1CGXA

Site directed mutations of the active site residue tyrosine 195 of cyclodextrin glyxosyltransferase from bacillus circulans strain 251 affecting activity and product specificity
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLLDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
publication title Site-directed mutations in tyrosine 195 of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 affect activity and product specificity.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 235
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1994-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgxA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgxA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cgxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cgxA01
1FBIH 4PP2B 1AMYA 1H3XA 1NEZA 4ELKB 3RO8A 2YMXL 3S96B 2LTQC 4QHNB 1W3LA 1DVFD 3ZHKA 1KNOA 1BEYH 4Z7NF 4UTAL 2A9NH 3HE7A 4LIQE 5H94A 1HDMA 2AK4A 4YQXH 3HZ3A 2CK0L 1MWAH 2FB4L 2P8MA 2YEZA 4U6VL 5F72S 3KJ4B 3BJLA 5M94B 3ARDB 1G7HA 5D9SB 3AS3A 2D03L 3W0WE 2OYPA 3WKML 3GBMH 2VC2H 2ZCKH 3WFHA 2W0FB 3DXAA 4XCEA 5T3XE 2ITCB 1J8KA 2R56L 3P0VH 4IHOB 1S7WA 4OCYH 1CDBA 1C5BH 4IIQA 3HR6A 5F7FA 4NGHH 1Q4NX 3M1BB 1BJ1H 1IV8A 1CZ8H 2F7RA 1YEFH 2I9TA 4UT6L 5I6XB 4HIIA 4WENB 3V5HA 1H5BA 1RJYB 2NX5E 4K8RD 4OUUB 1NCDH 4V2CB 2CMRH 2MJWA 1EZVY 1I8LA 2IMMA 3GSXA 5HYSA 1ZMYA 5IXEA 4KVCL 3OLEA 4DGIL 1E72M 5CEXB 2G3NA 2NQCA 3U83A 2FZ3B 1MH5A 1J11A 2E9IA 5AUMA 4ZSOB 4MZ2A 3RJYA 4C57C 5BVPH 1A7NH 1TFHA 4NQCA 1K8DB 5IESL 4NRXB 3CFEB 3O9WA 5IMMA 3WELA 4UQCA 3O4LD 1JAEA 4FTVD 4ZFMA 4CD6A 4KV5E 2BNRE 1VAHA 1WFTA 5H2BA 3VSTA 2BRQA 4GAJH 1EOKA 5HYIA 5GSVA 4WHCA 2OWXA 1ZGLM 2DSZA 3K0WA 2XSBA 2IALA 3D18B 3QWOA 3O6FB 2ID5A 2W38A 5IW6A 4JJ5B 4H7VA 3HKFA 2CBJA 1FO0A 3BIKA 1GIGH 3MXWL 1TITA 2H32A 3P4NA 3IU4H 1FVDB 4NCC1 5SWZA 4Z7OF 4NHUB 1MHPL 3DECA 2DDXA 1NDMB 1CFSB 3JWOL 2XTKA 2ALWA 5DJXA 1Q9LB 3TF7C 3GHEH 4YC2C 4PJGF 2ZXBA 5CMAA 1TJHL 5ETUA 5K9KA 1RY7B 1QI3A 5EWIH 5INCA 5LA1A 1QSFE 4MAYC 2VWEE 1ZEAH 1MPAH 4HPYL 3Q6FA 2XZCH 1P2CB 1M03A 3H0TB 2GHWB 3DX9B 5F3BA 3OHXB 1LD9B 1IT9H 4LSRL 3MNVB 2W9DL 2KBGA 1QKZL 4GMTH 4LIQL 4O9HL 5D6DC 4WO4B 1S9KC 2XTJE 4KK8C 3WQ6A 1R3JA 2AXHA 1MIMH 2NY0D 4YDLB 2ADJB 4OZOA 1LEIB 4Z77B 2A0LD 5EU6D 3RVVC 4E8DA 1J7VR 5DJDA 2BNQD 1KFWA 2ERJB 3PHAA 1GOOA 1FSKB 1KCVH 1NWTA 4H1LH 5JUEL 3NFSH 4MMXC 3CTTA 5HHME 5AEAA 3FRPA 5SWSA 4WWKA 1WE5A 3H7BA 1T4KA 3KPNA 4Y89A 1DWFM 1UYWL 4MXQD 1NMAL 3BD3A 3RM8A 1MFDL 3FB5B 1Z3GL 4Q9QL 1JPSH 4RDQG 3QQNA 2IH1A 2DTSA 1MFBH 1G6RH 2D9CA 1MCNA 3QPQC 2IBZX 5IHUH 5I1LB 5J4MA 2VX7A 3VFMB 2X1QA 1U95A 5LXGH 2X8RA 1NKOA 4M1DL 4PMOA 4Y2OA 3JVGA 2IQAA 4X6BA 5DSCA 1EHXA 5F88A 1A1OA 3ALPA 3IKCA 3C2SA 1F3DH 3SE4A 5KVFH 3PGFH 1RULL 3C5ZB 4AYFA 4OIFA 1W0WB 2OTUB 1VACB 3LQAC 4JPVL 4W4OC 2EC8A 4LSTH 1J8HE 3AIWA 1OWRM 1WJ3A 1BD2E 2K1MA 1IAII 3LN4A 1T66D 3JV4A 4OGAD 3FY1A 4FFZH 3I6LD 4X7SH 3FNDA 5C0JB 3IXTA 2HWZL 2UYLB 4QRRE 3TEUA 4W70A 4TUKH 3KLDA 4UTBL 2O5XH 4UDUB 3Q5TA 2P8LA 4HBCL 1ZWIB 3UPRB 1GGCL 3RWHA 4P2RE 4OF5A 4YHEA 2E4TA 1IE5A 4BYHA 5FFLA 4OIAA 3FB7A 4ZTPL 3BX7C 4KK8D 2Q6WA 1CXHA 5GISH 4D9RE 3TH2T 2E0PA 5C0IA 3GUTA 1CTNA 1QFOA 1Q94B 2XYCA 2G75B 3D0LB 3B5HA 3WFBL 3CDYA 1FNGA 3PIQA 4OCMC 4JFHE 1UM5H 4PR5A 3RNKB 5L8JB 2A3EA 3O41B 1IBGH 1YPZB 4L9DA 4HJ0D 4AT6B 1ACYH 3DRQB 1ZU8A 5FO8A 3ZKMC 3VDHA 3OAUL 2Y6SC 2VZUA 3CFDA 1CLOH 4WFED 3QDGB 4TN9A 1XR8B 1UJ3B 1DQDH 1S9YA 1OP9A 1CBVH 4NOFA 3MUHL 3ZSTA 1IAOB 1KWGA 4X8XA 2EABA 2H9GB 2P48B 3UCQA 3OGVA 1JZ4A 3MV7B 3PGDA 3BDXA 3L5JA 3Q5OA 1ODUA 4PRAB 2WZHA 5GGTA 5IJVB 2NLJB 2V2XB 5D2NA 1HWHB 6FABL 4LHJB 2YA0A 3DO7B 3QFJD 4G8GA 3EGSA 1ZGLA 3LPFA 1JDCA 4PJAA 3V6OC 2WXDM 1IGCH 1X5FA 4PREA 3MO1A 5FGCE 5EU3A 4BZYA 5KS9A 3WLBB 4XP4L 3CIQA 5L6YH 4C56E 4AMKL 5K9JH 1BFSA 2BCKA 4D0BB 4PG2A 3W4RA 3BMVA 4H0HB 4LGPB 3O8XB 5I74C 1TIUA 2FEDC 3ARGB 4MD4A 1V0NA 1IZKA 1GONA 4FQJL 2EDTA 3RL2A 4U0QB 1GJIA 1ZANH 1B0RA 3A6BL 3WFLA 2I60L 2A9MH 1A9EA 5DR5H 3OXRA 4LSQH 4ENED 2GSGB 3WY1A 1A4JB 8FABA 1CICB 4JR9H 1BQLL 5DQJA 5TGBA 2JF6A 3P40A 3MNZA 3T0VA 1RUMH 1RZKH 1OP3K 3IXAA 4MA7L 5IGXH 4F80A 3UTSB 2FD6L 2ITDB 3BW9A 3SO3B 2FBJH 3U30C 3I84A 4AZBA 4PJIF 1DDHB 2J8UA 1CDUA 5CBAA 3NABH 4AMCA 1T2QH 4OSUL 4XHQA 4JFXB 2Q86A 1NDGB 3UYPA 1H4PA 3BKMH 5HYQA 3L6FB 1OTTC 3TA9A 3QEGL 2XA3A 4KROB 1GZJA 2J8FA 4PGCB 3NZHL 1PG7X 4C83B 4CD8A 5CINL 4LARL 3SE3C 3QEQA 1B3YA 1W8OA 2DM3A 4NI3A 3ESVF 4O02H 4QTHA 5GGSA 3L5IA 3O6AA 1F13A 4FQCL 1S9XB 2Y36H 5LYRA 1MCWW 2X4OB 4I77H 5MENB 5D9MA 2VIRB 2DAVA 4JY6A 4KI5F 3U0PA 5KSBA 1QG3A 2NY6B 1U8OB 5E2TL 3VXSB 1NP2A 2WP3O 1TZGH 1HX0A 5ABFA 4Q9CA 4PBXA 3CMOH 2VI0A 1KCUH 3RA7H 4R9HA 3RWCA 5GGVL 4L8CA 1JTPA 4HBQA 4LCIL 5E6YA 1AR1D 2WAGA 1Z6JT 3TO4B 1ZT1A 3BD4A 1FGNL 3BT2H 3INUL 2HJFA 1RHFA 5GIRB 2FEDD 3VXPA 1NOWA 2ZE0A 1JNLH 2RAMA 1W2KT 4RFEA 1UWXH 4OZHB 2CLRB 5HGGS 1IKNA 1MHEB 2X4QA 1TTGA 3FCTA 3V6FA 5FOJA 5D7KE 2J12B 2AJVL 3CHCA 2E7LC 3R0NA 1XFPA 4NQSB 5I1GH 4Z76B 5CWSA 4P2QB 3BI9X 2VLRB 4PRHE 3AIQA 3VWKC 2VLME 2VX6A 3KLSA 1GQJA 2WVUA 2VISB 5C9JB 4IOFD 5DD5L 3CFIC 5FKAB 1FPTL 4CW1B 1A1NB 1AJ7L 4R0LC 2LU7A 1IEAA 5I0DA 4Z0XB 1FCCA 1E40A 3WDHA 2B7DT 3C6SA 1JNNH 3GRWA 2D3NA 4DO4A 5IMOA 1QBMH 3SCRA 3CU7A 1GNXA 4N0UB 3N9KA 4NO0A 3U57A 1CF8H 2HFFA 3VRJA 3OZ9L 4KJQC 1SMDA 4HCRH 1QRNB 1IGFH 2GCYB 2DYPA 4NZJA 4AL8L 1A6PA 1T3FB 2IPKB 2UVFA 3FQXA 5T3ZL 1D6EA 1L7TL 1X4YA 1LHZA 3P9MB 4LSSH 2V5TA 1YUHB 3QI9C 2W60B 3QZWA 4ZFOB 2C26A 2CRZA 5J12C 5GRUH 3LMJL 2AEIT 3K2MC 4G5ZH 1JV5A 2EH8H 1BF8A 2EXWC 1K3IA 2D4DA 3HC0B 4WW1B 3S5YA 1YJDL 3L2MA 2AK1H 2ARJQ 3PZUA 5MP6L 1MHHB 1SM3H 2CXGA 1TQUA 2R4SL 1DUZB 1A6WL 3VFOB 4D94A 1FLRL 1NCBH 1L6XA 4PJ9A 1MRCH 3L7EB 3RZCD 5E09A 2JE8A 2HLAA 3E6HB 5EUOA 4YDIL 1DP0A 3VVGA 3DX7B 4YLQT 3QCTL 1MHCB 2X0YA 4NFDA 3CMGA 1C5DB 1QLFA 3BEVB 2NNAB 4PS4H 3LIZH 1MI5D 1VPOL 1SYVA 4GBXD 3VI4E 4DZBA 3JV5A 1VKXB 2NZIA 4Z7VB 1ZVSB 4LAQH 3SCVA 4K07A 2KUTA 1JK8B 2Z31A 4BH7A 5I19H 1UR4A 4P3DB 4IOIA 5BXFA 1QP1A 4HU0A 3AAZA 4UQ3B 5FKPA 3JTSB 3SE8H 4ZPTA 4ELMA 2WMFA 1N5AA 3VWKD 2R0LH 4EN3C 1IKFL 4HKZB 3BAEH 2EPKX 2JTDA 4FQPA 1MVUB 2OZ4A 2G3IA 2QLVB 4YBLB 1D5ZB 3VH8A 1FIEA 1R24A 1I4FB 4XMKH 3DVGB 5DZNA 4ZXBD 4M8QA 3MODL 2C3XA 4TSBL 3DV6A 4KRPB 4O00A 5A16B 4L4TB 3TBYA 5DHXB 4KJQD 2BNUB 4WEBH 3C08L 4W6YB 2D0HA 5IVXE 1R7AA 4GG6F 1HH9B 2DF3A 3GK8H 1IAKB 2N56A 3SQOH 1FL5A 2E27L 3PZGA 2XJ7A 3O4LE 5CLWA 2FR4B 4FTVE 1PZ2A 4U6XA 4DVRH 2UZYB 4WSJA 4UQDA 1H2JA 4GUPB 4OJFL 4XPFH 4I2XE 1FL3B 1ZLWK 5LBSL 2PCPA 2I07A 4RX4D 1XGYH 5T1KD 5D5MF 4PY8I 1MY5A 2X2YA 2JELH 2RB8A 3KPSA 5F6HI 4UDTA 2BVYA 4DOHB 4LQFL 1K8IA 1T0NB 2YPLA 1H8SA 3GGWB 1YMME 5ID0A 1S78C 1J0YA 4LSVL 1CD1A 1JL8A 3VMOA 2OL3A 3FMGH 4HPOL 4JDZA 1I7TB 1AVAA 1TQWA 3B3IB 3DSFL 2P5ED 1MQKH 3NCFB 1IC7L 5F7DA 3LXAA 4Q2ZA 5GRJL 2JIXB 3MLPA 1KG0B 5HJ3B 1LILA 1VFBB 1E0WA 1Q9OA 3I2CH 5F93C 3WY4A 1FC1A 4YGAB 1OAUH 2BC4A 1YY8A 3TN0D 3RDTB 4P5MB 1J86A 1INQB 4FNQA 5EPMB 3GBDA 5E6ID 2OXHA 2DJUA 3QO0A 4X4ME 3VFVA 5FA4A 3RPIA 5C0FB 3F5JA 2EDOA 4X5WB 1LNUB 2QQQA 5CHNA 4K2UL 1F8TH 3F12B 4Y1AE 1WZ1H 2V2WB 3DIFA 4Z0BH 4L4JA 5EU6E 1EEZB 3RPKA 2F53D 5ICXB 5DFAA 3S36X 2WUBH 3FFCB 5IW1A 5TH2B 2BNQE 3ZE2F 4TRPL 2VDRH 4Y4KA 3PE9A 2DWEA 5D7IA 4B3KA 4MA1C 4M1GH 3BAJA 4HK0A 1C7SA 4X80H 4ETYA 1EFXB 4PRDB 5M17A 5I6SA 4GMSL 1BGGA 2F54A 4IOSD 2R0ZL 3VG9B 3GSRA 3VILA 2FE0A 2B1AL 3QUXB 3R1GH 3VGBA 2W91A 4K8RL 3NVQA 2EZ0C 3MBEB 1JFQL 1OW0C 2MQ3A 3Q2CA 3QHTC 3VIGA 4PJ7A 3ZDZF 2DJ4A 4QHKJ 1WZAA 4NKOB 3B5TA 2UY3A 1YNLH 3HCVB 3NAAL 1GC1C 3EDJA 1I1YB 5E95B 3REVA 4APQC 5CP7A 2W07A 2PR4H 4POUB 1YC7A 4P23B 3MA7B 1AI1H 3FO9B 2B20A 4MWFA 4QWWD 2JK5B 4LL9A 1S78D 5TPWH 5D4QA 3I50L 3STBA 5HHNA 4JFFE 4ZUWB 1A6TA 3ILPB 3Q48A 2D23A 5DWUH 5F1IB 5HPCA 5EOCH 2Q1EA 5GGUA 4MYWB 5JA8B 2QHRL 4ZPVB 1U8KB 2VLKE 3ZYZA 3FO2B 3CXDL 5JW5A 3G6DH 2AV7B 3MLWL 1K5NA 4BSVA 2XN1A 1GHFH 2WCAA 3PXHA 2XN9D 1ZHNA 3EOBB 3FT3A 5DMKA 1MFNA 3J8F7 4WEMB 5GGRY 1CQKA 2JB6A 4KK9D 4TULH 4JVPA 5ITFB 3HG1A 3VFPA 3BIBX 4HG4K 4PJXE 2BSSA 4TOYL 1HIML 2WVVB 5I18L 3BUIA 3WQVA 4OZFA 1WEJH 2WZEA 2X4TB 4OGYL 4D0DA 4Y16B 1SJHB 4H26B 3TPUB 3SCQA 3PP4H 3PWPB 5A2CA 1SVZA 3PWUB 3UJIH 4ZG1A 4X6CB 5L2KE 3B9EA 3MTRA 3NZ8A 1FN4B 2GJPA 2J74A 4X4ZA 1EJOH 1LGVA 4DQOL 4AD4A 4R4BB 3I3EA 1I3UA 4NO3B 3BSZL 4K3DL 1E5NA 1WC7A 5EOTA 4WFEE 1G01A 4YHOH 4HK3N 2MOVA 4O58L 5ALCH 4RRPG 4F9JA 3QHOA 4ZODA 3IFPA 4APQD 3DI3B 4PJBB 1AO7B 1T22B 3GM8A 3SKJH 4P3CH 2C5DC 4YHLH 3X11A 1JGLL 1Q6DA 3MV11 3CC5A 3UPAA 4OF6A 5HHQB 2BFVH 4MB5A 2VURA 4XUYA 3NPZB 1X5XA 5TE4L 1KTRL 5FV1L 5MI0C 3WUGA 4FQ2H 2YBTA 2VKWA 4PY7B 3ZE1F 4AIOA 4I13B 5BXPA 3QHMA 1JRHH 4Y4FC 1IFHL 4NBYB 3OAZK 3QQ3B 1IM9D 4CMMB 3KPMA 2AW2A 4ZO8A 3KPRD 3H54A 2D31A 1JTOA 1YN6B 1U8HA 2FJFB 2YHGA 3MRIA 4ALAL 4JDVA 3ZOAA 3WFEH 1JP5A 3TWCL 3BN3B 1E4XI 3AREA 2VXUH 3GBEA 5GS0H 4HFWA 1TZHA 5KSVA 4HU8A 4P5TA 2D7QA 2W9EH 3WDPP 3A6CH 2X7LB 3F7VB 4U1GB 5CEZD 1PX3A 2C7UA 2Q8AH 3JWDC 3LEVH 1UWEH 3MPCA 1AQ0A 3FT4B 5F44A 5HVHB 4EDXA 4DKEH 5BVJB 4EE9A 3ULVC 1K85A 2G9HB 2Q76A 4PSRA 1CEOA 5AG8A 1WPCA 5I1IH 4PV8B 2Z8WC 4DN4H 4NYLB 4UZSA 3QQ9C 4MB4A 4CDHA 4WY7L 2GJXA 1CQYA 4HXAL 4UFKA 3IDIB 4XAWL 4BF7A 3JTTB 1H3GA 2V38A 1D5BB 1UCBH 3D3VA 4B7LA 2FIRT 3BCFA 2B4CL 4PTMA 5CUSH 2EDEA 1G9NL 2HLFC 3OQ3B 5IFJB 4JZ5A 1YECL 3BKCL 3LRLA 1SBSH 1HKFA 1KELH 1NCCH 4XP5H 1KN2H 2JJWA 1HH6A 4HXBH 5EG6C 4MXWL 4LLMB 1AGEA 2VDML 4WV1C 4LSPH 1T5XB 4N9GB 1ZXQA 2OSXA 4TUJB 3BPCA 4LMQI 4UQBA 3GMQA 4CNIB 5GXBB 5BZWB 1W3KA 3FQRB 5DRNB 1YEGH 3V6OE 1NJ9B 3HLAB 1ZK9A 4G6FD 1CLCA 3HI1B 3KLHC 4ODSL 1SYSA 3VMNA 5JMRA 3ZJ7A 3CUJA 3KPQA 3TIEB 3CDGA 4G9FE 4N5EC 4KZEL 2EAEA 1IQDA 2QTEA 2XVPA 1IGYA 2VXTH 4GRWF 4DGYL 3DVNB 3QYCA 3CHEA 3BP7A 2ZZUT 4WGVB 5E5MA 3QCUL 1WAAA 5C0DA 2R39A 3LQAL 2X05A 4PJAF 3LPOA 4PGJA 3RHWK 5BCAA 3U7VA 4M7KL 3WD5H 4IDJH 4PGBB 3ARQA 5KTEH 5FAAA 3BVNA 5KS9F 3WIFA 3QEUB 1WUNT 3PZNA 1T80A 3WHE0 3TC9A 4NM8H 1PGRB 2VLJD 4OBSA 4PRNA 2WC4A 1R3HA 4PV9B 2HJKB 5DHVB 1C92A 1KIPB 1KCKA 4N0YL 2CRYA 4O5LH 3NPSC 4OD1L 2CIIB 1HQRB 2C4XA 4ODWB 5EO0B 2CLZB 1PAMA 1PZ3A 2Y2WA 1JMZA 3SJVE 3EYFB 1EHLL 5CSYA 1U3HA 1V7ML 4GI9A 2J6EA 3MLUH 3UJJH 2YC1B 5EFFA 3LKNB 4NM4L 5J6GA 4I5BA 5D7LD 1A3QA 1GOMA 3CH9A 2VTFA 1HVXA 1U9KA 2OQJB 3KG5A 3LRMA 4WUUA 2WZPD 3MJ7A 3WFCH 3TT1H 2MFNA 3OR7A 2IG2L 1FO0H 5AAMA 4PJEB 4ZTOH 5A8PA 2HLFD 3IDXH 3V0AC 4XCFH 3ZKNC 1IC4H 5MHSD 3I6GA 2J8UF 4MNMA 3LKSA 1PPIA 3QXAA 5F1NB 3ARYA 5C0BD 2BRRL 2ORBH 4L8DA 1DQLL 2A73A 1EDTA 3QPXL 3CJJA 1MREH 2DQJH 3S35H 3S8WA 2DH3A 3W53A 1IAIM 4Z7WE 4Z5RA 2ZG2A 1S7TB 4LLWB 4EKXA 3KYKL 1WWBX 4R4FL 1FORL 2AJYH 3PHOA 3MACL 4XPBH 2APFA 3C60C 3SDXA 3WN6A 2OK0H 3S2CA 4HG4J 3KLHD 3MOAH 4UAOB 4XPAL 2FX9H 1OSEA 3C09C 3STZB 2CH8A 1CFTA 1MYRA 4N5ED 4M9PA 5F7LB 3GMMA 3FN9A 4L8BA 3GTNA 2DLFL 5KSBF 5D9NA 4M02A 2DDQH 2AJZA 5LG1A 2WMGA 3RGVB 3BAYA 3I6KB 2OJZH 5EOQL 3IRPX 1CFBA 2HTKC 4FABL 4NQEA 2A3HA 4E0RB 2WZIA 1GHSA 2HG5B 1E4WL 5TE7H 4UUJA 1MFVA 3MV8D 4POZC 5KSUB 4PP2A 3BDYL 4HGKC 4ELKA 2EPLX 5DDHA 2ED7A 3OA5A 4XC3L 3QOKA 1R3IH 5LA2A 3HN3A 1J9CT 4QHNA 1N64H 4FFVC 4BH8B 4NDMA 1B1YA 3HR5B 1B6UA 3SDYH 4LLDA 1AXTL 1TETL 4G8EB 4RISH 4NN6C 5D8WA 3C2AL 3UETA 2GJ6A 4PJ8B 1FZKB 4UOW0 5CJBA 3ARDA 3KYNB 3VJ6A 5M95B 3MV9B 4XTRC 3EDEA 4F7TB 5JR1H 3NDYA 2ITCA 2FBOJ 2H45A 3G6JB 3ZKND 3UG4A 1QNZH 3H9ZA 4NKDB 4PBGA 1JHLL 1QQDB 2H3NB 4XVUC 2WUCL 4KTEL 1M7DB 3O6KH 2L4OA 4WK9A 1CLYL 1EPFA 4KRNA 3O3EA 3M1BA 4I0CC 1UQYA 2XG9A 1I9JH 4AIXA 2X41A 1A6UL 3OKKB 4H04A 2DQCL 4I18B 3RFZC 4Q6IB 2PF0A 3I3BA 1RJYA 3WSQH 2MHAA 5E8EA 4M7LT 2UY6A 2RIKA 2ZUUA 4PMZA 4KC3B 3R06A 1KPVB 3BZ4B 3SY0B 5T33L 4KU1A 4LSUL 1PG7L 4P49A 2JCCE 3SKOB 1UEYA 3P4LA 3QDME 4MSWB 5D96C 4A6YB 4EOWL 4KMTL 2PF6A 1I1AB 3GSWA 2E9MA 1XEDA 4S1QL 4M7LL 4XCNA 1RZ7H 3CFEA 5DEFB 4PMNA 4OOZA 3QOMA 2P5EE 3BPOC 3VRLE 1ZJAA 3D5HA 1F3JB 4LK4A 4GKZA 4M6NH 5D72L 5FB8A 3KL3A 1UR1A 3EW3B 1E4KC 4POZD 5F89B 3FT2B 5DLML 3D18A 3O6FA 1DN2A 3W0WB 1NAMH 2X4RB 3TTYA 5F7EL 1AQKL 2OTWA 2NXYB 4MHHI 4NZUL 5LAXB 1CFSA 4XC1L 4ONFH 4QNPE 4MDOA 4JFDD 4ZS6D 4DVBA 5GGTH 3ARTA 1F2QA 1I9RH 5IT2H 3RILA 4CVUA 4H25A 4XTRD 1AE6L 3FOLA 4F8QA 2I26N 2NX5B 4IRZL 4NQDA 4CMHC 1CD8A 2WWMC 4MHHG 2BOBB 4RAUB 1V6XA 2QEJA 5L2JB 4FS0A 4XVUD 1P2CA 4JHWH 2Y7QA 3DX9A 1LVEA 3NN8B 4HEPG 1GC1H 4X7TB 3OHXA 4WHTB 4QOKE 3MNVA 5IJKC 3AY4C 1T89A 4WO4A 1T04B 1H11A 1V02E 4YWGL 1QSVA 5KW9H 2ADJA 4Z77A 2YD6A 2LABA 3DYOA 4HOZA 3BE1L 3AIBA 2WHLA 2C1PA 1BOGB 1MCOL 4JO3L 4PRPD 2BNRB 3HHRB 4GRLD 4OCNC 1ORQB 1UZ6F 4Y4HC 1BF2A 3TZVC 4P2CG 3D4YA 1OD8A 4O4YH 5C0NC 4G8IB 5D1QC 3ZM8A 1YEHL 4JDTH 3L4ZA 1HHKB 3GSQA 4YXLL 1KJ3L 3FB5A 2PO6C 5C2BH 1HSAB 3WIHH 1DBJL 4Y2DA 3O2VL 2B39A 5DJCB 3S34L 3ARUA 3V6BR 5MERB 4ZAKB 2JJUA 5D1ZA 1HNFA 5I1LA 4OCWL 3GBLA 4JHZA 3SDCB 3VFMA 4OD2B 1YMHA 2DICA 1PIFA 3A4AA 3QP3A 2DQGH 3AS2A 2WIIB 1BVKB 4LF3B 1C8YA 5DJ2B 2GFBB 2HN7B 2AEQH 2R29L 3MUJA 3UTPD 1T1ZB 1QSFB 3U9PH 3BKYH 4WVRA 2OTUA 1VACA 3N15A 3OAYH 4GXVL 2B5IB 1MWAB 3P0YH 1FFOB 4LCCB 4WW2C 5I16B 2X1OA 1OARL 3KPOB 2XTJB 5JZ7D 3VO0A 2EDKA 5C0JA 1ETZB 4UQEA 1OWQA 3KS0H 1NEUA 1D5MA 3BPLB 2AJ3B 4XXCC 3PHSA 4LCWE 3HS0A 1MAMH 3ZLQC 4KHXH 4UDUA 5I1JH 3BXNB 3NIDE 3ZMRA 1XV8A 1FZJB 1A6AB 4Y5YB 3ZT6A 5FD0A 3UPRA 2ED8A 1YN7A 3VXQB 4FRWA 5HHMB 1C16A 1DUYB 5HDRA 4ATWA 3M8OH 4TOQA 3QGVA 2ILLA 3RWFB 4NRSA 5M03A 2PYED 1G1CA 5T5FL 1INDH 1AHWC 4NWTH 4QDMA 1Q94A 5JQHC 3QULB 2W0PA 2DQIL 3K1KC 2PXYC 2XIIA 1IAMA 4XGZB 3RNKA 1V3MA 3MUGA 2NY3D 4ZFGL 3SN6N 2NY4C 4OCSL 4FHBD 1YPZA 1XMWA 4DUWA 3DRQA 2J7LA 2OX5A 2FX7H 3AVEA 3DUHA 4GOSA 5KVDH 4IMKA 4W81A 4GKLA 5AYUL 2K7PA 4LLQB 1A2YB 3CVHL 2UZIH 2CKSA 3KPRE 3BAWA 2BJMH 4QXTB 1J8HB 5EN2B 3GSNL 2WVTA 3H55A 4V2XA 4P5KA 1BD2B 2APWA 3L5XL 1E4NA 4BSWA 1IAOA 4YJZL 2H9GA 3GNPA 1IGML 3MV7A 3CMJA 3BQUC 2CKBH 4U1IB 1UOKA 3PABB 4PRAA 2DLEA 4RFNC 5D2LA 5FECB 4QRRB 2NLJA 5IJVA 3UROR 1U93A 3T1FB 5CEZE 2WBKA 2LE9A 4OLXL 4QRQA 5BRZD 1BFOB 4P57A 5DD1H 4P2RB 3A67H 4DTGH 3B8SA 3LAFA 4FP8H 3WLBA 5DUPL 5FUOL 4BUGA 1YDPB 5JXED 1VBRA 5F9OL 2J25A 1YY9C 4EQ2A 1CZ1A 4ODVL 2DLIA 1JPGA 2VAJA 4W6XB 3O8XA 3ARGA 3TBWB 5IVZB 3FB8B 15C8L 4UIMB 2F74A 3TJHC 3K81A 4QEGA 5IROA 2NW2A 4P9ML 4YDVB 3LV3B 1F58L 4DW2H 1TLKA 1JG9A 3QNYA 3LD8B 5ALBH 1A4JA 2Y8VA 1XGRB 3TBSA 4J27A 3B2VH 3LS4L 1NCTA 4H1LB 4U1JB 3SDAC 2D7OA 1U0QA 3RJDA 1SFSA 3S36L 1OINA 4OFYA 1DFBL 3HMWL 3ROOB 1FNLA 2ITDA 4K23L 2O61B 1KTLB 2X1WL 4ZOBA 1DDHA 3T4AB 5DEGB 2XIDA 2VDQL 4GSDL 5EC1A 4JFXA 1UJTA 3T2NL 2NY4D 5HBBA 2CBIA 2CRIA 2ARJB 1NDGA 4EI5C 2VDNH 4H8WC 3ARFC 1MJ7H 3D48R 2KZWA 3UYOD 1G6RB 4DGVH 5F1OB 2NY2B 3SURA 1W9BM 3ULUF 2QV4A 4C83A 2HH0L 5GJTL 4YGVB 3WJLA 2JJSC 2O5ZH 1GORA 1U2CA 2YD2A 1M6OB 5GS3A 2LAGB 4BFIB 3ZQ9A 5FGCB 3ZHLA 5IBTL 4HSQA 2HKHL 4S10A 4HWZB 2ZNXA 3HUJF 3WQ5A 1RIVL 2H1PL 1CXLA 3I9GH 3MRBB 3KLAB 5CJXA 1S9XA 4C56B 2YFNA 4PMRA 3WN5B 4TVPD 4WU5B 3T09A 1RZGB 4UINL 1U8OA 1WK0A 2VLJE 4JM2A 4U33A 3BD5A 5I8OL 4Z8FH 1PKQE 2YLLA 4LKXA 4I3SL 4ODTH 3WF4A 2AKRA 3OB0H 1JDDA 5FHAH 3TYGL 4MJID 3ULVE 2HFGL 3RJQB 5ESAA 5KSAA 1CE1L 1A3LH 3TO4A 4RE2A 4NN7C 4IRSB 1XF2B 4H1LG 4EANA 2WMPA 3ZR5A 1FBIL 3D0VA 5GIRA 3LQZA 3PL6B 1HJQA 1A7QL 3D2UD 2VL5A 1LDPH 3UYRL 5CEZL 1KULA 2UY5A 4OZHA 4FFYL 2FH6A 3THMH 5AYIA 3A5VA 4NUGH 4PGEB 3IB4A 3KXFE 3DHJA 5IVOA 3U7YL 5E08H 4NQSA 1MRFH 4Z76A 2OL3H 5SX4H 4P2QA 1D9KD 4RQQA 2VLRA 1C3FA 2EE6A 4KI5D 1LO0H 2A38A 5J1AB 1FH8A 5FYKU 5JIPA 1OY3B 4DUVA 2QSCH 4PMYA 3H9HB 1F4XL 1FNSL 2A3BA 4PIRF 4R27A 5FKAA 3RKDC 1WCGA 4CW1A 1A1NA 2YA2A 1GOHA 4AK1A 3ZKXB 4TTDC 4CU8A 1VERA 4Z0XA 2AAAA 4P4RA 3PDOB 4YUEH 5L88L 4E41D 4YHKL 4K9EL 4EI5D 1FG2A 1OD0A 1KLFA 2VMFA 2JB5H 2ZSWB 3RVXC 5IKCB 3MUZ1 3HG5A 4HW6A 1QRNA 1FNFA 5ESQB 2GCYA 1KJ2H 1JYXA 4D9LL 2FWOA 2Y07H 1BOYA 3CK0L 1B4JL 4LVNC 3VRIA 1HTYA 2VQ1B 3MS8A 1YUHA 2VRQA 2W60A 4XHJD 4L8SA 4KDTA 3MV8E 5KZCB 2EC9T 2W92A 1GOWA 3MXVL 3LX9A 4JFYB 1MXDA 1CR9L 3HC0A 1I8KB 3QRGH 1MHHA 2MPAH 4L9LA 1WAAF 3NA9H 1DUZA 1DE4B 1PQZB 2F5BH 3VFOA 3MZTA 4YAQB 4L3CB 4RNRB 2J7EA 4M7JL 3DWTA 1CDIA 2FJHB 3E6HA 1AGBB 3RY6A 2PW1A 3QXVA 1F02I 4G7YL 4PRHB 3DX7A 1MHCA 1UFUA 5D7JB 1C5DA 2KL6A 4E42B 2NNAA 4OQTL 3EOTH 3CLEL 2GEEA 3JWDL 1T83C 1ZVSA 2EYSB 2J8HA 3E6FA 3ULVL 1YEDB 1T2JA 4P2OD 4PMVA 4P3DA 3P73B 5DA4A 5I8CA 1KXVA 5FUZH 3WL9B 1HWWA 4HAGA 1HYSC 2WC3A 4YX2H 2N7BA 5DZOA 5FEBA 5A95A 1Z9LA 3DOSA 4OZ4B 4EVNA 4HKZA 4A2MA 1IQWL 1UWGH 3VWJD 3NIGF 3E3QC 4XV0A 1H3PL 3QUMA 2ZUYA 3VFGH 3UEQA 5JBDA 4QLJA 4FZEL 4K68A 4JFVA 1N0XL 1I4FA 4CD4A 3QUYA 2GTZB 4FQXB 5L8KB 5FYJU 43C9B 1QNQA 1RMFL 4YE4H 5I30L 4LNRB 5A16A 3GZAA 2DQUH 5DJ0A 1JPTH 2VXQH 3OPZL 4HF5H 3WHE1 4L4TA 4W7UA 1EO7A 1WBYA 2BNUA 4HH8A 3KR3H 1UQSB 4J6RH 1HH9A 5FM5M 1IAKA 1AC6A 5C0CD 2P43B 3SDXF 1QVOB 2FR4A 1JPST 5IM7A 1F4YH 1R6VA 4GUPA 3QHFL 1J0IA 1FL3A 3J7HA 5F96L 3HE7C 5E2WH 3D85A 2QJDA 1EIBA 1NCNA 1TQVA 2GW5A 5EBGA 3GMNA 1T0NA 1OAYL 1BFVH 1JPSL 2GUOB 3T77A 1NCWL 4HFUH 1OAZL 4ONOA 1ISVA 1FP8A 2WBJC 1OAKH 1NC2A 4TVCA 1I85A 2DL9A 1KPUB 3VGAB 3DV4B 3ILQD 1QLEL 5B3NA 4S1RL 1IC5H 4DKFH 2W59A 3SCSA 2DT2A 4MQXC 5HDBF 4JFED 1KG0A 4OFVA 1NBVH 3OXSB 2VDKH 3G04B 1I8LC 3BP6B 1NUFA 3HMXH 4FFWD 2ZCHH 4NSKA 2UVEA 5I1KL 3RDTA 3IDYB 4MCZA 3AZTA 5GS0D 4DFIA 1INQA 5A2JH 4M9OA 1EV2E 5BXSA 5IQ9B 5FYLH 1O7DC 3LEXB 4AEHH 2LAAA 5F7WC 2BS9A 1AKJD 2AABL 2H2SD 4X5WA 5IVXB 1LNUA 3OX8B 1ECEA 1FIGH 3PWVB 3EDKA 1XAUA 3O9WC 3DI2B 5CCKL 3CUPB 3C8HA 3O4LB 4HZ8A 5ICXA 4FTVB 4TSAH 2O5XL 1TA3A 1VCAA 4FNTA 3TO2B 4PRPE 4Z7OE 4GXUN 2X42A 1KTCA 4XB3A 4I2XB 5C08D 5C0AD 3II1A 3MFFB 3MRLB 4KWUA 1UB5A 3T08A 1EFXA 3CHFA 4PRDA 4JPWH 4LCYB 1RK1B 3OGCA 5E1AA 1QW9A 1U8JA 1WZKA 2LTQB 2BY2A 1YMMB 4HGWB 4KRTA 3MBEA 3DMMC 1EEYB 4KQ4H 4PB0H 4KJPD 1MAJA 2BVUA 3GI9L 4XP6L 4JG1L 5CFHA 3L7FB 1EQCA 1NC4A 5E7FA 7FABH 2QQKH 3K46A 4DKAA 1DANU 5F7YC 3HE7D 3WDJA 4CBPA 2AK4D 2RQ8A 3HC4L 4WI5A 4MDIB 4TVUA 1XF5B 5AWNH 3IJYB 1EDGA 5IF0B 2J7DA 3MA7A 3UTPE 1V0MA 3FO9A 2IQ9H 2NTSP 1ZLSH 2JK5A 3DXAD 3GMPB 1F4WH 1E6OL 1PIGA 1ITCA 4Q22A 1J5OL 2HJLA 4D3CL 3NIYA 3ILPA 1XGTA 3MUY1 3Q3GA 3RVUD 4RRPA 3W9EB 4OF3A 2UY4A 5IOPA 3T3ME 1B6DA 4MQXD 3DX3A 2VZTA 1I3GL 4FA8A 4Y1AB 1U8KA 5EU6B 2FDMA 1SBBA 1A6ZA 1T03H 2AV7A 1MFUA 2BNQB 3WD1A 4OLUH 1UZ8B 3X14B 1NBYA 5JDJA 1MW3A 2YN3A 3L3IA 4CVZB 3MC0A 1ADQA 1GCFA 2ZUSA 3NFNB 5CEYB 3V79C 4QT5A 4AC1X 3TH4T 1IARB 2PYEE 4QXUL 1O5DT 4NQCD 5HGDA 2WVVA 2GK1B 4KJYB 4PYGA 4MXVF 1DN0B 2YKLL 3O9WD 4JY5L 2JIWA 4LFHD 3CLFH 3WEXB 3VXRE 2EDJA 1OPGL 2GIYA 3C6LA 1SJHA 4H26A 5F7MC 3L4WA 3PN8A 1YQVH 3PWPA 3PWUA 1N82A 1HILB 1CLVA 1EGJA 3D39E 4X6CA 4Y5VC 1DL7H 1JNJA 1EDQA 1A7OH 4I8DA 3MKKA 1CU4L 1FAIH 1FN4A 1KLGB 3B9AA 3C87A 1BQHG 3SE4C 1YQ2A 4R4BA 1ONQB 4NO3A 5IB2A 3EYSH 5L7XH 1ISWA 1L0XA 2FGWH 4WTWA 5SWZD 1G7LB 4JFFB 3E2HC 3OKNB 4W68A 4RIRB 1OF2B 2EPMX 2VDPL 4YC2B 2VZ1A 2OYMA 35C8H 1HNGA 3VI3F 1AH1A 1KXQA 1JMXA 3JV6B 1CGWA 1EUUA 4L4VE 1AO7A 1T22A 4PJBA 2VLKB 2GI7A 5HHQA 2Y25A 2OM5A 4MAYB 1M53A 4AD5A 5DRXB 5DS8B 5DRZB 2EQDA 5BRZE 5J7CC 4KKNA 5CS7A 3IK2A 1MNUL 4PY7A 4ESKA 4YO0A 1ZGLP 3SIMA 4MNHA 2XFFA 5JW3L 1U8LB 3EJZC 3QQ3A 4PJXB 4CMMA 2MNUA 3IJSA 5L9DL 4NHCL 1YN6A 2FJFA 1V6WA 4G9DA 3H3PL 2EE2A 3PWLB 5F9WC 1QUNA 5AZEH 1QFWL 2WIMA 2IC2A 1A6VL 4PEEA 2PWGA 2ZUVA 1KCUL 1IEHA 2YSSB 5E8DL 5L2KB 5SWSD 4NPYB 4WWKD 1LO5B 5C07E 5BV7L 2X7LA 3F7VA 2IFGA 4DK3A 1Z2KA 3FQUA 3U7WL 3BT2L 4AIZA 4KAQH 5HYFA 5CJ8A 1ZVYA 3EJPA 2DMCA 3FT4A 3QIBC 3ZE0F 4LP4A 1OP3H 3HI5H 5BVJA 2DT3A 3OKMB 1MFAH 2G9HA 1PEWA 1OLLA 3EZJB 3UO1H 2QHLA 4AZ6A 2VL4A 2Z1SA 2H41A 4O51B 5DO2D 1UXWB 3SUWA 3B9VA 4NYLA 2VO5A 2XN0A 4X0KB 2ZUNA 2ZWYA 1MQ8A 1ZT4B 1BZ7B 4HWBL 1JWSB 4I0PC 2PWFA 1AGFA 1OCWL 5D2NC 3V0WH 1UHVA 4Y88A 4BZ1L 3IDIA 4PJHE 4OJYA 3ZO0A 1NPUA 1D5BA 1KLUB 2PBOA 4NRYB 4LEOB 5DEZA 5ACZB 1WBXB 3NTCH 1ISYA 4FK9A 3VFSB 2YOCA 4AMWA 3NMEA 3FO1A 1YPZF 4LLMA 4HC1A 2V5SA 25C8H 1CWVA 1I9IL 4TVPE 4XRCB 4N9GA 3NCYP 4HUKB 3LCYA 3S3PA 1W9UA 4PG2C 2EXYD 3SCWA 1HSBB 3O3DA 4TQEH 4QHMB 4BFEA 3SEPA 2MQCA 5DJZB 1CF8L 1HEZB 2EEXA 4UFIA 3BGAA 4OI9A 3CSYB 3EJSA 1JIBA 4HLZH 2RGSA 3NACL 3B2UD 1LWRA 2G3MA 2IBBA 3BH8B 2YBUA 3CD4A 3EJZD 3LKRA 3MLSH 3TIEA 1NARA 3WUZA 3IYLW 5BRQA 2XGBA 5HHPB 5D2LF 5CGMA 4OFDA 3DVNA 4LPTA 1PBGA 3L9RB 4YPJA 1OAQH 2OMNA 1OB0A 1QYGL 2W67A 3IGUA 4ERSL 5A2BA 1OQXA 1BX2B 3DX4A 3MSDA 4S1SH 4LBEA 2XHYA 1W8NA 5JO5B 5C09A 1WO2A 1QFHA 2ZJSH 4CJ0A 5FKYA 4PV9A 2H8PB 2HJKA 4R3SB 5DHVA 1KIPA 2YZ1A 1MJUL 3N1FC 4FXKA 2CIIA 1HQRA 4JVWA 4ODWA 5EO0A 3CUIA 4AD0A 4R4ND 3RIAK 4HIHB 4R26H 5D6CB 2ZUQC 4P9HC 4HH9B 1U58B 2YS4A 4P99A 2VYRE 4JY4A 1D6VL 2ADFH 2YC1A 1EH9A 3G5ZA 3LKNA 2Q3ZA 1PZ5A 5DZLA 1HHHA 3SUVA 1W0VB 1JHKL 2YR3A 5EIIB 5CKAA 3UC0H 3RVWC 3LSOA 1KSRA 1BWMA 2OQJA 3GXPA 1OHQA 3CNKA 4NZRH 4G8GD 4PJEA 4G42A 3KDMB 4X6FB 3B4NA 3R8QA 4FOMA 3EFDL 4TVDA 3O0RH 5I8KH 4WJ5B 5IFPA 1K6QL 1A5FL 4G9FB 5I1EH 2QQLL 1LL6A 4HPHA 1B2WL 2F19L 5I74B 4LLWA 1LQSR 1E6JH 2A1WL 3HC3L 3PNWA 2PB1A 4G6JH 2FCBA 2J7CA 3QSKB 3OKDB 1IKNC 3DYPA 3GK8L 3GBNH 4AENB 3D9AH 3ESUF 1NBQA 4ZENA 2FL5A 5J89A 4TVPL 3AGVA 2NW0A 3T0WA 3DYMA 4S0TD 1OIFA 3ARRA 5GHWL 4EJ1C 2GY7B 5HY9B 4J2XA 3N85L 4JM2F 4QYOB 2MTPA 5B39G 3SCMA 3RGVA 3SJVB 4XCCH 3U30B 5L8LB 2VXSL 2ZCLL 3I6KA 2N4IA 2D3VA 3W28A 1Q1JL 1CXFA 4F37K 4E0RA 2HKFH 2IMNA 2YWYA 3KL5A 4J8RB 5TDNB 1EQPA 3V52H 1OD9A 5D1XC 3VGHA 4H88L 2OYKA 5GGRB 3FMGL 2W62A 1I75A 1JI2A 2NY1D 4KFZC 4U1NB 1MQKL 4OKVB 4OZHF 3QEQD 4BH8A 4TUOB 4S1DC 4LPYA 3PQYE 2LQRA 3SUTA 3WH7A 3MANA 1K9TA 2YXMA 3I2CL 4G8EA 1B0GB 4X6DE 3VXNA 2IAMC 2HAZA 1HT6A 1LK3H 3RVWD 3W9DA 4PJ8A 1FZKA 3PWJB 1KGUA 3WEOA 4Z7WB 2ZPKL 4AM0B 1YNTB 4GLRH 2YD4A 2X40A 3T1WA 3G6JA 2EADA 4H8UA 1XCQA 2HP4A 1QQDA 3RWEA 1CFNA 4P4KC 5C0CE 4Z0BL 3VNYA 4U5KA 4PLJC 2A74B 4PJ9C 2FO4B 4H8WL 5JOPD 4GKSB 1L0YA 1UB6B 4M1GL 1ZLWH 5HPMB 3VFWB 1KJVA 5JIKA 2WV3A 1OGTB 2YFOA 2HYMA 2CXKA 2VITB 3JXAA 2HTLC 3BZ4A 3SY0A 5LWYL 4QXGL 4X4YA 2Z31C 3HB3D 1JZ3A 4GAFB 1UUQA 2DT0A 1WT5A 5ICZA 3NIFE 3SKOA 1Q0XL 4OLYH 1S9WB 4MSWA 3VWKB 4A6YA 3BUQA 5AZ2H 4M93C 1I1AA 1T7VA 5DEFA 2FNBA 5A2LH 3BKJH 4WDIA 5I73C 1FVEB 5BW7A 1F3JA 1Z5LA 5SV3A 2O9RA 1T20B 4LCUA 4R0LB 1PLGL 1FGVH 1T2XA 4XNYH 1E28B 2FGLA 1KGXA 2A2QT 5A6JA 3OJ2C 4W4NA 4OIIH 5D1XD 4CU6A 3FT2A 2Y8KA 4NO0D 5A2AA 3ELAT 4TNVK 1V3JA 4PTTA 2X4RA 1CGSL 1WFUA 4LPXA 4B5EA 1T6WA 4LDEB 3E3QE 5I5RA 5JA9A 3KGRA 2DYPD 4N5UA 3FQNB 4HIJA 5LAXA 3MLVH 2HRLA 3WUWG 4FNLL 3CH1B 5HHVH 3QI9B 3FN0H 1LE9A 2BP3A 4TNWK 5J12B 4QXWA 1YA5A 4JANA 2JKXA 3QUZC 3VIJA 1IGIL 2ZIDA 3TP4A 3ES6B 2NX5A 1KGWA 1XIWC 3X3FH 3V4VH 5I1CL 4PB9L 2FIKB 1NMBH 5L2JA 3TT3L 4XVTL 3NN8A 4WKHA 4PRIA 2JCCB 4PJ9D 1MEXH 1U3YA 3JBG7 3MUAA 1FZMA 3RHWF 1T04A 3RBGA 3QDMB 3EJQA 4FZ8H 3WL0A 1UKPA 1UA6L 2FJGB 4LQ1A 3X12B 4F2MB 5HYJE 5HTSA 4M03A 3B8YA 2P5EB 1FL6B 3PZ9A 4PP1D 3FN3A 5KVEL 4OZGB 1QW8A 1BOGA 4NO5B 1CDGA 5JPMB 2HTLD 2XKUA 4ODHH 3H9SA 2J4WH 2Z31D 1ORQA 2ICES 1KWKA 2IPTL 3FO0H 1IZJA 2D0GA 1ODAA 3GJFK 4G8IA 1M71B 4QTIH 2MCPL 4M62H 2G41A 4ZUTB 4EN3B 1AGCB 1HHKA 2R4RL 4KUCF 2PBGA 4QRUA 1I8IA 5ALCL 4K3JH 4MAUH 4AIUA 3FB6B 2JEQA 1MFCH 5I66B 1UH2A 5MERA 4ZAKA 1MRDH 3SDCA 1E0OB 1Y7VA 2PWDA 3BVUA 4M80A 3BVVA 3RWDA 4L5FL 4MCYA 2WIIA 2YD9A 5HI4C 2DQDL 1QACA 1JPFB 5DJ2A 3LXCA 2UWEA 4M6OL 1MFEL 5C0RH 2XA8H 2XT1B 1JRHL 3BPNC 4QGYA 4YXHL 1QSFA 6TAAA 4XPGL 1CDHA 1EAPB 1MWAA 2YPVH 2EDNA 4OCRL 2JF1A 3GMLB 2QLYA 4GO9A 1RUKH 4HJGA 5I16A 4QOKB 4M5YH 4NKQB 3D5OF 3DVIA 3LEYH 4W8AA 3KPOA 3EFFB 5T1MB 3AYSA 1ETZA 2XQYG 4NP4L 1J1XH 3SDDA 2AJ3A 1DQMH 1XCTB 2J88H 4NRZB 5HHXL 1E4MM 2D9QB 3KPSD 5E9DA 3BAXA 1N0LA 3BXNA 3AIUA 4PJFE 3GSNB 5I8EB 2YPLD 1KUMA 1FZJA 4L4OA 1A6AA 4Y5YA 3VXQA 4RWHA 5ADPH 1DUYA 1T1YB 3GKWL 2DMBA 2V7HB 4Q58C 4UV4L 3FHAA 3RWIB 3QXUA 3F62A 1ED3B 1GJUA 2BDNH 3QULA 1EMTL 1JXJA 3BESR 1A3RL 4V2BA 5I17B 4XT1C 1J05B 5DT5A 4XGZA 3MRFB 2X0HA 4URTB 1VFUA 3IETB 1NLDH 2IPUG 3G5XB 1JGVH 5CUSL 3UBXB 4TSCL 1E71M 2A6IB 1KEML 2H2PC 3DRTB 1W9VA 2CK2A 4HXBL 2ZKHL 5JORB 4LLQA 1A2YA 2BSTA 3OAZH 3LPWA 3EYOA 3K1DA 1J8HA 2G2RB 5GGSY 4HKBB 4OV6F 1BD2A 4UFHA 3DLQR 5FHBL 5CPTA 3VXUA 4Y4KD 1B90A 5HI4D 4MA1B 4U1IA 4FN0A 3PABA 5IFHL 4JFOB 1R5IA 5FECA 3T3PF 5C0EB 2DQHH 2AGJL 5SWSE 1F97A 5EU7C 4EIGB 4LCWB 3T1FA 2KH2B 3WUEA 4CUCA 1WQVT 2F54D 1OAXH 4Q0XH 3DSNA 1QSZA 4U49A 4XH2B 3D69B 4QF1B 4F57L 4PYSA 4UCFA 4F9PA 1FYTE 1T7ZA 1YDPA 4IS6B 3WD5L 2X9YA 3MLXH 3UBXI 4HUXB 5KTEL 2BVDA 2EDLA 1B9ZA 5F6HJ 3W24A 2BVEA 4JFPA 3ULUC 3REWB 4APQB 5I2IA 3TBWA 1H49A 3TGXA 4BK4A 3SKMA 5FA3A 1UVQB 3ZL4L 2W4XA 4W86A 1JJUA 4YDVA 4NJ9H 3LV3A 1J1PH 5J8OA 5HGBB 2H26B 5D8JL 2VNCA 1LQ0A 5C6TH 4KUZL 5EFIB 2UY2A 1RZJL 4N0CC 4NZTL 4JGMA 3B9KC 2GK2A 4TX8A 3QCVL 1NGPL 1XGRA 3MRJA 5CZVL 4X6CF 3VD4A 3OG2A 4H1LA 1FDLL 4U1JA 3SGKA 1HKKA 3QXTA 4U31A 4F58H 3KPRB 5M7QA 2YWZA 1NGXB 5CAYB 1E6XM 1KTLA 4XNUL 3T4AA 5DEGA 2XY2A 1WICA 3IJHB 3EIFA 1BJ8A 2ARJA 4YXKL 5GZOC 4UU9B 1QI0A 2CHNA 1G6RA 4P5TC 3HG1D 3TTOA 3ARBA 2ZOLA 4Q7DA 4KTDL 4RA3A 3KPPB 3WS6A 1QWUA 3TLRA 4PJBF 2KQNA 4M43L 4GAYB 2Z35B 1VF8A 1MREL 4MJ4A 2DQJL 4JAMB 1KTKE 4BFIA 4YN5A 1F90H 1UD8A 2DB8A 2AJYL 3WJJA 3MRPB 4HWZA 3PZOA 4X0VA 5A69A 3MRBA 1VESA 3KLAA 3Q6GH 1KFAL 3IDMB 3HPLB 4C56A 1ORSA 2ATPA 1XGQB 3VFUA 2DKMA 1ZTXH 4WU5A 5EUKB 5HDOA 3HA0A 1JUFA 1GQIA 1QA9B 2A6DB 4J3SA 3CPLB 4H5SB 1RIHL 1E4JA 1DWHM 2K7QA 3RTQC 3BN9D 5F3HB 5GRZA 3VM5A 4OGZA 4KKAD 5I24A 2EYRB 5EBWB 5JBEA 2EIEA 3OKEB 4WUKH 4ODXB 1UM4L 3KNBA 2LU3A 4IRSA 2SEBB 1XF2A 3K4ZA 5H35B 5B3JF 4NKIH 3ULUD 4QFUA 3PL6A 2C7FA 3MJ8B 4LRIA 5D2NE 5EZJB 5ADOH 4JLRB 2AEWA 3EZ8A 4G8GE 4KK6D 4U6HB 4PGEA 5MI0B 5K59E 5ESVB 4G6FB 4JO1L 4MD5B 1R33A 4D1IA 4N0CD 3E8UL 3KPLA 2WWKT 4HUMB 1GSMA 3T0BA 5KS9E 4Y4FB 3JWOC 5HGHA 2V7NA 1KYOK 1N26A 5EO9B 4OZIE 1N6VA 4CADA 5DK2B 1G0DA 4UILL 5JW4Q 1XR9A 2MKLC 2RGLA 3VG0L 3ARED 2OW6A 2B1HL 5TF1L 3H42L 2AJXL 1QBBA 4GO6B 2GUYA 3D3AA 4P5TD 5E2VH 5KG9B 2ZSWA 2F58L 2R2BB 4J1UB 1TQBC 2VLJB 1HXMB 1G94A 4D9QD 1PKQB 2CKBB 4J4PC 1C5CH 4UB0L 4RWYL 2YZ8A 4PTVA 4ODUB 1C1EL 3N0PB 5DJYB 5HSFA 1PX4A 2VQ1A 4Q9BA 5DUML 3PV7A 1KOAA 2O26U 4C7DA 4V28A 5FYKH 1N4XL 4JFYA 3HPJA 2H6PB 3WXWL 3HZKB 5F6IC 1EK3A 1I8KA 2Y5EA 1DE4A 3D3VD 1E6ZA 2ZP0T 1IEBB 2Y23A 3MGAA 2BY1A 5DMGC 3KXFB 4LGXA 4L3CA 4RNRA 5EBLA 1BLIA 3L95A 2K9UA 2FJHA 4W6WB 1AGBA 4FLRA 1F6AB 4GAGL 3BUYA 4WV1B 4Y19E 5D7JA 1XCWA 1G0YR 1JGEA 2V2TB 4LYPA 5DD0L 3DX6B 2PUQT 5E8NB 4D72A 2DRUA 4JHBA 3MA9H 1UM6H 1H3TA 1YYLH 3ZTNL 4TPRL 4WHYH 1YEDA 4UV7L 3U46B 3P73A 3T65B 3WL9A 1QBAA 1FH5L 3HFMH 3GIVB 1RURL 5ITBH 1FNAA 3MRKB 2YIHA 1A47A 4DZ8B 1UKQA 4OZ4A 2P5WE 4LASL 3QB7C 1R34A 4F7MA 2V3FA 3WSUA 3KAAA 4PJEF 3HE6C 5GSRB 2GTZA 4FQXA 5E1QA 43C9A 1DEEB 3ALWA 4KY1H 3Q1SH 1AC0A 12E8L 1CFVL 1ADQH 1X6NA 1LO3H 3MV8B 3DX2A 1VRXA 3BWUC 2CD0A 1AY1H 2FSEA 1N2RB 2VN4A 5E0CA 3P77A 1KJMA 4WI6A 5ECJE 5I15H 3VW3L 3KL0A 3QAZC 3LMYA 1ISZA 3NPSB 2XYLA 1UQSA 1BPLB 1XGUB 2KQMA 1G7JB 3DX8B 5E24E 2GY5A 3TV8A 2OR8A 1QVOA 1ZOXA 3B5GA 2HT3D 1X7QB 1U3HD 4XPHH 3TESA 2XRAH 4KPHL 4BQBA 5JLZB 2C0HA 4R7NB 4N90E 2GKIA 1TJGH 3TIDB 4PMDA 1R3KB 1E4XH 1UWUA 4WUUD 4PTWA 4XVJH 2R8SL 1CT8B 3P30L 5CILL 4JFSA 2GUOA 1DQJB 3FRUB 5FYKE 1R85A 1BGAA 3L3GA 1KPUA 4X99B 3DV4A 1KB3A 4D0CA 3IGAB 1C7TA 1M7IA 2AV1B 4B53A 2WKGA 3UTTA 3NDZA 3OJVC 5MEOB 5BO1H 4J3XA 5FIEA 4KZDL 1HVQA 3DDGA 1OGAE 3C5JB 1V7NH 5BS0A 4Z78B 3OXSA 3C60B 3KYOB 2E9BA 3BP6A 3O2LA 3BOVA 4LVHC 1Y6KR 3ZDYE 5GS1A 3CVIH 4BKLB 3K2UL 3C09B 1Q6GA 3F58H 5IQ7H 1RH9A 4JKPH 5HHOA 3EYUL 5EUOE 1GJWA 1Q9KB 3OX8A 4E5XB 3KHQA 5J6HA 3LHPH 3CUPA 5EIQA 3UCRA 4HUVA 3G6JF 2WAHA 1MAML 1G9MC 2LU4A 4M5ZL 5DJ8A 3TO2A 4NQED 3B83A 4HCRA 1KJ2B 4XBEH 4XVSL 2BVQA 3MRLA 3NCJH 5JXAL 5BJTB 4ELME 2AQ2A 5LCVH 5MEPB 5KJRH 3VFRA 3BUPA 1FNHA 4DAGL 1RJCA 3V9FA 5I1HL 3IFOB 4JZNB 5IB5B 2JJTC 4HGWA 1YMMA 1L7IL 5SX4I 2BSRB 1NBZA 2EIDA 1EEYA 3U36B 1ND0A 1OSPH 1J18A 3L7FA 3MR9B 3S4SG 3RM9A 4NN6B 4UT7H 3RPMA 4F7EA 2NTFA 1C91A 2EDDA 2YUXA 2GJ6D 4U1SB 5GPRA 4LLUB 2IGFL 1XF5A 3ARDD 4UT9L 1BQHA 4HS6B 3TA3C 1NAKH 4RMRA 1PW3A 3GI8L 2AOSA 4AW7A 1ZBWA 4BZ2H 3GSUB 3U0WL 5F97E 1V03A 3GMPA 1U33A 2DLGA 3BLKA 2AQ3A 4NZCA 1CFQA 4P46A 2OR9L 5TQ2H 4HC1H 3GRWL 4X4MA 3L3HB 3TNNB 3S97C 5FYJE 1T89C 3W9EA 5A6SA 2E7MA 1BWWA 4K55A 1R3LB 1M01A 3KVQA 3BVXA 2AXGB 4OFIA 2OP4L 4Y1AA 3MYJB 1UR0A 5C8JB 4YHML 3IANA 4Z95H 3QNZB 4PRPB 4QAWA 5D9OA 1UZ8A 3X14A 1TVHB 4CVZA 2EIZB 3BRGC 5EULV 3RU8L 2ZUWA 2IADB 2X70B 1KT2A 5E94B 5ABHA 1KTBA 1C8PA 5DURB 4K94H 1VB9A 4U1KB 5D96B 3PZMA 2DM2A 3TM6A 3V4PL 2GK1A 3U5YA 4D2NA 2YXFA 4YDKH 1VSCA 1DN0A 3BPOB 4KQ3H 2M26A 4Y2DC 2E9WA 3WEXA 4ZS7H 4JRYE 4K7PX 2X4PB 5D1ZC 4FQIL 3T0EC 4JIEA 3N9GL 1UASA 4OB5L 5DHVH 1G7PB 2PN5A 5SWQB 2OR7A 3O6FD 1MELA 2G3JA 3B2VL 4J23A 3T2QA 4ZXOA 4FQ1L 2YN5A 5F9DC 3CUHA 1HF6A 3UTZB 1KEGH 4BK5A 3QXWA 1G7LA 5IEHA 4JFFA 4ZUSB 2O93L 2C1OB 2P44B 3OKNA 4PJIA 3QXDB 1OF2A 2EH7L 4RIRA 1KC5L 5I1AA 3O2DH 4G3YH 1X1NA 1P1ZA 1KCRH 1GPFA 5D7IE 1HHIB 2MSPA 4LLYB 1WITA 4M8VA 1XH3A 2VLKA 4CMHB 4NQDD 4R2GC 4MAYA 2OZ4L 4QCIB 5LGHL 4DO6A 5DQDH 4YHZH 3BYTA 3CFKB 3O3BB 2ICWJ 2YL6A 1DSFH 1CK0H 2X2HA 1NUGA 4OV5A 2VE6B 1JGIA 3MROB 4PJ7E 5ISZA 1U8LA 3H3KA 1FP9A 1EAJA 4G43B 4WO4D 4RGNC 2FEEI 2YMXH 2PYEB 2UWEF 1IT0A 4JB9L 4YHPB 4D6JA 4U3CA 3VXRB 5B22A 2CNCA 3PWLA 3WF1A 5FO9A 5EZOL 1YJDC 4A2LA 4Y4HB 1GGIL 1QFWI 1HIZA 5HBFA 1M7XA 3TZVB 4UTAH 4MDPA 3D39B 5DK0B 1IGJB 5D1QB 5L2KA 3IDNB 2CK0H 4I9WD 2FB4H 3O6LL 1LO5A 3MLTB 3MRMB 4KVNL 4NPYA 4U6VH 4XMLL 3U6RA 3WD3A 2D03H 3WKMH 4IMKC 2PO6B 2GTWB 2R69L 4ORGB 1FJ1B 1YEJL 2R56H 4Y2DD 3JWNC 3S37X 1P6AB 1GQLA 1TVPA 4U6YB 1EEQA 1XD0A 3BAIA 5D1ZD 1JF1B 1RSFA 2E7HA 2NY5C 1MUJB 4AZIA 2YJQA 4O51A 1JGUL 3IFLL 4X0KA 2XXMB 4PJDE 1ZT4A 1JWSA 1P4BL 2VDLL 4L4VB 2P24A 1B0IA 4I48B 5ABDE 3WNKA 3EMZA 1LO0L 2QL1A 1KLUA 4NRYA 5E99H 3K7UA 1C08A 2P7TB 2VRAA 4KVCH 4LEOA 5FF6B 4W4OA 5ACZA 1WBXA 3BWAA 5BRZB 5FOBB 1NSNH 4H8VA 4DGIH 2K3TA 3VFSA 4WW2B 1XH1A 4CU7A 4FLOA 3QH3B 4OOUA 3H6JA 1NUDA 2G60L 4XRCA 2E5EA 5EU7E 1BZ9B 4R2GD 5D93C 5IDIA 4HZ6A 4PGZA 2KDGA 1HEZA 4QRSB 1DCLA 1WBZB 1LO4L 2VZVA 1RJZA 2HFEB 4LPVA 3PF2A 3CSYA 2DMKA 3FAXA 1INEL 5C07B 4OKDA 4RGND 1JZ5A 1P7QB 5HHPA 4L3EA 2X9XA 4D6DA 1AHWB 4OAWA 3U1SL 4U2ZA 2F8QA 5IVNA 3ULUE 3MXWH 2OI9C 4KK5C 2X2IA 2C9AA 2XNAA 4H41A 2R15A 1MHPH 1IVLA 2PXYB 3PZIA 3QRGL 3JWOH 3UZVB 1RZ8B 5DUBA 1TENA 5DVNA 3QNXB 2YKKA 1Y0LB 1KV3A 1ZBCA 2NY4B 4BQ4A 5JO5A 1TJHH 4HJJL 1G7IA 4X8JB 4PJHB 5D7SL 2ADIA 4GQPH 5B39A 1C93A 4HPYH 2AJSL 4ACZB 3EJYD 1KR0A 3WJLC 4HIHA 5D6CA 2RHEA 1U58A 2NZ9D 4B9YA 4M24A 1XF1A 1GOIA 4LSRH 2W9DH 3ZR6A 1QKZH 4LIQH 4O9HH 1MW1A 5C7XL 2EEBA 2IXUA 3MV7D 1U8NA 3BQUB 3V95A 1DVFC 4X5LA 5FUZL 5EIIA 1K3ZA 1WCBB 5D8ZA 1II4E 1UACL 4RFNB 2F18A 4YK4C 1KQYA 2GT9B 4MNQE 2J7BA 4UOQA 4JM2C 5CPSA 1KN4L 4PMXA 3V6OA 3FQTA 3KDMA 5JUEH 4PJCE 3VFGL 2DEPA 4WJ5A 2A6KA 2V9RA 3W29A 4G9FA 3SPVB 3TVMA 5KSAC 1ODZA 5I2UA 3RX7A 1MCLA 1UYWH 1NMAH 1XF3A 5IK3B 1MFDH 2VABB 1Z3GH 4Q9QH 3BDBA 4P59H 2WWCA 2PETA 3O8XD 4TVSa 4HF5L 5IUSA 3ARGD 3F6IA 1UCTA 5KOVC 4CCDA 3L3JB 1URLA 4XP1L 1S7VA 3WEMA 2XKNA 2FYYA 3OKDA 3KR3L 4J6RL 1NM9A 2IXVA 3O45B 4FNPA 3FAWA 4M1DH 3PXJA 4AENA 2YRZA 1UYQA 3PZQA 4OCXL 1K2DB 4X6EA 1GPOL 3SDAB 4C4KO 4G6KL 5HY9A 2B2XL 1W9XA 4IDLA 4QYOA 1E1FA 4JG0L 4OFYD 4JPVH 5D5MA 3SJVA 2HVKB 1W3HA 4LLAA 2W65B 4EUPH 5ILTL 4RGOL 3TCLB 4JO4L 4QHUA 2Q7YB 4J8RA 4EI5B 4UFMA 2CUHA 5TDNA 1VGKB 3ARFB 2HWZH 2D7MA 2QSQA 3WMCA 1R5WB 1FVCB 4AMXA 3MLYL 1E73M 3CUFA 3ULUL 4HKJA 4U1NA 3SE3A 4HBCH 4OKVA 5H37G 2CJUL 3NBNA 1GGCH 2AXJA 5JIHA 5D70L 2XUCA 4RSVA 4GRMA 3U79A 4ZTPH 4LYRA 1HJXA 4X9HA 3SGEH 2EE3A 4L8SC 3PWJA 1BBDL 4Z7WA 1F2XK 1K9FA 3R8BB 2Z4QB 2NY6D 2W0LA 5A8OA 3WFBH 4JM2D 3IJ7A 5CBEB 2DSUA 4AM0A 4AEHL 3M46A 1YNTA 2O9PA 1FNEA 2F7PA 3O3AA 1BIIB 4L9LC 3WUWA 3RIFK 3MGTA 2A74A 1JHTB 5DFVC 5KSAD 2EE9A 4NN7B 3TO4D 3RGHA 4GKSA 3DTXA 1VJSA 1JYNA 2W5FA 1RZIB 1UB6A 3OAUH 5GGQL 2XPGB 2WINB 2YK1L 1OGTA 5E8PB 5E2JA 1AQDB 3WBAA 4G6AD 2VITA 5E8OB 4HMEA 2J78A 2NY0C 3BGFC 3ZJ8A 5GGVY 2A0LC 1IMHC 1KXVC 3HNSL 2E7LA 2VCCA 4XX6A 4KQ4L 4PB0L 4ZYKB 4P2QD 2ESVA 5TQ0L 6FABH 4JRXE 5GS2H 2VLRD 3OJDB 2QQKL 3HZYB 4OBRA 3UTQB 1Y6MR 4MXQC 2CITA 3PQYB 5MEQB 3CZFB 4R0LA 4D71A 2NW3B 2P46B 5AAWA 4ZFZA 3QUYC 4X6DB 5JDSB 4NQVB 4U4BA 1OB1A 3UG5A 4XP4H 1IRAY 4U7MA 4AMKH 3QG7L 2X10A 3MOBL 4K7PY 5F9AC 2YUWA 4ATLA 3F6LA 3VIOA 2O5YL 1SY6L 2EEAA 1QRND 3A6BH 3GIZL 5CD3B 2I60H 5C0CB 4LKCB 4ZD3L 4LVNB 4LLVB 1NFIB 3CH1A 1ZJBA 3QI9A 1MSPA 4FQQB 4NQEE 5LKNA 1BQCA 3BEWB 2QADC 2X44D 5JHDE 4QHKI 3NFPB 4JKMA 1U8MA 2HVJB 1T66C 3VDCA 4OGAC 2FD6H 4HLZG 4F7PB 1WDQA 4JFQA 4YPGB 1LO2L 2FIKA 2XFXA 3GMOA 4OSUH 1RFDL 1V8HA 2IWGA 2WLYA 4WFHD 5DFVD 5HDQL 3QEGH 2WP3T 4UIKL 1ZA6B 4RFOL 3QDMA 3NZHH 2FJGA 5CINH 4YIQB 3W81A 2XPKA 3X12A 4F2MA 2GJ6E 4LARH 4NQUA 3IF1B 1FL6A 2YDRA 3L1OH 4X9IA 4LHQB 4OZGA 3NUKA 3JSSA 4E9LA 3BXWA 5JHLH 4K3EL 4BS0A 3EDFA 2BNJA 5ANME 1OP5K 1QI5A 1LP9E 2B4CC 1G9NC 2J6EL 5BOPA 4JZOB 2HFTA 2WQ8A 2WHJA 3V4UH 5E2TH 4EN3A 1AGCA 3BUBA 2PKDA 2I9LB 1AD0B 3HI6L 2BX5A 5ACMA 3VI4F 5J9PB 1AKJB 3WD0A 3GO1L 3FB6A 4HJ0C 5I66A 2J62A 3DX0A 4LCIH 1S7UA 3QUYD 2OYLA 4C7GA 4LDOB 3VFTB 4QLLA 2V17L 3LKPA 2A6JB 1FGNH 4P7NA 1X5KA 4KRPD 3INUH 4IJ3C 1JPFA 2LV4A 1ZA3A 2UUDK 3RUGB 3O11B 4NX0A 2F61A 1TR1A 4L4TD 4XWGL 1NEZB 3AYRA 2M8XA 2P45B 2EDFA 3OTTA 1RUAL 4XZBA 4CKVX 5IV2A 4NNYB 4JRWA 1VFAB 2AJVH 2EO1A 4XI5D 3GMLA 3LS5L 4JZJA 1NMCC 4QOKA 3OMZA 4G7VL 5GQBA 3EJUA 1NLBL 3EYVA 2J5LC 1HKLL 3EFFA 2QKIA 2QADD 5T1MA 4LVOC 1CXIA 1EO8L 3HE7B 2YRPA 5HYJB 5DYOB 4JHAL 3MJ9A 2P8MB 5DD5H 3WFDL 2NMSA 3D85D 1XCTA 4NRZA 5IVXF 4WKAA 4DWSA 1FPTH 3SBWA 1A14L 1AJ7H 3C9NA 4OLZL 5I8EA 2BXZA 3UDWC 3MI6A 2WBJB 1T1YA 1NC2D 4KJWD 1MF2L 5I76B 1QSEE 4M3KB 2EC9U 3OZ9H 2I9TB 2JF7A 2JFEX 3N1PC 4JN2A 2NY7L 4HIIB 2RR3A 4ENEC 3V5HB 1KQZA 4AL8H 4JFUA 4NQDE 5I17A 5T3ZH 1QOKA 5HYSB 1GZQA 1J1OL 3MNWB 3IETA 3RVTC 5ENWB 4J7RA 3G5XA 3UBXA 3RDTD 3LMJH 3MCLH 2A6IA 3DRTA 4GLRI 2Y72A 2OW7A 1HP4A 5AUMB 1YJDH 5JORA 5MP6H 3K8LA 1RHHB 2R4SH 1A6WH 5JOFB 3O9WB 5IMMB 1N8ZB 3WKNA 2BK8A 4LDLB 3MRDB 3QIWA 1UD4A 1I7ZB 1NAMA 4XNMB 3V6ZB 3C6LC 4D8PA 4YDIH 1T1XB 2YD3A 2VC9A 3QCTH 1GOFA 4JFOA 4GINA 1VPOH 5C0EA 4KKLD 3D52A 1EFXD 4LCWA 3GNRA 3QWOB 4RMTA 3UJTL 3OKOA 5BQ7A 4PJFB 4LGSB 2ZX6A 3D69A 4QF1A 2ICEA 3MBED 3DMMB 1W1TA 3BIKB 2H32B 1BVLB 4B50A 1L4IA 2XWBB 1NC4D 3T0EE 1IKFH 5EA0L 4HKXB 4WJXA 1AR1C 2R0WH 3WO4C 4U3AA 2Y9RT 5JW4N 5K9KB 1GAFL 2DI9A 1UVQA 5INCB 2VT0A 5ACLA 4NWUH 3RCNA 3H3BC 4TSBH 4N0FA 5HGBA 1G9ML 2D2OA 4GW5B 5EFIA 5FO7B 1YC8A 5CJ5A 1Q38A 1AIFB 3TNMA 5C1MB 5LQBL 1Q72L 3C08H 4JGUA 2NXZC 2E27H 1TPXC 3L4YA 4AZCB 5DJDB 2DBLL 4I3RH 3IJHA 3RVTD 5FCSH 4IOFC 3WIHA 4OJFH 4MJ5A 4R6UA 1S7SB 4UU9A 2ZX8A 3UP1A 4XWOC 2V3EA 3AJ7A 1BGXL 3LDBC 5SWSB 4NN5C 5T3ZE 1A7PH 1PG7W 3H7BB 1T4KB 4RGNE 1EBAA 3F5LA 5DGQA 1KPRA 6CGTA 4UR9A 4JAMA 2QMKA 3IKKA 3GHBL 4RMWA 2Y24A 3QA3A 3MRPA 1LK2A 1FYTB 3C6LD 5LJYH 4N8VB 4PCTA 1EUTA 5B8CA 3HPLA 3PWPD 4HPOH 1U95B 4OLWL 4AZGA 3S3SA 4Y5VB 3CBWA 3MMDA 2WC7A 5IEKA 3DSFH 3D9AL 1IC7H 4PJXF 1A1OB 4V1DA 5GRJH 3A6OA 3SE9L 1JVKA 5JBFA 3MRNA 3TTSA 5F3HA 2E40A 2FRGP 3PBGA 2EYRA 5EBWA 4MQSB 3FW6A 4Y5XC 3OKEA 3VXOA 1IAIL 3E2HB 1H15A 1TQSA 4YBQD 4ODXA 3JV4B 2I25N 4ISVA 4K7FB 1F6FB 1RZFL 3MRGA 5H35A 3RZCC 3IDGA 4K2UH 3IXTB 5D2LE 1AO7D 4H20L 1PYWB 1DBKL 4OM0L 5TE6L 1E27A 3W11D 1MJJA 1U3JA 3VXTA 1CNVA 2D7TL 3V8OA 4TRPH 4U6HA 3VXME 2WNWA 4GZEA 4GBXC 2P8LB 5ESVA 1NWSA 2W1NA 1H41A 5IR1B 4OM1L 3G6MA 5DGRA 5IB4B 4EEEA 3FB7B 4Y4FA 3HZVB 4GMSH 3VUPA 5EO9A 2R0ZH 3GEWB 2B1AH 4M48L 5C0IB 4LGRB 4MB1A 5DK2A 4K8RH 4K7PL 2NXZD 3NCMA 1CD0A 1JFQH 1XGZA 4HV8B 3PV6B 5F9WB 1FNGB 1K4DB 5IG7B 3FOMA 4GJTB 2IANA 4N8VG 5C86A 5DMIL 3I75B 4XWOD 2UZXB 1ZS8A 1QBLL 5KAQG 4M8UA 5KG9A 3NAAH 3MCG1 3A23A 2R2BA 4J1UA 3DDFA 4ZXBC 4HA1A 3MLZL 1YYML 4HMCA 5FO8B 2EIBA 4QRPD 1WAWA 3H7LA 1PKQA 2CKBA 4AH2B 1U30A 1F3RB 3QIBB 1PFCA 3PHQA 3CFDB 2PTTB 3I50H 3IDUA 1OM3L 4OLVL 4ODUA 5DJYA 4QRTA 2Z1KA 5DT7A 4PJ5A 3CO4A 1I9EA 2X5PA 3PGDB 2FLBT 4I0PB 4F8TA 2QHRH 5D2NB 2E7CA 4X83A 1UR2A 2XZAL 3CXDH 3MLWH 4R8WL 4G8GB 2DPEA 3EGSB 1IEBA 4M81A 3KXFA 1CGVA 1PSKH 5ID1B 1HHGA 3MO1B 3LKOA 5KS9B 1E56A 3ZZ1A 5ICYB 1G7MB 5SX5K 4TOYH 4OZIB 1HIMH 3PDGA 4ZFFB 2V2TA 5I18H 4OTXL 1P4IL 3IU3B 3ZDXE 5E6ZA 3SO5A 1NFDE 1T0OA 4P0DA 3QUKA 3KHOA 4YDJB 3RY4A 2WMJA 1W9DM 3RL2B 3KJ6L 3U46A 3T65A 1B0RB 2VJXA 3WBEA 2QPUA 3GIVA 3HZMA 2OJEA 2NY5L 4RMUA 2D3LA 3OXRB 3WH9A 2CEQA 1YEEL 4HPGA 4MNKA 1FZOA 3D25A 2ADGB 4AZ5A 3S37L 3TN0C 4DQOH 1WLHA 1P7KA 2QSVA 5F21B 3IXAB 2OXGA 4U1HA 3BSZH 5E6IC 1ROWA 4NZDA 3IAQA 3SCMC 3BW9B 2ZOXA 2I5YL 2PI6A 1OCQA 2DD8L 1DEEA 1MY7A 4IRJA 3W38A 5IFAL 3VGDA 4DO5A 2PWEA 4O58H 2I27N 1MIEL 3WLWD 4ZXLA 1I8MB 1VFMA 2Q86B 5C09D 5HYQB 3BH9A 3W5MA 1JGLH 1QFWM 1H8NA 2IBZY 1B3WA 2XQBL 1T1WA 5BMFL 5TE4H 1XGUA 1G7JA 1HZHL 1N7ML 1ULVA 2ZUQB 4GG8B 4WIWA 1EEUA 3WIIL 4WU7A 3BO8A 3D50A 1IFHH 4Y19B 1T21B 4R7NA 1BSIA 4XNXL 3TIDA 4PCSA 4JY6B 3U0PB 1R3KA 3QFDB 4GW1B 5E9AA 1DBML 3DBXA 4HUWB 3TWCH 1L8NA 4U1MB 1DQJA 3FRUA 2XWDA 5DI8B 3RWCB 1MFCL 3UXFA 1L6ZA 3S4SA 1QWNA 4QGTA 4R96B 5CSZB 4QWWC 1MRDL 3LPGA 4CDGC 2AV1A 2J2ZA 2P5WB 2DT1A 4EBQL 2NT1A 1EXUB 1T0MB 1ZT1B 2C3VB 3I85A 3MRCA 5MEOA 1MCKA 2HJFB 2VLLB 2J8GA 3VDBA 3C5JA 3FZUD 3IVKB 1KGCD 3C60A 4ZUVA 2KZ1B 2X4QB 3ALFA 3FCTB 1KBGL 1NFKA 1A0QL 4PTUA 2DQXA 3CX2A 1IGTA 4WFHE 1WT5C 3TTQA 1JWMB 3VD7A 3WNNA 4DN3H 3QDJA 4WY7H 1T7YA 5CWSB 1AQMA 1AXIB 1GZPA 4HUUA 5C0GB 2CGRL 4XAWH 4Z7WF 1Q9KA 2R0KH 2CDEB 1ZE3C 3CX5J 4KK9C 1SEBB 2G5BA 3ISWA 5DRWA 2B4CH 5J3HC 1ISXA 3SCMD 1YECH 3AC0A 3BKCH 4JGJA 3RGVD 2R23A 3KEHA 1V3LA 3MMEA 5BW7C 1IEAB 3CDFA 4OD3L 2XWEA 4U2YA 4MXWH 4WI3A 2VDMH 4XBGB 1KJ2A 5E03A 3C6SB 3GJFH 1E6PA 4CRPA 5IMOB 5BJTA 5C70A 5D1XB 1KIRB 3L3KA 5MEPA 4YFLF 1U42A 2HFFB 2V5DA 1ZVHA 3DC0A 3IFOA 5A6KA 1BQUA 2Z93A 1CG9B 3U36A 1A1MB 5EOCJ 3GJEB 4ODSH 5J1SC 4JKLA 5EO1A 1D6EB 3S9DB 2IAMB 3GXNA 2ESCA 4KZEH 5TJWK 5I3DA 4G8FB 3QZWB 4HHAB 3T0XA 4C58B 4DGYH 3W5NA 1EO5A 4Z2KA 4U1SA 4PJ8D 2J75A 1T7XA 4LLUA 4ONHA 2VXVH 3S6CA 1JV5B 4HS6A 3QCUH 1S7XB 5IMLA 1OGAB 3AUVA 3LQAH 2RBLA 1WFOA 3GSUA 4NJAL 4P4KB 5GNZA 1NGZA 1JE6A 4IM4A 4PJ9B 4ZNEE 4MAVA 1RU9H 3L3HA 2E9LA 3ALXA 5EUOB 1PDKA 4N0YH 4OD1H 1GYAA 1J9YA 1QLFB 2AXGA 1V0LA 1SYVB 3MYJA 1E3XA 3WH5A 3I6LE 5C8JA 1EHLH 1A22B 2Z31B 1NKRA 4NM4H 2F2HA 1TVHA 3QG6A 5BXFB 4CCEA 2D4FA 5E5RB 3AAZB 3MFGB 4HOWA 4AD2A 2IADA 2AI0L 2GSIB 2X70A 4ZPTB 2V5RA 1A21A 4ELMB 1W32A 4U1KA 1N5AB 3N12A 3GZKA 3MLXL 1TVBB 4M93B 1I1AD 2IG2H 1BZQK 5J3HD 1BG9A 2Q20A 5I73B 3CSPA 3UERA 1TZIA 4JJHA 3VH8B 3CFCH 3V5DA 1WSST 1R24B 4YNYA 3LXBA 2X4PA 43CAB 1T5WB 2ZOKB 5FUCC 4M8QB 2JCCF 1DQLH 1E4KA 1S9VA 3QPXH 4DUXA 4ZDHA 3HRPA 5B21A 2AMGA 3KYKH 4R4FH 3MACH 1AGDA 3VRLF 1NGQH 4UZGA 3PJSB 5T3XD 1V0KA 4OZGF 2BV9A 2NXYD 2VDOL 3M17A 1FFPB 1XRVA 4XPAH 1YNKH 2IEPA 2Z8SA 3PWNB 2C1OA 3MX0A 4I1NB 4JM4L 1AQHA 5GRVL 3LKQB 4CVXB 4OQ1A 3PP3K 2DLFH 4WHYG 2EPNA 1KB5L 3QUZB 1HHIA 4K9EC 1P84K 4A3YA 3DNKA 3SDDC 5I1DB 2NX5D 1XIWB 4IMLB 1H8OA 4YFDB 1I1RA 2GDVA 2X4UA 1JNHB 5EOQH 3QUML 4FABH 1PJ9A 1TVDA 3CFKA 3O3BA 1K8IB 2F8OA 4NCC2 2HT4D 1EVUA 1E4WH 2X89A 4ZO7A 4AY1A 5FGBA 4PRID 3QFJE 4QNPF 1HXYB 3DUSA 3NSXA 5IJKA 3AY4A 3MROA 5E4IA 3BDYH 3HUJA 3TJEL 1CD1B 3AS1A 4XC3H 4BQ2A 1KBKA 3HMXA 4YHPA 4UBDD 4F7CB 2OSLB 3S88L 1M1SA 1UXSB 2MCG1 1NH6A 1OGBA 4EI6B 1GUVA 2WMIB 1K4CA 4LRNL 3VXRA 3DHPA 1AXTH 4JRYB 3RWGA 1JGDA 1TETH 3H9SD 4Y4HA 4TXEA 3TZVA 3QRFM 3C2AH 3SOBL 3D39A 2BC4B 4YHNA 3MSGA 3IJ9A 1MCPL 5D1QA 5CP3A 1E0VA 3MLTA 4JFZL 2L7JA 4LAJH 3S6TA 4FF5A 3KWWA 3QO0B 3T04D 3LRSB 3T3PE 3RPIB 2PO6A 2GTWA 2HRPL 4ORGA 2BHUA 3TOPA 1JHLH 2Z8VC 3U9UB 1NANH 4HIXL 4KTEH 4PUBL 1PY4A 3EBAA 4U6YA 3UR8A 4ZAKD 3APGA 1CLYH 4TTGA 1JF1A 5C3TA 3IJ8A 3SDCD 5GZNC 1CL7I 3NH7L 4KRUA 5IW1B 1MUJA 1QHZA 2DWEB 5D7IB 2DQCH 5DXWA 4L4VA 1I7RB 3BPNB 4FQLL 4I48A 3P9WB 1QSFD 1BAFL 5TFSL 2QQNH 1G84A 1B2YA 1J0JA 2P7TA 5FF6A 1WWAX 5T33H 4ZQKB 4H0IA 1NCUA 5FOBA 4UNTA 4LSUH 1FG9C 1PG7H 1A8JH 5DC4B 3VINA 3QH3A 3W25A 4PJ7B 2MQ0A 2XTJD 4EOWH 4KMTH 2DS4A 2I24N 3AB0C 4S1QH 2VZ3A 1D3CA 3DURA 4NC0B 4XXCA 3N1GC 3SDDD 3REVB 2PWHA 1KTDA 2HISA 1H3WM 5J06A 4W84A 5E9DD 1WBZA 1WV7T 4X4XB 5T1DL 3WH8A 4PSPA 3WXVL 5HHMD 4PD4K 5C07A 2FO1A 3N04A 5DLMH 4K3HA 3NCEB 3KYMB 1P7QA 4GQ9H 2GJZB 3EMCA 1KCSL 4NNPL 4Y0GA 5F7EH 3SGKC 3PTQA 1AQKH 5DD6A 4JQIL 1KXQE 1P6WA 4NT6A 1EZVX 2YD5A 3L3DA 1ZSDB 3NIDF 5J57B 2CIKB 2PXYA 2MWCA 1EX0A 5JW5B 4JO2L 4XC1H 1RZ8A 4ETQA 4BSVB 4URIA 1C12A 3CCHB 3CZSA 3QNXA 1ZHNB 3FT3B 1BM3L 3FQWA 4LP5A 4PJDB 3MRQB 2P4AB 1AE6H 3AQUA 4IRZH 2ED9A 3ARBC 4PJHA 4MA8L 4MDJA 1VBUA 4ACZA 2BSSB 3OKLA 2N7AA 3OAYK 2E3VA 3RX8A 3N06B 1J8HD 1XZ0A 1V08A 4XP9H 2CUMA 2XZQL 5GZND 1BD2D 3SCOA 3WJJC 1S3KL 4LHUB 3VXUD 2OWCA 1YEIL 2C3GA 3BQUA 3HNVL 4HWNA 2DOCA 1D5IL 1WCBA 4YWGH 1QR1A 2Q8BL 3WNOA 3FONB 1QI4A 3BE1H 1MAKA 4DCQA 3NZ8B 1MCOH 4QRPE 4JO3H 4XNQA 2APVA 5FIPA 1N6QL 3M45A 1OTUD 4L3AA 1N59A 1YEHH 1NP0A 3SPVA 5EBAA 4Z7UA 3QIUA 4L4PA 1UZ1A 1VEOA 3Q1SL 4YXLH 1KJ3H 1AP2B 4PPTA 4D9RD 5EZIL 4AD3A 4MS8D 1DBJH 3O2VH 3IFPB