1CGXA

Site directed mutations of the active site residue tyrosine 195 of cyclodextrin glyxosyltransferase from bacillus circulans strain 251 affecting activity and product specificity
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLLDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
publication title Site-directed mutations in tyrosine 195 of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 affect activity and product specificity.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 235
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1994-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgxA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgxA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cgxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cgxA01
3IDGA 5DYOA 4NSKB 3IAGC 4L1DA 4YFLI 2ZOXA 3WQ6A 5BWFA 4UNUA 5SWQA 3T4YB 1R0AH 1W1TA 5GJSH 2MKWA 5C0BE 4PJAA 1U36A 4MNHA 5I1DB 2HVKB 2F7PA 2O93L 1XH0A 2XY2A 4LHJB 5EOQH 5B4MD 2NXZB 4NO0B 1H8OA 4WTZG 3VA2C 3BLPX 4MXQD 3H9YA 3QHFH 2M2DA 3HMWL 3MO1B 1WBYA 3A3HA 3A6BL 1N6QL 2ADFL 4Z7OE 4ETQA 8FABA 3GI9L 5F7DA 5CG0A 4L4VA 2X6MA 3LN4B 2I9TA 2VLRD 4NN7C 1WDSA 3OKLA 5IFTA 1BAGA 1RU9L 1T1WB 4LLUB 1SBBA 5EOTB 3LKQA 4YUEH 1FN4B 4HUMB 4K07A 3LSOA 3GIVA 1LMKA 3T1FB 3OZPA 3KYKH 5D7LE 2Y8KA 2FB4H 2YZ1A 1P4IH 1EOMA 1GHRA 4BA0A 4Y16A 2VISA 3RWDA 3NZ8B 4KUCD 2FGWH 3U1SL 3D39A 3ARXA 4X5WB 2NY2B 5EIIB 3VO0A 1YEGH 2BVQA 3S88L 4Y5YA 3UTTB 5ADOH 3C6SA 2OXHA 4G6AC 5E5UB 3OZ9L 1H9VA 1GOFA 2DBLH 1H4PA 3WD3A 1HCVA 3QO1A 3MCKB 1B0IA 1OAZL 3D2UB 1LDPL 2X10A 3DVNB 1DUYA 2AQ2A 3DVGB 3BCDA 4X9BA 3EHBD 4HMEA 4LNRA 5LGHL 4UIKH 1KLGA 3GSUA 4PJ8C 4L3ED 3KVQA 4NQEA 1KCSL 3GEWB 5DVMA 3EOBA 4PGJA 3QRGH 4KQ3H 2R56L 4WY7H 1MH5B 3C08H 4FXGA 3ZJ6A 4JANA 1CDCA 1MCIA 5B39B 4FLOA 1QLRA 1KWGA 2C3VA 1WDQA 1NLDH 4Q6YA 4IRZL 3VXSB 1P7QB 5I1IL 3AZRA 5DTFB 1L9MA 2F53B 5KSBB 4GXUM 5IDIA 3LKNB 4N8VB 4FA8A 3O45B 2PC8A 4GAFB 3QDAA 4FQJL 1DQQA 2F5BL 1MW1A 5FM8A 5A1AA 5IVOA 1P7KB 5F6IC 5IKCB 4DCQA 4WHTB 2WQRA 2J6EH 3CJJA 1RZJC 5F1KC 4J3SA 1QOXA 3MR9B 2XKNA 1J1OH 3TA9A 4WW2A 1JF1A 4KMTH 2F54B 4R8WL 3KDMA 5EOCH 2ED8A 4ZODA 3BP5B 2EE2A 5IB1B 3BP6A 2Z31D 1BD2A 4K3DH 4OM0L 4J3TA 3CFEA 3GMOB 3G6JE 3K3QA 1Z0MA 4N8VG 5F7YC 4JQIL 3O81A 3ZT6A 1Q9OB 2WAHA 3AUVA 4IPNB 5I66B 3RJQB 4XCFL 1QP1A 5MP6H 1RPQA 4M8UA 1EPFA 3MXWL 1KLUB 1UXWA 3STZB 3VFGL 1CE1L 3PG2A 1RURL 1A6UH 1QNZL 4PRID 3HCVA 3C2AH 1ZHLA 2IQAA 3UPRB 1FGNL 3FO1A 5GNZA 1E4WH 4DM2A 2IFFH 4XBPB 4WHCA 3DTXB 3QSKB 3HR5B 4OD1L 4P57A 4FF5A 3WNKA 3LS5L 3VFRB 4POYA 1U8QA 3BH8B 4FQLL 4HIJA 1NP0A 2X1IA 4GW1A 2YD1A 5GXBB 4PRWA 1SEQH 2D4FA 3N11A 4MNQA 5JORA 4YK4C 4E0RB 3L5XH 3EIFA 5D1ZC 3A67H 1FNHA 3SCUA 1MI5E 1KJ2H 4DEPB 2IPUK 3CH8A 2XA8H 4XCYB 3O3DB 1A6AB 3OAUH 4JO2H 1CECA 5HI4D 1HYSC 5MEOA 3DX6B 3DX3A 2AJXH 3WXWH 1LHZA 1J0HA 4K2UH 2JF7A 3RA7L 1AXSB 2XN9B 3GSOA 5C07A 4ZXBB 4RAVB 5EFFA 1A5FL 5IOPB 1FA2A 1MFUA 4UR9A 4HCRH 4WCYL 4DN4L 3WHE0 5F9OL 3PJSB 1EV2E 5IHBA 3REWB 4PY8I 1DBKH 2NY7L 1L0QA 2GCYB 2DQCL 1U33A 1HKJA 5ISZB 5FAAA 3SE8L 4OOUA 4P46C 1I1YA 1RI8A 2EE9A 3NH7H 3KLDA 2G5BA 3S37X 3CMJA 4G6KH 1TETL 4ZXLA 1U8OB 1CD1A 1DLHB 2WM0A 3I6LD 2W60B 4RFOH 3BPOB 2XN1A 2CEQA 1FZJA 4EOWL 1I9EA 1TNNA 4R26H 4WV1C 5DHXB 4C83B 3IXAA 2YFNA 3WD5L 3P30L 3MA7B 2DIEA 3HLAB 3J8F7 1T4KB 5E09A 3L4YA 2KUTA 1U3HD 1Q72L 3Q0HA 3QH3A 4N0CD 3W9EB 4IRSB 4PJ5D 3S3SA 4WWKD 5AG9A 5BMFL 4I48B 1LL4A 4Y4HA 3SJVE 3RIAF 5DUMH 3MLWL 4OI7A 5IEHA 4PJHA 4YDVB 4YDKL 4NC0B 1BIIA 3IFOB 4KHTL 4ELKA 1JFHA 5IIEB 2XI9A 3LQZB 3QQNA 4WDIB 3MBXH 5E6YA 2ATKB 3IDMB 2NT1A 5CUSL 4PG2C 1VADA 4X4YA 2EDQA 2P24A 4Z0BL 5HGDA 1GZQB 2WBGA 1I7TB 5JDJA 4C58B 5I1KH 2GTWA 1W72L 1JFQL 4JN1L 5AZ2H 1G7MA 2AEQH 4R27A 3PF2A 3VWKC 1QRND 5GGRB 5L2KD 1GOWA 4HG4J 4DW2H 4G6FB 3BIKB 3S37H 5GS0D 1JNJA 1XR8A 4G80A 1UQZA 3I3BA 5C0FB 2OK0H 4P4KA 3I6KA 5CP3A 2WWKT 4GRLC 3V5HB 3FB5B 2HG5A 1G7QA 3W2DL 4ELME 1KTBA 2HTLD 2NSXA 3AMKA 3DRTB 3C8DA 3LDBC 3VFMA 2BOBA 2GJZA 4U7KA 4U1HA 2B2XH 3GI8H 4LBEA 2NY4C 1W1VA 2GT9A 1NCWL 4ZYKB 3WMBA 2X89A 4JB9L 4WW1B 4PMZA 1MCSA 1EVTC 1BQHA 2QSCH 1DVFA 2K3TA 3KG5A 4MNGB 4AISA 2ED9A 4XPHH 1V02A 1HL9A 4IMKC 4GUPB 5FM4A 3OPZH 1BGXL 3PXHA 5EA0L 1G9MC 1VFOA 4TPRL 2MCG1 2V2WA 2E27H 1NMBL 25C8H 1V3LA 3LH2H 2DKSA 3KPQA 4YC2C 2VSDA 4KTYA 2EDJA 3W24A 4PJ5E 5DSCA 1KXHA 4APQB 4Z77B 2YK1H 1GZJA 1MCLA 1XD0A 4HUVA 4AWEA 2EPKX 4QOKA 1OB1B 4J1UB 3TH3T 5KN5A 3NA9H 2VNCA 1MSPA 4QCFA 3RWEB 5C0JA 3ARGB 1SVZA 3WXVL 2FO1A 3A6CL 1B2WH 1HEZA 3O8XC 4KGJA 2H26A 1KG0A 3WFHB 2NW3B 32C2A 2AABH 1Q4NX 1A7BA 1D9KD 5L2KE 5FD0A 3ZKMD 1G6RH 1Y18A 3U7BA 1CVSC 4M7KL 5IMMB 3O41B 4Z7UA 3MLSH 4KKBC 2HRPL 4WK9A 5KVMC 3VIFA 5M03A 3L3DB 4MA8H 2EO7A 5D8WA 5E8OA 2D3NA 5GS0L 1O0VA 1DLFH 4LF3B 3QUML 3AMGA 1FZKB 1DEDA 3SOBH 1LO2H 2R69L 4JREB 4K9EH 2EPLX 3TV3H 4JG0L 1CFNA 1I1AC 5SX4H 4PJDE 5I17A 3GBEA 2DT2A 3BYTA 2VDRL 5L2JA 2CJUL 1VAHA 1D5ZA 1TVNA 3TBVA 5D9SB 4GBXA 1DQLL 1FL5B 1CL7L 1E4MM 4M48H 1AKJA 4LPXA 5DT1L 1JXJA 2BNRB 3E2HC 3MBEA 5LAXB 1CF8L 5E6IB 1IEAB 1HKMA 2A6IB 2D20A 3F7RA 2HH0H 3BQUC 1ZBWA 4XNQB 4IRJD 4MQSB 2Q7YB 4WFFE 1WIPA 4X4MA 5KZCD 1FRGL 2P8PA 3FO0H 1Q1JL 2IAMD 1XHGA 3E3QE 3CHFA 4IOFC 1U8HB 3VWJC 3D3VA 4OCLC 3MRFB 3NCJL 4XVTL 4DZ8A 2E7BA 5SWZD 3QP3A 5JW5A 5ETUB 2A3AA 1WAAF 3V0VB 4HOWA 2OBGA 4R9HA 1JPGB 4JM2C 5H2BB 4CGTA 2G9HB 2W65B 5C9JA 3VGFA 2Y9RT 5IB3B 1HJSA 3NZHL 1HVXA 4LCUA 4HUNB 3JV4B 5GHWH 4QF1A 1OLZA 3KPRB 4EN3B 1LEKA 2V5TA 1ADQH 1ZLSH 5JNYB 1TZIA 4HT1L 3KS0H 4IS6A 1E73M 4LVNB 3O4LA 4ACZA 5M95B 6CGTA 1U3YA 1BX2B 5DT5A 1FHGA 2C1OB 1F45A 3BN3B 3CXDH 4XXCA 2IMNA 3BXNA 4RX4A 2FD6H 4KK8D 2CK0L 1X1NA 1JV5A 2UYLB 3PWUA 3OG2A 4G8GD 4LVOC 4AYFA 2W9EH 2EIZA 1MFEL 2P48B 3OAZH 3FOMB 4WSJA 2WC4A 2VZUA 4L4JA 4TOQA 4JFFD 4IDJL 1NDGA 2IGTA 3IGUA 2OI9B 3TN0A 4XP6H 1U8MB 4UQBA 4JQXC 3S36X 3VFUB 3GSNA 1O7SA 1X9QA 1YUHA 1HQRA 4JJ5B 4F15B 1I3VA 2IH1B 2WBJC 4Q0XL 1P6AB 3WKZA 1ND0B 3BKML 1FL6B 1ACZA 5MERB 4JHBA 4H1LB 2OR7A 4HGKC 5D7JD 4F7TA 5FB8A 4MJ4A 2ZX7A 1TFVA 5A8MA 1ZK9A 1R5VB 2CR3A 4H0HB 1M7IA 3RWFB 2WVTA 4WGVB 4NBYB 5JO5B 2NXYB 3TA3A 1A0QL 3PWVA 4ATDA 4HEME 2DSZA 2W0KA 1JDCA 1L6ZA 1E5NA 4JZOB 5T1DL 1H49A 3HNTL 5C0NC 3QIUD 4NM4H 3HZKA 4XV0A 3BRDA 5JA9A 4M5ZH 2H2SD 2CGRH 1NCBL 2ESVA 1P84J 4WFGD 4H1LG 2HT2C 4AZ6A 1WWBX 4LGPB 1A3HA 2CUIA 3SKNA 5LWYH 3QAZB 1M01A 3MLVH 4C54A 2UUDH 2ITDA 3FOLA 4HIIA 2VDML 5CBAA 2O61B 1CEOA 4P59H 3AQUA 4W84A 4AD1A 5M3WA 3QI9B 1AGBA 1MVFA 1AE6H 2HFEA 3EJQA 3I6GB 4H8WH 5F7FA 2HLAA 5HHOA 4Y4KC 1EGJA 4XH2B 2V2XB 5D93B 4OD2B 5F93C 3TV8A 1UD4A 2Q8XA 3MMDA 3FQRB 3BKYL 4OUUA 4NQVB 4HH8A 4ISVA 2XT1B 4HHAB 1RUKH 5KVFH 3MNZB 4F2MA 3NIDE 2ERJC 3FFCE 3QJFB 1S9YB 3OAYK 5A6SA 3PDOA 3DLQR 1EJOL 3SDDC 4CCEA 3OMZA 1J1XL 3WFCL 3WDHA 3HA0A 4LXFA 2YZ8A 1MF2H 3DURA 2E5EA 2HT4C 4JFFE 1T7ZA 2YA0A 3U4EB 3QUXA 3MJ9A 1JRHI 2CDFB 1C8PA 5GS1C 2AXFA 2Z35A 4KZDH 1NCNA 3T0EA 5D7IA 1T03L 3DX7A 4HZLA 4Q9CA 4L3AA 4FZ8H 3S35X 1FHDA 1N3NB 4DWSB 1J5OL 1FJ1A 2R0LH 4LNVA 1EFXB 3NCYP 4NX0A 2FATL 3NGBB 4L1HA 2G75B 2OJEB 4HWBH 3OKNB 5LQBL 1CU4H 3O6FA 2GUYA 2O9RA 4K8RH 3EFFB 4NQCE 1A6WH 1B0WA 1OSZA 2ZOLA 4TSCH 3VMOA 5C8JA 1C16B 2X2IA 3ULVD 4U1IB 4HKXB 3T77B 3BDYL 4YGVA 3RZCC 5E2TH 5TDOA 3C5SB 1H3UA 4JDVA 1D5BA 2OXGA 1ZLUK 1WEJH 1OD9A 3IS1X 4HBCH 5EUOB 2AJZB 5IMOA 1XF2A 1WFOA 3QA3B 4CADB 4P2OA 1R33A 4BQCA 3TBWB 1I3GL 1ONQA 3UTOA 1T7YA 1URLA 4OZHF 2F5AH 2R1WA 4E42A 1IM9A 4PP2A 3VA6A 4JY5H 1IILE 3VD5A 4GAYA 4LQFL 3MRJB 1AD9B 1PEZA 5CJOL 3C87A 4LLYB 3T3PF 2IH3B 1H1NA 4LSTH 3KPLA 2NY6C 4M1CD 4OLVH 3BW9B 4LRNL 1MCDA 1S7SA 2YSSB 3G6AA 3D0VB 4EIGB 1S9KC 4IHOB 5F9WB 2DQHH 2YMXH 2GJ6B 2X4SB 4CU6A 1QR1A 3X3FL 4EBQH 4RAUB 1CR9H 4P3CH 1H8SA 1SHMA 4X99A 5ALCL 2VABB 3MV9B 2YDSA 2LAGB 3DJ9A 4PJCF 3ZMRA 3ARDA 4RIRA 3QXAB 4XGZB 1D6EB 3UTZA 1KB3A 5A6AA 2MQCA 4XVUD 1CN4A 1MPAH 2XRAH 3OF6D 3IDUA 3EBAA 4XCNB 5MEQB 4NRZA 1RIVL 4PN2A 3DX9B 4PMDA 1G6VK 4FRWA 3IFNH 3H3KA 1A7NH 1OAQH 3GRWH 4G43B 3IJHB 1NFKA 5SWSD 3MLTA 1CENA 1V3JA 3KLAB 3BZ4B 4M6ML 3RBSA 2YHGA 2ZG2A 5CSBA 3B83A 4G42A 3KPPA 4DKAA 1L0PA 5DRXA 2F18A 4JFTA 4AIOA 1DSFL 3ULVE 1RZFH 3WDPP 1KT2B 1OGSA 4N90D 2X8RA 1ULVA 1R5WB 1Q6EA 3O2VH 5JIPA 4ODWB 1LK3L 5KJRH 4HPYH 4RL3A 2ORBL 3WE6B 1PSKL 1BVLA 4UQCA 4CAGA 1HDMB 3ULVL 4LYPA 3L3KB 1CTOA 4PD4K 1CLOL 5FECA 5FYJH 4KRPB 5HGBA 4AJ0A 3ZJ7A 5CIPH 2C7UB 4OUOA 4OZGE 1NQ6A 2WCGA 3MRMB 2MSPA 4G7YH 3WKML 2QV4A 3OF6A 2DJSA 3SGKA 4AIZB 3Q6GH 1K5NB 3QFJD 3IRPX 2O5ZH 5D96B 3NFPA 2R23B 4ZUVB 5JUVA 5CJ8A 5D1QC 4KVNL 1T1ZA 3ET9F 3GBNH 4XBEL 1INDL 4F33A 5SWSA 4NWUH 1QFUL 1Y0LA 1HI6A 1NJ9A 4I3RH 4L8SC 1OF2A 3W37A 4UQDA 2G2RB 4E41D 4PRBB 2J8UF 2XJ7A 4AMKH 1OM3L 1T1YB 3O3BB 4G6AD 4PJBF 4Z9KB 4V27A 4TNWK 1IEBA 3UG4A 5I1HL 2AEIT 4MWFA 3K2MC 3SE9L 4AK1A 4CKVX 3QDMA 1E4IA 5LXGH 3SEPA 4PJ8D 5GRZA 4W7VA 1INEH 3VRLE 2R2EA 1F3DH 3P4NB 4JDZA 3HNSL 2FECI 1SVCP 3BE1H 3TWCH 3SY0A 1E6OH 2DQFB 1OAYL 1MFCH 1T1XA 5JR1L 5JMRA 3QEQE 1MQPA 4QHUA 2PWHA 4WWID 1C3FA 3DXAB 3AMCA 5T3XE 2FX7H 4HV8A 4KAQH 1LO5A 1MFNA 4MXWH 4OZFB 4S3JA 5DQJA 3QJHA 2Q87A 1F3JB 3RL1B 2LAAA 5HBFA 4I4WB 5HTSA 5AD0B 4N90E 4M80A 4MB3A 2QQKL 1QFWH 1W0VA 1QUNA 5F72S 5T3XL 3KEHA 1KIQA 5D6CB 3QIBC 4FNPA 4B9YA 5A69A 3GJFH 2QEJA 2ADJB 5T3ZD 4MAYA 4LMQE 3RL2A 2P5WD 4PRHA 3ARYA 5DUBA 4CCDA 4NO5B 2C1PB 1J1PL 5GIRB 5BV7B 4OLXL 1DBML 4M43L 1JXKA 2XY1A 2F7OA 1DWIM 4HX1A 4K9EC 3H9SD 4OZFG 2R1XA 1OAXH 1C1EH 5DHYB 3GKWL 2VRAA 3OB8A 4RWYL 4HIEB 4L8BB 1EHLH 2CUMA 1CK0H 5IXEA 1FIGH 3LRSA 3KPNA 4ZUTB 1W0WB 5B3JF 4OOZA 2DTSA 3OB0K 5I75B 3OR7B 3IF1A 1FPTL 5I18H 3HZMB 1G7IB 2EZ0C 1RUAH 4N0YH 3RVXC 5DUPH 4G7VL 1GL4B 5DEZA 5T1KA 2V17L 1P2CB 1OWQA 5AYBA 3IDYB 4WKHA 2YD9A 3INUH 1E4XI 1G7JB 2IXUA 2X4NB 2PYFA 3LKSB 2HFGH 4YR6B 4BQ6A 1QSFE 2WANA 4TN9A 5D5MA 5CP7A 2BRQA 1T83C 2V2TA 4FMVA 1F8TL 5FGSA 3WIHA 5IHUH 2EYSB 2CO7B 1UM5H 4FTVB 4UV4H 3HZYB 1DDHB 2AJYH 3MRQA 3VJ6A 4FNRA 3RIKA 1A64A 5KOVC 1X5AA 5D1ZD 5K33A 2GAZA 1CICC 3D9AH 4L9LB 4RRPG 2WZEA 5IROC 4X80L 1C5CL 3S97C 1WCGA 1X5LA 3ZDZE 4HMDA 4QRSA 1HYSD 3LN5A 4LHUD 4L3CB 1BF2A 1RHHA 3HG1D 4FLRA 2BC4A 3RVUC 2PW1A 4I2XA 3SCMC 5J11B 4HWUA 2OSLB 1Q9KB 4ZS6C 2XTKA 4MDJA 4P3WA 4S0TD 1J8KA 2JB5H 1I3RA 3VG0H 3I75A 4FZEH 1ZVSB 2P8LA 1VACA 2EADA 5H35B 1M6OB 1B3VA 5FKYA 2GUOA 4PGCA 3UR7A 4XI5C 1RZ7H 2FEEI 3BO8B 4JRXD 4UILH 2FNBA 4WIQA 5KVEL 4CD8A 4P46D 3IRZA 5EN2A 4XP1L 1P1ZB 2BNQB 3V6OC 5BXFA 1NGWB 4PJGB 1JL8A 1XRVA 5T3ZE 4R7DA 5DK2B 1KJVA 1F97A 2XWBA 4Y5VB 4RGOL 1YEIL 2Z91A 4M03A 3MYJB 4QHKJ 4ENEC 5GS2H 4GZIA 1ETZA 3HAEH 4F9PA 1NGYA 1JIBA 2YD7A 2HTKC 5T3ZL 2YD5A 1JPSH 2ZSVA 4JFDB 4EAMA 3AIEA 2OL3B 2ZSWB 5ACZA 3IJ7A 1KFAH 3V4UH 4JPKH 4DGVH 1JAKA 3NA4A 2A2QT 4EI5C 5JPNB 1YPZA 3U2SA 1FL3B 2Z8SA 3EO9L 3VI4F 3GSRB 1Y6KR 4PMXA 3EYSL 4QXWA 3VW3L 3UBXA 3Q5YA 1RY7B 2E9LA 3CH9A 4MJID 3DSFL 3KPSB 4HJ0C 1HXYB 3AZSA 5I8OH 4RGNB 3AJ7A 4QHNB 3O0RL 3LPGA 5MEPA 2W07A 1S3KL 1U8KB 1DR9A 1BZ7B 3MMEB 5CCKH 4MQ7A 2CITA 1E0OB 2UWEA 3VWKD 5C3TA 1TJIH 3OXRB 3MMUA 5E1QA 1PD6A 1YEKL 1LE5A 3BAIA 5BVJB 3FZUC 1MRFH 2YRZA 4GKZA 43C9A 1KXVC 5K9KA 4MB1A 3FT4A 3WEXB 4Y5XA 2VKXA 1UZ8A 4ODVL 1AIFA 4O2FB 5ESQB 5DMIH 3A6OA 1Y6MR 1AGFA 4GRLD 4PJIB 3DV4B 3JTTA 3U0WH 1I1RA 1K8DA 2E6JA 3GXDA 2MCPH 4D3CL 2MQ0A 4GXUN 2R1YA 4B9ZA 1B0RA 3F8UB 4MYWB 3OG4B 3QUYA 1Z5LA 3MRIA 4NO3B 4KDTC 3EAKA 3F58L 2DLGA 1YEHL 1QNSA 4ERSL 1E4LA 2NY4D 4AXNA 1S7TB 5JXAH 4PTMA 2WINA 3FQXA 4FXLA 2F2HA 5HDQL 3D85D 1JZ6A 1MCOL 3V0WH 3S96B 4WJ5A 2VQ1A 2C7FA 5C0RL 1I7UA 3CCHB 4LARL 3ZHKA 4PG2A 1AO7E 3K0WA 3MFGB 2I24N 5A6BA 4F66A 5IESL 4HH9B 5F8QC 4QRPA 3THMH 3CX5K 5HYEA 4E8DA 2WIIA 4LEOA 3VXMD 5EU7C 4D94A 2I60L 3VGGA 1A3RL 1CDHA 4GMTH 5EBAA 3MLYL 1QNRA 4R5EA 2V7HA 1RFDH 1A6TA 1L7IL 5EDXA 1NEZA 1Z3GL 3LKPB 1XF4B 4O51A 1FFOA 4ZEPA 2CERA 3RNKA 1F4WH 4GRLA 5E99H 1NBVH 5I8CB 5DMJB 4TVSa 4OZIB 4JFZH 4PRPA 5A94A 4S3KA 4MJIE 4XNUL 2FHBA 4D8PB 2WZIA 1N59A 4Y19E 5BOZG 1U2CA 1MFDL 4I18C 5CEZH 3MKKA 2XUCA 4K8RC 4U05A 1MHCB 4ML4A 3G5YA 2AK1H 5F7WC 5DJCA 2QV2A 5E00B 3S5LA 2NNAA 3O8XD 1OAUH 2XM2A 4JRYB 2GEEA 1QFHA 3RHWK 5B8CA 2AGJH 4LSVL 3JVGC 3LMJL 1UZ1A 3N9KA 1MCPH 5I5RA 3U5YA 1GGBL 5H37G 4CNIA 1UZ6E 1SMOA 1O7AA 1PG7X 3RUGE 2F8XC 3MLRH 4NPYB 3RWIA 1RUQL 3P0VH 5C0AB 4KKBD 5C0BA 1RD6A 4J3UA 1CLZH 1KN4L 3KNBB 4C7FA 4NZTL 4PJIF 2D22A 1AHWA 4EI6B 3QQ4B 3OKKA 1FLTX 3BUQA 1I9RL 4W5UA 4QT5B 1BJMA 1JWSB 1CFVH 4MAUL 2ZWYA 3CNKA 4ZFOL 2HVJB 3TVMA 1Q9LA 3I02A 4R2GC 2BJMH 5TD4A 1I1AD 1U95B 3D0LB 2PO6A 4ODTL 2CBIA 2PCPA 5HHXL 2D7QA 5C08D 3UTSA 4MAZA 3HFML 3O11A 1Q6GA 3PQYD 1JDAA 4OLWH 5DZOA 1A4JB 3MRRB 1WZLA 2ICEB 2OYMA 4NOFA 3K4AA 3O6ML 3EZJB 3HE7C 4DVBB 3WIJA 5AC4A 5SWQB 4PJAB 3L6FA 4IMLB 3BQUD 2XHYA 4WTXA 5H94A 3MNVB 1ECEA 1D7FA 2PXYC 5IV2B 2XZAL 1W2VA 5D7LB 1MIMH 3LRLA 5D6DA 1QD0A 3ZKXC 1CLYH 3BP7A 4TVPD 3VWJD 3PWNB 1WV7T 3R06B 3OKDB 2X1XR 3JZ7A 1E0VA 1IAKA 4O5LL 1PG7H 3VOCA 4ZPTA 3PGCB 3AXLA 1U6AH 4KI5E 3ZE2E 3KLLA 1ODUA 4EDWL 2EDBA 4TUOA 2OSXA 4MD0A 1ES0A 4KUZL 1BQLH 4YO0B 4PRDA 3NFSL 4XPFH 4GW4A 4TULH 4X9GA 2OQJA 4BZ1H 3A4WA 3GIZL 2A9MH 3PWLB 3H54A 1S7UB 1YNKL 1EJ6A 1UA6L 3MPCA 1A02N 1CDIA 2BSRB 4BYHA 4BA8A 3PGDB 3BVVA 2VIRA 1UEMA 2MNUA 2XOTA 1A6VH 3BAJA 5J57B 3VFVB 3VXUE 3BX7C 3HPJB 2AAVA 1DQJB 1NCCL 1AC6A 3B4NA 3PHQA 1E1EA 1MW3A 1Q0XL 3AREC 5ALBL 5HPMA 3EYFB 3LPWA 4QRTA 5J13C 2L4OA 3EJUA 1C5DB 4AZCA 1D5MB 4GQ9H 4LNRB 3QUZC 2WBJD 3SE4A 5ICZB 5EPMA 4I77H 4OD3H 2K7PA 3BGMB 5FYLE 5IVZA 2IQ9H 4WFHD 3MRDA 4JM2A 2JF1A 2JB6A 4OFYA 4Z2HA 3ZDYE 3CFCL 3G6JA 3QIWC 4F37F 1RP8A 2YD4A 4FQPA 5ABHA 2VLRB 2RBLA 1UACH 5I6XB 1P5VA 3RFZC 3D5OF 2ADIA 5EU5A 3D48R 3O2DH 1I7ZB 4OF8A 4PJAF 5IK3B 2NY0C 4U5IA 1UWGH 2VX7A 3P9LB 1NBYB 5C0ND 4F7PA 4XNXH 2LTQC 3QQ3A 2VZOA 3MOAH 1GGTA 3QGVA 3HUJE 4D6EA 5J3HC 2GJJA 4CVUA 2LVCA 3LEXA 3MOBH 5H8DA 1IC5H 2HT2D 4OKVB 4QP0A 3AOFA 3VIOA 5CSZB 1FFQA 1KEML 5FYKE 4ZFMA 2WC3A 2G5RA 2GITA 3WSQH 4TVPL 4AD5A 4GRWB 4PJXE 2W92A 4O02H 5FKAB 3ZTJH 5FEBA 4LAQH 1N6VA 1IGTA 3KE0A 4LYRA 1E4KC 3CFEB 2OX5A 4P49A 1I9IH 4O4YH 1JGDB 5IM7B 2J78A 2WMPA 1MI5A 4P2RD 5DRWA 1ZMYA 3QHTC 3U7YL 4LOUC 3L7FA 4KKCC 1GQLA 1YHTA 4L3EB 2BVYA 4Y4KD 5EOQL 2QQQA 8CGTA 3Q48A 2VTFA 1LG1A 1OGAD 7A3HA 2HFTA 1UWUA 4X6DB 1HYRC 3BZFA 1ODAA 3QHFL 1KIUA 3TNMA 3ULUF 3ZKQD 2X41A 1DWGM 3ZIZA 2EXWC 2ADGA 1ZB5A 2YLLA 3SDDD 2J7GA 2XWTA 5IHLB 4F9LA 1TITA 1C5BL 2HT4D 3BPLC 1HJUA 1UB6B 3GGWA 4LPVA 2E0PA 4MNQB 5JORB 1FVCA 3L7EA 3PL6C 3RWGA 1N0XH 2CDGB 4AY0A 5AUMA 1NAMH 4WFHE 2DD8L 4IPLA 3KYKL 4X6BA 3U7AA 1VKXB 3CC1A 1P4IL 1PYWA 2K1MA 2FYVA 4FFWC 1NBZB 4P99A 5DD1L 3KYOA 5DXWA 3IXTA 4KMLB 2VURA 2Z31B 4OAWB 4NQDD 1WC7A 2FGWL 2QLVB 1DCLA 2F74A 5FGRA 4P2RA 1EA9C 5FV2A 1YEGL 1FFNB 3MMWA 2W91A 3V6ZB 5FGBA 3W0WD 3C60C 1ZS2A 2BSTB 3SJVA 4NGHH 4NBXB 1ACYH 5GRXG 3RZCD 4PRIB 4KUCF 4Y4FA 2YKKA 1QW9A 3AM8A 3FB7B 1OD7A 2G5BB 4ORGA 3MRHA 1W72B 2Y5TB 3QRGL 2XPGB 4KQ3L 1IQDA 3HHRB 1A9EA 2AV7B 2QSVA 3SCSA 3CPLB 4W8BA 4LRIA 4GRWF 3PZNA 4KDVA 3G9VA 3EJRA 4S1RH 1NLDL 2IALB 5I2IA 3ZO0A 1C8YA 5CLWA 4M9PA 3ILQD 1CT8B 3IXAB 1P5UA 4OIIH 4GG6B 2IG2L 1HH9A 3KL3A 1E28B 1HKLH 1Q9WB 4EVNA 3ULSA 3WBEA 5FCSH 1OGAE 4ODXA 5L8KB 1CPUA 4NN5B 3VE0B 4X6DF 3IU4H 1EEQA 2B8OT 4Y4HB 5DJ8A 5JDSB 4RFEA 4ELMA 1LQ0A 2J6EL 4PJHB 1G7HA 3WFDH 2COQA 3SDCA 4WSKA 5EOCL 3GBDA 1VADB 4NJ9H 1WBZA 4YPGB 5BZDB 1S7RB 1VGEL 3ZYJA 2AK4D 3T0VA 4LLQA 3GNMH 1AY1L 4Z76A 2EKSA 3SDXB 3PTMA 5DEFA 2J7EA 5HVHB 1OTTC 1GOQA 4YHOL 5E94A 1S7WA 4U1JA 3BEWB 3SCNA 5ICXA 4U3XA 5F88A 4LKXA 4CN6A 1VENA 1G9NH 5D71H 1XR8B 1BZ9A 5E2JA 3WN5A 2CKBL 1QA9B 1FCCA 4NQDE 1JNEA 1OQXA 1BHGA 3GMPB 4IOIA 1X3DA 1NCDL 3I9GH 1FP5A 1G7PB 4PY7B 2CHOA 1U3HB 2Y06H 2GJZB 1UVQA 4PJ5B 4WWKB 4FQQB 1MQKH 5D2LA 3N1AA 3GUTB 5IMKA 1SJHA 1U92A 2VITB 3DUSA 1SEQL 4C59B 3WH7A 2NTFA 5E8DH 3HMXH 2W0LA 1IGYA 3IDNB 3ZYIA 3WDRA 3L5XL 1FFPB 3A67L 1SMAA 4LCCC 1ZLWH 2MTPA 4TTGA 1KJ2L 3DNKA 1C7TA 3L3IA 5HHME 2F15A 4RE2A 3N1PC 1OP3K 2J8FA 3WXWL 2UY4A 1E40A 2B4CL 4P8WA 1GGIH 4K2UL 5E1AA 1W1PA 3ECQA 1WZKA 2VLKD 1BLIA 3BPCA 4AEIL 2O9TA 1A1OA 3DBXB 5D2NA 2GSGA 1QRNB 1LEIA 5KG9A 2BVDA 4GXPA 5L2KB 4BFGA 2WWMC 5D1QD 4HCRL 3D25A 3CU1A 1NFDE 3PZQA 3QUMB 4W87A 1DBKL 3UTQA 1X5YA 3F5JA 5I1EL 1B0GB 1CYGA 3VFOA 5BXPA 3FO2A 4DQOH 2ITCB 4PJHF 4F7MA 3ALPA 5DC9B 4ZD3H 2EKJA 2OWWA 5KN5B 4KH2A 4AL8H 4RFOL 1KIRA 3G5XA 4PJDA 4ZQKA 1IBGH 4R26L 3IJSB 4JFSA 1YMHA 5K9QG 3CUPB 1BYAA 2W4XA 4U7SA 4ZDHA 3SDXF 3NAAH 1L8NA 3UAJC 3ZJ8A 2XFXB 3BAXA 4XVJL 5ABGA 4U1GC 1A7PL 5FDWA 1QFOA 2Y7QB 5CJQH 4YHPA 3FFDB 3SURA 2EH7H 2A1WL 3EKCA 4Z7UB 2R0KH 4G9FD 5DUML 2QBWA 3SKMA 3QEGH 5AZEH 4YQXL 5IFAH 4M5YL 5HHQA 1T0NB 4HS3B 3LMYA 3MV8D 5E8OB 3MBXL 4GMSH 3RY5A 1UKQA 3U9UA 3OXSB 4XZUA 3W0KA 3ZZ1A 4U33A 4OJYA 1S8DB 2WNGA 1B3XA 4O2EA 5KVDH 4BFIA 4ZSOE 5GJTH 1KJMB 5CILH 3QIBD 4UQ3B 1XSJA 2AEQL 2NQCA 5HHNA 2OTWA 2NCMA 3V5DB 5HJ3A 3X14A 3IJ9A 3WSUA 2FGLA 4UINH 1FQ9C 1D5ZB 1S9WA 3GMRB 3RM9A 1LEGB 5GSRB 2WPGA 1DBBH 4UQ9A 3VD7A 5IF0B 5E08H 1BYCA 3WH6A 4L8DA 4C55A 3MV7D 3PZOA 4OZOA 4PB9H 4IIQA 3IDJA 4K23L 1OTSC 1KGWA 5M5DA 5J0BA 3BUYA 4YHMH 5ILTH 1D9KB 5ECUA 3PE9A 1GHFL 4L9DA 1K6QH 2P8PB 1EUTA 3NSMA 1MFAL 5DD3H 3GI8L 3MREA 4UU9A 5T5FL 3W9DB 2EZ0D 3DROB 3KXFA 4WNQB 2VX6A 4O58H 3RVXD 1ZGLA 4U3HA 3LKRB 3VFNA 5DEGB 3BVUA 4UOZA 1P4BH 1OY3B 3UEQA 4XPTH 2AKRA 4M6OL 1WBXB 3E6FB 2I07A 3VU2A 1L0YA 4XBGA 3U6RA 5MHSD 1MRDL 1XF5B 1LF1A 1G6RA 3GMNA 1EDGA 3VSVA 3IFPA 2VXVL 1FFRA 5TE4H 4LCUB 4P7NA 4N5EC 4UIMA 5IB2B 1CICD 2VRQA 2E27L 3WY1A 2E7LC 4XNMB 25C8L 3RDTC 3LH2L 1LL7A 3GMMB 3VI3F 1PBYA 5FGCB 3S8WA 3ZDXE 5TQ0H 3B9DA 3C5ZA 3ZKSD 4HLJA 2VR5A 2QHRL 4ACZB 2W67A 2CLRA 3RVUD 2ZXDA 4DKFL 4GRMA 2D7PA 4Z7UF 3GNRA 2VUOA 2FWOA 4ZS6D 1IQWH 1KYOJ 3MV8E 1MWAL 3WFLA 1IAIM 1SYSA 5LA1A 3NA9L 1J87A 4HF5H 4HJGB 4IRJB 4P7RA 4XI5D 2AEPH 5KZCB 4O9HH 2F8VA 2FJGB 2V6HA 1RUML 2IAMB 2A6KB 2OLHA 2XYLA 4J27A 3GHEH 1ZVHA 4MGXA 2LE9A 4QTHA 2FSEB 2C4XA 2Y6SC 4HFWA 5SWZB 1W91A 4PMRA 4TTDC 3CFDA 5F1SA 5F7EH 1CI5A 3TBYB 1QSED 5HY9A 2D03L 1V7NH 1UZ4A 2ENYA 5CEXB 1I8MB 3W6LA 5HYJD 4ENED 4AIXA 2HTKD 5T1LD 1E55A 2FH8A 1C91A 4U1MA 3CHCA 2V5RA 1CICA 5K9QI 5C0EB 1QHPA 2C26A 3SOBL 2GY7B 4EI5D 1RZKC 1CVRA 3VXQB 4K9EL 4LPWA 1KCRL 3FFCA 3FQWB 3VXNB 2D7TH 3SCMA 3L3HA 1S46A 3FN9A 5IW3A 1NEUA 4G8GB 2VC2L 2RFXB 5IR1B 1I3UA 3MRNA 5FOBB 3OA5A 5SV3A 2NLJA 1ZS8A 4HJ0D 3SUVA 4NIKB 1EVUA 4M48L 4JFFB 3FOLB 3PP3K 1CL7I 3RNQB 2DI8A 2GYSA 1BBJA 2EABA 2RCSL 4ZOAA 1BOGB 3PHOB 1AGBB 5MI0B 1PBGA 4CD4A 3U79A 2HH0L 1VFAA 1GNXA 3U4AA 3MJ7A 3FZUD 2YUWA 5A8OA 4CRPA 4EEEA 2V9QA 5D7JB 4ODHH 4W7UA 3FO0L 2ZG3A 4M9OA 3JV0A 4DAGH 1QFPA 4C4KT 4NQCA 4NKMA 2XWJA 4QRUA 1N5YL 5GRUH 3HI1A 5D8JH 2QADC 1TQWA 2FJFB 4XAKD 3QIUB 4NHCH 1CBVH 3I2CH 5F1NA 1D5IL 4X6EB 4YZFF 4G6ML 1S7XB 2WHMA 1I8KA 2WBKA 3FMGL 1WWWX 3DWTA 2NY5H 5GHWL 2CLZB 2H6PB 3MCLL 1ORSB 1KELH 4BZ2L 4J4PC 1ADQL 4AENA 3JV6A 2YC1A 3QHZH 3HZVB 1QSEE 3CVHA 5GPRA 2QTEA 2ZUNA 1QPKA 3LRGA 4HZ6A 4NQTA 5C09D 4RZCB 5FF6A 5KS9A 2BVPB 4F57H 3LEVH 4WRLA 5KSUB 1RJLB 4R97C 3B9KA 1R3LB 5IW1A 3V4VH 1CGYA 1HK6A 1N4XH 4Z8FL 2W9EL 2FJHB 2NX5D 1IGCH 2BCKB 1MIEH 3TBSA 4W81A 3G6MA 5BS0E 2V7NA 1QNQA 4XRCB 1FH5H 2ZJSL 4EDXA 4I3SH 3QZWA 4ZO6A 1U30A 5ITFA 3RJXA 4DO4A 1KTRL 4TSAH 2W38A 3IKKA 2BVTA 2HN7A 4UAOC 5FKPB 1UJ3A 1OL0A 1FLRL 4FQXA 5AEAA 1A7OH 3P73A 4LKCA 4K8RD 3RJYA 3T8XA 4KK6C 3WQ8A 3OZOA 4YHNB 4H5SA 5IJKC 1C7SA 2FO4B 5J1AB 3JWOC 4OV5A 3MJGX 4GAYB 2GK0A 1QI0A 2JE8A 1UCBL 1YMMD 4FLSA 2YPLD 4XUYA 1HHJB 4FFYH 3BJ91 4ALAH 1AGEA 3PWPD 1OQOA 2HJKA 4G9DA 1QR1B 1U2YA 2BZDA 2B1AH 1NDMA 3TT3L 3UO1H 1AQDA 3D69A 4NHUA 1K6AA 1QVOB 1ISYA 4MSWB 1YEJH 3MLVL 1KNOB 3F6IA 4NQUA 4XAKE 3UXFA 1RAMA 4PJFB 3MUHL 1S5IL 4R2GD 5T1MA 2KL6A 2XTJC 4JGJA 2GK2A 3IETB 3WO3B 5IEKA 1CGUA 3L3GB 5DJXA 3TZVC 2YOCA 5CZVH 1XGQA 4U31A 2RGLA 2R29L 2YFOA 2QSTA 1FYHB 4M1RA 3SQOL 5DWUL 1FSKB 4JO3L 1T21A 3HE7D 3ZKNC 5I1CH 4MXVE 1RUKL 1T3FA 4OZGB 5KVFL 5AY7A 1R3JA 4I0PC 4NT6A 4YNYA 2Z93A 5TPWH 2PTTB 3OX8B 3DMMA 5TE7H 1R47A 4E8CA 4QYOA 2OR8A 3BKCH 3FRUA 3VNZA 1UKSA 2NX5E 2FBOJ 1NANI 1T20A 1ZEAH 3BPNB 3X3GH 4Q7NA 4NKDB 2CRIA 2BHYA 1PX8A 1D5XA 5IFPA 5D1XC 4QKXB 3IKCB 1VEMA 2QR0A 2JLLA 4PV9A 4P23C 1VGKA 1NCTA 3CFKA 1G9NC 4YHLL 3MSPA 3D50A 4JFXA 4DFHA 5BVPL 4BKLB 4YXLL 1Z6JT 3OJVC 3FN0L 1KCUH 1WZ1H 2WHKA 3NACH 3GXTA 2D1ZA 3WHXA 2R0LL 3O9WC 4PS4L 2OR9L 3MROB 4WUUD 1XMWA 5IFJB 2IADB 5D9NA 1KEGH 3D6GA 1AXIB 3GJEA 4HWBL 1CU4L 4DTGH 2DYPD 3OAYH 5ENWA 4PTVA 1OGTB 5KSVA 2AV1B 4K8RL 1A6WL 1ITCA 5HGHB 4TSCL 4Y8AA 4NO2A 2WP3T 2YPLE 2ZCLH 1ZU8A 5CSYA 4X6CA 2CMRH 3EOYG 3QEQA 1YY9C 3HZ3A 2J4WH 5SWSB 1GOIA 1FBIH 1Y0LB 5E2TL 5FYJD 1PZ5A 2HJFA 3AIVA 2ID5A 1E6RA 2NY1C 2SEBA 5JBEA 4LIQE 1WEJL 4Y0GA 4HBCL 2PXYA 4XCCL 1SY6H 4WU5A 5L6YH 1KBGH 3H42L 1NGXA 5JPMA 4L8CB 4HXAH 3QR3A 2XXMB 1F13A 4K3EL 3GB7B 4PJFF 1V6YA 4XC1H 1ZHNA 4S2SA 2VXSL 3QUZD 2WSKA 2JCCB 4JY5L 5BW7C 3O6LH 1UM6H 3DGGB 1PPIA 4BELD 5E5MA 1HXMB 2MANA 1JD9A 3QXDB 2Y25A 4LEXH 3O3AA 5F9JA 3QIWD 1J18A 3BC9A 2BNJA 4NRSA 2F58L 4W5ZA 4R7NB 5IFHH 1C08A 4NN7B 2X4PA 1K4DB 5FK9A 4YLQT 4QXGH 4EK7A 2UY5A 4YH6A 4P3CL 1ZLUH 1EMTH 2OS7A 4XWGL 2NY0D 3FRPG 4LSSH 1NOWA 2QJDA 3QO0A 1BEYH 3QFJB 1W9PA 4GKNA 5E2WH 5J8OA 3TCLB 1XGPA 1XSKA 4D9QD 3UDWC 1X5FA 2WZPD 4JLRB 2ZE0A 3T09A 1B6DA 5DJAA 5JHDA 5I19H 3U30C 5GGQH 3GSQB 2XRAL 1U58B 4H41A 2OTPA 3IT8D 5CIPA 4GW5B 1HZHH 4YDJA 4E41B 4YDLC 3AIWA 1QSFA 2UY6A 3IFNL 3AREA 4U6TA 1OAQL 3O6KH 3CUFA 4LLVA 3T0AA 3GRWL 1G0DA 3C8KB 1UR8A 2P5ED 4OIBA 3BAKA 5F7UA 2DM2A 4WUUE 4WFED 4A6YL 1BM3L 4S10A 5KSAA 5ISZE 4HX1B 4KKCD 1A21A 3OHXB 1M7DA 2YPKA 3CAFA 4GLRH 4PJ8B 4HK3J 1JNHA 1I1FA 3M8OH 4OF0A 4X5XA 1YN7B 3EFDH 1RZFL 4W88A 3MUIA 2DTMH 2ATPB 1QLFB 1S9VA 5K9JL 5EZLA 1EZVX 2EXWD 4HPYL 1TA3A 2D31A 5FHAH 1MELA 1SYVA 2ZPKL 5C7XH 4K94C 3QULB 3LEYH 2PYFB 5FYJL 2WSPA 1MJ8H 4DUWA 3SDAA 3TP4A 5F6IB 5FO7B 1E6JH 5J6HB 1ZA6A 3GXIA 2VRKA 1SBSH 3K46A 4GO9A 5ICYA 4XMKH 1GPFA 2YD8A 5CGYC 5EU6A 4QLRA 1G84A 3ZR5A 5MENA 2GAZB 3WS3A 4WI2A 1NBQA 4L4TD 4Z7VA 1S7QA 3P4MA 4F7CB 3D4ZA 4FFWD 4H7VA 7FABH 2P5WB 3M17B 3QWRD 5ABFB 4WU7B 4G8FA 4NWUL 4I3RL 4Q6IC 2PW1B 2BFVH 2AP2A 2D2OA 4OCSL 4TUJB 1JF5A 3X13A 4KTDH 3H9SB 4AMKL 3C60D 3GJFA 3CZFB 4D9QE 1MHEB 1NWSA 5DMKB 3LZFH 5E70A 1QYGL 3IVKA 3IJYB 4UZUA 1UM4L 2UV3A 4CDHA 4V1DD 3B5TA 4AM0A 1E43A 1WWCA 4K71C 3VVGA 2J88H 2VDOL 4UDTA 4HUWB 5F3HA 3X12A 3QHOA 2P5EE 4O2CB 1E6OL 3L5WB 1DQDH 4KJPC 4U2ZA 5JW4Q 4ODUA 5E5RB 4WFEE 4BH8B 4YK4B 1I8LC 3PL6A 1YC7A 5D1ZB 5DDHB 5DGRA 2VVNA 2V3FA 4KXZI 3NIYA 1DFBL 5ACZB 4ZE5A 3WHE1 3TTSA 4MXWL 5EWIH 4NNXA 4MNGE 4LHUB 2VZVA 4P7QA 1JWMA 1A22B 1HQ4B 3HG1B 5DZNA 1H2JA 1ZBCA 3AU1B 3MGOB 4C57C 4F7EB 3VD9A 4NZRH 3CMGA 2BFGA 2YXFA 4LSQH 1HHHB 4MCYA 3VDHA 3G04A 2UY3A 4Z7WB 3DUUA 2OTUB 2D7OA 4OCNC 5TDNB 2ZUQC 1NMAH 4JRXB 4R0LA 1FH9A 4P5MB 4OBRA 4P46B 1FZMA 1OTTD 2UVEA 5JQ6L 1VJSA 1C1EL 1WAAE 4HC1L 1O5DT 4LHUG 2GFTA 2NTSP 5ERWA 2DS4A 5IBTH 3WIIH 4N0UE 2Z1KA 1M7XA 1JYXA 2EPOA 4TOYH 1CK0L 43C9B 3FT4B 2ICWJ 5DLMH 3TM6A 1FYTD 2GW5A 4WUKH 5ACMA 4Q58C 1JI2A 1MCEA 3NCOA 3WH9A 5EBLA 1X4YA 1ZTXL 1WTLA 4WV1B 5IW6A 1KBKA 1RUAL 3LV3A 3L95B 1UH4A 5EIQA 4KMQA 1TJHH 3KPRD 2PF0A 3W27A 1PX3A 2MMXA 1EDQA 2ZX9A 5D8ZA 1W9UA 1B0RB 4Y1AD 1C92A 4OLYH 4U1SB 1HHIB 4Y16C 1NCAL 3P9WB 4OSUH 1FAIL 4PJEB 2GJXA 4XMPL 3V7AE 4UV4L 3ULUC 3CDFA 2Y8VA 1OARH 4HGWA 2QQLL 3U36B 4V1DE 2X4QA 2GFBA 5JLZB 4Y19A 1JK8A 3I50L 4KVCL 1PKQB 1MJUH 4M62L 3HAEA 3D9AL 5FO8B 5IQ9B 1M71B 1CG9A 3OR6B 4MJIB 2DQIH 3N1GC 3U46A 1A1NB 1V8HA 4PGZA 4Y5YC 1CXEA 1K4CA 5C0DB 3S5ZA 3FY1A 3OB0H 1IGML 1WWAX 1LILA 4QFUA 3EYUL 4LLDA 3WFBH 1TQSA 2FL5B 2EEAA 1RVFH 4HA3A 3GSVA 4LCWA 4FFVC 4JAMB 4OF6A 3AIQA 5D4QA 3OLGA 4Q74A 4G8EB 5GGVL 4JZJA 3VWKB 4DGYL 5E24E 2E3ZA 2VCCA 2JB5L 1U3JA 2WWMD 4YHIA 3RUGA 5DD0H 2I5YH 3D4YA 2WMIA 3CTTA 1V5JA 4NRYA 4EJ1C 4P9HH 2APTA 3UROR 2Q3ZA 4D0DB 3G5ZA 1YN6A 4GRLB 1J8HD 4ZFOB 5DS8A 3DX0A 2D0HA 4UV7L 1RJCA 2N56A 5BRZD 1N59B 2R2BB 1BFVH 3EGSA 1QHZA 2P1YA 3LDBB 4Z7WF 3IGAB 5CZKA 3PWJA 3BWAA 3WNOA 3GMQA 1UA7A 4LSRH 5CWSB 3PV6A 2NNAB 5T33H 5HYFA 2EQDA 2NY4B 1XGRB 3MLUL 3P11H 5DD5H 3D85B 1EGJH 3N50A 4FNLL 2BNUA 2UWEF 3UAJD 1KFWA 2H9GA 1ITXA 2VLLA 1MUJB 4WW2C 1AP2B 4JPKL 3R1GH 4DGVL 1R24A 4W4OA 3LPOA 1FYTE 3HC4H 5CEZD 5FHBH 2D24A 4JAWA 1F42A 1CE6A 1F4XL 3UJJL 4M7LL 1T22B 2FZ3A 3M6DA 3VXMB 1JGUL 3CHEA 3KPRE 2O26U 4LDEB 4XP9H 1SM3H 4YC2B 3MJ9H 1W9VA 3RGVA 4UTAH 1YDPB 4MJ6A 3G08A 3CVIL 3BZEA 4PJEF 3MUZ1 4YBHA 5CCKL 5I1GH 3D5HA 1V3IA 1MCRA 1QHOA 5JW3L 3RTQA 4JPVL 3W39B 3KYMA 5IB4A 1IL1B 1KULA 1EAPA 4ZNEA 3TTOA 4ONGH 3ROOB 5I1AA 3F62A 1TG7A 3BRGC 5J56B 2J7LA 5DMIL 1HNGA 3O8XB 4W68A 5D9MA 4MVBC 2ZX6A 4Z2IA 1OTSD 1J7VR 5HGGS 2VB5A 4RQQB 3CUGA 2MCPL 1WF5A 2VXTL 3BLBA 2QHAA 4Q9RL 4P4RB 1FP9A 1IJ9A 5EC2A 3ISWA 4R4FH 4XZWA 3VXUA 5TQ2H 1H0DA 1JUFB 3GKZA 4X9YA 3T2QA 5JXAL 4Z2JA 4X9FA 1M05A 4OGYH 3IB4A 4J3OC 4NFBA 3QCTL 2JJUA 3NIGF 3U5UA 1GGYA 4HUUA 5BRZE 1Q6CA 2R0WH 1K8IA 3PZMA 1ZLVK 3OKOA 4Z7NF 5F96H 2WLZA 1E6PA 4YXHL 3THML 1ES0B 5EBGA 3ZL4H 3ARBA 4U0RC 4U1NB 4PLOB 1MFBH 4N5ED 3WUZA 5CSUA 1I1AB 5HVGB 5EU3A 3ZT5A 2DQUL 3RDTD 1CIUA 4GMTL 1FNGB 1F58L 1B90A 2XACC 4ZOEA 3UTPD 1CDUA 2A6DB 5C08B 4DKEH 3NIFF 4JY4A 3PQYB 1RFDL 4YAQA 5F3BB 4LSUH 3E2HB 4PMUA 43CAB 2Q86B 4OZHE 4EXPX 1M4KA 1FZOB 1SJEB 1CLCA 3O4OC 4JFYA 3EYPA 1NBVL 4JDTH 4QXTB 4GAJL 3BQUB 3MLXH 3QNYB 4K55A 3T3PE 1T66C 3UMTA 3MRKA 1F4AA 3DX1A 2AK1L 2GQHA 4F3FA 3HUJB 1KXTB 3VWJB 1OAUL 4DZBB 1DQML 4W4NA 1KSRA 2Y6SD 4U7MA 1JHTB 4TTDD 4PJXA 1CFSB 4Z7OF 2D3VA 2DIBA 1MCPL 4XAWL 3BHBB 3ARFA 4OLZH 4PJCE 5E9DA 1ZT1B 4AZIA 1MJ7L 4P5TA 1QRKA 3MLRL 1JN6A 2X4TA 3P0VL 2YBUA 3MUGB 4Z78A 1CLZL 1E72M 3C9NA 5C0CD 1F4HA 3MGTA 4RWHA 5GNXA 5EU5B 3OKEB 3P0GB 2ZWZA 4HFUH 5BCAA 5IHZB 5IMLB 2H32B 4GPNA 2P42B 3CFJA 4BQ8A 1WVZA 3EJJX 1CFVL 2VN4A 3GM0A 2QF8A 3VFSB 1QW8A 1AFVL 2E8YA 1DL7L 1NC2D 5K93A 3K2UH 4P4KC 1E27A 2HISA 1TCRB 3VSTA 1G7LB 4K7FA 4YHYC 4LVOB 3EW3B 1QSVA 4KQ4H 1IT0A 2FECL 2JIXA 5J89A 1QPPA 3VNYA 4HJJL 4OLWL 5EO0B 3EMZA 3GDBA 4MX7A 3P0YH 4HGMA 3VUPA 1EEZA 4P0DA 5E2VH 1IMHC 4JPWL 1AGCA 5HGAA 1AGDA 5D7SL 1ZSDB 3D52A 2DEPA 3EO0A 4X9IA 4M1DH 5EZJA 3AY4A 3JTSB 4F79A 3L7FB 2WBJB 4YHKH 2GSJA 2AXGB 4J7RA 4NNYB 2EYRB 2ZCKL 3LCYA 5EUOE 1R8LA 3C6LA 3UERA 4U6XB 1DVFC 1YEEL 3HRPA 3DVIA 4XNYL 2R4RH 3V0AC 1QO3A 3TNMB 1GSMA 3VRIB 2XN2A 3ZM8A 3RX8A 1X5XA 3BGAA 1YY8A 1KWKA 4JFED 2VAAB 4PJ7B 5EBWB 5CEYA 2QADD 4KRTA 2WP3O 2LQRA 3K4DA 4QHMA 5IQ7H 1XD1A 2ZKHH 4EUPB 2E7CA 2VCBA 1Z32X 1NARA 3GMLA 4XPFL 2GJ6E 5E7FA 2J8UE 3TYGH 3HE6A 1ED3B 1MLBA 3TYFA 5C0GA 4J4PD 1QQDA 3QG6B 1KIPB 1U2HA 3DO7A 4PJBE 3MV9E 1DANT 3GZKA 1LE9A 3WYRA 3O2DA 2VL5A 4JM2F 2WQ8A 4LPCA 2V3EA 1NKOA 2IPTH 2WAGA 1E4JA 4FABL 4ONHA 2V3DA 4P2RB 1F6AA 3T3MF 3TO4A 1OAKH 4EUPG 4Y4KB 3U82B 1ZHBA 4U6YA 4ZPVB 2P8MA 1A9BA 1LP9B 1OGAB 1IT9L 2DSVA 2EC9T 5EULV 5EZIL 1R3HA 4GQ9L 2BSSB 4C7GA 1EXUA 4KJYA 5I8EB 4H26A 1W8NA 5FO9B 3SO3C 4FQ1H 4QRRA 3IDIA 2ERJB 3WENA 1BP3B 1RZKL 3Q5TA 3SDDB 5L7XH 3WY4A 1YJDH 4KK6D 5DD6B 4TXEA 3LRKA 2BMKB 3E8UL 4MHHG 2DH3A 5GS1B 2DWDB 4Y2OA 5JW4R 4MLIA 1BOYA 1KB5H 4BSJA 4B16A 1PFCA 2CKBB 4OB5L 5GGUB 4RSVA 1UR2A 1MAML 5JQHC 3N85L 1YNLH 3QOMA 4D2NA 1FE8H 3LN9A 1RZ8B 3QPXL 3FHQA 1QNPA 3VG9C 4OCRL 3B9EA 1F4YL 2HLFC 3FTGA 3NFNB 3MBEC 4HUXB 5A16A 3MOBL 4NQDB 4PSRA 4M00A 4XX6A 1KOAA 3QNZA 4HA1A 3VKKA 5E4EC 1TR1A 3QDGA 3W0WB 3MUJA 3OGCA 3L5HA 4K3JL 3WIHH 5B3JE 1B1YA 4QRQB 3PABA 1WBZB 3UYRH 2G3JA 2B1HL 1H3PH 1KJ2B 2Q7NA 1OBAA 3RZCB 2XTJD 2O9OA 3OGVA 1I9IL 4O4YL 3VCLB 1T04A 2VSCA 2UY2A 3TZVD 4UB0H 3VH8B 3EMCA 4ZXOA 1X7QB 5FUCC 1Z9MA 3TO2B 1ISWA 3UETA 1S7WB 4NZUH 5FUZL 1EEYB 2ZUXA 2QQNH 4LKXB 3ZKND 1KPRA 5INCA 3NCCB 4JY6A 4I0PD 1OM0A 4D6DA 2HA1A 3V7MA 5A2BA 1Z0NA 1FNLA 1K85A 1GVYA 4BSWB 3O3EB 1HJVA 2WMKA 2PYED 4Y8DC 4XC3H 2HT3C 4Z95L 2IEPA 3RAJH 3VXTA 4FN0A 4LQ1A 4LASL 3PNWA 5DQ9A 5D1XD 1NFDB 2VLJD 5IB5B 3VH8G 4LCYA 5EBMA 4CMHC 1FO0A 4P23D 1OSPH 5IJVA 4XXCC 3GSWA 5AYUH 4ZAKA 1N0XL 4HS8L 3DXAE 1NAML 3FXYA 1GAFL 2WUCH 3O9WD 1JYWA 3CC5A 2Q8BH 3VSUA 4M61B 3N1MC 4JFUA 2AK4B 3TN0C 4X8JB 3EYOA 3LXCA 5TF1H 5CD3A 1CFTB 5EFIB 4R96B 4HLZG 3P40A 3T2NH 3TZVA 1LO3H 5ID1A 1ZWIB 2YPVH 2DM3A 2RR3A 1FNFA 5HXMA 1RJZA 3Q6FA 3ARUA 4LCIH 5F21B 1QI4A 3JWOL 3ROLA 3MS8A 3B3IA 1XIWA 4JO1L 4U6HB 3IFLH 3F7YA 3FCTA 5F1IA 1F3RB 3HI5H 2NY1D 5INDA 4C56D 1E71M 1Q6FA 2APXA 5TGBA 4XVSL 3TA3C 5DFAA 1EHAA 3MA9L 2WK2A 4LVEA 4NWTH 5SX5H 1GZPA 2WW5A 3PUCA 2BVOB 5BV7L 3G5XB 2HKHL 3DV6B 3VI4E 1YEFH 2VLJA 4NJAH 1XF3A 4BFBD 4TUKH 4P2QA 5I16A 2CBUA 1S7VB 4ZFFA 5CD5C 1H5BB 1NC4D 5HYQB 4UT9H 2BY3A 5GGSB 2W0FA 3KYNB 4HK0B 4NYLB 5HPOA 1T89A 2JK5A 2F19L 5DRNB 3MODH 3NCBB 4RMUA 5EU4B 1LJYA 3IU4L 4ZUWA 2AS5M 4FTVE 4QTIH 3ZYZA 1BYBA 2VLKB 3VXRA 4J23A 1EOKA 3A0OA 2J75A 3CD4A 3VIGA 4OT1H 3VXPA 3HMXA 3WUWB 4NDMB 5D1QB 2DLTA 4NJ9L 2FIKB 2XZQL 1ZA3B 3BUPA 5BQ7B 1QX1A 2BDNL 3FB8B 4BFIB 3GNML 3V6BR 5D2LF 4NXKA 1CXKA 4L8SB 35C8H 3PP4H 3WUGA 3HNVH 4Z5RB 1UKOA 5I8KH 1OINA 5AWNL 3PN8A 3WLWC 2WMJA 1KJ3H 2QLYA 3QDJA 3KWWA 4HOZA 1EO8L 2EYTA 4Q9QL 5TFSH 1G9NL 2JJTA 1HJWA 4U3CA 3QUXC 4XB8A 1OPGL 4MCZB 1NFIA 2OZ4H 4OQTA 3SGEH 5IVXB 3WUWG 2DT1A 4JEGB 3HN3A 3T0EC 1XFPA 1CLXA 1LVEA 2IGFH 1MWAB 1MQKL 1QLEH 2ZUWA 5EUKA 4P7LA 1HH6B 2CKRA 1NUDA 4G9FB 4C56E 2AQ3A 3LPFA 5BO1H 4OZ4A 3O6FC 2AXHA 4BQ3A 5E4IA 3MV8B 4MA7L 4UT7H 5DHVB 1OW0A 5DGQA 3VIIA 1FVEA 3HR6A 4I9WE 3PTQA 1XEDA 4Y2DA 3MNWB 1G6RB 1KV3A 1MCBA 4JG1L 2OL3L 5CGYD 3WLBB 3QIBB 1MYRA 7TAAA 1KF9B 1SEBB 3APGA 1O6IA 1CD9B 5FA4B 2EDEA 3H55A 2CLRB 4M8QB 4NRXB 2Z4QB 4YX2H 3MV7B 4CD7A 4HKJB 5DK0B 2DWEA 1T0MB 4S1QL 4F8XA 3A6BH 2ADFH 4ZD3L 2FX9L 1SYSB 3GI9H 4PRNB 5BJTA 5CAYB 4AL8L 1ISZA 3JSSA 1DEEB 3HPLB 3OL2A 4WI6A 2C4FT 3SPVB 2XNAA 2XPKA 1A6ZA 3V4PH 1UB5B 1HP4A 1INQA 1EFQA 4PJIE 1ZT7A 5E8NA 3NAAL 2FYYA 1DWFM 2KDGA 3KPOA 1FNEB 1QKZL 5CJQL 2J1KA 3GSXA 1SYTA 4KJPD 3B6SB 4F9JA 5EO9B 3SIMA 3ARDC 4D9LH 3T65B 2R0KL 1KCVL 3WNPA 1FG2A 3NN8A 2CLVB 1RQ5A 5AZEL 5IFAL 4AD2A 3BVNA 3RO8A 4FQHA 3DIFA 1MEXL 5IVXF 1CICB 1IM3A 4MJ5A 4MDIA 3FJTA 4GMSL 1CGTA 5D70H 4MA3A 4ZUUA 4PJ9A 1QPXA 1A4KB 4HZ8A 3OZ9H 1BREA 4V2CB 3AI0A 5IG7A 1OAZH 4UUJA 5HYSA 1LDPH 2DIJA 4LDLB 5GSVA 5KVDL 4XPBH 5GJTL 4Q6IA 4N9GB 4BH7B 5C0IB 4HKZA 3SCMB 1MLCA 3KHQA 1JYNA 1RZIB 2WW8A 1MY5A 4P5KA 4WO4C 2R56H 2JKXA 4WI7A 1WK0A 4AT6A 1HX0A 1ZS8B 2H1PL 1ORQB 3FT3B 1DBBL 1V7ML 4MD5A 3H7BB 1JE6A 4ZTOH 4CW1B 5I1IH 3V6FB 2G3MA 1HNYA 1WCBB 1WB0A 2B7DT 4PB9L 4K94L 1OWWA 4HU8A 4FQCL 4RFNB 5EH1A 3S34H 4L29A 5LGJB 3MUAA 4H88H 3SQBA 1U8IB 4OZIE 5TH2A 5E8EB 5ILTL 4FQJH 3FNDA 2QPSA 3MJ7B 2F5BH 1AR2A 3V5KB 1QSEB 3G5VB 5DJYB 3T0DA 4L4VD 4WTZA 2FX8L 3L3OB 5C92A 3RPIA 5CMAB 5HYJB 4HEPG 1U0QA 1XH3A 4M7JL 4X0NA 5T1LB 5FUOL 2AI0L 5CBEA 4NUGH 4UCFA 1P4BL 3EJZC 4R8WH 4XPTL 3WL9A 3QDHA 1UC6A 1VEOA 1YQVL 1UWSA 2YEZA 4WEBL 5BS0A 3OKMB 4J3WA 1G0XA 5LYRA 4GH7B 4NSKA 4W86A 5A6KA 2H8PB 4Y16D 4EI5B 3STLB 3UJIL 3ILPB 3T4YA 3ULUD 5C0AE 4YIQB 1RIUL 4OFIA 5TE4L 5I1DA 2HVKA 2X4RB 5F9DC 4PGBB 2HRLA 3D39D 3BVXA 1FVDB 3MRBB 5I30L 3S6CA 4XCFH 4NO0A 1MREH 2UY7A 5TQ0L 3HRZB 4OGAC 3MXWH 4N0FB 3O2WH 4TSBH 3VFGH 1U42A 1RURH 5LJYH 4OIAA 5FF6B 1RJYB 4FFVD 2R4SH 4PRAB 1FGNH 1VFMA 3MO1A 2VH5L 1IQWL 1R7OA 4NQED 1UASA 4OD1H 3BUDA 3LKOB 3LS5H 4K7PL 1N8ZB 3LN4A 4FQLH 1QACA 4GJTB 1VRXA 3AAZB 4O9HL 1T1WA 2BXYA 4LLUA 5EOTA 3WJLA 3WUFA 2CBJA 1X6LA 3ECBB 1FN4A 1ZANH 2KQMA 3IDXH 2W9DL 1PG7W 2DJ4A 3S9DB 1ERNA 3T1FA 4PJAE 4Y7EA 4EANA 3IU3B 3P2TA 4PGDA 4NKOB 3NTCH 5F7EL 1XT5A 1EHXA 1DANU 3NZ8A 1HN1A 1LLOA 4B41A 3I3DA 3M1BB 3FQTB 4H04A 4JFQB 2L7UA 4X5WA 5EIIA 1HCFX 1M53A 5FCUL 3VRJB 2VLMD 3UTTA 5BXTA 3WELA 4PY8J 1BJ8A 3MRLB 4WCYH 4DN4H 5F9OH 12E8L 3C5JB 5IBLC 4MAYC 5GS3A 3MCKA 1DE4B 3D2UA 3DVNA 3VIHA 4L4VE 5TE6H 2EC9U 2VI0A 3DVGA 2DQCH 1BD2D 5C09B 1MCWW 1BECA 3VGHA 2HJKB 3HG5A 3MJ8B 3UCRA 2XKUA 6FABL 1T5WB 4X4XB 1MW0A 4H8VA 5D7KE 2MOVA 1GOOA 2YBRB 5SX4I 2XIBA 1LDSA 1XYFA 1MH5A 1CBGA 3QEUB 2NX5B 5GISH 3HU7A 5B39A 5I75C 4A2LA 3VXSA 4KJWC 5M7QA 1P7QA 4YFDB 5DK3A 5DTFA 2ZP0T 3ULUE 2F53A 2WC7A 5KSBA 2YIHA 4LPYA 3LKNA 2YBTA 4N8VA 5FM5O 3D39E 3HS0B 1DBAL 5GGRY 3VTRA 2JELL 2VWEE 2OJZL 3O45A 1XCXA 1Q72H 4I18B 4LFHD 5BMFH 3ULUL 5AAWA 1P7KA 5IKCA 1TZGL 2D9QB 4H25B 1V0LA 5TDPB 3MLWH 3NOIA 4I8DA 1QEWA 4WHTA 5E0CA 4XNZC 4YDKH 1LWJA 4MVBD 5KS9F 3MR9A 2C0HA 4YNYB 4MNQD 4KHXH 2F54A 5DRZB 1FC2D 5GRUL 3CH1B 5CUSH 3RKDC 4NQEE 5D8JL 3BP5A 3LXBA 1E5JA 5IB1A 1YMMB 4Z0BH 4HWEL 2YPLB 3N9GH 1P6WA 3V52L 3KL5A 3PP3H 1HILB 1PKOA 3GMOA 3ARSA 1W72H 1JFQH 4JN1H 1JGEB 1CDGA 1Q9OA 3PWPB 1A1MB 4MZ3A 2VLRE 3QFDA 5I66A 2KH2B 3L1OL 4TVDA 3FQNB 5C07D 1KELL 2X4OB 4NQXB 3V79C 2HKFL 1V6XA 5I0DA 3WS6A 5DMGC 3CSYB 2DL9A 3QHZL 3KAAA 3GTNA 1KLUA 3KPMB 2A77H 3STZA 3RWHB 1CD0A 4R2GB 3LEVL 1J86A 3UPRA 3W2DH 3ESUF 1N4XL 2VLME 3DTXA 2APBA 3WH5A 5DI8B 3HR5A 4U3AA 1W0YT 2EEDA 4YHZL 5LG1A 3VFRA 2R2HB 3BH8A 4GRWE 5JZ7C 1AI1L 1KB9K 3EO1B 2OW6A 1BD2E 4RCAA 3HE7B 5HHPB 1LD9A 4E0RA 2PWGA 4F9PC 4JB9H 4A4AA 4R90L 4PREA 3MFFB 2PNDA 4XCYA 1JPFB 3O3DA 1A6AA 1T66D 4L3EE 1TNMA 4J6RL 1NP2A 5CJ5A 3DX6A 4WIWA 4J2XA 5GRVL 4PTUB 1XH1A 4X6DE 1BGXH 5EA0H 3ZKXB 3H8NA 1J0KA 2ZX8A 1AXSA 2XN9A 1BPVA 4ZXBA 4RAVA 4Y4HD 1NCUA 4D6HA 4JFPB 4U6VL 5IOPA 3M45A 4PBWD 4AQ1B 4A6YB 2GK1B 3PJSA 1GHSA 1ZOXA 2DSUA 1TZHB 2Z8VC 1N7ML 3BEVB 2GCYA 2RIKA 3UYOD 4ALAL 5ISZA 5KW9L 4WUUB 3OJDB 1DP0A 3B2UC 2R2CA 4MNQE 2DYPB 1U8OA 4Q2ZB 2J8GA 1DLHA 2W60A 2AJ3B 2PTUA 1RK0B 2G60L 3WXVH 3DC0A 1YEJL 1MJJB 3A6CH 2NYYC 1H8NA 4C83A 4Y5XC 2PW2B 3CUHA 3FQUB 3MA7A 1H0IA 3HLAA 4P4KD 1T4KA 4LU5L 3UPCA 1R87A 5CIPB 5C07E 1HOCB 1FHLA 3W9EA 4IRSA 2Q1EA 5CFHA 1T7WA 5J13B 4NSBA 4I48A 4M7KH 3AFBA 5EORH 2I9LB 2QKIB 3QUYC 1EZVY 1GIGL 3EOTH 4DM1A 4YDVA 3CDGB 5I1CL 3IFOA 5IIEA 3LQZA 4WDIA 2XQBH 3IAPA 4PRIE 5F7KC 3VRLF 5GS0H 3QUZB 3RDKA 1RMFH 2ATKA 3IDMA 4OBSA 2X89D 2VN7A 3BKCL 3X3GL 2B39A 4HIHB 1GZQA 4P3DB 1I7TA 1DVFD 3DOSA 3IS0X 3QIWB 4KK9C 4IJ3C 4PLKC 4PEEA 4X6CF 1SY6A 4JG0H 5ESVB 1AMYA 2EC8A 2Q6WB 4HPHA 2VDRH 5GGRA 2CJUH 3SO5A 3NDZA 2JJVA 4GG6E 2NY0B 3BIKA 3W25A 4FQIL 5DT1H 5F6HI 2LTQB 1KCUL 1WZ1L 4YDIL 5C0FA 2DAVA 2YL5A 1JPTH 5IGXL 1AJ7H 1H09A 1F2XK 3ES6B 5JXEC 4UFIA 1KENH 3V5HA 5ICYB 1U8JB 1KEGL 3FB5A 4BSVB 3CDYA 4DTGL 4FOMA 3UESA 4PJHE 4OLUL 1F6LL 4QOKD 4Z7VB 3O2LA 3DRTA 4O00A 4ESKA 1B4JL 1U41A 1FRGH 5IUSA 4I5BB 2P5EB 1UYWH 3MLZH 1HIZA 4QCEA 4JVUA 4XVTH 1T2QH 3NCJH 5DF0A 5HI3C 3U83A 3HC0B 2R8SL 4HPOL 2A9NH 3O3UN 3VXOB 3Q1SL 4WW1A 3SDXE 2X7LB 2J7BA 5B8CC 3ALXA 3UC0L 3OAZK 2DN7A 1TMCB 1GOMA 5C2BL 1KBGL 4GUPA 1L7TL 3I6LE 3IVKB 3RY6A 3CMOL 2N7AA 1VFBB 2ZOKB 3H6JA 4ZG1A 4BFEA 4GG8B 4HT1H 3P77B 4I0CC 4XP5H 5A2LH 3REVB 1AHWC 4DOHE 2EACA 5F3HB 2BHZA 2X2YA 4S1SH 5JUEL 1H3VA 1FORL 3GK8L 1A14L 3BPLB 1T0PB 4APQA 4Z77A 1J05B 2YA1A 3FO9A 5IFHL 4WTWA 1VPOH 4ODUB 3TVMC 4QLKA 1WAAA 4QXGL 4HXBL 1OB1A 4J1UA 3VD3A 1EMTL 2ICWB 1MFEH 2LV4A 3S98A 4DKDC 2PO6C 4LSSL 3MZTA 4RGMC 4L4TB 5E2WL 2FEDC 1MCWM 1FP8A 3RWEA 3ZDZF 3ARGA 4IDJH 2NMSA 1GH7A 3P4OA 4GBXD 4N0UB 4RNRB 3WFZA 5A2CA 1AKJD 2IAND 5I19L 4KKAC 2HLFD 3MBED 4MD4A 5EC1B 3BGFC 3WFHA 1WFUA 4AD3A 4Q0XH 1B31A 1HZHL 1L6XA 3BKMH 4XP4L 3RVVC 5FDYA 1QRNE 3F7PC 3AIBA 1PW3A 5HNNA 3C60B 2NW0A 5IMMA 2J8OA 3AIRA 5JBFA 3O41A 2UUDK 2X70B 4DK3A 4BF7A 5D6DC 3MRCB 3L3DA 4TQEL 4JZ5A 1SFSA 3D3VD 4LP5A 3LVEA 1A0QH 4X7TB 4V1DB 2ZUVA 4BQ4A 1FZMB 3VDAA 4LF3A 2F1AA 2PTVA 5A8QA 4NN6C 5T1DH 2CESA 1FZKA 1XGUB 2IFGA 4Z7VF 3AS3A 3U4BL 1QWUA 2CIIB 1BVZA 2DTML 3F7VB 1S9XB 1NCBH 2JALA 3WD0A 3LV3B 4HKBB 1LK2B 4FS0A 5FHAL 3SBWC 5D9SA 3VI3E 1BFSA 1FL5A 2GVYA 2HT3D 4JZNB 2DLIA 3QISA 3LEYL 2BNRA 3V7AG 1US2A 5LAXA 2VDMH 3ALWA 3O4LD 2XFRA 1MJ8L 3QUKB 1G0CA 4R4BB 1E6JL 1IKFH 2IANA 2P7TB 1IEAA 5E6IA 1SBSL 4Z7UE 1DZBA 1QBMH 2A6IA 2D0FA 3W5NA 4RX4D 4XNQA 5J6GB 1E6QM 1ZAGA 2Q7YA 5I1LB 4PGEB 3CZKA 4M7LT 3AIUA 4Y7MA 4FFZH 5EIVA 3U46B 2YLAA 3K80A 3MANA 2WMFA 3BKYH 2VCAA 3HB3C 3KJ4B 7FABL 5J12C 1NWUA 4WKFA 3BSHA 3MRFA 3TN0D 4HAGA 2BFVL 2B5IC 5ETUA 3OLDA 1VBUA 4MQTB 2ZUTA 4PD4J 2WHLA 3V0VA 1CD8A 1J1XH 1JPGA 3WFCH 3SE4C 1RK1B 5HDRA 1WIUA 5DO2C 2O5XH 2YWYA 5H2BA 4PMQA 2E8ZA 2G9HA 2W65A 5IB3A 3LZFL 1FYTB 2P47B 3JV4A 4JKLA 1LNUB 4EN3A 3X17A 5HI5C 1T03H 5JNYA 2AAAA 3TA3D 2J88L 3TIDB 4FNSA 2J77A 3H9HB 1BX2A 1T7VA 4Y1AB 2C1OA 4A3YA 3C09C 2NY3C 3PWJB 2FATH 1RV6X 5CD5D 1F90L 2YJQA 3D3VE 2UYLA 4B15A 2ESVD 5HYIA 3JWDH 1PQZB 5FUCE 4LCCB 3DUHA 3F65A 3FOMA 2CK2A 2YWZA 3DX2A 3RP1A 1T6WA 3RIAK 2FGZA 1BQUA 1SQ2N 2X1WL 3SCRA 1U8MA 4LLWA 3VFUA 1DUZB 4JJ5A 3F7QA 1CE6B 1TVBB 2IH1A 1QFWI 1ND0A 1FL6A 5I71C 5MERA 2E40A 4HWNA 4H1LA 3DDFA 2HMIC 1G0YR 4KKLC 4NFDA 4LSQL 5FGCE 5HHOD 5K9OA 3OBAA 4PBXA 1R5VA 4YBLC 4UDUB 3WQ4A 2DLHA 5JO5A 3RU8L 4AC1X 3WO4C 1CXFA 4BJLA 2GSIB 3UYPA 4PTTB 4LQFH 3S4SB 4PBGA 3RKPA 1J8HB 4PPTA 5CJOH 4JZOA 4AW7A 3AC0A 2UZIL 3CVHH 5FA3B 4KZEL 3WLWD 5FCZA 1NAKH 3FONB 5BRZB 1UOKA 4AG4L 3WIIL 2OP4H 4TOYL 4F9LC 2XSBA 4YZFE 3QUXD 4KRMB 4WUKL 4M4RA 3U9PL 3X3FH 1HXKA 4D6IA 3HI6H 2ICWI 4NP4H 3L4TA 3T0ED 5SWZE 4YPJA 1MVUB 4UQ2B 3LIZL 3K7UA 5FO8A 4U1GB 4QO1A 3D18B 3RUGF 5EC2B 2O61A 4OLYL 3GSNL 1IRAY 1RZGB 2YUVA 3S4SG 4ZUSB 4W6YB 2Q76B 3MRPB 2K7QA 1OARL 1NKRA 4OZHB 3I6GA 1RIVH 4TRPL 4UFMA 3O6FD 3RJDA 4XH2A 1YEDB 3BSZL 3X11B 2EXOA 3S36H 2DQIL 4OD2A 3WFEL 3FQRA 1HSAB 4NQVA 5FGBC 2VDNH 3LS4H 1K9TA 3TPUB 1KACB 4HHAA 1RSFA 3MNZA 4HTYA 3QJFA 1U8LB 1A6PA 3AB0C 1HINH 4Y4FC 3L4VA 4OUEA 3AM8C 1UQSB 4G8GE 2HJLB 5M94B 4JHOA 4PJCB 3U4EA 3D3AA 2I5YL 4X0VA 2CDFA 4D72A 3SCTA 2XGIA 4LRIC 4P2OD 4H8HA 1LK3H 15C8L 4FG6C 1CZ8H 1KTLB 2ORBH 3CFBB 1TVPA 5E2UL 3JXAA 3ULVH 1IM9D 1IV8A 1OD0A 3V2AR 2WWDA 1CLOH 1N3NA 5HHOE 3RWJB 1EFXA 3EYVA 2CDEB 5D4YA 4Q9BA 1J11A 2G75A 2OJEA 2ICES 3OKNA 4LSRL 3WKMH 1E0XA 4NZJA 3U0TB 3P11L 3EFFA 2ARJB 1EGJL 3BMVA 3EDKA 3D51A 3HMCA 5GNYA 1FDLH 4W89A 3SDCC 1BG4A 4U1IA 1BWMA 5E9AA 4Q97A 4KVNH 3T77A 4XBEH 3ARDD 1QFUH 1JGLH 1X5IA 4WKAA 2X4TB 4AEHH 4B7IA 3C5SA 1FGVL 3GO1H 4GO8A 4G8IB 1BFTA 5J06A 4WFGE 1HIML 3A21A 3RDTB 5EUOA 1SM3L 2AJZA 3WJJA 5JA8B 1P6FA 3GHBH 3MJ9L 3QA3A 1Q94B 4CADA 3F5WA 3MJ6A 4ZNCD 4UT6H 3TBWA 4HBQA 3BAEL 2P46B 2G41A 1OT1A 4MA1C 3WN5C 5IHRA 1ZT4B 3FT2B 2WYSA 3MRJA 1AD9A 4WO4D 1IAOB 4QHLB 4LLYA 5E56A 2IH3A 4NUJB 4ATWA 3SHSA 4IISA 1HTYA 2MKLC 3CSBA 4M29A 1GXEA 3BW9A 3OKYA 2YSSA 1A2YB 1OAYH 3D0VA 3WUBA 4IHOA 4BQBA 1H3GA 5JR1H 3ARQA 1N5AB 2GJ6A 2X4SA 1H15B 4R3SB 5FYJU 5IWLA 1C12B 3S35H 4URTB 3DHPA 3N12A 1U91B 1DN0B 2J8UB 2VABA 4GI8A 3MV9A 1OOAA 1NMCC 4UMGA 3QXAA 4PJBB 4XGZA 1D6EA 4PB0L 4M1GH 1CQKA 5DFWH 5T3XH 5TQ2L 1BLNB 1XGYL 4I1NB 1UGNA 4X6FB 5MEQA 1C8QA 5EO1B 3DX9A 3EJZD 3OGOE 5C0CB 1LO4L 1XF1A 3PZ9A 2NW2B 4G43A 1C93A 3IJHA 2R0WL 5D2NC 2LU4A 5JIKA 4UNTA 1MVYA 3T4AB 1XGTA 4CBPA 3AFLA 3NCMA 3KLAA 4WEUD 4GINA 3ZL4L 4GOSA 5F7LB 4M43H 1MFBL 5A2FA 1NC2B 1TE1A 3AHVA 4JFOB 4NI3A 1ZHKB 4WO4A 4YE4L 2N1KA 1WJ3A 4OGAD 1KT2A 4QY8B 1K3IA 3FB6B 1IAIH 1FPTH 4LSUL 1R5WA 4Y89A 5CJXA 4ODWA 4NCC2 4PJFE 2HWZH 2Y72A 3QDMD 1U8NB 4HZAA 1HDMA 2V17H 2PB1A 3L3KA 4N8CH 4CMMB 4J8RB 4BZYA 2DDQH 3CX5J 2P8MB 4KTEH 4WI3A 5DA0B 4FMFA 3MRMA 4AIZA 5C9KA 1CGXA 1K5NA 4KJYB 1NL0H 3PIQB 3QCVH 2J5LC 1RH9A 1C5CH 4JFEB 2R23A 4ZUVA 2QADB 2N7BA 4OLZL 3WIFB 5I76B 1UXSA 2XZCH 4OCXH 1IGJB 5GRYA 3HC3L 3SKOB 2G2RA 2LFGA 3QOKA 1V6WA 1UD8A 3BI9X 3VFTB 4OFVA 1N2RB 1T1YA 3O3BA 4N8PA 5I77A 3WQ5A 1S5HB 4P9ML 5IBLD 4MAYD 3PHAA 3QEHB 2KZ1B 3NDYA 1NUGA 3ZTJG 4PG9B 4PRHD 1PVHA 3FTGB 4TTUA 3K2UL 2NR6C 3P4NA 4WI9A 5ANMB 4IIQC 2FBJL 4AYSA 3QNZB 3CGTA 3DECA 1R46A 1DJSA 1YEIH 2ZUSA 2DQFA 1JNLL 4KJWD 3P0YL 3M46A 5F8RC 4IEFB 1NAMB 5E2VL 1I9JL 5SWSE 5T3ZH 1UD5A 2WUBL 1UT9A 1TQBC 3POHA 4GSDL 3DXAA 3MACL 4OIFA 4FMKA 5DQDH 3IJ8A 4UAOB 5T1KD 4YHKL 5DJZB 5JTWA 4OZFA 2AOSA 3RL1A 1F3JA 2Y2WA 1F2QA 5BZWB 4I4WA 4QWWC 5AD0A 3ORJA 1KPRB 3C2SA 5D6CA 5AAMA 2GTZA 3VW3H 3LX9A 2ADJA 2FR4B 2R15A 3BP4A 2JCCE 1JWUB 3RKDD 3TJEH 2CKSA 3DSFH 3L2LA 1EH9A 3EDFA 1VF8A 2E6QA 3O0RH 3C5ZC 1S3KH 3CZSA 1N64L 4NO5A 2C1PA 4CJ1A 5T5NF 5D72H 5GIRA 3ZE1E 5KTEH 5DJ2B 2DMBA 2O5YL 4IM4A 5DHYA 3TYGL 2VDKL 4JPIB 3QB7C 1BAFL 4HIEA 5DMGD 4L8BA 3QFJE 4YWGL 4ZUTA 4GQRA 1W0WA 4RRPA 1QI5A 5CXPA 1KB5A 3VFPB 3OR7A 2OMNA 3HZMA 1G7IA 1NM9A 1VDGA 1MNUH 3BOVA 4QDMA 1J0YA 2IPTL 2XTJB 2BVEA 3H2WA 3E6HB 1P2CA 1J01A 4MNMA 2YA2A 4EZMA 4D3CH 3TZVB 1G7JA 4E41E 2X4NA 1WNOA 1OAKL 4YR6A 1HSBB 5F89B 2EDHA 5JZ7D 5CHNB 3F58H 2EYSA 3BMWA 1YEHH 1HL8A 4ERSH 4FTVA 3HZYA 1DDHA 5ID0B 2TAAA 5HDQH 1F11B 1MCOH 3F7YB 3FCTB 3WV0A 4I0PB 5J1TC 4L9LA 1U8PB 3O9NA 5C0RH 5E8PB 5TGBB 3CSPA 4FQ2L 5L7XL 2J7CA 3NUKA 4C7DA 2PYEB 2V5YA 4L3CA 5IESH 3AHYA 5DR5L 1GZPB 5E03A 4Z7QE 1BF8A 3AS0A 2BOCB 4MMZC 5D1XB 4AD0A 3GZAA 2VLJB 2VZSA 4FHBD 2I60H 1Q9KA 4P23B 2DQJL 1R5IB 3WNNA 4U5KA 1D6VL 3HG3A 1GORA 3MLYH 2W0FB 5ABEA 1CFQB 4OCWL 1ZVSA 1BVKA 5H35A 1M6OA 2E7HA 4X98B 4PCSA 1L7IH 1FE8L 3BO8A 5CZXC 1Z3GH 1I4FB 1XCQB 3O9WB 3AGVA 2GJRA 4D0BB 1IC7H 3L9RB 5EZOL 5AG8A 2X0YA 1P1ZA 2BNQA 3UCQA 1NGWA 4PJGA 4XNUH 1XZ0B 4JR9L 5DK2A 4OTXL 1MFDH 3BT2H 1AQKH 4Y5VA 1QNOA 4NNPL 1U93B 3WIHL 2VE6B 3F6LA 3MYJA 3JWDC 3WCYA 1UWEL 1T80A 2NYYD 2P5WE