1CGXA

Site directed mutations of the active site residue tyrosine 195 of cyclodextrin glyxosyltransferase from bacillus circulans strain 251 affecting activity and product specificity
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLLDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Site-directed mutations in tyrosine 195 of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 affect activity and product specificity.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
total genus 235
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1994-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgxA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgxA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cgxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cgxA01
1W32A 3FW6A 3MJ7B 2J6EA 1UKQA 4ZD3L 3IDMB 4PJGA 2PXYB 3NYDA 2IG2H 3T3PF 5HI5C 1AQKL 3NAAL 1HIML 3QDMD 5IB3B 3RDTC 3SCTA 3QDJD 3WN5C 4NT6A 43C9A 1V08A 3UTSB 1L6XA 5DS8B 3CH9A 1INDL 3QPXL 4HFUH 1FPTL 3VXSB 5K33A 5LQBL 2AOSA 4Y2DC 3OG2A 3FT4A 3KYKH 1OTUC 2FX7L 2DLIA 5K93A 4N0UA 2HN7A 1G7LB 1JPGB 2J7DA 3BZFA 4FQLH 5I1HH 4AZHA 4YDKH 1D6EB 1ZLSH 2F8OA 2X1QA 5A16B 2E5EA 3WXWL 3QHMA 5TH2B 4JZ5A 2R39A 2F19H 1E4LA 3GSQB 2EICA 4M43H 3HE7C 5A40E 5KANI 2BVQB 2AEIT 3B5HA 3Q2CA 4D72A 4GLRI 3JTTB 3ARBD 4NZUH 1AXIB 1NGQL 1EHXA 2DQJL 1F3JA 2YA2A 2ZE0A 5CMAA 3SGEI 5JHLH 1U2YA 1NEZA 1BVLB 4KMLB 5I1LA 4I0KA 3C6LA 5CJXC 2R0ZH 3FQRA 2DAVA 1AFVH 1TVHA 1PG7X 4DKFH 3VD7A 4QEGA 2Q7YA 2XXMB 2HFGL 4JFQA 4XPFL 4LXFA 1A7BA 3FN0H 1SEBB 5DMKB 1BFTA 4PG9B 2NY3C 1PVHA 1LP9A 5ESAA 4JPWL 4PJXE 4O51B 3X12B 3MRMA 3V4UH 5KJRL 3GUTB 1I7UA 4JFZH 4GG6B 4Z7QE 4U1IB 3FOMB 4CAGA 2P46B 3S96B 1R3LB 2I5YH 1LQ0A 1G7QB 4YHZH 3K4ZA 4LLVA 1FVEB 3D9AH 5IROA 1P84K 5SWSE 2XFRA 3QUZB 1EFXD 1JZ2A 2XQYK 4HHAB 1RJYA 2Y07H 3UYRH 3O2DA 1PEZA 4KGJA 3S88L 2JIXD 3MGOA 1IEBA 2Y25A 3DI2B 4I9WE 3QWRD 2AJZA 5D7KD 1D9KB 3MLXL 3EDFA 3VXOA 3ZKQD 2X8RA 4PYSA 1BJ1J 2PWHA 4LMQE 3THDA 1WWWX 4PRNB 1UM4L 4F7EB 4XNUL 3LRLA 3VI4F 3C87A 5EIQA 1PLGH 5F9OH 3ZSTA 1JDCA 4K71C 3C5ZB 2OWCA 1AQMA 4G8FA 3UEZA 1F2QA 5E00B 1F6AA 3ILPB 2J2ZA 3ZTJH 3R8BB 3IFNL 4IRJB 2R1WA 1CD1B 4MAUL 3G6DL 4MXWH 4P23C 4MJ5A 2WUCL 3H0TA 1BJ8A 5EN2B 4D6JA 2HLAB 3FKUS 2XNAB 3LEVH 4YHLL 1K2DB 4GAYA 5GGUA 5DFAA 4YLQT 5DFTA 3WJJA 4HS8H 3GH7A 4LSUL 1XR9A 3D3VA 3KLKA 3DSFL 3SGKC 1W1PA 1F3RB 5CHNA 4UTAH 2DM2A 4X6EA 4ZFFA 4D6FA 4LIQH 5ISZD 4LPWA 1KTRL 3ZL4L 3WQ4A 1IGMH 3MNWA 3IDIA 4K94C 3MR9B 4P2RE 4WFGE 5HHOE 1VJSA 1EGZA 4Y89A 3X14A 4ETYA 5HVHB 3BXNB 4IRSA 1NMBL 2EQDA 3TBYA 4D8PB 1R5VA 4MNGE 1P4LB 2XACC 4DGYL 4F58H 3ZYIA 1BJ1H 5FK9B 5L2KE 1FZMB 5FYJD 2Z31B 4H88L 4M7ZB 4OKVB 1OB1A 5EO9B 4P2QA 2WQ8A 4UOW0 3F5JA 4N8CL 2UYLA 5C9JB 4UZGA 5I76B 2D31A 3BGAA 4NZTH 3RKDD 4L9DA 4JFEB 1YECH 3DUSB 2AABH 4OIIH 1FL6A 3ISWA 1WC7A 2XTJB 5SWQA 4DKEH 5JZ7D 4A6YB 5ACZB 1MEXH 1U8IB 4JFPA 4K68A 5IEHB 4Z7WE 3DYOA 4G6AC 5DGQA 3RDTB 4Y5VB 4NGHL 4HGMA 1QLFA 2MHAA 4GRMB 2B1AL 3QT2A 4XP1L 2YXFA 2VLKA 4H26A 1Y18A 2VC2L 2GK1B 3CLFH 3HG2A 4O5LH 5C0NC 3AZTA 2GYSA 3S4SG 5F9JA 3C5SB 1NMAH 5JHDA 1BVKB 1T1YA 4RGMC 1CLXA 3L5XH 5BVPL 1MW0A 1U8QB 1C7TA 1HKFA 4K3GA 2JK5B 1OTTD 4NNYA 1HT6A 3JV5A 1KQYA 5K9KB 5D7JC 4I3RL 3CMOH 4W5ZA 3Q5OA 5I8KL 1BX2A 3MRIA 4TX8A 4IDLA 2D23A 5D9SB 3WD5L 1N7ML 2YK1H 4GXUM 4PJXA 4TNVF 5LQBH 1KJ3H 1KCVH 4ZE5A 3VXSD 2XFXB 2C7UB 3O2DH 4J28A 3WBEA 5IP4A 1SY6H 4G5ZL 3HI1A 5SWSD 4FRWA 3R06B 1PQZB 1FCCA 4I2XB 3LV3A 5E4EC 3HZVA 1ZLUH 4PJ5D 3HS0B 1MELA 1YPZB 5EFIB 3VXSA 2X5PA 2X2JA 3OR7B 5EBLB 4YPGB 3KLHC 4FTVB 3GBDA 5IMKA 4XNQA 3PZGA 4P8VA 5T1DH 1WFOA 4GXPA 3BO8B 4W6WB 4HU8A 4Y4HD 4PMXA 1HNYA 3TH4T 3MRPB 2YMXL 1ZKAA 2IANA 1I1XA 2GCYA 3L5WA 1P53A 2BNUB 2AK4B 4P2OB 4OAWB 1MPAH 3UR7A 3CU7A 3W0WE 4AISA 4CU8A 1MCQA 1S7UB 1S9YB 2V5SA 3O11A 4CN1A 2C3HA 5TFSL 4N0YL 4S1SH 1YEIH 1FFOB 1JDDA 2J4WH 2Y5EA 2EDDA 5MENB 4NJAL 4EDXB 4YHKH 2EO9A 4JJHA 5MEPA 4BQ6A 4JY6B 3RX7A 4LARH 3RWIA 1BQSA 4WFHE 3H7BB 3NIGF 1RK1B 3DROA 3O9WB 4I18C 2XN9E 5F3BA 4R4BA 1V7MH 4R3SB 5KSAA 1GC1C 3K4DA 2W9EL 2QV4A 2FO4B 3HNTH 1AXTH 4RDQG 5HYJB 3BT2H 5IVXA 1JPFA 1QEWA 4UTBH 3LEXA 1YJDH 2CHOA 2BNQA 3OKKA 2W1NA 1R3HA 1UM5H 2Y07L 3UYRL 1D5IL 3MUGB 5DHVH 1B3JA 2P4AB 3BGFB 5D1QD 2Z1SA 3DX1A 2VXQL 3QI9A 5SX4I 4D71A 1ISVA 2L7JA 4L5FL 2WKLA 1MJ7L 4LLQB 4Y16A 1KBBA 3RWFB 1CGWA 5IFHH 4BQ8A 4LPTA 3O0RL 3MNZA 3HG1D 3V4PL 1XCXA 1GVYA 4NQVA 1UKSA 4ORZC 4BSWA 3LMJL 4FMKA 4H1LG 4RE4A 5A95A 4Z8FL 5F1KC 3K81A 3VRLE 4PJFB 5EFDA 1V3JA 3ARXA 2QHRL 4L29A 5KVGL 4GFTB 4JPKH 1W1YA 2EIBA 3TA3C 5EBAA 2D0HA 2WP3T 5HDBE 3WIFB 4DOHB 1D5ZB 1FFQA 1HILA 1II4E 1MCKA 3I3BA 4BA0A 1CWYA 1I9RL 1I9EA 3BVXA 2AEQH 4QGTA 3PL6D 1GOMA 3VFNB 1Q0YH 3H3PH 2OL3L 5I73B 3H9ZA 2HJKA 3INUH 1FSKC 1JRHI 3CMOL 4NN6C 4X7FC 4MCYB 2VZOA 4EJ1C 4LDEB 1HHKA 5JIPA 3SE8L 2QQNL 3PZTA 4QRPE 4J7RA 1QA9B 3H3KA 3OF6A 1U8MB 5DFWH 3O2DL 4F37K 15C8L 4LVHB 2NW3B 1LE5B 2WIMA 3RQ3A 4JVWA 1Y18B 1IAII 1SY6A 1RJYB 3PGCA 1CGUA 1AC6A 4F7CA 4TRPH 5A6AA 4QTIL 3VOCA 4U49A 2FJFB 2X4TA 5DEGA 5BYWA 3MX0A 4X4XB 1ES0A 5DUPL 2CLRB 3DUUA 4N8CH 3U79A 3V0AC 4FNQA 3T77B 1HJUA 4PSRA 5M03A 3B5TA 1RUPL 5DURD 5CIPH 4P46A 3ULSB 3THML 1IGIH 1T0MB 1E6PA 5DJAB 4W70A 3WENA 3B3IA 3OSKA 2HWZL 1H8NA 3PWUA 5HHNB 1S3KL 2Y7QA 3VJ6A 3H9HA 2HT4C 3JWOC 1KJ2H 1ISYA 3CDGA 5HVFB 4NCC1 4LLWA 5J12B 2YZ8A 3REVA 5KN5A 3VH8G 3PWLA 3L4WA 4FP8H 2IPUG 5ALBH 1WIUA 3MV8E 4TOQA 3JUGA 2J8UB 4O5LL 2VWEE 3IFPB 4QCFA 1CGSL 2ZCKH 1HDMA 2G60L 2HVJB 3FONA 2Y06H 3KJ4B 4QNPE 1YEJH 5GGSA 4HZ8A 4HBQA 1RH9A 4PJ9C 4UT9H 5DSCA 3QHOA 2PXYD 1A4KB 3HR5B 2WSPA 3QJFB 3L4TA 1DN2A 5B22A 5CD5D 4LU5H 1K9TA 3QCUH 1TVBB 4DKAA 5BV7H 1R3KB 1ZSDA 4KKLC 4UTBL 4YIQA 3FO0H 5T1LA 5D7JB 5IMOB 4Z78A 5I1IH 3MV8A 3KPLB 5IBTL 3LKSB 1N7MH 2PETA 1VIWA 4ELMF 4NN7C 3SKMB 3X13A 2P49B 4ZOAA 4XPHH 4M1RA 2VZ1A 4HOZA 1I3UA 3QBTB 5C3TA 2D03L 5DEZA 3DTXA 5DHVA 3D85D 1OTSC 4ZFOB 5KZCD 5BWFA 3GSOA 2F54E 1WB0A 4QRRD 4LLMB 3LX9A 1NGYB 4XCFL 4M1CD 3NGBB 2FO1A 1JAKA 1CFQB 5L8JB 3KS0H 3E2HB 3BJLA 1DFBH 4HKXA 3FT2A 1NQBA 4QTHA 4PLNC 1TETH 5CJBA 3L7FA 4M43L 4IRZH 4Y5VC 3RZCC 1HJSA 3O2WH 1HL8A 1U42A 1UXWB 4YFDB 1DUYA 4PJ5E 3MRHA 3PGCB 2GITA 2APVA 1T7WA 1HJVA 1YEKH 4EAMA 1Q8MA 1C92A 5FV1L 4TX6A 4YBQC 1UH2A 2RCSL 3AXLA 3KGRA 4LKCB 3GBLA 4RGOL 2EEAA 1HOCB 4DVRH 3MLPA 4PRID 2OJEA 2RQ8A 5J3HD 1U3HD 3KXFE 4TUKH 1XF2A 3E6HA 3QNZA 3WO3B 4TSCH 3MJGX 1HQ4A 3T0DA 1TA3B 5BOPA 4JQXA 5JZ7C 2PWFA 1E43A 3ZOAA 2EDKA 4HK3N 1LG1A 3GNRA 2YPLB 4JPVH 3HTLX 1LEKB 2EPMX 2DLEA 4OD3L 4JY4A 4MB4A 1NOWA 1X5LA 4IISA 4RSVA 2PF0A 3QUMA 3TC9A 1I3GL 4FFVC 3MLRH 4M9OA 1IGJB 5F88A 5CAYB 3NACL 1JD7A 2K3TA 4M7LT 4PREB 1UWXK 2D7OA 1CICD 1NKOA 3H55A 1Y6MR 3HZMB 1P7KA 3TNMB 2VRQA 1QVBA 1YMHB 2EYRA 1TZ7A 4KJQD 4NM4H 3BWAA 1KJ2A 2OLHA 1MHPL 1DQMH 3F5WB 2J8OA 4QGYA 3BH9B 4RRPA 1TVNA 4V28A 1F6LL 3KHQA 1YMMB 1A3LH 3ULUC 5F7FA 3WUZA 5IR1B 4WNQA 4W4NA 1E6JH 1EQCA 1ISZA 1IC7H 4HIEB 1E71M 5GJSH 1MUJB 5LGJB 5GGTH 5EU5B 2Q86B 1BQHB 4AMKH 3RM4A 5GGRA 5A69A 3CUJA 2NXZC 5JHLL 4P2RD 5HHOD 4YUEL 1LGVA 3FFCE 1PSKH 1XCTA 1FAIH 3DUHA 4XXDA 4RNRB 2FHBA 3B4NA 5E6IA 5TE7H 3A47A 4FNPA 2XT1B 4FNTA 2OZ4H 1PY9A 4ONHB 5DRNA 4IPLA 2F58L 1KTDB 4PRPB 5I2UA 4YH6A 3KHOA 4JFOB 1HKJA 4KKAD 5DFVC 1RVFH 3H8NA 4ONGH 3UZQA 1NFDE 3VFTB 2BVOB 3RGHA 2QADD 2V17H 2MANA 1T2QH 1G7JB 1UKTA 5GSVB 3FQWB 1WJ3A 2WMJA 3NABL 4DN4H 4M7KL 5DUPH 3K4AA 5LWYH 3DX8A 2GFTA 1B90A 3CVHB 3O2WL 5AD0B 2G75A 3D48R 4K3EL 3QR3A 5F9WB 4O9HL 1B4JH 1SM3H 5CS7A 2JIEA 5DHXB 4MTVA 4C4KO 3RUGF 4ACZA 3MLXH 4L3AA 5ESAB 4Z78B 4ELKA 4KTDL 1BYBA 1NARA 3U82B 4RGOH 1HXKA 4G8EB 2VISA 1KENL 3HPLA 2V5CA 4J3SA 1MCEA 2NY5C 3T2NL 4ESKA 5DK2A 3QOMA 1JHKH 3JVGA 5J1AA 1DWAM 1UR9A 5IEHA 1T5WB 4RQQA 5BRZD 1OAXL 5JW4Q 4X8XA 1EVUA 4HUUB 1RJZB 3CVHL 1SMOA 1MIMH 4MX7B 1S7XA 3PWNB 4Z18A 3OGCA 4ZPTB 4FQJH 3QEQE 1A3QA 5A6MA 5I9QB 2FATL 2E7LC 2VL5A 4GZJA 2WCGA 2VQUA 3C8KA 3MA7B 1OLLA 3LHPL 3HUJE 4BUHA 3MRNB 1C08A 2DQDH 3FQUA 5HHVL 3GNPA 4CNIA 4M8QA 1INEH 5E6IC 4N90E 3EYUL 3RGVA 5IVNA 3PP4H 4P46D 3UROR 1FHLA 4ONFL 3UZVB 1YEHH 4PV9A 2WW8A 3CFEB 4GMTL 3BW9A 1TTUA 1S7VA 2FB4L 1EEZB 1CF8L 3GRWL 5AZ2L 4BKLA 4BCEA 1AIFB 2PO6C 1J18A 4D0CA 1QI5A 5DEFA 3SDXA 1JTTA 1G9NH 1YYML 1Z5LB 1CLOH 2WYSA 2UWFA 4TTUA 1WISA 2LE9A 1WDRA 1A0QH 3QFJA 5EU6E 1GGIL 3PNWB 2CKBH 1N5AB 2EXYD 5TQ2H 4XMKH 3MRRB 5T3ZL 2OZ4L 5ANMA 4UFMA 4KTEL 1QHPA 2QV2A 3HRPA 3OTTA 1UZ4A 4PUEA 4X6CA 1R5IB 2EDWA 1DBML 4GSDH 4Y4KD 2CNCA 2UVEA 4P23B 1JGUL 4MWFB 5CEYB 2X2IA 1IL1B 2DL9A 1ORSB 4WDIB 5C9JA 4XCYB 4CKQA 1ORQB 4DWSA 4Y16C 5JOPD 1WCBA 4MLIA 2D4DA 3EJJX 4MNMA 4CD4A 2D7TH 4PY8I 4MAVA 1QSEA 1B0RA 4L3ED 2XFYA 3VX1A 3LAFA 1C16A 4FNLH 3M7SA 1BOGB 1NBVH 4G9FD 3B9AA 2V7NB 3FONB 1G9EA 3SCNA 2FL5B 3A6BL 5HY9A 1Y0LA 4QXTB 5ANMB 1KXTA 1FCGA 2OWXA 4NI3A 1TQCC 1MRFH 3QI9D 1U8JB 1JF6A 3UO1L 3VXMB 4XGZB 2MQ3A 4M62H 3K1DA 3T1FB 3U0PA 1RZJL 4PIRF 4QRSB 1ZA3A 1OAQH 4ZTPH 3D2UB 5DT7A 3W81A 4D9RD 2HA1A 3MRNA 3WUWA 3QH3A 1FJ1A 3IJYA 5SWSA 1MHHA 4UZUA 2FBJH 2NY7H 1I1YA 2QLYA 2HFFA 2FO4A 3HUJA 4ENEC 5F72S 1N6QH 1CENA 1UQSA 3LN5B 4LCYA 2YD9A 3ARTA 1KTBA 2CIKB 4QRPA 1W3KA 2YMXH 4XXCA 4YFEA 4JN2A 4HAGA 5ESVB 3BH9A 3QWOA 3IFLH 4PRDA 2DQHH 2EC9U 2VC9A 3U30C 4Y88A 3VWKA 5FM4A 1I1RA 2J6EL 1PX3A 3O81A 4R8WH 3BUQA 1RV6X 1MRDL 4Z2LA 1KLGA 1KJVB 1NC2B 1J05A 1A6AB 3KNBA 4NKMA 4E42B 3VD4A 5J57B 1QFUH 5JHDD 1H3VA 1RVFL 5I8EB 3MGAA 5EOCL 5HHVH 4YHKL 3FNDA 1LL4A 3DGCR 5F7NC 5DD3L 1HH6A 5F88B 1RPKA 1FBIL 3T3ME 5C07D 3FB8B 5GS0L 3N13A 4NQSA 4KV5F 5DC0A 2GITB 2C3VB 3TV3L 3NABH 2R9HD 3WIFA 1HXYB 3V2AR 4NDMA 1VGKB 2W0LA 3KPQB 3GSXA 1WZ1L 4Z95L 1I1CA 2ZOKB 4KDVA 1CF8H 3WEXA 4P5TA 5ID1B 4NZUL 1X5KA 1BBDH 2OBGA 1J01A 4HIIB 3WXVL 5A2BA 1FE8H 3MA7A 3K1KC 2DQCL 2CK0H 4J4PD 1P69B 3HNVH 3DHJA 2VL5B 1A0QL 1TLKA 4QYOB 2F8QA 5FCZA 4FQ2H 1WT5A 4HK0A 5HPMB 3O6LH 2BVTA 2EDQA 4HOXA 3W9EA 2FJGA 5EOCJ 1U91A 2VN4A 3BFOA 3I9GH 3L95A 3TZVC 3S3PA 4OCXL 1PKQB 3O3DB 4KMTH 2VJXA 3OZ9H 3BWAB 3U46A 4UOZA 1YUHA 4KQ4L 4APQA 4HT1L 4OZHF 3TVMC 1FHGA 5FGBC 1GOQA 4R2GB 1JZ6A 3QUKB 2GY5A 1WFNA 1EGJL 4GW1A 4Z77A 2DTSA 3GXTA 3IANA 5D6CA 3RZCA 2P45B 5DD0H 4TULL 4LRIC 6FABL 1UASA 4XX1E 1G01A 2MHAB 1BD2B 1MH5B 1U8OB 3HI5H 4MXQD 3W37A 3QWOB 2JB6A 1V3KA 1EIBA 4QHUB 4EN3A 4RNRA 3JVGC 3KYOA 5JDSA 2AJSH 3G6LA 1U9KA 15C8H 3OX8B 3ZHDA 4YIQB 3DVNA 4LCCB 3WL1A 3QR2A 4R9HA 4RIRB 5C08D 2AQ3A 3KPNA 1W3JA 4XNUH 3TBVA 1E4MM 5HHMD 5HVGB 4ELMB 1UR0A 3DDGA 5KSBA 4AC1X 2W0PA 2ZXDA 2BVOA 2XTJE 4L4VA 4KROC 4G8IB 4LDLB 4OLUH 1N6QL 2YL9A 3O8XC 4M80A 5ID0B 4LVNB 2IPTL 5I75C 4MXWL 2DMBA 4IRSD 1NGXA 4KROD 1QRNE 4N5EC 1KXTB 1BD2E 1L8NA 4XP4L 5GGQL 2FECI 2DTML 2VDQH 4XRCA 1UXWA 2J25A 2J6EH 3EJRA 3OAYH 3TO4C 1XIWC 3D3VD 5C07E 1FZOA 1DQJB 5A2FA 4TQEH 5GNXA 5GIRB 1CXIA 4NKIL 2XG5A 4XP5H 5HYQB 4F7PA 5FF6B 4XPBL 4HIIA 4L3CB 2WHLA 3ESUF 3CSYA 1YQVH 3F62A 5DJ0A 5JHDE 3OR7A 4LCWE 4CMHB 1ZEAL 1HHGB 1FBIH 1IGYB 1DLHA 1A6VH 5EORH 4IRJA 3MMEA 2G5BA 2F53D 4TNWF 4Z9KB 3ILPA 4O00A 3WL9A 2CDGB 4LU5L 3LPOA 1FFNA 4M7ZC 4OZGF 4Z7QF 4JDZA 1BVKA 1KJMA 3UP1A 1U92B 3L3KB 4UNUA 1MW3A 5AYQA 1QFWI 2B20A 3VMNA 1BBDL 4XPHL 1QSFB 4OIIL 3QIBA 4DO6A 2F5BH 5JA8B 1J05B 2F5AL 1U8HB 1A6AA 3D85A 2MKLC 5HHXH 3NBNA 5CLWA 2GJ6D 1DL7H 4Y5XC 1JGVL 4N0CD 4LLDA 1XV8A 2ZUVA 3CDFA 4LRIA 2AP2A 3DRTA 3DXAB 4U0RC 2A3BA 2WWMD 1ZLWH 2A6KB 2ATKA 2FGLA 3ZLQC 4GMSH 3G5VA 4U6YB 1IAIH 2H41A 4LASH 1U8NB 5C1MB 1W72H 3S35X 1G6RL 2NY3B 2OSYA 4KJPC 5IMLB 1MQ8A 5IBLD 3NIDF 2CGRH 2IAMC 2XTJD 3WFCH 3G6DH 1G0CA 1ZB5A 4X8JA 4XV0A 1JNHA 2IQAA 4YXLH 2NXYC 3N06B 3Q3GA 1MWAB 5GRWA 25C8H 1VADB 3L1OH 5CJ8A 1U8HA 4WSJA 3C60C 1T83C 1FP9A 3A67L 3CX5J 1J1PL 2COQA 3E0GA 3GJEA 4TULH 6FABH 1C5DB 3RWCA 2ICEA 3JWOH 4QLKA 5GRYA 4BQ2A 1Q1JH 3G5VB 4U6YA 4ZSOE 1IFHL 2KH2B 3TBTA 5ILTH 3EFDH 3HE7B 4TN9A 2F18A 4X9IA 1S9XA 2DF3A 4K9EC 5KN5B 4NRZB 1IARB 4OM0L 3HMCA 3T3PE 1G6RB 3UPAA 4MAYB 4R4ND 4GZEA 4XNYH 4JO4H 4OSUL 1K3ZA 1S78C 4OCNC 4BK5A 4UV7H 3MYJA 2Q3AA 1QNSA 1ORQA 4M6ML 4BFIB 2V6HA 1H3XA 3O6FD 3LSOB 4NZTL 5IJVA 4RMWA 1MCIA 4NRYA 3WFHA 3UTZB 4LBEA 5M7QA 2FIRT 4FNSA 3GJEB 1BPLB 2FDMA 1AKJA 3MRQA 4XVUC 2AAAA 1B6UA 3DHMA 1AQDA 1C8QA 1HN1A 3TTSA 3DSNA 1DQDL 1H41A 5I8OH 3G5XB 3MV7B 4PJ7F 5I1KH 4QDMA 4UMGA 5F7UA 1AGBA 1XT5A 2OCFD 2BVPB 4Y4HC 4GXVL 1VFMA 4LVOC 4L8CA 4U5KA 2VDPL 3AISA 3PL6A 3KLHD 2XXCB 1ETZA 5DR5L 1ZA3B 3KPNB 4FTVA 1CFBA 1JNLH 3O3BB 3VGHA 1NGWB 4YXKH 3HR6A 1JHTB 4JFHE 3QA3B 4JHOA 4OOZA 2WMKA 3MI6A 3M8OL 2EE9A 4PB9L 5IT2H 4NNPH 4TVCA 3BT2L 1CDCA 1ZK9A 5ID0A 2YN5A 4PBWD 4XNXL 3WFDH 4RGNC 3ARGC 3D4YA 1E55A 4HKJA 5E1QA 4PRBA 3T09A 1YNLL 3P73A 2YS4A 1CLCA 4Q0XH 1VEPA 2EDHA 3IJYB 1UR8A 3DJ9A 2RR3A 1XGYL 4FN0A 3EYUH 1OB0A 1ADQA 5JR1L 4IDJH 2I60L 4MMZC 4EDXA 1J8HD 3IDGB 4MA7L 4K94L 1RJZA 5ELIA 5EZLA 4HPGA 4UNTA 4DW2H 3MRKA 4M5ZH 1E5NA 5JPMA 4WJ5B 1BZ9B 3BZEA 3NCJL 3O6ML 5FK9A 3LV3B 3T4YA 3EJTA 3BAEH 5CJ5A 1RIVH 3QGVA 1BQLH 2BV9A 2VE6A 2PC8A 3NA4A 3GSNL 1GCFA 3KJ4C 4UFLA 3PZIA 2OTUA 1EEZA 2J3SA 3U36B 4HCRH 4N0UB 4K3JH 4N68A 2A83B 2EYSB 5BMFH 3OQ3B 1FL6B 1A6ZA 4HIJB 1I85A 1F4WH 4XP9L 1OOAA 4EOWL 3GM8A 1HWWA 3ARED 1XRVA 5K9KA 4M24A 1S7TA 3VJ6B 3RA7H 1OWRM 3IDJA 2UY3A 1QFPA 5D72H 4NQDE 2G75B 3L7EA 4X6CF 2VLKD 4WSKA 2ITCB 1B88A 1XD1A 3KE0A 1NC4B 4G9FB 2F7PA 1HKKA 2ZUQC 3ARDB 4IJ3C 3WUWG 2EADA 2O5ZH 3FO9B 1MFCL 1KB3A 2YWZA 3FO1A 3TO4A 1WLHA 4P4KB 2BFVH 4WW2F 2J7EA 1GSMA 4LCCC 3N9GH 3CNKA 4JM2D 5EFIA 3VXPB 3AI0A 3ULVC 3MJ9A 2RGLA 1YMMD 4C83B 2GQHA 1OM0A 3N11A 3AMLA 1EXUA 5KEZA 4UUJB 1PPIA 3LEXB 5IFHL 2CSPA 4FQ1H 4ZTOL 1QWNA 5TF1L 5I66A 1QUNA 4P8XA 4NM8L 4K9EL 3VRJA 4MJ5B 4D0BB 3W6MA 3O9NA 3BD3A 5FCUH 1JV5A 4KZDL 1W72L 4XAWL 2OYKA 4PMVA 4Z7WB 2QMKA 2VR5A 2WV3A 4U1JA 4ZPVB 1XCQB 4A2LA 4LPXA 4JY5H 4XCNA 4JPKL 1FSKB 1YDPA 3P4NB 1V05A 3IAQA 2W92A 4UINH 2BY0A 4HS3B 4GKLA 4LGPB 4AQ1B 1CLOL 1IQWL 3KJ6L 2UUDH 3MRFB 4UIKL 3LN4B 4LPCA 4PJFA 4AZIA 5T33H 3UJIL 2VIRB 1DSFH 4XZBA 1B3WA 4GIAA 1GUVA 4GI9A 3VI3F 5D1ZC 4I4WA 4DN3L 3FFCB 1VCAA 2VX6A 5L7XL 1IBGH 1FZMA 1V03A 2ZXAA 1XF4B 3HLAB 3KWWB 3FB6B 2HLAA 1J5OL 3T2OA 3BGMA 1XSIA 4Q0XL 3UBXI 2Z93B 4G80A 1MOEA 1E6OL 4AD4A 1S7VB 2KKQA 2XWTA 1NJ9A 4UB0L 3KXFB 3O4LB 1CDGA 1I8LA 3PXJA 5EU6A 2O9PA 2QEJA 4OSUH 3U4AA 2QMJA 1M53A 3LS4L 2G41A 5E8EB 4S1DD 4PY7B 2OWWA 3A6CL 4KROB 5GQBA 2R1YA 1K2DA 4GAYB 5E6IB 4HF5L 4MS8D 4UILH 5J3HC 4QT5A 1D6EA 3LH2L 1CR9H 2OI9C 1TPXB 5C8JB 1LDSA 4WV1B 5I1KL 3D52A 3S5LB 4LHUG 5I6SA 3MBEA 3PP3H 1E6SM 1BQUA 3T77A 3MR9A 1YA5A 5B38A 3CVIL 3U1SH 4EANA 1H5BA 1EMTL 3NTCL 3VFGH 5F8QC 4PJDE 1ZGLM 3T65A 1LO0H 4OFVA 4TUKL 4U7MA 3G6AA 3T8XB 1ISXA 2ENSA 2DMKA 3CC5B 4TUJA 3PV6A 4ZS6D 2P8MB 4TSCL 3RA7L 3DRTB 3WFLA 4X80L 1GQKA 5DFVD 4CD5A 1Z3GL 1C5DA 4A3HA 1QSVA 4ZXLA 5JO5A 1ZANL 2QL1A 4H1LH 1N59A 3GK8L 5DJ8A 4X9HA 5A8NA 2E6QA 2O26U 3DWTA 4AEHL 2VKWA 4UQ3B 1K4DA 2OYLA 3ALWA 2F61A 1BFNA 1JPGA 3RL1A 2JFEX 2V2WB 4LCIL 2C4FU 4HS8L 5IF0B 5FYKD 3JWDL 3VGAB 3KYMB 2UUDK 1MCHA 1ROWA 3RHWK 2ITDA 1A8JH 3S96A 1MCLA 3CFDB 3T65B 4JDTL 1B3YA 1ZA6B 5TDNB 3VIOA 3PHQA 1FNLA 5E4EB 5KZCB 5D2NA 1FC1A 1NMBH 2DEPA 5T1LB 1IGFL 3NCCB 1R33A 3VRIB 3QNZB 5E1HB 1J0HA 4U1HA 4DGVL 3MLVH 3RAJH 4WEMB 3BKJL 1UFUA 5I1DB 3MCKA 5JNYB 2W66A 4KK9D 3NPSB 4JHAL 4XTRD 5FYJU 5CZVL 1QR4A 3BUDA 3VINA 4ZUVA 1RIVL 5DJYA 5IB1B 3ZQ9A 3V5KB 2XSAA 5A2AA 1CDUA 4R96B 4ZUWB 1N8ZA 4KKCC 4LGSB 2A1WL 1MEXL 2QHLA 3OKYA 2VQTA 1DANU 4K3JL 5BMFL 3SQOH 4BFEA 2QHAA 3VFWA 4HLZG 5D6DC 3MZTA 4RIRA 4NX0A 3QIWA 3OKLB 1LP9E 3WDQA 2H2PC 2DLHA 5IFAL 5IGXL 1A9EB 1SFSA 3SDCA 4FG6C 2Z4QA 1RZGA 5DD1L 4QHMA 3CIQA 5C0EA 4P5TB 1JDAA 3QDJB 1OD7A 4OZIE 1WAAF 2W60A 1RUAH 2I07A 4HS3A 2JIXA 3SCMA 1QOXA 4I0PA 3NCEB 4JHBA 3P4NA 3F6LA 1XHGA 1MYRA 3ARDD 3MUJA 1DLHB 2IAMA 2AK4A 1OIFA 1RZ7H 1UD2A 1A14H 5C08E 1YEGL 2BXYA 3QG7L 1XGUA 3MFFA 1SJEA 4FFYL 5D7LD 2H1PL 3KXFD 1QEWB 3VXQA 3MS8A 4L8SB 4NRSA 3GKZA 4UR9A 3CSPA 1JE6A 4APQB 3EO1B 3L4VA 4BH8B 2NW2A 3UR8A 3QXTA 4W8AA 2EDFA 2YD4A 3O3EB 2X4SA 5GGRY 3BKCL 3O9WA 5E94A 4MVBC 5FCUL 3VXPA 4AIZB 3GHEL 2X4QB 4F9LA 5C86A 1I7UB 4GG6A 1CXLA 1ZXQA 1NLBH 3RGVB 5F7DB 2LABA 3SHSA 1BEYH 4BZ1H 3TA9A 4UINL 4B9YA 4Y19B 3DX3A 1MFAH 4BSWB 3GSUA 2BJML 5JIHA 1BFVL 3ALXA 5BJTA 4CVZA 3OKMB 4NQXB 3PN8A 2VRKA 2FD6L 4X6BA 2F54B 4WY7H 3RNKB 2ADFH 4J3UA 3GSVB 4DJMA 3A67H 2DIBA 5KS9E 2DGAA 1KB5L 4XCEA 5E6ZA 1CPUA 1KXHA 3QEUA 2PWEA 3CD4A 3WJLA 4LLYA 3RILA 3F7YB 5I17B 1TPXC 2X6MA 4HXAL 1UWUA 2X4RA 1RHHA 2DDQH 2FE0A 2BOBB 2YD6A 1BF8A 1AJ7L 2YIHA 5DK2B 5DVKA 3PG2A 3EYSL 1A2YA 2C7UA 1GPFA 3Q3GB 4WF7A 1YJDL 3O4LE 4FQCH 3QUYA 4TUOB 2ZUYA 3W24A 1NFIB 2UWEA 3KG5A 4K3EH 4D94A 4OZOA 2VXTH 2D9QB 2ICWA 3IJSB 2E27H 3SGJC 3D25B 4MGXA 4PBGA 1LE9A 5F1NA 3ROOA 2F5AH 3HHRB 2DWDB 2GJ6E 3SCMC 1ES0B 5DVOA 2J7LA 3SOBH 3TCLB 2JJVA 5JMOC 5KG9A 4X7TA 4U6XB 1GRWA 2Y4SA 1MJUL 1GGTA 1U8QA 4V1DB 2BOBA 3TN0A 1TE1A 4Z2JA 1DLFH 2GJJA 1A4KA 1N0LA 1AHWC 4LRNH 3MSGA 3TO2A 1UR2A 4Y7EA 4J3TA 5DYOA 2EIEA 2G2RA 4M81A 2F53E 1R5VB 5FXCH 3CTTA 4NKDB 1QD0A 1A22B 3L3DA 4D6CA 5I9QC 3LKNB 4F2MA 2Q8XA 1UWGH 5IV2B 4HWEH 2IBBA 3CMJA 4G9DA 3GSNA 1VFUA 3U7YH 3DDFA 2GT9A 1AQDB 2K7QA 1PQZA 3EO9L 4QHLA 4Z7UB 3OXSA 4MVBD 3H9HB 2APXA 2IPKB 4NUJB 1E4IA 4G6ML 1Q94B 3EKCA 4FQXD 4QTHB 2MSPA 4PJHF 5C0BB 3AMKA 4Y5YC 1ODUA 1RZ8B 1BD2D 4OLWL 5IMKB 1PX8A 5CD3B 2C7FA 1GQIA 1WO2A 1JFQL 1SVCP 4ZUUB 1UA6L 5E8OA 4NT6B 1ZHBB 5CEYA 4DGVH 4NHCL 3BKJH 4TVSa 5KSAC 3ARDC 2UY7A 1SYSA 1CIUA 1HEZB 1MLBA 2FECL 4EUPA 1R5WB 4YHEA 4HJGB 3WSQH 2WC3A 1FNEB 3CZNA 3KPRA 2P8LB 3P0GB 2DQJH 2VDNL 5CP3A 3IFLL 1HSAA 2XKNB 4I18B 1YHTA 1DVFD 1FNAA 1HP4A 5TQ2L 5L8LB 1AC0A 1EEYA 1K6QH 3ARFC 4IMLB 3ULUL 1BQCA 5AEAA 5MI0B 2XZAH 1KTLA 3RKDC 4X4YB 5L2JA 4H5SA 3ARBA 5F6IB 4X7TB 2BX5A 2N56A 3FB7B 5C08A 4LLDB 2WANA 3HZVB 4HXAH 2H8PA 1E3ZA 5CUSL 5HBBA 3BAJA 4HA3A 1Q9LB 3O4OB 3ALFA 4PRPD 5C0GB 1MF2H 2D7TL 3R4DA 1UWXH 5GS0H 1WNOA 2A74A 4URIA 1N6UA 1I8KA 5DMJB 4AZ7A 1NBVL 4MA1B 2LFGA 3IKCA 1EUTA 3GXIA 4LLQA 3FQXA 1P9MC 1I4FB 2UY4A 2Y6SC 4HFWB 4PJAF 5TDOB 1ZBCA 2DQGL 3VIPA 2YD2A 4YWGL 1T5XA 3SIMA 3LXAA 4RDQF 3X11B 5CHNB 2AGJH 2CK0L 4FXKA 1BSIA 3TESA 3VFPA 1GZPA 3DVIA 3VXMD 4JRWA 3BE1H 3GIZL 4LLYB 4NUGH 1U3ZA 3PJSB 4PJHE 1GORA 4X98A 4ZFZB 5C0CB 4K94H 5CCKH 1UWTA 3H9YA 4YGAB 1XF5A 2IBZX 1WWBX 1TVDA 1U3HA 1X7QB 4P57B 1RK1A 2APWA 3MLYL 4JDZB 5BOZG 1E5JA 3AVEA 4P46C 4E41D 3SCWA 3NDZA 3BUIA 1MFAL 4OZGE 2A6IB 1OARH 2GTWB 2ED8A 3V0WL 4LP5A 3GO1L 2D7MA 3QEHB 2CXGA 1UYWL 3WO4C 4NRYB 2R4SL 3WFHB 3W5NA 1UZ1A 1DSFL 4P2OC 3NCBB 5I5RA 5JQ6H 1T80A 5DWUL 1EJOH 4PP1D 5GSVA 5J13B 1A1NB 5DRZB 1EO5A 5CGYC 2E3VA 4JHWH 3RX8A 2R4RH 1DBKL 5FB8A 2KQNA 2G3IA 2W5FA 3ARPA 3QQ4A 4PJBB 5IHSA 1ACYL 1BFOA 1DANT 3MOBH 4NKDA 5DT1L 5T1KB 3SKUD 4G9DB 4BFBD 1ZBKA 2GFBA 1RZGB 1UGNA 1JPTH 2PR4H 3BP6A 1I9IH 5E2WL 4XXDB 2DLTA 4YEFA 3TT3H 2YN3A 4LSQH 5FYLH 4EUPH 2VL4A 4QRUB 2YR3A 5GRXG 2WPGA 5I71C 1OAKH 5D6CB 2UY5A 3CJJA 5CP3H 3QIWB 1OGGA 5HHMB 1HHHA 1WWAX 3U2SA 3F12B 4PP1C 3PZUA 5D1ZD 3VWJA 4IPNB 2VC2H 2OR7A 3VFGL 1C3FA 2VDOL 4HGWB 1LE9B 1SQ2N 4Z7UF 2GUOB 2NXYB 3DYPA 4WHTB 2NSXA 3QAZB 5GJSL 2F7QA 4GKOA 5INCB 2CHNA 4WK9A 1WAWA 1EBPA 1DQTA 4YC2C 3SDAA 4XMPL 5F96H 3TZVB 1A6UH 5HHQA 3HG5A 4H26B 1CQYA 2GK1A 3RO8A 1KLUA 1YJDC 4XAKD 1QBAA 3RTQB 3EZ8A 2V2XA 1XH1A 4JL2A 4HULB 4F9DA 1NBQA 5L8KB 2V38A 3WEZA 1R24B 2FYYB 1JWSB 2D9CA 3TN0C 2N1KA 1D5IH 4X5WB 1UB6A 3ZKXC 4LYPA 4K2UL 3S8WA 5H37G 2F5BL 1J5OH 1KBGL 1XR8B 4NDMB 5GRZA 1CZ8L 5F6HJ 1IVLA 1YEEL 5ITFB 5I1AB 4Z2HA 1E6OH 5K59E 1IAIM 4WGVB 5IB3A 1IKNA 5IHUL 1RU9L 4PPTA 4TVPH 1G7PB 5C2UB 5D93C 4M03A 4WI9A 2UVFA 4CCCA 3E6FB 2J79A 3WN5B 4XZUB 5DJ0B 1CGTA 1JIBA 2XVKA 3GI9L 4JFVA 5F70A 5HHQB 2Y6SD 2OYMA 3HMWH 1B9ZA 5CGYD 2JF7A 3PV7A 1HOCA 4BQ9A 5D7IB 1GOGA 4NYLA 4PJAB 1B2WH 4PYGA 4OZIB 4AY1A 1CLYH 1VESA 3LH2H 5J8OA 4JVPA 1LK2B 1P6FA 2CLVA 1W0YT 5D9MA 2G2RB 5AYUL 2WM0A 4P7OA 3WEOA 1XGRA 4KV5E 3TT1H 1CI5A 1JTPA 4G8IA 1H3UA 3ZJ7A 5BZWB 2KDGA 4QRUA 2XN9B 2F8VA 4ZFZA 5SWZA 9CGTA 3MUIA 1AMYA 2HFEA 2RFXA 2Y7QB 3PWVB 4F37F 5K9JH 4M3JA 5ETUA 1ZEAH 5E2UL 1QYGH 1KGCD 3MRDA 1G0DA 1HL9A 3F4VA 2VZ3A 1NMCB 1EAPA 3QUZD 1TR1A 3V4VH 1V6VA 2BRQA 3C60D 4ZUVB 2WZIA 1IM3B 1RUAL 4F9LC 3O6KH 4X99B 1IV8A 4QHMB 4DO5A 4YE4H 3MCG1 3DMMC 3U4EB 5IVZA 3U48A 5FYLL 1TQCB 1IC4H 1YQ2A 3DRQB 3HR5A 3RMEA 2GAZB 3JWDC 1ESWA 3ARBC 4APQD 4MSWA 2HWZH 4Q6IB 2BC4B 4QLRA 4HZLA 2VDMH 4JJ5A 1MFDL 5ITBH 1A7OH 5I1GL 1FO0B 1S78D 3P9LA 2V5RA 2FEDC 4L9LA 2AJUL 5KVEH 3MLVL 3MNVA 3RAJL 4F80A 4HMDA 4NWTH 2BERA 4Z8FH 2GIYA 4RMSA 5DRXA 4FQXC 4S0TD 2FSEB 2B8OT 3BOVA 1EEYB 2FB4H 1RULH 2ZCKL 1A47A 1J0IA 2VNCA 1ZWIB 4M56A 1HKLH 4HWBL 2BSRA 4EQ2A 2ARWA 5JIKA 1LWRA 3QIUC 5IT2L 1MHEB 1Q0YL 3H3PL 4JGJA 4M6AA 5DJAA 1UH3A 5E03A 4AK1A 2DDXA 2FD6H 2HKHH 1R5WA 4FHBD 4FMVA 1J1PH 5KSBE 5B8CA 5GS2D 4U3HA 3FB8A 4QXWA 3ARGB 3VXTA 2ZICA 5F3HA 1DEDA 2XICA 2NW2B 2VDRH 3BCDA 1I1WA 4ZXOA 3FFCD 1W9VA 3UTTE 1ED3B 4G6KL 4OFPA 1QQDB 2P8PB 3BI9X 3DX6A 4BQ5A 4ONOA 3IFPA 4XCFH 4JRXA 1KYOJ 2BVPA 1H3GA 1YY8B 1SHMA 1S9WB 2VLJA 4PJCB 1CGYA 1EA9C 1XIWD 3I6GA 2WCSA 2H32H 1Q72L 4MDJA 5DT1H 4ZE4A 2Z92B 4JFSA 4XVSL 3PV6B 4NWUH 5CINH 4CNIB 3B8YA 4PRDB 5TQ0L 1CFSB 1A6TB 3RDTA 2BHZA 2OMBA 5EUKA 1M7DA 2E7LA 1DVFA 5BW7A 3O2LA 2AEWA 1OT2A 3DIFA 1X4XA 4YHNB 2H3NB 1KTLB 3QUXB 2H1PH 1XGTA 4G8GA 2PNDA 1U3HB 5IEKA 2VXSL 4EKJA 4JLRB 1C12A 4L29B 2P5EA 1CBVL 1G9ML 3UAJD 1BHGA 3V5DA 4G80B 3X12A 3ZYJA 2NTSP 1ZVSA 5EIVA 4FP8L 4M1CC 4QOKE 1H0DA 1L6ZA 3MJ7A 3WYRA 3VI3E 1D5XB 1M7IA 4UI2A 1UACL 5ABHA 3JTSA 4GS7B 5HD8C 1HJQA 1M7XA 3S3SA 1UWQA 5DT5A 1TJHH 5ABFA 3WN5A 1ZU8A 1HH9B 2R2EA 3KPOB 4XT1C 2W0KA 4UOQA 4UT9L 4XMPH 5F96L 4HFWA 3V4VL 4DM2A 3EYVA 5CD5C 3IU4L 4BH7B 1VFOA 1S7SA 1G9HA 4OM1H 2PYEA 2PXYC 1KFWA 4F79A 2G3NA 4XWOC 4XCNB 1M1SA 3TO4D 1WIOA 4OZ4B 4UU9A 3M1BA 2F15A 1QSED 1L7IH 4UTAL 4K2UH 3W27A 1Q9OB 3WF1A 4L8DB 5DDHA 1W1TA 4LLVB 5DD3H 4N0UE 4QHLB 2H2SC 1FZJA 1BGXH 1MFDH 2ID5A 5JXEC 4TVPL 2Y2WA 3OMZA 3MMUA 2WWKO 1A7OL 5F1IA 1P6WA 1SZNA 4HP5A 3F58L 3I3EA 1UA6H 1ZT7A 1NBYB 1ZGLB 3GI9H 4ODXB 3B2VL 2VX7A 4RL3A 3REWA 1A9BA 2X40A 1OAZL 5IKCB 1UB5A 1RZKC 2NNAB 4HC1A 4N9GB 3FTGA 4W81A 2VCCA 5FYLE 4N8PA 3HFMH 2CIPA 3H42H 3K7UA 4LEOA 3F12A 1INQB 1I8LC 4Z7UE 5HYJE 1OW0C 4R97B 1O7VA 3D18B 1ECEA 4Z0BH 1BF2A 1UG9A 3O4OC 3ALGA 3L3HA 2C8NA 2J8HA 4HA4A 3VXNB 1K8DB 5FA3A 3O6LL 3GSWB 2GJRA 1T21A 2E7BA 3CLFL 4J6RH 4PMQA 4NBXB 1ZT7B 4ZAKA 4EBQL 2NW0A 1NBYA 5GS2H 5LCVH 5IW6B 5CXPA 3KPSB 4Y0GA 1AD9B 1CLZH 3VWKB 3GXMA 4HS6B 3MUZ1 4ZO7A 2ZX8A 4Y4FB 5D72L 3UG4A 4R7DB 2NY0C 5IW1B 1QR1A 3RL2A 4N9OB 3GHBL 3P0YL 4KI5F 2X05A 4QY8B 1OHQA 1OD0A 4OZFB 1D5MA 1JYVA 1OINA 1OGTA 5GPRA 1Z32X 1CD0A 3VWKC 3F8UB 3HC3L 5LWYL 4RMTA 2EECA 5TQ0H 3P11H 3H7BA 5F3BB 3OKNA 2WHJA 3WNOA 4JAMA 3D2UA 4CN6A 3CFBB 1G0YR 2ZSVA 4DFHA 1R85A 5IVXF 1BVLA 1KCVL 1L0PA 3TONA 4JY4B 5A3IC 2W9DL 4PN2A 3NH7L 3I6LE 3CCHA 2Y5TB 2AMGA 4DWHA 4TVPD 1JK8B 5DYOB 4E4PA 3FZUD 4WENB 5F97E 4FA8A 1F5WA 3GSVA 2B4CC 1G9MH 1MHPH 2Y1VA 1QO3A 5KVEL 4ZFOL 1FORH 4J8RB 5I30H 4N0RA 1IILE 4QY8A 1OGAD 3QRGH 1K5NB 1MFBL 1MJ8H 1U58B 2H2PD 4KWUA 4E41B 4B3LA 1I1AD 1TTGA 4UDTA 3QUZC 3QIUD 4LAJH 4B16A 3BVWA 2D7NA 5EZLB 4EXKA 2N4IA 2OXGA 3K0WA 5ETUB 1LD9B 2VDQL 1M7DB 4FQJL 4ZSOB 1TMCB 4XVJL 1UYWH 1JXKA 5CP7A 2FATH 2WINB 3OAZH 3V52H 2F58H 1M05B 5H35A 4H25B 2HJLA 4IS6B 1J0ZA 3RRQA 2V7HB 4ISVB 5SX4H 3P0VL 3VXOB 4XC1H 4ATLA 3BWUC 2J8UF 2A9NH 1OTTC 4F7TB 3G6JA 4KKNA 3MJ9H 5ENWB 3U9UA 1MW1A 5GJTH 1TZGH 3BVTA 5FKAA 3FRPG 1DBKH 1HH9A 4XP6H 4WI4A 2Q8BH 2VUOA 3MGTB 4JFOA 4DOHE 5CJQH 4NNXA 1BG4A 4GS7C 4YNYB 2FEEL 1S5IL 2ILLA 4LP4A 1MNUL 1OP3K 3VG0L 3C5JA 3WIIH 3HE6A 4UILL 5IHZA 1YN6B 1OQOA 4KXZI 1AGBB 1KN4L 2CO7B 3A21A 3HC4L 4JRYB 2CRZA 1HCFX 3WS6A 3MXWH 1P5VA 1P2CA 3MV11 3FQUB 8FABB 2YBRA 2CKBL 4QRQB 2GW5A 1KWGA 4AXNA 5DMGD 5IVZB 1EHLL 3BXWA 5ABGA 4KTEH 4NC1C 2WWDA 5IMMA 3T2NH 2WBWB 1HXJA 4CL7A 4QHNB 4R4FH 4ZS6C 1LO2H 2NXZB 4B50A 1D6VL 4N1EA 2ADIB 1X5XA 5IFAH 5IM7A 5DXWA 3IDNA 1NOFA 5IQ9B 4MNHA 1MQKL 5E8OB 5IBUG 5BW7C 4YBLB 1OGAA 3EYOB 5JUEH 1MIML 1FNFA 5BRPA 1KGUA 4RE3A 5D5ME 2F53B 1NGPH 2YFOA 4FXKB 1UQZA 1AQKH 2GSGA 4PJ5B 2HVJA 2NYYC 2VLLB 3BIKA 4IMKA 4S2SB 4MA8H 1F90L 5FYJH 4GW5A 4P4RA 3RM8A 5TGBB 5EO0A 2AXHA 1BOYA 4ZQKA 3U9PH 5F7KC 5T1LD 5ICXA 4Q22A 2V2WA 5IF0A 3BJ91 4FOMA 3LRKA 2J7GA 3OJDB 1XF4A 4PG9A 2QBWA 5J06A 1QSFA 1YEHL 3WIHL 1QNZH 4B5EA 3NSMA 1UQYA 2FJHA 1YC7A 4FABH 3V79C 3IDYC 1NANI 2YPKB 2YRZA 2X4RB 4JM2C 1XZ0A 2YPLE 3V6OA 5A43C 4Z5RB 1CE6B 5SV4A 3QUKA 4Z7OF 2CK2A 4MCYA 3I02A 1G9NL 3G6AB 4RISL 1UKPA 3RY6A 2A1WH 3VXSE 5E95B 4FFZH 1Z6JT 5IVXE 1W91A 2I25N 4RFOH 2R0KL 5ISZB 12E8H 5ERWA 3T0VA 5ALBL 4JFHD 4X7DC 1T1XB 4EI5B 2VVNA 1V7NH 4JKPL 2MWCA 3D5HA 4XX6A 3VIJA 1P1ZB 3HKFA 2WIIB 4DK3A 4FLSA 5EULV 4I3GA 2DQUL 5H94B 1B4RA 4LGRB 4FNUA 5CIPB 3VG9B 1A3RL 4FNLL 4OZFG 3W28A 1GH7A 2GDUA 3ARFB 1CXEA 2KZWA 1P84J 3POCA 4W93A 1ZLVK 1A14L 3OF6D 4U1NA 4LOUD 4AL8H 3QEGL 4Q74A 4Q2ZB 1MRFL 4OF8A 4X6BB 4XRCB 4YZFE 2JELH 3D39E 4ZS7H 2BNJA 1T20A 2G4FA 5FFLA 1NCTA 2L4OA 4ERSH 1HDMB 5ABEA 7CGTA 1MRCH 1UWRA 3BQUB 4LSVH 5EU7E 1H8OA 5I30L 1FIGH 3LKOA 3QRGL 4RGND 4H04A 3PWUB 5HHNA 3SDDD 2AKRB 2AVGA 3T0XA 4HK3J 3OGVA 1L7TL 3OXRB 4KQ4H 3NSNA 4AMXA 5FB8B 2NZ9D 4FQQA 2R0WH 1A2YB 2D31B 3C9NA 4FFWD 4HPYL 5FCSH 3NZHL 4J3VA 3BPCA 1DE4B 4J8RA 2CMRH 1EGJH 4JM2A 3BP6B 2ADFL 4N1CA 2E4TA 3V6BR 4ETQA 1ERNA 1JI1A 4QCEA 1EXUB 1MCWM 1MHCA 1F42A 4HH9B 3BMWA 3SJVE 5F7LB 1YZZA 1QNPA 5DEGB 1TUXA 3W29A 4XC1L 3X17A 2W63A 2O93L 3QWRA 3VFSB 3TWCH 5IKCA 3VXNA 3QZWA 4IOIB 1X3DA 3AS1A 3PQYE 2F54A 2W67A 1HI6B 3N85H 4TPRH 1XD0A 4FLQA 4LSDA 2NYYD 2DH3A 2UY2A 3E8UL 2F2HA 1HHIA 1KCRH 2MCPH 3VFMB 4Z2KA 5CJQL 4Z76A 4K8RD 2H8PB 5IW1A 2BOCA 3AHZA 1HILB 3Q6GH 1QLRB 2BSTA 5GS1B 2HJFA 3WKML 1LP9F 3KYAA 3IF1B 3HZYB 4PV8A 3O6FB 2D22A 4KUCF 2CEQA 3CUIA 1KV3A 2C3VA 2ZWLT 4NHUA 5DK3A 3IK2A 3C8DA 3O41B 3WMSA 3R8QA 1CFSA 4RZCB 1EHLH 4WI3A 5FO8B 4HZAA 4Y19A 5DMGC 4XP1H 1J7VR 4FFVD 1HI6A 1KIPA 3ES6B 2Z8RA 3OV6A 1A5FL 4B53A 2IWGA 4ODBD 1XH3A 4UBDD 4C56B 1A3LL 4V1DD 4X7SH 4Y2DA 1CECA 3RPMA 4HKZA 2DD8L 4TOYL 1S8DA 5T1KA 3ARRA 3SKNB 1F4YL 2DSUA 1U8IA 4JFPB 3TBWA 3HA0A 4CRPA 4D3CL 3DX2A 2BK8A 4ZYKA 1M05A 5H35B 4ZNEA 3L4YA 1QFWH 1QRNA 4LPUA 3MLUL 3P30L 1S7WA 5ICYA 3ZR5A 3QIUB 2XN1A 3VFOA 2AK1H 3EO9H 1KPUB 4PGBA 1XFPA 2V5YA 3TPKA 3TOPA 1RJLB 3MO1A 4MB5A 4CW1B 1NWRA 4CADB 2WP3O 2VDRL 1DE4A 3D1MC 3VD5A 1AQ0A 5BXSA 1SY6L 5C6WH 3PDOA 4I5BB 1NUGA 4A3YA 1UC6A 3ARUA 5C08B 5D4QA 3ZKSD 2X0YA 3VIHA 1PD6A 3ARBB 4MJ4A 4M61A 5AZEL 3ZHLA 4ODWA 3WIHH 4P4RB 4M7KH 4XI5D 4AYSA 2J77A 3HU7A 4K07A 3HI6H 3O3BA 3FQTA 3ZJ6A 5LGKA 3I75A 3CZFA 1UT9A 1T66D 4OZHB 1L7TH 4UNIA 1G6RA 2V3DA 3BQUC 4O9HH 4AD3A 3MBXL 1SM3L 2EDJA 3M1BB 3VD3A 2DKSA 4M4PA 1KGWA 4JRXE 2Y23A 4DFIA 4P8WA 3RWGA 4U33A 1K6QL 3ULUH 5IQ9A 4PP2B 4LFHG 3BO8A 1GGBL 2YPLA 4U6HB 1E40A 1Q4NX 5DWUH 3ROOB 1K6AA 4AIOA 3KL0A 3D0LA 4JKPH 1E0XA 3BPOC 3AMCA 4QYOA 1JHKL 2OSLB 3TWCL 4Y5YB 1NUDA 4NKOB 4WI2A 5ACLA 3ZMRA 2OR9L 5ERWB 3GK8H 2R23B 5JXED 4K71B 4HEPG 4PJGE 2R0LH 1AXTL 2V3EA 1ZHLB 1BLNB 1T0NB 2DOCA 1XF3B 3MYZA 1E1EA 2R1WB 3HC3H 1HIMH 4UUJA 4LSTH 3AXHA 1XGRB 1KNOA 3MV9E 4XBPA 3OR6A 5IOPB 1V0NA 2B1HH 1KIQB 2XRAH 3WKMH 1Z9LA 1H5VA 4LSQL 3LHPH 2VZUA 1YEFL 1YN7B 1JN6B 4RRPG 2DQDL 3VFOB 4GKZA 1KPRA 4NC0B 2ICEB 1INEL 3S9DB 4NBZB 3AM8A 3OGRA 2XWEA 4Z5RA 1KIRB 4NUGL 4WLCA 1NCWL 4HXBH 1FDLH 3GKWL 2ZPKH 3WF0A 3QZWG 4LASL 3WKNA 3WNPA 1NC4A 2XQBL 4XC3L 3S5ZA 3M46A 1OAZH 3VD9A 4XNMB 1FRGL 3IFOB 5BQ7B 3L7EB 3ZE2E 2XPKA 4PJ7A 3OJMB 4EDWL 5KVGH 2I07B 1QBLH 5B4MC 1ONQA 4D3CH 1ZHBA 1NCCH 4QWWC 4YAQB 1NGQH 1QFWL 4POZD 1DWFM 5DJ2A 1OCQA 3N50A 1TXKA 1NAML 3HAEB 3MACL 4LHQB 3W4RA 1WBZB 25C8L 2ZWYA 4YC2B 4GW5B 2EABA 3W9DA 4YPJA 1HKIA 4Z7OE 4MXVE 1I1YB 2AK1L 3UJTH 2WMFA 3AIEA 5IROC 2VZSA 3KL3A 4JFEA 2FR4A 5EUKB 1T5WA 3DV4B 5BVJB 4L8SA 1EO8H 2BVUA 2B2XH 5JQ6L 2A2QT 3T04D 4HLZH 5T3XH 3VXUB 3IS0X 4J6RL 2HH0H 4GSDL 2AJVH 3QJHA 2AI0L 5GZOD 4G6JL 5DJ6A 5F7HA 3WS6C 1YEEH 5E9DB 2GK0A 3SDXE 1KJMB 4EI5D 3OKDB 1QW8A 1U8PA 1MCNA 3GEWB 4U1NB 2DPEA 4XNYL 4JL1A 1CD8A 4PRHA 4YFLI 1EEUA 5FO9A 4L8BB 1N6VA 1S7TB 1Z9SA 2BCKA 2PR4L 1I8IB 5CEZL 2TAAA 2VISB 1KYOK 3LZFL 3MREB 1T3FA 1H09A 1NFDF 3UO1H 2GSJA 1MFEH 4NNXB 4ZXBB 4D6EA 4X4XA 4UIMA 3G5YB 2DLGA 3RVXD 4MWFA 4E5XA 2WVTA 3C6LD 5A8PA 3OXRA 2P5WE 2VZTA 1UOKA 5DA4A 1IGTB 3DBXB 3WEMA 3WN6A 1B0IA 3GHEH 2XA3A 2O5YH 4AIEA 3C08H 1AD0A 4X5XB 3UTSD 3SCUA 4C57C 2Y06L 3L5HA 1DUYB 4Y1AE 4V27A 2CBUA 4CKVX 1N64H 3O3DA 3OKLA 3C5SA 2YL6A 1CICA 1AGDA 5JBFA 5T1MB 3QFJE 5D2NB 3LQAL 1KULA 4RA0C 3DVNB 2DQIH 3I3DA 4LSUH 3C9NB 4PJ9B 1D2KA 4KAQH 1VHPA 4KY1H 4P3DA 1A6ZB 4YXHL 3NIYA 1QFOA 5B3JE 2QR0B 3LSOA 2EEBA 4GRLD 4IDJL 4ACPA 2QSQA 1BQHA 3RJXA 3KPLA 2R2EB 3KPOA 4N8VB 1FG2A 3G9VA 2HFEB 2RFXB 3PWVA 1UEMA 4PJEE 5ADPL 4OJYA 4YDVA 4LSSH 1GZQB 3M45A 3FHQA 4DCQB 2XKNA 4XAWH 1R8LA 4HUXA 3U0WH 3P4OB 4O2FB 1QBLL 1CLYL 2ORBL 5D7IF 1V0MA 3LEYH 1W1VA 3O3EA 3MBXH 4JO1H 2DMCA 3WXVH 2EIZB 1CDJA 4L1HA 3DO3A 4WUKH 3TNMA 1E6XM 4FFZL 2HFFB 4R7NB 4NYLB 5DQJB 3CBWA 2JJTA 4U1MB 1ZLWK 1FYTA 2X1OA 3M17B 1HK6A 4EOWH 1BJMA 2B4CH 2YL8A 4Y4KC 4I0PB 5IHBA 3OZ9L 5E2UH 1A1MA 1H1NA 3AXXA 3PABB 3F7PC 3ILQC 4LKCA 1WCGA 3GSXB 4OI7A 4K7PY 1UWGL 3OBAA 4UB0H 4NO5B 4YHYC 2R0LL 4X4YA 3H2WA 4R0LC 3HAEA 2VLJE 2DIAA 3C60B 4LLUB 5D8JL 5TPWL 1D7FA 1F8TL 2CRYA 4QOKA 5J1SC 5CEZH 3QNXA 2ZNXA 4I18A 3QCTH 4HF5H 1RUKH 5F7WC 4G7YH 1S5HB 2DSWA 5B8CB 3MXVH 5DJ8B 1E4JA 2XSBA 1T1XA 2VQ1A 4Y2DB 1X6LA 5KVFL 1U8LB 4NQUA 5ADOH 3RWDB 1JWMA 4PRAA 3CFJA 3DX6B 4R97C 4ERSL 3ZTNH 3BLBA 3CXHJ 4LYRA 2Q87A 4UCFA 1NSNL 2EIDA 4LSVL 3HC0B 4XC3H 5HNNA 1JN6A 4KZDH 5ITFA 3EBVA 1NC2D 2QKIB 4KKBC 4UQ2A 5KG9B 5D7JD 1TJGL 3VFNA 3M6DA 1G7QA 3AIBA 3MJ6A 3HRZA 4NSKB 3IKCB 1HKLL 2ATKB 4HWBH 4UV4H 2A3HA 4QP0A 1FO0A 5HYEA 3VDBA 1FOBA 4W88A 3ZJ8A 3LKPB 5JUVA 4NQVB 2GY7B 2DQEH 4QNPF 4KUZL 4QT5B 1JYXA 3WHXA 3SE4C 2CUHA 1MVUB 5GGQH 4IEFB 3F7RA 32C2B 3WH7A 3PGFL 1E4WH 4YO0A 3VX0A 4NRZA 3PZ9A 3ET9F 5IHLB 4LNRA 4ZOEA 3BAKA 1GOWA 1OW0A 2PO6D 4U0QB 4NKIH 4JQIH 3DYMA 4XP5L 1U8JA 4X9BA 3BD4A 3GSNB 2R29L 1PZ5A 3QO0A 5A8QA 3FN9A 1WE5A 3WUBA 2FLBT 4HH9A 1O7SA 4TPRL 1MSPA 5FHBH 5A2IH 1VPOL 4IM8A 1S9XB 5T3ZE 3W38A 5BJTB 2VDLH 3U0WL 1FGVL 4W8LA 2NZ9C 1MI5E 2EEXA 1AGCB 2CO6B 4JHAH 4ZSOA 1WQVT 5M3WA 3Q6GL 1KXVC 2ZOLA 3BN3B 4MD5A 4X6CB 5LXGL 5H8DA 1JWUB 5DD6B 5FUOH 2VLRA 3N1QC 1R47A 3B9VA 2IMMA 1K8IB 3BLPX 5IJVB 3UTTB 5IIEB 4NO2B 1IQDB 3O0RH 4NIKB 3N1MC 4ODTH 3U5YA 4TUFA 1C5CL 5HTSA 2WLZA 1IKFL 2PCPB 1VACA 3VXQB 3MODL 2VR4A 4XBEL 2W65A 5IGXH 5FL1A 1UH4A 3MLYH 3EYPA 2DM3A 3KLDA 3X3FH 5ESQB 4OGAC 4R26H 5C09B 2ZUMA 5IOPA 1PGRB 3OJVC 4K8RH 3IAGC 2IG2L 1XR8A 4E0RB 4RE2A 3TCLA 1U2CA 3IB4A 1IE5A 1WITA 2DLFH 1HHGA 2XQYG 2ICWB 3IJSA 2BSRB 4QFUA 4GG8B 2Q6WA 4W6XB 3GSUB 3QPXH 4HFUL 1IFHH 3SE4A 3RTQA 3WHE1 4G8GD 5DQJA 3X3GL 4BZ2H 5C0BD 1RSFA 5E08L 1PKOA 5IMLA 1UJ3C 4P2OD 1OLZA 2SEBA 3BSZL 2ARJA 4ONFH 3MU7A 3WV0A 1KCRL 2MCPL 4LSSL 5HGGS 5A6BD 4WWKB 3FCTA 5DQ9B 1E9LA 5CEXA 5CLTA 3WNLA 1KT2A 3WFEH 3LPPA 3CDCA 2OXHA 1NJ9B 4NNYB 4ORGA 1S9VB 1MWAH 1U6AL 3Q5TA 3U5UA 5GIRA 5C6TH 5DC9B 4HUNB 3O9WD 3EDKA 5F6IC 5C2BL 1DBAH 3VIKA 3LQZB 3MTRA 1QWUA 1KJ2L 2IFGA 2NPLX 1FIEA 2X9XA 4Y5XA 8A3HA 3O3AB 2AW2A 1UADC 1R46A 2ADJB 1I7TA 2OK0L 4XB8A 5DLMH 4GW4A 5EU4A 5JORB 3BVNA 1GPOL 5C07A 1SBSL 1YEDB 5CEZE 5E1AB 3LD8C 4GUPA 1HXMA 3VGAC 5JW4R 2A9NL 4AIZA 1V3IA 1Z2KA 3RUGB 3OKKB 2JLLA 1N0XL 3MLUH 3JV6B 3P30H 3GSWA 2AJXL 1GGYA 4L3EA 3TN0B 5L6YL 4FLOA 1KPVA 1NCDH 1NMCC 5EC2A 3M8OH 1OT1A 1DBBH 2IH3B 3MRJB 1QKZH 5DRZA 3PIQB 3D9AL 5KW9H 1TZHB 5JO5B 2R2BB 5J6HB 1GHSA 5C70A 1KJ2B 3C2SA 1J8HE 1I7TB 3BCFA 4OBSA 1V3MA 1YNLH 1KSRA 1ZTXH 4OAWA 1T7YA 1CZ8H 2YOCA 5T5NG 2VTFA 3RBSA 5DRNB 4O02H 3MRLB 3QFJD 3VMOA 2JF6A 3BP4A 2ZWZA 5JQHC 5MHSE 2P7TB 4HWZB 1EEQA 3IVKA 1PLGL 3O3UN 4Y1AD 1AXSA 3FT3A 1XGUB 1BLIA 2NY7L 2D3VA 1TJGH 1U8KB 3CLEL 4JFXA 4YBLC 4M7JH 4EDWH 3WNNA 1QTYT 3SUTA 3QFDA 1RP8A 1KXQE 3TVMB 2WUCH 4R26L 3EJYC 2DQEL 1YMMA 4MMXC 4MNQE 4NOBA 1EH9A 1CFVL 3ZIZA 2CBIA 3LEVL 3X11A 3NFPA 3MV9D 3D6GA 3OB0K 4JB9L 1KB5H 2GSIB 3W6LA 4DTGL 5J11C 3BAYA 2P7TA 4HWZA 3OHXA 4A6YH 5A2JH 4HKXB 1KEML 5JOFA 4KRPC 4Y5VA 1QYGL 5EZIL 3V8OA 4C7DA 3S37L 3W2DH 5BVJA 4N42A 4KXZH 3MV7D 4F8QA 5E08H 1UD5A 4I4WB 3CFKB 1DWJM 5IFPA 2WINA 4H41A 4EEEA 4WU7B 1KGXA 3RWEA 3L95B 3WD2A 4H88H 5GSRA 1E6ZA 1KCUH 3QO1B 4JR9H 1NDMA 5EBWA 4UDUA 1AR2A 4PJDF 1MNUH 3STLA 1C1EH 1I8MA 1FHDA 1WP6A 1G94A 3U7BA 1CFTA 1U6AH 3U0TB 2OL3B 1YECL 3JV6A 1A1OB 2W0FB 1MWAA 1MCPH 4WO4A 3QH3B 1I85C 1WZKA 3SOBL 3KZSA 5DVNA 4PUDA 3UMTA 2XKUA 4MDIB 5DUBA 3WBDA 3UTSE 1MJUH 3LKQB 4JQXC 4AZCB 3SY0B 3D5OF 5I6XB 1MH5A 1FNHA 1U8OA 3ARYA 2XN9D 4MX7A 3QUXA 3CK0L 2F54D 4WU7A 1V7NL 2GI7A 1T89A 1TVBA 3VM7A 2CDGA 5DUMH 4OKVA 1FNGB 5EO9A 4W5UA 1RULL 2C4XA 3DNKA 4N5ED 4H8VA 3WD1A 1J0YA 1NGZB 1E4XI 1KXVA 1N0XH 1WVZA 3GSQA 2ZCLL 3OKOB 4N0CC 5KSUA 2EE3A 1QI4A 3I2CL 3D50A 1R34A 3CZGA 4ORGB 3VIFA 3W0WA 2A77L 5DRWA 3AMDA 1ZS8A 1MAJA 5C0AA 1P7HL 4PJDA 3DI3B 5D4YA 4NCC2 4XWOD 3WD5H 4AL8L 3GBMH 1J1OH 4OLWH 4ZUTA 2AV7A 3SGEH 4XNMA 4M00A 4M82A 4HV8A 2VVSA 2YLAA 4WWID 2GUYA 2OQJB 1AGCA 5DZLA 3BE1L 1AGFA 3GIZH 5ANME 2WBJC 4LQFL 4PMZA 4UFKA 3QUMH 2V7HA 4AENB 2Q76A 5GRJH 5IQ7H 4D9QD 1T22A 2H26A 2WBJD 2VWEC 5C0DB 5I1EH 3MCLL 3MA9H 1QPKA 1DQLL 4D2NA 1FLTX 5SX5H 2HJKB 3A3HA 4LSPL 3NCYS 3SDAB 2NY5H 5CZXC 5FKAB 1G6VK 1P6AB 4LCCA 1QSEE 5MP6H 1JMZA 3TVMD 1OY3B 3ZYZA 1QNOA 5J0BA 4LDOB 5E5MB 4ZXBC 2CMRL 2FJHB 2OMNA 1HWHB 4KKCD 3LDBB 4LCWD 2XA8L 4QXTA 4X0NA 4F8XA 2HTLD 4NZCA 5C0EB 2VMFA 3CVIH 3U1SL 2V9RA 4BSVA 1D9KA 5HDLA 2GJ6B 1X5AA 4N0YH 4S1SL 4N0FA 1PJ9A 1JGLH 4GW1B 1P4BL 1FFRA 3H9SD 5GGTA 4KPHL 5E8NA 3SEPA 4A6YA 1WCQA 4J4PC 5ACZA 3CFCH 5JIWA 4Y16B 1BECA 3N0PB 5AAWA 2VIRA 1FAKT 2YA0A 4QHKI 3BP5B 1MXDA 3PZMA 2JB6B 1JG9A 5EU4B 2E9WA 2RIKA 1G5AA 4KK5C 1ZL1A 2CYGA 4ZDHB 4CMHC 2PN5A 3ECQA 5A6LA 4D9LH 3TBWB 4X0VA 1KLFA 4WCYH 1NLDH 2YSSB 2OYPA 4YWGH 2JCCF 4R7NA 4OZFA 4XXCC 3VIGA 3TTQA 2QSVA 2NY2B 4X5LA 1HEZA 4HIHB 3V7AG 3L9RB 1F97A 4PY7A 3DV4A 4UFHA 4PGDA 2E9MA 3WJJC 4ZFFB 5C0CD 3IJ7A 1MRCL 3H54A 4ZFGH 1US3A 2F19L 3LMJH 2ERJC 4ZOBA 1NCNA 1MAMH 2NT1A 5LYRA 1LEKA 4JKWA 4ZUTB 2HYMA 5CBEA 4H1LB 3VSVA 4WFGD 5HYJA 2XNAA 4WU5B 3UTTD 1UXSA 2WWKT 3T0WA 3SKOB 5EU6D 1LQSR 1KF9B 3TJHD 2X1WL 3WFCL 3BISA 3BKML 1V8HA 3KYMA 2B0SL 1KBKA 4K23H 3WUWB 4H8WL 4L3CA 1OSZB 1AXSB 4KJWC 3EGSA 1I9RH 4DEPC 4H0GA 2LU3A 3IGAA 3CX2A 2ZOKA 4NCDA 1P7KB 4PFEA 4PJFF 3S4SB 3I6GB 4FLRA 2V9QA 4X7EC 3R1GH 3RDKA 3CFJB 2EDRA 2J74A 3D2UD 3R0NA 1J1OL 4AMWA 2AK4E 1LDPH 3VXUD 1OSPH 1HYRC 3MRKB 3C5ZD 4OCSH 1TZHA 1QW9A 2J12B 3T0EC 2DQFA 2FX9L 5TDOA 3EMCA 1OVZA 4BKLB 1WIPA 1ACYH 3MOBL 4M6OH 1KCUL 3W26A 3U46B 4JR9L 1AD0B 1VPOH 4NN5C 5E8NB 3TZVA 3UBXG 3ZO9A 1MHEA 4M6MH 4M6NH 3ARVA 3RWIB 3OLEA 2H6PB 2OR8A 4PJEF 2IQ9H 1LF1A 2ZX7A 3TT3L 3MXVL 1L0QA 2P1YA 3WMCA 2QQKH 3SDDC 2YEZA 4FFYH 2X4OA 4GW4B 4MAYC 3U83A 1PY4A 5BRZB 5KSVA 1KR0A 3PIQA 1H2JA 2MJWA 5C0AB 4U6VL 4WI6A 5D7JA 5IMOA 1NOUA 4PJXB 3IRPX 4RMVA 3FJTA 4GG6E 3SE9H 4X6FA 4CD7A 3SGJA 5DJDB 1BGAA 4XMLH 1T03H 4KI5C 1ISWA 3CIVA 3EZJB 1G7JA 4Q6IA 3VGFA 43CAA 3QI9B 5E4IA 4LPYA 3NZ8B 5I1LB 1BM3L 3DMMD 5FGRA 5L0QC 3PJSA 1HHJA 1IGJA 3VCLB 3JXAA 1JNEA 1RIHH 2GSIA 4PB0L 4AYGA 1A7PH 1E6QM 1AO7B 1MREH 5D96C 1U91B 1BFVH 3SCVA 1MCWW 2EH7H 4F9JA 1QVOB 3QCUL 5TDNA 3CU1A 3QISA 3TPUB 4GRWH 4L4TE 5D2NC 2DT2A 3GJFK 1CVRA 3TN0D 3TVMA 4OBRA 4NFCA 7A3HA 5I1IL 2ZJSL 5A16A 1KEGL 1NWSA 2C0HA 1GHFH 1WPCA 4LMQI 5A6SA 1OSZA 1F13A 3PDGA 2X4PB 1IGML 3MYJB 4FFWC 4JAWA 1ZVSB 3MLSL 3MPCA 3AU1B 1KPUA 3HZ3A 4JPIB 1MUJA 5HYQA 2IPKA 1TETL 5FHBL 1G84A 5IQ7L 2P8MA 3RX5A 1KC5L 3PBGA 1S5IH 3O8XB 2V2TB 5HDQL 3RVTC 2NW3A 3MRRA 4IMLA 1J8HA 3VO0A 4RFEA 2MKWA 4ATDA 5K9OA 4L8CB 3BLKA 3ARDA 1UZ6F 5AYUH 5JW5A 3HNVL 3QDGB 2RCSH 5EC1A 2J7HA 3QNXB 3SDCC 2WBGA 4HCRL 5B38G 2O5XL 4LLMA 1BZ9A 2W0FA 3F7QA 3F5LA 1HJXA 2IF7A 6CGTA 3BSHA 3RP1A 1V02E 2OTWA 5E8DH 4AH2A 1IC5L 1C5CH 1EVTC 2G5BB 5ESVA 5IFTA 4GRLA 4R4FL 5FM5M 2DICA 2NQCA 5EN2A 4UIMB 1Z9MA 3QO1A 3L7FB 5D1XB 3CVHA 2NY4D 5AD0A 3F6IA 4K3DH 1I4FA 2UYLB 4OLVL 4PJ7B 1E0OB 4JPVL 4UQDA 5I18L 3LKRA 4KJYA 2GTZB 4OD3H 4P5TC 5BROA 3MGOB 1OCWL 1AH1A 1V0KA 5FECA 4XZWA 43CAB 1IGCL 3GXDA 1RFDL 2IMNA 3WIHA 4M48H 4XPGL 1R7AA 5DMIH 5E9DD 3EO0B 5LVEA 4PJCF 3OPZL 5K9QI 5FAAA 1VBUA 1X5IA 1TCRB 5INDA 3LN4A 4KRPB 3KR3H 2R1XA 2WW5A 4KKAC 1X6NA 1HINL 4LNRB 3VMPA 4QXGH 4GBXC 1FDLL 3GKWH 4RQQB 4U1SA 1FVCA 4PJEA 4NM8H 1OP3H 5E24E 1DQML 3HLAA 3TIEA 4NHCH 4NWTL 4F33B 2MMXA 5EA0L 4UQCA 2GAZA 2BFGA 5H2BB 2O5YL 5D7KE 4FABL 4PJ8D 1W0WB 1AGFB 3TV8A 1GJWA 1WDSA 4M7JL 4OUEA 1NCCL 5AYBA 5A2KH 1UWSA 3VRLF 1A7QL 1NC4D 3A22A 3LKOB 3QOKA 5BV7C 3D0LB 1AO7D 3HCVB 4JZJC 3CPUA 1T4KB 2DYPA 3LIZH 1PSKL 1QBBA 2JB5L 3MUAA 4YUEH 4NOFA 3IFOA 4PJAA 3UTZA 3KPSD 1YMHA 2EYRB 1SEQL 4GINA 4LF3B 3EJZD 1PG7L 4TQEL 5IV2A 5TFSH 1E1FA 3ALPA 4WKAA 1Y6NR 2AQ2A 4RAUB 3WLWC 2ICES 1LO5B 4GKNB 1CK0L 2CRIA 4I77L 3QUYC 3BAIA 3S37H 1A6VL 1CT8B 4XNQB 4Z7UA 3W2DL 5HPOA 2CETA 2UV3A 4JFFE 2CD0A 1Q72H 1E56A 3S6TA 3U57A 5I1JH 4XVSH 5D7LA 1NGXB 5FHAH 1WBXA 5JOFB 2YD7A 1RIUL 1MJJB 1HQ4B 5DO8A 4LLWB 4YJZL 4MNJA 3MRCB 3VXRE 1RZKL 2Q8AH 3OKMA 5KVMC 4QLLA 1ZTXL 2EPLX 4F7PB 1GAFL 4P3DB 2NXYD 4WHTA 1I3RA 3TYFB 4PREA 4PMDA 3P4LA 4AY0A 4X9GA 2DSKA 2JK5A 3ZYOA 5KZ6A 4F7TA 4BQ3A 3AHXA 3HB3C 2EZ0D 4YGVA 4NXKA 1KCSL 3GDBA 1FO0L 4O4YL 4PJ9D 4AQOA 1HHHB 2EACA 5BXPA 4KMQA 4P2QD 4HUXB 2X10A 1N2RA 4YN5A 3CVHH 4HPYH 4F15C 4D1IA 3VWJC 3GHBH 2JE8A 1WTGT 3P0YH 3A24A 2WUBH 3QJHB 3UC0H 3RIFK 5DJDA 3V0WH 3MCKB 4G3YH 4GI6A 3W11C 1FNGA 1WF5A 3NCYP 3BZEB 5ICXB 4NZJA 4JY6A 4WVRA 1H11A 4WUUB 2ESVB 3B2UD 3SE8H 1INDH 4JQVC 1B3XA 3L3GB 3SY0A 3EFFB 1T21B 2B31A 1OTSD 4GRLB 1EK3A 4P2CG 5EZIH 1UZ8A 5CBEB 3KPPA 1GJUA 2FYVA 1UD4A 2DBJA 4JFQB 3LPWA 3MRHB 3I50L 3RVXC 2NX5A 2F7RA 3P73B 5JDJA 3IETB 4CJ0A 3RFZC 2M26A 1XEDA 3AFLA 2IFFL 4GMTH 2QTEA 3GMLB 4ZO8A 1TQUA 2WMPA 3LEYL 2DKMA 1RURH 2J75A 3QQ9D 1ZGLA 3C6SB 4Z0XB 2VLMD 1S3KH 4U2ZA 2ZG3A 1ITBB 3L4UA 2XA8H 2EDNA 5CILL 3PHAA 1WZLA 1JF5A 2EPOA 1T3FB 1DBMH 3PP3K 2R23A 5LAXB 1GW1A 1IAKA 5DUML 3DPBA 3PHOA 4POUB 4NN6B 5FYLD 2OJZL 4OQTL 2G9HB 4OIBA 4M29A 4LEXH 1IGTA 3DBXA 4JFZL 1OCWH 4GRWF 3U7WH 5I15L 1T5XB 1JNDA 3AIQA 1T7VA 5J11B 1JGDA 2A73A 1AKJB 3MRQB 5T5FH 3VFVA 1IGCH 3TFKC 5E0QA 1E4KC 4IIQB 1EERB 3PNWA 1AO7A 5DMIL 4P2OA 4KRUA 5BCAA 1JCKA 1RZKH 3OPZH 3WFZA 3AS3A 3CUPA 1XF5B 5HD8D 3EJUA 4H25A 4YDJB 4DCQA 3FHAA 4E0RA 1BIIA 1GAFH 3V6FB 5ADOL 3EYFB 3BKYH 5KTEL 1T7XA 3DMMA 5L2JB 4PMYA 3BKCH 3QO0B 1FORL 1PZ5B 3CFBA 3A4WA 5K9QG 5TGBA 2ZSWA 3FOMA 1FYTE 3OKEB 1FL3A 1UR4A 1E28A 3QXDB 3S35L 1HH6B 3AZRA 5I3DA 1NFDB 3K2UH 3MRFA 1DUZA 3QHTC 4RWYH 3MGTA 3TEUA 3VFVB 2DS4A 4Z7NF 3WDRA 2DBLH 3BRGC 2PB1A 3A0OA 3OJDA 2ATPB 2MNUA 2RGSA 4P4KD 2F1BA 1R3JA 5J4MA 5BS0E 5HYJD 4JFDB 1U8MA 4JANB 3VGEA 4NP4L 4Z7WA 1HX0A 4HBCL 2AJZB 3DTXB 3ZDXF 3WH6A 1T0OA 2DJ4A 4OIAA 3U0PB 3V52L 3DUSA 4D0CB 5DJ2B 3BP7B 4YHML 2FJFA 3QIUA 2WC7A 1T0PB 4OLXL 1PZ3A 2JJSA 1NCBL 3VA2C 3X3GH 1K9DA 5GJTL 5IG7A 4PS4L 3I50H 4WJXA 2Q8BL 3V9FA 4KFZC 5JPNA 2HP4A 3JWNC 1M71B 2NMSA 1U95A 2X70A 4M4RA 5I16B 4UQAA 4P2QE 4XCYA 4DWSB 5TJWK 3NFPB 2CKRA 2NY1D 1G9NC 2IQ9L 3N9GL 4F7MA 3LQAC 2J7BA 2HLFC 1MQQA 1MY7A 4S11A 1CTNA 2DQCH 2GDVA 3MZGB 4DKEL 2ZP0T 1U41A 1I1FA 4XPTL 1ZS8B 5CKGA 3LQMA 1WEJH 3BUPA 2NTFA 2I9LA 2X1PA 3GB7B 2ZSVB 2W59A 3L3GA 4NUJA 4S0SD 2R0KH 5TF1H 1C91A 3QIBD 4HWUA 4H8HA 5BS0D 3OKDA 3CFKA 3SDAC 3ZDZE 2CITA 5DLML 3KWXA 3GNMH 4QOKD 1UWEL 2IUZA 4U2YA 3QEQA 5IVXB 3SURA 4BQ4A 4IBLT 2X4TB 4FZ8L 2OJZH 4GO9A 5GGTL 5J9PA 3QQ9C 5M95B 5L88L 4N5UA 1FYTD 4H8WH 3CZLA 1YNTA 3EAKA 4Z7VE 4PJFE 4QCIA 3SPVA 3VH8A 4HCRA 4NQCD 2F8XC 5BXTA 1YYLH 3D39B 7FABH 2G8ZA 1GOHA 2X4OB 3Q0HA 3L3DB 4WWKD 1EO8L 3G5YA 3SDXB 5FYJL 4YHYB 2F7OA 5FO8A 1RZIB 3H3BC 4GRMA 3B8SA 4LCUB 2BNUA 2XOTA 1LD9A 4RAVB 4OGYH 1OSPL 5H2BA 4JCMA 4H5SB 2PBGA 5KTEH 3I84A 4MDOA 2YUVA 5HJ3A 4M6OL 5EZJB 5MENA 1QNZL 1AO7E 4Q9RH 2DT3A 1T1ZB 1N8ZB 3S35H 3EJSA 4C83A 1XH2A 1KC5H 5T1DL 3QXWA 5ENWA 1MWAL 1CDBA 5CQ1A 2VERN 5TE4L 4OTXL 3RZCB 2JCCE 2ZIDA 2B39A 2IPTH 3BUYA 4U1MA 4ONHA 1UR1A 5EWIL 2R2BA 1A3HA 2EXOA 4BFGA 4OD1L 3WH8A 5IM7B 2JIWA 4HBCH 4EK7A 4L1DA 1GJIA 4Y4FA 1J8HB 4I48B 1S9VA 1W2KT 12E8L 4FS0A 3IU3A 2O5XH 4L4VE 5ID1A 1KENH 4DKDC 2EO1A 5D71L 5FUZL 4XMLL 1T03L 1YQVL 1G7IB 4JEGB 3IDGA 3OL2A 5DJCA 4AEIL 2VITB 3A6OA 1GOIA 4BH8A 1VKXA 3KL5A 1FL5A 1A7NL 4P4KA 1E27A 1Z3GH 2O9RA 1MF2L 4ZENA 3IDUA 2CPCA 1KIPB 1MREL 3ES6A 5I15H 3N9KA 5M94B 2DRUA 5T5FL 5CWSB 3HG3A 1AD9A 5DJ6B 5D5MA 3ULVE 3EW3B 2RJMA 1RZFH 1KIRA 4H20H 3OWEA 3EBAA 1LK2A 4HMEA 2X2HA 3UTPD 3T0EB 4RCAA 5EZOL 4XWGH 1RUQL 5EPMB 2XG4A 5D2NE 3ELAT 4MNQA 2BNRA 1KGCE 2A83A 2EYSA 1CE1L 1HINH 4WHYH 1T04A 3P2TA 4K8RC 4G6FB 1C93A 3ZE2F 1F00I 2EXYC 4LVNC 1R3IH 1GQLA 5I8CB 3MFFB 3V95A 4M8QB 1VSCA 3UERA 1V3HA 4CUCA 3K2UL 2Y24A 1P4IL 4PJIE 5E7FA 1DDHA 1JP5A 1WZMA 2ED9A 1KB9K 1R24A 1KTDA 4PRPA 5AUMB 4GAJL 4E8DA 4WUUA 4YXLL 1CFTB