PC 1ADQA 4NYLA 1G7LB 2WLYA 2X40A 1D5MB 4XZWA 1JGIA 2H41A 3AC0A 5AZ2H 1XH1A 4Q6YA 1WIOA 5C08D 1FHLA 1MVUB 4G8GD 4JFEE 4CAGA 4JFXB 3C5ZB 3I84A 3C6LB 4X9HA 4NJAH 1UR8A 1T0MA 3QH3A 3PTMA 5I16B 4YFLF 3K2UH 3TFKD 1SEBA 4Y4HC 3H7BA 3OKMA 5ESVA 4P4RB 3QJHB 4N0UE 2HA1A 1TJIL 3QUZB 5DI8A 2A74A 2QQNH 4JG0H 4HCRA 3IJ7A 2ZKHL 1MW3A 1C8YA 2GJZA 4NQEA 3UROR 4ODUB 2DI8A 1TUXA 3CFEB 3SDXE 4EXPX 3HI1A 4FQCH 4CJ0A 5BROA 2XZAH 4KDVA 4QNPE 4U6HA 3BHBA 4KKNA 3MANA 5E6ID 5TDOA 1U33A 4JVUA 2CHOA 3SDCD 4Y4FD 2GY7B 2OSXA 1KCLA 3MRQB 4PRID 4UZUA 1Y18B 2PF6A 4GRWB 4GXUM 1TCRB 4ODXB 3MNZB 1XYFA 3MXWH 2W9EH 2VRAA 4M6ML 3MRHB 1E4XI 4LEXL 4EAMA 5DC0A 1RZFL 5TH2B 3G5VA 2PYFA 4JQIH 5DZOA 4B53A 1DBBH 2BNQB 4JY6A 2E7BA 3HC3L 3IT8D 3RU8H 4FABL 4NM8H 1FC2D 4U7KA 1FGNH 1NCCL 5TQ0L 2X1PA 3CUGA 1WVZA 3NCYS 5DURD 3WF0A 3CAFA 3MBEA 4HWZA 1UCBH 4L8DA 4GAYA 3FB5B 4ONHB 3TYGL 3QIBB 4ETQB 2BJMH 4OGYL 4APQA 5DJ0A 4RA0C 1PVHA 3GRWH 1DCLA 1FJ1A 1C8PA 5DLMH 1NCBH 5IT2H 2YBTA 1WGOA 3SE9H 5HGAB 3DV6A 1VPOL 1RUAH 1W72H 5JIIA 2OYMA 1V6VA 4B16A 4V2XA 3QXDB 3BP4B 4M6OH 2BSSB 1I1AB 1VFBA 1TNMA 1FVDA 1WISA 4L4VE 3GH5A 2BSSA 1PIFA 3O2DA 3TP4A 1GJIA 8FABB 1JNEA 1RK0B 3K74B 4I9WD 3RX7A 1G1YA 1GXEA 2AJUL 4WO4B 3UAJC 1QVBA 3U83A 1YMHB 3MUJA 3M45A 4BSJA 2O9TA 3Q6GH 4P46A 4LSVL 4H1LH 5CG0A 2P8PB 3G6AA 4C56E 2ZUQB 3KXFA 3NAAH 3PWPD 4F9PC 3UTSA 3WEMA 4O2FB 3BP6A 4YGVA 1J87A 2J4WL 3OR6B 1D9KA 4DN3H 3HNTH 2OM5A 3OSKA 1OCWH 5DK3A 5HHQA 3J8F7 2DT2A 2YPLD 3QO1A 2G5BB 5JXAH 5IQ7H 1U3JA 4LSPH 5E24E 2HISA 3ET9F 3KPSD 3KL3A 3SCSA 4PJ5A 1K4DA 4IPNB 4PB0L 2JJSA 3L95B 5T1DH 2ATPB 5BMFH 3GHEH 2JLLA 3GXFA 3P30H 2B5IC 2AGJL 4JCLA 2XG9A 2NPLX 2ADJA 1UWUA 3SCPA 3ARUA 2M1KA 2FZ3B 5JIWA 4FMKA 1Q8MA 1GVYA 1JCKA 2HG5B 4TSAH 5FEBA 2JCCA 3O41B 2XWTB 1JNHA 2ILLA 4DWHA 3O0RH 1FV1B 5BXPA 1ZLSL 1IAOB 3P4OA 1N0XL 2ADGA 4BFIA 1W3LA 3WCYA 4UT7H 4BFEA 1JGLL 5HHMB 4XPTL 1E6OH 4U6YB 1IGJB 4OIBA 5A3ID 5J11B 4Y0GA 5CJOH 1XGQB 2HT3D 3DXAE 4XPAH 1R24A 2DQJL 5HYSA 5DMIL 3GSNL 4OLUL 5I6SA 3ULVE 2WBJD 2OCFD 4PJCB 1KGXA 4I3RL 4AZGA 1HOCA 2FO4B 5IHZA 1JWMB 3SCTA 2VMFA 1TTGA 2GT9A 4GG6A 1ITCA 2H32A 3W6LA 2Z31C 3PHQA 3U9PL 3MMDA 1BD2E 4P59L 2B0SL 3ARBC 1UQSB 2CLRA 4XNYH 5C6TL 4ZO6A 3MUAA 5GGTL 4KHXL 3UTPE 5MERB 4HOZA 3GI9H 1KACB 4IM8A 1S7SB 3IVKB 1M7XA 1KCRH 4NQVB 3HB3D 5B4MC 5C9JB 1KEML 3S8WA 3L5XH 4O58H 3O3EA 1RZGA 3D2UB 2X1XR 1M04A 4HIXH 2JF7A 1RZGB 4EKXA 3LY6A 3WXWH 3QDGA 1I8MB 4NO2B 1NAMH 1QO3B 1DWHM 4QEGA 4OCWH 2O9OA 5GGQH 2WQ8A 1CD8A 1MFVA 1U8QB 3S6CA 4NHCH 3A4WA 1C12A 3MV8E 4HGWB 4LSUL 4H0HB 2EDWA 5C0IA 4OUOA 5M03A 1SMOA 1DDHB 3CX5K 1MCLA 2XIBA 4WVRA 1Q6GA 2XVNA 1NCAL 4Y7EA 4FZEH 4DZBA 2W60B 2VR4A 3TF7C 1OSEA 2YRZA 4IJ3C 1A1OB 3A67L 4JRXE 1CFNB 5D8ZA 3HRZA 2NXZB 2W4XA 3IF1B 2ZUNA 2AOSA 3OHXB 4R8WH 5J8OA 3AIVA 5FYJL 4LLVA 1CICC 4APQD 3OB0K 5J13C 2AXGA 2A73A 4F15C 3I6GA 3O3AB 2AXGB 4HXBH 3L4YA 5D1ZC 3IU3A 1JFQH 2DQJH 3P0VL 4BSWA 2IC2A 4KZEH 3TOPA 2ZCLH 2CK0H 3CJJA 3MRCB 4NDMA 4IISA 3WDQA 3TCLB 3NDZA 2JTDA 1IAIH 3P0GB 5SWZE 3O3UN 3WN5B 1HX0A 2C4FT 5DFWH 4FNPA 4JFOB 3NPSB 4W8BA 4FNLL 1QPKA 3KDMA 1HNFA 4AMXA 3FO2A 5J3HC 4FNQA 1R3LA 5H37G 3ILPB 3VGBA 4G5ZL 2EEAA 4Y4FA 1XV8A 3MJ9L 1MELA 2COQA 2FHFA 5D93B 4I13B 4AG4H 1V05A 1U58A 3CFBA 3QDMB 3PWLB 4PJCF 4D6HA 1QI0A 1CZ8L 1T0MB 3H9YA 2EEXA 3NABH 4OQTL 5JO5A 1OT2A 4QTHB 1E9LA 2FEEL 4XP5H 2BFGA 4Q97A 3UTSB 3UYRH 2Q76A 3DX7B 4B5EA 1GC1C 4Y1AD 4EI6B 4PB0H 1NGYB 1CBVL