1CGXA

Site directed mutations of the active site residue tyrosine 195 of cyclodextrin glyxosyltransferase from bacillus circulans strain 251 affecting activity and product specificity
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLLDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Site-directed mutations in tyrosine 195 of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 affect activity and product specificity.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
total genus 235
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1994-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgxA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgxA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cgxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cgxA01
2H8PB 4X9FA 4HWNA 5F6HI 1A3RL 1F3RB 4ZSOE 5HDRA 1A4KA 1A7RL 4OKVA 5IOPA 1G1YA 5FDWA 4AIUA 3TWCL 5D71L 1N7MH 1LNUA 3EJUA 1CLXA 3LN9A 3P11H 2FL5B 2W92A 4DGYL 1S7XB 1KB3A 3G9AB 2Z31C 5SWZD 4YZFE 3ULVH 1DEDA 1FH5L 3FRUB 5F9OL 1E6JL 3DYMA 4XNZC 3IFOA 1CFVL 3DVGA 5D1XC 1MCFA 1E6RA 1I1AA 4LBEB 4P59L 1FSKB 3WHE1 3TPUA 4HA4A 1WZLA 1Y6NR 1J0HA 1NMBL 3DOSA 3FKUS 3WBAA 4DWSD 4I3GA 3FQWA 4KDVA 3VWKC 4LHUD 2BVOA 4FMKA 3P0GB 2QKIB 5ELIA 2OW7A 2J4GA 3RVUD 5EOQL 3MRGA 1CGVA 5GS0L 4DTGL 3TESA 1BECA 4Y4HC 5J11C 3OKOB 5ETUB 3EIFA 3Q6GH 3DNKA 2VABA 4RA0C 5T3XL 1UYQA 3O6AA 3V7AE 5FDWB 2QV4A 2XFXA 2X4UB 2UVFA 4GW5B 5E95B 3TNMB 2NX5A 2MCG1 4QNPE 3BLBA 2ZZUT 3VFSA 5F88A 4P7OA 1QP1A 1NBZB 4X9IA 3UZEA 4BQ4A 1M05A 5E8DH 3W0KA 1MRDL 5DZLA 4DEPC 1G94A 3PZ9A 5D7JB 4RIRA 5DJXA 1LO3L 5C0BD 3MJ7B 3TV3H 1OIMA 5HGHA 1T6VN 1J05B 1DR9A 3UTSE 2R2BA 3UTOA 1WITA 4PMRA 4WSKA 5KW9L 3LPOA 1NAML 4KVNH 3L5WB 3X3FL 1GORA 1QYGH 4YHKH 5GS3A 3WD1A 2A9MH 2DLHA 1HJVA 1QSEB 4X4ME 3RP1A 2AVGA 5EPMB 3ILQC 4Q0XH 4X5XB 4RISH 4WI6A 3ZTJG 1J8KA 1WBYB 3E6HA 5CEXB 4X98B 3HPJA 4KKCC 4PLJC 4HUVA 1W91A 1YEIL 1V02A 5K59F 4XNYL 4HBQA 1X4YA 4YIQB 1T5WA 4NC1C 5C0AE 3BMWA 2VZ3A 5CUSH 1JWUB 1GVIA 3HG3A 3M46A 2JJTC 3MACL 1F4XH 4MWFA 5J12B 3MV7D 4WFGE 5JUVA 1PEWA 1F90L 3ARUA 3UXFA 1HILB 4NSBA 1QBLH 3V4UH 3VRLF 2G60L 2DD8L 1IE5A 3WSQH 4OZOA 4S1DD 4DKFL 3CZFA 3IDMB 4X7TA 3L3GA 4GRWB 5TDPB 3RBGA 1Z5LB 3TH4T 4I77H 4Y16B 5BOPA 5CIPB 2J75A 2ZUNA 1OB1B 4G9FE 3BAEH 4M48H 5JHDD 5H8DA 2FATL 5JBDA 2YPKA 2VDOH 3PNWA 1OP3K 3TT1H 5EU3B 2ESVA 2P43B 2IH3B 1T5WB 2XG9A 1HYSC 1TG7A 4D6JA 4ELMB 4UUJB 4WCYH 5T1LD 5HI4D 1T7VA 3GNPA 3U7AA 1U0QA 3EYQD 4OGYH 3S7GA 4AT6A 5SWQB 4AZ5A 2R0WL 3SE9L 1NGXA 4L9LA 2BNQD 4D6CA 5MEOA 1XF1A 1Z2KA 2FH8A 4OZ4A 3IETA 5F9WC 4JFSA 3KR3L 5CD3A 1E4JA 2WBGA 1JPSH 3JWDC 4WW2C 5KANG 4XH2A 3IGAB 1JJUA 4QTIH 1LO2L 3E8UL 2VLKA 4BA8A 3NSNA 4ENED 4PJIB 5DEFA 3MROA 4D0CA 2HG5A 1PZ5A 5D1QC 4XXDB 5C0CA 1QSFD 2VAAB 4LCCA 4BS0A 2CETA 4W6XB 3ULUC 3TO4B 1H4PA 3OA5A 1C08B 1U8LB 1UR9A 5F9JB 2YPLE 1BQHG 5GPRA 4MXQC 3EOBB 2EYSB 4PRWA 3Q5TA 4UQ3A 4ODSL 4TUJB 3W4RA 1RMFL 4PJ5E 2B8OT 4N5UA 2QSTA 5LGHL 1SBSH 1W3JA 4X4XA 1NSNL 5ABFB 3ILQD 2WBJB 1WF5A 5FM8A 5ABEA 3QFJE 1UWGH 2XA8L 1T20A 1MCWW 5TDOA 4EKXA 5ENWA 3TV8A 3F5JA 2XN0A 3EJQA 5D7LE 4HUUA 4WU7B 5BXSA 1DSFL 4KK8C 4U7MA 1V3HA 4PV8B 1GONA 5KSAC 3QXDB 1V0NA 1KB5L 1ZWIB 1IL1B 1F97A 1F4HA 1F2XK 4E5XB 1TJIL 1BAGA 2D7QA 2EQDA 1MAKA 4KRLB 1CDYA 1NFKA 3QXAA 1XV8A 3WQ6A 2W0FB 1N64H 3MNWA 5A6LA 5GHWL 3AHZA 3U4BH 3QXUA 4D3CL 3STZB 3KPTA 5LBSL 1VFOA 1UR4A 4M80A 1U8NB 3U30C 1JVKA 2VRAA 1OSPH 2WP3O 4NKOA 4QXTB 4TUKH 3GMMB 3RFZC 1MWAH 3D25B 1RZKH 3RL1B 4FQ2H 4JO4H 4H20H 3BLKA 3T0ED 4YHNA 5E2UH 4Q9QH 3VXTA 3HAEA 4TSCL 1BIIB 1MH5B 2CIPA 1N5AB 2ED8A 3AMLA 3OB8A 4PRHB 4GO9A 3I2CL 1S7RA 1OHQA 4WKFA 2BERA 5H94A 2DSZA 1FFOB 3GFUA 1T0MB 1YPZE 4LFHG 1A14L 3VX0A 2V38A 4JPIA 4PV8A 4WO4C 3BUIA 4F8TA 5I0ZA 2V3EA 3GB7A 4PJEA 3QQNA 2X4SB 5INCB 4C59B 3SURA 4JQVA 1C16A 3TPUB 3ULVE 4M6MH 5GSVA 3F6IA 3T0WA 1R3KB 2EDTA 3TIEB 4AQ1B 2ZUWA 4P46D 4PJCB 5K9JL 3JTTB 1V08A 5FKPA 5I17B 2PXYC 4JQIH 3ZKMD 1PKOA 1C1EL 1OGAE 5CCKH 4TSBL 3PGCA 1B2WH 4D94A 5BVPL 3RCNA 3LRKA 1EFQA 3S2CA 1Q0XL 3W24A 3HZKB 5GS1C 4WLCA 4NZTL 1XF2A 2C3HA 1A2YA 4XCYB 1US2A 3AMKA 4HSQA 2J47A 3MCKB 4ZXBD 3WUFA 3V0VA 1JV5A 3SDAA 2IQ9H 3PN8A 1NBZA 4N1CA 4NRYA 5DFVC 2BSRB 1MCPH 4M5ZL 4L4OA 1O7SA 1H41A 1OM3H 3ZDXE 3FMGH 1YEEL 2W38A 4MX7B 5IDIA 1PYWA 4FQLL 5D7KE 1RI8A 5F3HA 3RIFF 4FQQB 5C9JB 1A9EA 2JTDA 4YJZL 1CLZL 5E2TL 3D48R 3WN5A 3MMEA 4AZBA 4G7VH 4XWOD 3QIUA 1C8XA 3PZMA 3RVXD 1WVZA 1EMTL 2A6KA 5IFHH 3Q6FA 2FWOA 3CLWA 4PUBH 4WJ5A 4H1LB 1LWHA 3PDOB 1OD9A 1MCNA 3KWWB 3STLB 2F53D 5C0JA 3ULUL 4UUJA 2J5LC 4Y8AA 4Q97A 3H9SA 4JFVA 1MCCA 2J74A 4O58L 1ED3A 3QULA 3MLUL 3LRSB 3QJHA 4KKLC 3FZUD 1WO2A 1YY9C 1QI4A 4LCWE 3EHBC 5AAWA 5IBTL 1JHLL 4DVBA 5E2WL 2HKFH 5HI5D 4NNPL 3F58L 3PQYE 1SM3L 1PBYA 4FQIH 4KKBC 2A73B 4PUEA 5EZOL 5FYKE 4GG6F 2VRKA 3G5ZA 3SCNA 3VI4F 1FDLH 5F7NC 4MTVA 3CLFH 1O0VA 5DJ0A 4MAYA 5AZEL 1I9EA 4J7RA 4JHZA 1HIMH 3GSQA 3MRHB 1KEML 5DC0A 1U42A 3O0RL 4DKDC 4XNXH 1V6UA 3H53A 3FOLB 3N13A 2DGAA 3O8XD 1E4KC 3QUYB 4FFVD 4ELKB 4IISA 5I18H 2QR0A 3CLEH 1J1OH 3SDDD 3H0TB 1OPGH 1W1YA 5E8NA 4FFVC 1MELA 4OAWB 3FT3A 3QDHA 4NO0B 3WJLC 2P1YA 3ECBB 4G6FD 4R8WH 3OAYH 2J6EH 5F93C 3WXVH 5DJ8A 3T77B 4TSBH 1JL8A 1MFBH 3NFPB 4J3SA 1QSFA 4G43A 1XMWA 1R0AL 4DGYH 2ADIB 3SO3C 3DARA 1PFCA 5C0NC 1YNLH 3OMZA 4OTXL 4AEIH 1PIFA 1ORSA 2I27N 5ACMA 1CVSC 4QAWA 5TDOB 1LEGB 2BVTA 5CIPH 4RFEB 4W7WA 4YBLC 5LG1A 2CPCA 4NM8L 3B5TA 5AEAA 2J25A 2G8ZA 4X5WB 3KYOB 4G3YL 5FUZL 5HYSG 1CFSB 5C2BH 1QO3B 2X4RB 4DW2H 4U2ZA 4LSVL 4GBXA 1SJHA 2UV3A 2BY2A 3WD5H 5F1NA 4K8RD 3T65B 1T21A 3I6LE 2MCPL 3CZEA 4UINH 3CZKA 3TGXA 2ARJQ 4S3KA 1UZ8A 1XR9B 4Y1AA 3FFDB 5ALCH 2WSPA 1X5IA 2VDQH 3LV3B 3D2UB 3VRIB 3PWLA 5FGSA 1JE6A 2X09A 1B88A 3U57A 4IOIB 2V5TA 4W7VA 4K9EL 1QPXA 4NN6C 2X1WL 1B3JA 2AEPH 2JJUA 3H9YA 1ZTXL 3O45A 1MW0A 3PUCA 3KAAA 1Q9WB 3MXVL 1IEBB 4LEXH 3W5NA 1ZA6B 1KJ2B 1XRVA 3NIFE 1JPTL 2YSSB 3MNVB 1T1ZA 1GGYA 1IC5L 1U8KA 4CD8A 1QO3A 4MAUH 3QDGE 4HMEA 4OCLC 1HF6A 1R7OA 5DT7A 5CZVL 3WS3B 5I75B 4Z6AT 1XGPA 3P30L 3EYSH 3T0BA 3RZCD 4LDLB 4QRSB 4OM1L 1SYTA 4P23D 2NY4B 4JN2A 5I8KH 2B39A 2VX4A 4Y4FC 4N1HB 2FSEA 4X6DE 3B9KD 3B2UD 1GHFH 4FQ1L 4PP1C 2E4TA 5L8KB 4W7UA 3JTSA 2WPGA 5C08E 4YHMH 3ARSA 2P42B 1NCWH 3VH8A 4GH7B 4XVJL 3AVEA 4BFIB 2PXYB 3MUZ1 2WCAA 1V0LA 5IQ7H 5DMKA 1ONQA 4UV4L 3I3EA 3L5HA 2XJ7A 1JYWA 3KLLA 4TVPE 2HT3D 1TUXA 4Z5RB 2J7GA 2WB5A 3VXME 3RUGE 1FZKA 2QSCL 4JRXA 2AOSA 2ITDA 1H3XA 2VISB 4OLUL 1DQDL 3BIAX 2G9HA 4LYPA 3ILPA 1X5KA 3VXQA 4CVZB 3H8NA 3NCJH 4FTVD 1AJ7H 1ZHKB 1U30A 2J7FA 3HPJB 5A8NA 4S0TD 4M62H 1QBML 4OUEA 4HC1L 2QQNH 3UROR 1DEEB 5HVWA 5D6DC 1RZKC 3TZVD 4GFTB 4U6TA 3D0LB 1JFQH 5E2VH 4OGYL 5FV2A 2VMFA 2BC4B 4AIXA 1K9TA 5TF0A 2R0WH 3OGSA 4U3XA 4U3HA 5JDSB 1EPFA 3G08A 4YDKH 3VXRE 4X0NA 2FWOB 3TVMA 3DGCR 2WNGA 1J05A 2EDYA 1LWRA 1LHZA 3MXVH 1K85A 4LEXL 1JWMA 1CIUA 2P45B 1NGZB 3MUAA 2E9LA 4NKMB 3U36B 2R69H 4I3SL 1I85A 2QHRL 4YLQT 5F7FA 5IUSA 3B5GA 4XPGH 5D7IE 2IXVA 3TNMA 2VXSL 3TBTA 4BSWB 5A3ID 1IBGH 1AQDA 4CMHB 2KZWA 4XWGH 3CX5K 1XR9A 1G9EA 3S35X 3A6CH 3L5XH 1A2YB 2V3GA 2ZUYA 5CJBA 5GRZA 4MXWL 4AIEA 2X40A 2DT1A 2K9UA 2N56A 2AJZB 1SBBA 2EABA 1FIGH 2DM4A 2NPLX 1MYRA 1MREL 5DJAA 1PPIA 1QW9A 1C8YA 4F7PA 3G08B 1ISZA 3RJYA 2BNRA 5GS2H 1DE4A 4WWKB 2WWMC 1UWUA 1ZSDB 5IW6A 3BQUB 4J28A 5GZOD 1YN7A 1Q9LA 4GRMA 4GG6A 2CERA 2H9GB 5GZOC 2VOTA 1U8MA 4V1DD 1HHHA 1RJYA 1T0MA 5KW9H 5LGJA 1LEIA 2XA3A 1YEIH 3BP4B 4YNYB 1IAOB 2YA0A 3C5ZA 2Z93B 1AQDB 3RKDD 5C6PB 4V2BA 3Q48A 1PKQE 35C8H 3PWLB 3REWA 2OL3B 1XEDA 2ZOKA 3QBTB 1QBMH 1N6QL 3TO4C 4OZIE 1OSPL 4LVOB 3V6ZB 4J3UA 4OZGB 5C0IB 3SDDC 1KCVH 5INDB 4ALAH 4PGZA 4UDTA 2O92A 3QHMA 1G7PA 3GKZA 4CKVX 3MRCA 1U3HA 1FZJB 5JOFA 4QTHA 2LE9A 1A6VH 3BSZL 4KQ4L 2AAAA 2WWDA 4QLJA 3AI0A 3HMXH 4D0DA 4PMXA 1N59B 3I9GH 4JFTA 4J8RB 4UQCA 3UG5A 1GOMA 2O5ZL 3VFMA 1VACB 4Y4KD 3KL5A 2D7OA 1WTGT 5IK3A 5JOEA 1BPVA 1EJOL 1QOKA 2E7LA 1HJQA 1T3FA 1PSKH 1TJGH 3O6FD 5EORL 3KLHC 3IFLL 2L7JA 4YUEL 1XGPB 2KH2B 1FZMB 4NSKB 1R33A 2BOBB 4ZFOA 3OGOE 2Q3ZA 4UILL 3RDTB 3WDIA 1KXTA 3ARWA 1LO2H 3ECBA 3LQZB 4EDXA 4J27A 5JOFB 1C12B 5E8NB 3RWHB 3QRGH 1K5NB 4CU7A 2E7HA 4TUJA 1VF8A 3ROOB 4OCSH 4BSJA 4WGWB 3MA7B 4M8UA 4TTDC 1RSFA 1JPFA 5HHNA 5DXWA 2DQIL 4I2XB 1ZANL 1HJWA 2HN7A 1ITBB 3C08L 4JRYD 3O41A 2VC9A 5KSUB 1P1ZA 3TNNA 5DSCA 4ZSOB 4E41D 3LQAC 4AD0A 5DD5L 2CR3A 2FECL 4CNIA 4QOKE 5HYSA 3QG7L 2PW2B 3CDGB 4NQXB 5FA3A 1V3MA 5T3XE 1LLOA 5I74C 5C0EB 1YEGL 3UR7A 2VE6A 3RHWK 1R46A 1GC1C 2P8PB 4DOHB 2BZDA 5ACLA 1IGMH 1BQHB 2DM3A 1CWVA 1Q1JH 4LPTA 1WAAA 4PJDB 1RIHL 3LMJL 3RNKB 4H8WC 2VLME 5CD5D 4GSDL 5TE7L 4PG9B 4B3KA 5HI3D 1OGTA 1VHPA 3NIDE 3PG2A 2FLBT 5GXBB 5L2KE 4H2CA 3MO4A 3MLZH 2EIDA 4DO4A 4TVCA 4WU5B 1KJ2A 3WD0A 2XG4A 3O3UN 1J1XL 2G75B 2IH1B 2FL5A 3NH7H 4M56A 1IGCL 1HHIA 1UASA 5IESH 2DIAA 1BBJB 3TNNB 4NO2A 4OF7A 4N1EA 1K6QH 1H3VA 3AIUA 3PZGA 1A7OL 1I3GH 3BZ4A 3RIAF 1C5DA 5J6HB 1HKKA 2APXA 2D9QB 2Z91B 1RK1A 1VBRA 2BHZA 2XWTA 4LHUA 1EBPA 2YFOA 1XH3B 2K1MA 1HIML 3S3SA 4DQOH 1KEMH 3P4NB 3GJFB 1DLFL 2TAAA 4RL3A 1UM5H 3C60B 3GRWA 3TZVA 4LGRB 5FUOH 2JEQA 4HOWA 3QUZB 2YK1L 5TQ2H 2E8YA 1S78C 4JRYE 4PJXE 1QRNE 1TQVA 4Z0XA 3VI3F 2IJ0C 5IR1B 3RDTA 5EFDA 1QLFB 3WF4A 3EYQC 5KS9A 3N1MC 4OM0L 3SGDI 3BPOC 2CESA 2R1YB 3LN5A 4F66A 3O6FB 1UEYA 3PDGA 1OVZA 3LKSB 4OLVH 3GZKA 4G8IB 1GW1A 3QDJE 1NM9A 1I9RH 2OL3L 5JPMA 1ED3B 3QULB 1YNLL 43C9B 5J0BA 3CVHH 4NQEE 4HUWB 5IEKB 5CSZA 3C08H 5DF0A 5GGTH 2CK2A 2DJSA 2Y4SA 2GJPA 1DLHA 4KJPD 4HX1A 2XPGB 1N6VA 3HN3A 3BQUC 3HTLX 4PRPA 2ICES 3B9DA 3HZYA 4KK9D 3MV9E 2PYEA 4NHUA 3Q1SL 3B8SA 5F1SA 3WJJA 1GVYA 1MCSA 2CUMA 5DQ9B 3BD5A 4HF5L 4FXKB 4KTEL 4TN9A 4HK3N 3MRQB 1O6IA 4LQ1A 4G6FB 3PZUA 4OT1H 3RWEB 2Q76B 2P4AB 4I0PA 1IAOA 2BXZA 3MRMB 1CWYA 1RJZB 1Y7VA 1EA9C 2VJXA 4CN1A 2VXTL 2O9TA 5CXPA 1WTLA 2GJXB 2AEPL 2RIKA 4YPGB 1QFHA 5A2AA 4LARL 2DYPB 3BH9A 4HIJB 4MLSA 2Z35B 3WN6A 3PV7A 4UT9L 4KKAC 3CDCA 1IQWH 3PV6B 2P5WA 3H9SB 3BSHA 4XPBH 4IOSD 1TJHL 2BVOB 4YBLB 1OP3H 2I07A 4LYRA 1BFVH 3U6RA 4XVSH 2M2DA 3DV4B 1HNFA 4HS3B 4F15C 4JCMA 1MQQA 1R3JA 4CMHC 5HJ3B 3FCTB 4FFZL 2X4SA 5INCA 1FLRL 5DO8A 4OCRH 4NQCD 4Z7VB 2BK8A 5GS0D 3NZ8A 4ZYKA 4OCXL 5TD4A 3D85B 2HJKB 3VFPB 1WEJH 3B9AA 4X9BA 4ELMA 3UYRH 5F7LB 2J7CA 3BZFB 3JVGC 5TQ2L 4ELMF 4LK4A 5C8BB 3RTQA 2ZCKL 1AGDB 2H26B 1P4BL 4FLOA 4Q74A 4QGYA 5GRYA 2NY7H 1T5XB 1ZHBA 2CQVA 1QBBA 4H0IA 2WBKA 3MANA 3TCLA 4AIZB 3FAXA 3LV3A 4PRBA 1BHGA 4ZSOA 5EN2A 5EU6D 1QNRA 3PTMA 1MFBL 2P8LB 3KPOA 3LKOA 4B3LA 4C7DA 1MJ8L 4FFYH 4TXEA 5CHNB 4NPYA 4F7MA 5K9QI 3NCMA 5GGVL 3D3VA 2I26N 3HR6A 1CFSA 1NH6A 1T4KA 2XYCA 1NLDH 3QXAB 4KK5D 4LSTH 4MNQB 3MRJA 4YK4C 4O5LL 4KMTL 2UWFA 4LMQE 2GIYA 4X6EA 1JHKH 4YR6A 3VXMA 4DGIH 3BRDA 2VLJE 3CIQA 4AWEA 1ES0A 1G7LA 4IM4A 3SCTA 1HKLH 2ITCB 3B8YA 2W0LA 3CMJA 1FBIH 4R96A 5IVXF 5ADOL 4X5LA 2NY5L 3W9DA 4X98A 3PF2A 4QY8A 2O5XH 2M1KA 4OTXH 1I7UA 5F9AC 1FOBA 3QG6A 2XQYK 2O5YH 1TLKA 3DURA 3QXVA 4XB7A 5IG7A 3X3GH 4PY8J 3HE6C 5FIEA 3N9KA 4NGHH 2J6EL 4HXBH 4UTFA 1DUYB 3T2OA 3LIZH 3BEWB 4F7EA 3U7WL 2PR4H 1OB1A 1BSIA 4B41A 3MOQA 1VGKB 2F1BA 3QO0A 5SWSE 1A6TA 3IDMA 3ZSSA 2ZXDA 4NBYB 5DT1L 2PXYD 3MPCA 3VXRA 4XPGL 1JK8B 1BYBA 2NTFB 3QNXB 2GK1B 4JFHE 1HEZB 2PKDA 3DJ9A 1C5DB 3REWB 5E94B 3TBVB 2OZ4A 3BKMH 1TFHA 3QZWG 4UNVA 1RAMA 2W0FA 1S8DB 3T0EC 1YEKH 2XFXB 3UCQA 4M1GH 5HPMB 4OCXH 4MS8C 5LA0A 1L8NA 4XPAL 5I66A 3T04D 2LVEA 4QLRA 4M1CD 5D7IA 3UG3A 4WI9A 4NX0A 3HA0A 1WWCA 3O9WA 2X2JA 1CE6A 3ABZA 4ISVA 2V5MA 3QUML 3SQBA 2PYFB 1H5BC 1R3HA 1EEQA 4XVJH 4I9WE 2BJML 1IC4L 2VIRA 1MQ8A 3U2SB 4XB3A 4JKPH 4IRSA 5DRXA 4NC1E 5DVLA 4EUPB 5JXAH 4HA3A 2ZJSL 2ZG1A 4PREA 1U6AH 5I66B 1OGBA 4CD7A 5HD8D 1MJUH 3BH4A 2RGMA 1GHFL 3X17A 3WDHA 1H3TA 3WIJA 1NAMB 3NPSC 4PJ5B 5DDHA 1OD8A 3SUVA 4AM0B 2HG5B 5EIIB 5DI8B 4OIFA 3BFOA 2IWGA 5T1DH 3AXXA 5CEZL 1NCAH 3EYSL 5F88B 4RE2A 3TBTB 4BSWA 3CFCL 3PHSA 2FX9L 1N6QH 1HKLL 5IIEB 2EADA 4OM1H 1MPAL 1MJJA 4RQQB 2R2CA 2FEDC 4O2EB 4WFHE 2NY3C 3ULVL 4PLKC 4QGTA 4EOWH 2ZG3A 3DX8A 2J1KA 2AQ3A 1Z3GL 3MFFA 4KHXL 4TX6A 1XF5B 4FZ8H 2C3WA 1SJEB 2WBJC 3EYUH 3ROOA 2F8XC 4KQ4H 3X3GL 3NYDA 3FJTA 4URIA 4PN2A 3SDYH 1URLA 3I9GL 5E6YA 3PHQB 1LO5B 3ZTNL 2EYTB 3DV6A 3T4AB 4RFNC 4Z7UB 3K74B 4FMVA 1TJGL 5EORH 3WUGA 5AUMA 3WL9A 1KJMA 3ME0A 5CEXA 1K9FA 2XQBH 5DD3H 3SOBL 4APQC 5EDXA 5GRUL 4QXGH 3CK0H 4YXLH 3UTZA 4KRUA 3ARED 1YEFH 5ESVB 4ATDA 2D3LA 1AHWA 4NN7B 4OCWH 4XB8A 4P23C 3AY4A 4KZDH 1NGYB 4MB5A 1QHZA 3D5HA 2NX5D 1UH2A 3VXTB 4HQQL 5FM5M 4ZMAT 3ZR6A 5E1AB 3FN0H 1HXKA 4Q6IB 4EDWH 4LVNB 3L9RB 4NKOB 4QXTA 4ZTPL 5D7JD 4I1NB 4JKKA 1A5FH 4NOFA 4MYWB 4HUMB 4D2NA 1UZ6F 2UY7A 5FB8A 5INDA 1NGPH 3RWIB 4Z7VF 2R4SH 1HL8A 3AMGA 3CU1A 3BUYB 5DC4B 5H2BA 3O8XA 2R69L 3PWUA 4MQSB 2A9ML 1ZHBB 1E0VA 1QRNB 3ZT5A 2XN2A 3IDXL 4XBPB 4LGSB 5F6HJ 4YO0B 4NJ9H 1ZLVH 4LF3B 3ZM8A 1JF1A 3JV4A 4OZFB 3B3IB 3OAZH 4HUXB 5JO5B 3WF0A 1P6AB 3HE7A 1XD0A 3RL2A 4ODHH 5JW3L 1EAPA 1NFDA 3JV5A 1W9UA 4W4NA 3T08A 5T1DL 3UDWC 3BP5B 3QEGL 4JPWH 5GRXG 3AZTA 3DECA 3NTCH 5A6AA 5EU5B 1FO0B 4I3RH 1CU4H 1RVFL 2DTML 4DZBA 3CFCH 1LJYA 2QL1A 2XNAA 1UQSB 4EI5B 1JXKA 2WUCL 3QIWA 3FRUA 5IR1A 3FZUC 1KXVC 1VESA 3IF1A 1K3ZA 1T7XA 2JE8A 1N7ML 3WLBB 5AYUH 1WE5A 3DETD 4YPGA 4KUZL 1R24A 3BC9A 3DHJA 1GRWA 2XWDA 4KKBD 3IRZA 5D70L 4BZ1H 3QFJB 1G9NC 2X10A 5BS0D 3EDEA 4H0HB 2L7UA 2IAMC 3P9MA 3DETC 5BV7C 1MXGA 3IGAA 1I1RA 4WGVB 1NMBH 2X0YA 2VKXA 3OHXA 4OIIL 1R3IL 3BUPA 3CH1B 1XGTA 1FORH 3L3KB 3KJ6H 1MIMH 1FL3A 1WT5A 5GGSA 3RM9A 2ZUXA 4KKAD 4P3DB 2LFGA 1OGTB 3TIEA 1IFHH 3JWNC 5EU5A 4Z77B 3TP4A 1H49A 4PJAA 4UOW0 1E70M 4Z78A 4C58B 1OL0A 3KLSA 1CD1A 3G6JF 4NM4L 2BSTA 4EDWL 1CE6B 1TETH 5GGSY 5T33H 2EBNA 3TBWB 4BCEA 4UAOC 3H9HB 5M17A 1KF9B 5C8JB 1NGPL 4W86A 5CFHA 1WQVT 3SCSA 4NWTH 3AS2A 3BW9B 5D1XA 1R8LA 2WW8A 3MUGA 3W0WB 1IAII 5C70A 2IAMD 1A8JH 3QPQD 2APVA 4Z0BL 4DGVL 3DXAE 4WRLA 1U8HB 1UB5A 3HB3D 4J2XA 4TQEH 3LEXB 1ACYL 2Y24A 4NCC1 1NKRA 3FT3B 4RX4D 1P1ZB 2QSQA 3W0WD 1UA6H 3DPBA 4Y4HA 2BS9A 2KQNA 4OZGA 3FO1B 2B5IC 1L9NA 4ODHL 1AKJA 3U46A 4WI7A 5DA0B 1MIEH 3BKYH 1CNVA 2M26A 2J77A 3GDBA 1KQZA 3V4PH 3X13A 1SY6L 4UBDC 5EBLB 1NMAH 1T0PB 1R5WB 4R4NC 3B9VA 4HJJL 3MNZA 1AQHA 1G6RB 3MOBL 1J86A 3S96A 1BFNA 2J12B 2LU3A 3ALGA 4K7PH 5FA4B 2HRLA 2VCCA 2XM2A 2G75A 1F00I 5D2LB 3QG7H 1UD2A 2IF7A 5I77A 4UFKA 2UWEB 4NZRL 4IOFC 4R2GC 3BW9A 4YFEA 4P4KC 5IB2B 3VA6A 4Y16C 3I6GB 5C0DB 4HBCH 4ZS6C 4KK6D 5K59E 4QRSA 3G6DH 4R4BB 1MRCL 4S1QH 4DKFH 3MUY1 4GZJA 2EYTA 3WNNA 3CUPA 4ODTL 4JIEA 1N64L 1X7QB 2OTWA 4ZOAA 5ITFB 4GXPA 5D7LA 5GNXA 4I18A 2ADGA 5LKNA 3PWJB 5D6CA 3PQYA 4D3CH 2ZICA 3MR9A 2DQJL 4Q0XL 4GMSH 2EYSA 3SGEI 2EPNA 1TQWA 2P5WE 4FA8A 4V2XA 2XACC 2AK4B 2A3CA 1TCMA 1U8LA 4RFOL 3F12B 4MCZA 5MERA 2YJQA 1NEZA 3QDAA 4HFWA 4ZO8A 1MLBA 5J6GB 4JFFA 4PJ5D 1F5WA 3H7BB 4NO5B 4JFEB 4LVNC 2N4IA 4JZJA 2UZYB 2D1ZA 2NZIA 1RUPL 2DB8A 1WFOA 3R4DA 4ZODA 1K6AA 4XAWH 1DBMH 5BMFH 1QSFE 4EUPA 4NXSA 3QWOB 4AZCA 2EIEA 1A1OA 4LSQL 4ZFZA 1JGEB 4N90E 5EG6C 1JNHA 5E6ZA 4UIKH 1KSRA 3FN3A 1YYLH 3AMDA 2GITA 5B38A 5I71B 1XCQB 3GI8L 1U36A 4HLZH 3MLPA 2YUZA 2W65A 2A9NH 1KN2H 1IAMA 1L9MA 4P57A 1NQBA 1X5FA 3WQ4A 3UJIL 1EO8H 5DD1L 3NN8A 5LWYL 1EEYB 1AIFB 4NFCA 4WCYL 1Q6FA 4XMPL 3DHMA 3EOTL 5LGKA 1T7WA 3O81A 2P8MA 4OGZA 1AFVL 1V0KA 12E8L 2QHLA 3QIBA 3D69A 4HCRL 4ODSH 5KVFL 4NGHL 4YZFF 3HR5A 3IFNL 4TTDD 2PC8A 4OT1L 1S7RB 1ZKAA 4E2OA 1GC1L 5GISH 5E6IB 5I16A 3O4LB 5TGBA 1JZ8A 2O26U 1E5NA 3RVWC 2VXTH 4YGAB 4PJGB 4C83A 1CDGA 5HI5C 3EZ8A 1LWJA 4H04A 1U95B 3QA3B 3W29A 2YEZB 4HBCL 5HVFB 1TVNA 5GGTL 5LYRA 4G7VL 4HF5H 3AIEA 4Y7EA 1U58A 3N1AA 2X9YA 4P23B 1GZJA 3OKMA 4U31A 2GQHA 3IKCB 1E4LA 3C5ZB 4FXGB 5A3HA 5SWSA 3W9EB 3LOWA 1VFAA 2GY7B 4O51B 3L6FA 5FHAL 3W9DB 4HOXA 2D24A 3KPSD 3E6HB 2CBVA 4MPKA 1RFDL 2PO6A 1J9CT 2D03H 5IF0A 5J3HC 4MD0A 4RX4A 1GZQB 1XGYH 3VG0H 5FO9A 4AG4L 2NY7L 5GZNC 4J8RA 1VSCA 2F54D 5MEND 1E73M 1L7IL 2OR9H 5I3DA 4FXGA 4NPYB 1MEXH 2HLFC 4ODVL 3U0TA 2XVKA 3VFNA 2XT1B 3A6OA 4LLYB 4AENA 3DUSB 5C07A 3C5SA 1UD4A 3UYRL 4K7FA 1WCQA 3VFRB 4HJGA 1CLYH 1I9IH 4ERSL 1JTPA 2EC9T 1I9JL 2HTLD 3VGDA 2VAAA 2CLZA 4M6ML 5CEYA 5C0BE 4HGWA 4UFJA 2V2WB 1FIEA 4GMTH 5E5MB 3D39B 4J6RL 1KGCE 3OKOA 2YKLL 3PZVA 3VWJD 4IRSD 1T21B 1ZT4B 2E9JA 3HFML 4GKNB 1BVLB 2GFBB 2OSLB 3DX7A 5LCVL 1OTSD 1F4AA 3EYUL 4FZ8L 2ZCKH 5FYLE 3U0TB 4JO4L 1WV7T 4BQBA 2XKUA 5JA8B 3C8KA 1MJ8H 3SCVA 3QP3A 4IBLT 3P9WB 1PY4A 2IPUG 2YN3A 4LCYA 1XH0A 3WKZA 5I19H 1X5AA 3UJTH 2GKIA 1YEJL 4U0RB 5FO9B 2HLFD 1BAFH 1W1TA 5A6BD 5KVEL 1DE4B 4WWKA 2AV1A 1U92B 5F1KC 3VWJB 1JPST 1R75A 1IGFL 4R4BA 1GSMA 2XKNA 2B0SH 4PFEA 1UKTA 4K94L 5IB2A 1P6FA 2UWEA 5L9DH 1HTYA 3JV4B 5DUPH 1ZHKA 4R0LA 4AH2B 3NAAH 2QPSA 1R3LA 3ARFB 3CH8A 3VXPB 3EMCA 5HYSB 2GJ6A 1FLTX 3C60C 1YJDL 4JFDB 4GLRI 4L1DA 3VH8G 1G0CA 1CVRA 3AXLA 3U7BA 1UENA 2YRZA 3QZWB 2EECA 3W6MA 1YEKL 5DHVA 3QEHA 4MA7L 4NO5A 4DOHE 1MFVA 4Z7OF 3NACH 1F11B 2PR4L 3LSOA 2Y2WA 4XVTL 4P3CH 4G5ZH 2QBWA 3SE3C 1C8PA 1HKFA 3U9PL 3I3BA 1AI1H 3WEOA 1OCQA 4TULL 1OY3B 1HNGA 2A3HA 2AJSL 4J3OC 2AJXL 4HD9A 3GBMH 3T0VA 4ORZC 2FH6A 3GSWB 4M5YH 4PGCB 2NMSA 2A6IB 2HMID 2AABH 5B38G 4NSKA 1G7MB 1PLGL 1IC4H 3IYLW 4YC2B 2OX5A 1V7NH 2WAHA 1N3NA 4QLLA 3UTZB 2JIEA 3H7LA 4YPJA 3T4YA 5J1AB 5JW3H 2NY2D 4XMLH 4WHTA 4FNTA 5IB4B 5KG9B 3ROLA 5BXTA 4BSVB 3IXAA 1ACZA 4W93A 5CP7B 1A4JB 2CITA 4PY8I 4JDVB 4GS7B 3QWRD 4OF5A 2QTEA 3WDRA 4WTZA 5KSBF 3DXAB 1MFCH 2HJLA 1FYTA 4XPAH 2AK1L 2JALA 3H9ZA 1TZGL 1FRGH 4BYHA 2NY6C 4IPLA 4PMYA 4DCQB 4OD2B 3X12B 1Y18A 4Q9RL 4HXAL 1ZHLA 1AY1L 4F80A 4QRRE 5I1KL 2YC1A 3TFKC 3WSQL 1PYWB 5C0GA 1OGAB 4LASH 4XNUL 5ESAB 1E43A 5KZCB 4P9MH 1B3YA 3GXDA 3DVIA 1T0OA 2J8UF 1UHVA 2VUOA 2Z92B 5C09B 3ZTNH 2ORBL 1GZPB 4YDVA 1INDL 4YHLH 3T2PA 5EZJA 1JRHH 1YNTB 4MA8H 3A23A 3OWEA 5CJXC 5J89A 1MQPA 4LPCA 1UJTA 5CGYD 4K3EL 4PMNA 3NCCB 4LRNL 2XQBL 4G8EB 3L4XA 3P77B 1Q6GA 4EOWL 4LX4A 5BWFA 5E8EA 5GRUH 4IOFD 3CK0L 4YXLL 3TYGH 1OTUC 3UTPE 3ZHKA 4M7KL 3KLKA 1XGQB 3NZ8B 4QCIB 3QHTC 3CXHK 4R3SA 4ZYKB 5BRZD 4PG2C 2VN4A 2E27H 5DRWA 3CZLA 1EDQA 3BP5A 1TETL 3MV7B 4LCYB 5FL0A 2VDKH 5I73C 2WKLA 5IT2H 3MNVA 2Z8WC 2DM7A 2OWWA 4AEIL 3WSUA 3IXTA 4ZFZB 2CIKA 1WDRA 3VFTB 5D2LA 4MB3A 3HC3L 1OSZA 4JLRA 2F5AH 4PJAE 1XC6A 4NOBA 2AJXH 3KPMA 5HGBB 1YUHA 4TQEL 1M7IA 3OHXB 3HNVL 5CILL 3FO0H 5KVMC 5DUMH 1A4KB 1IV8A 3LEYH 3OKNA 4JFEE 3BUQA 4PJBA 4OI8A 4H26B 4N0UB 2GK0A 3OAYK 3RWEA 1FNLA 4R4ND 4OFDA 3D52A 5EFFA 5DD3L 1I1FB 4UBDD 3SOBH 5J6GA 1UWEH 3AAZB 1YZZA 4M61B 4HFWB 3N17A 3VIOA 1H0GA 1Q6DA 4W68A 4JFHD 1HSAB 2JB6B 3GKWL 1F4WL 4WIQA 3NABL 4YHML 5C0ND 4DVRL 3GHBH 4JGJA 5SWSD 1OTTC 3QR2A 4QHMA 3GIZL 1G0YR 4MSWA 1HCFX 4Y4KC 3ARXA 5B8CA 4TTUA 1TZGH 1QI0A 1UM4H 2CMRL 5E9DE 3NVQA 3IB4A 3T3MF 1BBDH 1JGDB 3L2MA 1LEGA 3QISA 1IEHA 2Y5TA 3QWRA 1KJMB 1FHGA 1JN6A 3ARDD 3WUWG 1UCBL 2HRPL 3U5YA 1WBYA 4TOQA 1HE7A 5I1EH 2WC7A 5EC1A 3T4AA 1FFOA 4RAVA 2VRQA 4GG8B 1UD8A 2XIIA 1KB5B 4AY0A 1BYAA 2BNUA 35C8L 3H42H 2RFXB 5A2FA 1CU4L 1RVFH 2DTMH 1CXEA 3KPPA 3BPCA 5HY9B 4TVPD 1NP2A 2DT2A 1Z32X 5DMJB 3W11D 1KCVL 1HI6A 5EO9B 2XSAA 4D6EA 1AKJB 3MRFB 3WL1A 4QDMA 4L3EB 2VDRL 5JPNA 1GPOH 4XPTL 4HLJA 4TUKL 1TVBA 3L9RA 4Y0GA 1V5JA 2E27L 4Z95L 2EJ1A 2VLJB 2NZ9D 4AYSA 3CVHB 2FIRT 4XC1H 1S9KC 3SQOL 2A73A 4P0DA 5H37G 3VFSB 5TJWK 2FBOJ 5A2CA 4OB5H 2X44D 3MRRB 5I1DB 1K4DB 2R15A 5DMYA 5IXEA 2NXYD 4XXCC 2VLMD 3BRGC 3KPLB 3AS1A 4HIEA 5EC2A 4YUEH 2F5AL 4XWOC 1F8TL 3AS3A 3QRFM 1MCJA 3ZDYF 2GSJA 5EFIA 2B2XL 5KSAB 1FH7A 3WLWD 3DX4A 1G0DA 1UA7A 5A16B 4H1LA 5AZ2L 1ITCA 2J7EA 4OLZH 1ZT1B 2WBJD 1EAPB 4X6BA 3AREC 3V7MA 4MQ7A 4NQCE 2XN1A 1O7AA 1P53A 5J8OA 4E41E 5GRVK 4IIQC 1UGNA 3A6CL 3EOBA 1FL6A 1ESWA 1FP5A 2P8PA 1IEAB 3AROA 4NQDB 1P7QB 4KV5E 4PYHA 3V5DB 5KBNC 4GS7C 3MRRA 3V79C 1GQJA 1CTOA 1SY6H 3M17B 4QFUA 2AJVL 5D1ZB 4K68A 1S78D 4NM4H 1OGSA 3IT8D 4LSPL 4M5ZH 4L8CA 4LHUG 3QFJA 5C07B 1B0GB 5B4MC 4HIHB 1JI1A 4L29A 1IGML 4Z0BH 1QTYT 1LEKB 5DJCA 2X6MA 1RPKA 4R6UA 2WIIB 2XRAL 1LQ0A 4C7FA 4IRSB 5D2LF 3DUHA 3NUKA 1IBGL 3HI5H 1BOGA 5JTWA 4N0FB 4XPHH 4GI6A 1W9XA 4AW7A 2A77H 3V6OE 5K9QG 5FCUH 2EYRB 2DSKA 3L5XL 1C16B 5SWQA 4M4PA 4IRJA 4KJQC 1MVYA 3LD8B 3N85H 5DEZA 2CH8A 4XPTH 5CP3H 4P5TB 1H15A 4XTRC 3N9GH 2GJZB 3SKUD 3P73A 5FOJA 3PHQA 2YD8A 4KJQD 4PRHA 1JHLH 4Y19B 4K8RH 1OCWL 1SBSL 4X0VA 3F5LA 3QUKB 5I73B 2ID5A 1ZAGA 5JW5B 3C2SA 2OTPA 2QQKL 5H2BB 2JEPA 4XP6H 3WIIH 3JUZA 2YEZA 5HGHB 4AZGA 2J8UA 2RCSH 5AZEH 3VXRB 2QPUA 5IJVA 1CXLA 3SPVA 1CLYL 2X4QB 4MJ5A 3IFLH 3A21A 4PJ8A 2DQDH 4PJIA 4JQXC 5DEFB 4JHWL 4UIKL 2AMGA 2DMBA 3UTSB 3OKNB 5DHVB 3UEZA 4MJIA 2QQLH 4PJCF 1JG9A 1NC4D 4P2QA 2WWKO 3QDMB 3PWPB 2DRUA 3BMVA 3NDYA 2J3SA 3WXWL 4HOZA 4XC3H 4RFOH 1ZBWA 1F2QA 1XGRB 5D5MA 4I2XE 3WMBA 3CSYA 2P46B 1OAZL 3AJ7A 3VM5A 4CMMB 2BCKA 5JIWA 3H54A 4LSQH 4QT5A 3SKJH 3CUIA 3VFGL 1JMXA 2K3TA 1Q9LB 4C56D 3EO0B 5KVEH 3GSUB 5ID1A 2FEEL 2ZCLH 4HS3A 3VDCA 4E8DA 1A9BB 5GGUA 4GRWF 2OYLA 1JNJA 3MRJB 3MI6A 4B53A 2DQCH 1A3HA 4D9LL 1F13A 4S2SA 2XZAH 3SKMB 4LIQH 5ECUA 4LQFL 1D5IH 3W2DH 4XZWA 3ALPA 1JZ7A 2X9WA 3PWPA 3CUHA 1MJJB 5E5UB 2ICWI 3ARQA 3U1SL 3K80A 4NUGL 1S8DA 4KHTH 4OFKA 5IHZB 4JFQA 3CUFA 2ZOLA 1NKOA 3S34H 4BZYA 4DUXA 4N90D 5FCUL 2Y36H 4JG0H 4E42B 4PJDF 3CVHA 1ZLWK 4L1HA 5B4MD 3HMCA 1D6EB 5J9PA 3F5WB 4L3EA 4GO6B 3VXRD 1J18A 5FHAH 1GGBH 4FQCL 2YDSA 3MC0A 5F89B 5FL1A 2HKHH 2DQXA 1CL7I 1Y0LB 2JB5L 1NCUA 1YEDA 2XTJC 5JZ7C 2GDVA 2CJUH 2HFEB 4PJFE 2I60L 2UWEF 3JWOH 1W9DM 4OLYH 4PTUA 4HX1B 3FTGB 4AQOA 1DL7H 4OCRL 3ALFA 4I0KA 4M8QA 4OD1L 2E8ZA 4KK5C 1FNSH 4GAFB 5D4QA 1CD9B 4JFPA 3CFDB 4H1LG 3HJEA 4J4PC 4R96B 2IANA 3V6FA 2PO6B 4R9HA 1RZIA 2QSVA 1RFDH 1RIHH 3LKSA 4U1NB 2ESVB 1KC5L 4RWHA 5FYLH 3L4ZA 1ZXQA 1INEH 4AEFA 5HDLA 1I3UA 4DFHA 1MFCL 1H2JA 5DD6B 1WBXB 1BGGA 4I8DA 4NT6B 4L5FH 4YX2L 3WNMA 1FL5B 1W9VA 1W32A 2YL9A 3ZJ6A 5CINH 1VFFA 2VKWA 4KY1H 4D1IA 3ZZ1A 1EJ6A 3AHVA 1X1NA 1D5XB 2Q7NA 1D5BB 4O58H 3QI9C 2ZSVB 1VGKA 5E00B 5MEPA 5A3IC 4R2GB 1A7BA 3V5KB 2HVJA 3CPUA 3A4AA 1I9IL 3GMLA 3KPPB 4ERSH 5I19L 1KGUA 4JL1A 4UFLA 5JLZA 4YDLB 3WIHH 1DQDH 4CKQA 2RFXA 4KTYA 3F7YA 2QLVB 4NNPH 4B0MM 1AD0B 2IALA 5MEQA 3MUGB 3W0WA 1DUZA 4QRRA 3RZCA 3VXPA 4XNQA 1UM5L 4NRSA 3WFCH 4G6AC 1KENH 3O11A 3RWFB 3V6FB 5ECJE 3FQRB 3JTSB 4NP4H 1NUNB 3KXFE 1Q8MA 3MO1A 5I74B 3QEUB 4UDUB 3SCMB 4NKIH 1LL6A 3HI6H 3CZNA 4AMKH 1T04B 1UG6A 5E2VL 2BNQA 3PXHA 4PJEF 2WP3T 3FQUA 4PJHB 2XWEA 3CGTA 4NF7A 2AXFB 2QHAA 5JORA 1EHLH 1DCLA 1Q9KA 1LE5B 1A02N 4A2MA 1CTNA 4F7PB 3H3PL 2DQTL 3ARDC 5KVDH 3HFMH 5LCVH 4OF0A 5ADPH 2DM2A 3MRKA 1K4DA 4G6MH 1TNNA 5TDNB 4EVNA 4YDVB 3GJFA 3V6OC 4C57C 5IFJA 1E4XH 2Y1VA 4R27A 4XNMA 3GSOA 4M6NL 1B90A 1MLCB 3KDMA 4JO3H 5BVJB 4OD1H 1NAMA 2R2EB 3D2UA 2ENSA 3ESUF 5F7KC 3MV11 3E2HC 5KZ6A 3QUXB 4R0LC 3VFRA 4OSUH 5EUOB 1G9MH 2CDFB 4I9WD 1Q72H 1SJXA 3PGCB 1HJUA 3WF1A 1NFIA 4PY7B 5BS0A 5FGCB 2D7PA 3BPCB 5HY9A 3VFPA 1OWRM 1EO5A 1JHTA 1CZ1A 1C12A 2DBLH 2VSCA 1DFBH 4RAHA 5IB5A 1IC7H 4QRTB 2CHOA 4RBPK 1ZBVA 3RWDA 3UZVB 3DVGB 5B21A 3OJMB 4YHYC 1L7TH 4JFYA 2EH8H 2WLZA 3MLWL 4ONGL 2C4FT 1V7NL 2BXYA 3OZOA 1AO7E 4NQVA 5DR5H 3WIFB 3RX5A 3ZHLA 2J79A 3MXWH 1H3PH 1T0NB 2GAZB 4NQXA 2D2OA 5FA3B 5EZJB 4ZUVB 3AOFA 2HWZL 3BD3A 3ILPB 4LHQB 4LSTL 4HIXH 5C1MB 1Z0NA 3NCBB 4Q9BA 4CDGC 1ZBCA 1A3RH 4AK1A 1QHPA 4FTVE 5BRZA 5C3TA 1S46A 3L2LA 2VISA 4OLEA 1KCLA 1WEJL 3T2NL 4YHLL 4PSPA 3PQYD 1BGAA 5A8MA 1T6WA 1XSIA 3FO1A 1HH6B 3IFPA 5FOOA 4H8VA 1EVTC 4M02A 4AEHH 3BEWA 1T22A 2X89A 1K5NA 2AKRA 3ARYA 1E6XM 4M7KH 4QRPD 1QFOA 2AK1H 2H2PC 2DQTH 5KVDL 1FRGL 4ZO9A 1UJ3B 4QYOB 3HR5B 4HKXA 5ADPL 2DBJA 2IH1A 3V95A 3S36H 3IDNB 3EJSA 3PZQA 1P4LB 3FRPA 3MZTA 1TR1A 2AW2A 1KFWA 3QDGB 4GRMB 3WIFA 4GG6B 5ABGA 5HNNA 2VC2H 3LPGA 1CK0L 2B2XH 2Y5TB 4GQPH 3T0AA 2X2IA 3CFJB 2A0LC 2GJJA 3FHQA 4PTTB 2IQAA 1YA5A 4ZO7A 1ZK9A 3DX6B 2R1YA 3LN5B 4JFOB 3F7QA 3RAJL 1WB0A 2B31A 5CJXA 4H25B 3Q6FB 3BAWA 5GRJH 4CCEA 3HS0A 3GSNA 3UCRA 5EOQH 3IDYB 1JP5A 1SYVB 4XP4L 3RTQD 1G7IB 4ODUA 4OCSL 2HLAA 4F7TA 4OQTH 4RGND 2A74B 1KIPA 4PP2B 3QWOA 4WUUA 4OZGE 1FCGA 3S8WA 1GGIL 1ZGLA 1KPRB 1FGVL 4K71C 5JMRA 1IKFL 3DRQB 5FO7B 3RI5K 2VWEC 1FG2A 3CSPA 4P4KB 4JZJB 1L0YA 5I1CL 1GIGL 1OQOA 1FNAA 2YZ8A 5JIIA 5DUML 4WFHD 4YBQD 2BVQB 4JZOA 4K94C 3VKKA 2VQTA 4U1SA 1LP9B 3IDJA 3N1FC 3HUJA 3C8HA 5LQBL 3R8QA 3HU7A 4HCRA 5SX5K 1I7ZB 1S7SB 2GTZA 3SJVD 4P2OA 5AG9A 4U1IA 1AQMA 3KYMA 3NABH 3PQYB 4JG1L 3QOMA 3HC4H 2BSED 3MOAL 5JDSA 5F3BA 5DRWB 1CGXA 5GSVB 2IFFH 2F7QA 1U3ZA 2XXMB 1WLHA 4J12A 3BJ91 3ESVF 2CKNA 15C8L 1C5CH 4O4YL 5I8OH 3L95B 4S1SH 2F1AA 2X4NB 4Y5VA 5HDBF 5DFTA 5GZND 4D6IA 1S9VA 4D6DA 3NFPA 1VFBB 4X9HA 4YAQA 1TVDA 4EQ3A 3RILA 1QEWB 2MMXA 4P2CG 5CBEA 1QSED 4OBSA 4HLZG 5DSCB 1LD9A 1M7DB 5D2NB 1CXIA 2NTFA 5AYIA 4F37K 3EMZA 3RKDC 1OLZA 3BIBX 1B6DA 1G7JA 3F7RA 1HN1A 4PTWA 1U2YA 3D0VA 2OYKA 4NIKB 3AB0B 3RX7A 1YQVH 2FHCA 4XHQA 5C71A 5DQ9A 4Y4HB 3MLSL 4X7SH 4CVXA 4NHUB 4XRCB 4NUJA 5TQ0H 4GKZA 4HZ6A 4RAUB 4WFEE 4JPVL 3BIKB 3RVTD 2CRIA 3RGVA 3OLGA 3WFZA 5HI4C 2XZQL 3WXWH 4XC3L 4YAQB 5HYIA 2VI0A 4ZPVA 4OFVA 4AD5A 2X05A 2XUCA 2BOBA 1CDCA 3OLIA 5J56B 2XTJD 1T66D 4JN1H 1E4MM 1TXKA 2NY1C 1C8QA 2XXCB 4IRJB 3EFDL 4WI8A 1BVNP 3O6LH 1ZVSB 4P2QE 4IHOA 3TO2A 3KPRB 2E9MA 4DAGH 2J2ZA 2RGSA 2ZCLL 4WDIB 3GRWH 1LP9E 1NARA 3A67L 1EDTA 3GSWA 4PGCA 5IB1A 2JF1A 1VKXA 3IU4H 4M43H 3V8CA 1F6FB 2BNRD 4X4XB 3S98A 2MQCA 3AM8C 4XAKD 3BZEB 5C07D 4Z18A 5AC4A 1FL3B 1NEZG 3D9AL 1U58B 1GGCH 3BZDA 1CQKA 3PABB 5BW7C 1T03H 5EBAA 3D39A 4OCWL 2XWTB 3SDDB 3SCOA 3E8UH 5IWLA 3NBNA 1A6AB 3O2DL 3AREA 2NY3D 4JG0L 1TQTA 4P8VA 1CICA 4QWWD 3MREB 2XYLA 1W3KA 2ED7A 3AHXA 1IKNC 3P40A 2HVMA 2O9RA 2KKQA 3WD2A 2A77L 1HXMB 2BMKB 4UB0L 4MCYB 3VSVA 2O9PA 1D9KA 1Z9LA 1AMYA 1RV6X 3QRGL 2PETA 4ZQKB 4GKLA 7TAAA 1QFUH 4J3WA 3BZEA 5IKCB 3W5MA 1RMFH 3TV3L 2FIKA 3NPZB 3IETB 4PJGF 1H8SA 2CLVA 4LBEA 1U92A 4HWEH 1JF6A 3G5YA 4Z2JA 1RUKL 1JDDA 5TE6H 3TPKA 5EFIB 1QNQA 5M94B 1UWRA 4PTTA 2XM1A 4U1HB 3HE7C 4BQ6A 2GITB 2NW3A 4IM8A 4PTXA 2P5EA 5JHDE 1JGEA 1Q9OA 3IJSB 1YNTA 4JPIB 3C09C 2J88L 2QLYA 3WF2A 4QWWC 3VMNA 1FG9C 4HW6A 1INEL 3BUBA 3NTCL 3S96B 1SJVA 2ATPB 2WUCH 3MQIA 1XF3A 1QPPA 3OGCA 2W0PA 1NJ9A 4MJIB 4F79A 4RMRA 3K8MA 4KY1L 2ICEB 2F5BH 1QNZH 3SJVA 3UAJC 3S6TA 4KRPD 3WO3B 3IGUA 4GLRH 4JCLA 1ZLVK 2AJ3B 5F97E 2EZ0D 1JD9A 3RY4A 2A9NL 3QCVL 4KXZH 4ZD3L 5L7XL 1PBGA 5IB1B 4NCC2 3LHPL 1A4JA 1U8HA 5CSBA 4PRPE 1PG7L 2Z31D 5K9JH 1R5IA 5D1QB 5LWYH 2HFGL 3FQNB 1LVEA 5IBLC 4PRPD 3X14B 4JQXA 5F71A 4Y2DC 5MI0C 3MV8D 4WHCA 4BH7A 3DRTB 4PJFF 3OR6A 5CP3A 1QLEH 1DQQB 2O5XL 1D5IL 3W2DL 4KU1A 4OGXL 5F3BB 3WDPP 3TN0B 3U1SH 5GS0C 4P5KA 4JQIL 3G5VA 4XX1G 1G6RA 2XVLA 1JNHB 4WEBH 3O2LA 5IQ9B 1HKIA 4FOMA 1BPLB 4NWTL 2C7FA 1AQKH 1O5DT 1UACH 1N4XH 4KMLB 4LHUB 4MADA 3P0VL 1L0QA 1HWHB 2GK0B 5HGGS 1V05A 3FAWA 5I1GL 2NYYC 2Q1EA 5FHBH 1KLGA 4KTDH 4M7ZB 4PBWD 4RMSA 4V1DE 3VIJA 3MTRA 4GAYA 1E6QM 1I3RB 1A7PH 3NMEA 4AM0A 1AXTL 3C8DA 1INQB 5F96H 4WUUB 2BHUA 5DRZB 3WLWC 1AH1A 1YNKL 4LIQL 5IJKC 2AV7A 2P5EB 5ETUA 3QB7C 4MMZC 4LP5A 4POZC 4ZUUB 5HHOE 2J88H 1R47A 3MX0A 2YD6A 4K3DL 1AIFA 1FVCA 3TTQA 1HJSA 2C9AA 4D71A 4HJJH 1RURH 1ZEAL 1NP0A 3GJFH 3ZT6A 2E3VA 4G42A 1NSNH 1YY9D 2QMJA 4G7YL 4POZD 3ULUH 1UWGL 4L5FL 4LDOB 4N0UE 4Z77A 1T1ZB 3DUUB 1QI3A 3VINA 4YWGH 1SEQL 4K7PX 3MMEB 5C09D 2DH3A 5DRZA 2H45A 2AI0L 1RHHA 2V7HB 1VENA 2WANA 2YR3A 4J3XA 2XTLA 1IQWL 3JBG7 1B31A 1CDIA 3ARBC 3BYYA 3EDKA 4WI2A 2HKFL 3D3VE 5I1DA 3NSMA 4HH9B 1NUDA 4KRTA 1BFOA 4XVSL 3TVMD 4EN3B 3SBWC 3LRMA 1VAHA 4NXKA 4UQEA 4QEGA 3SDDA 3QR3A 5C07E 1GXEA 2VLJA 1I7TB 4D9QE 3NCOA 1GPFA 1EO8L 1JYXA 2DOCA 3RVVD 4NP4L 2DDXA 4MNGB 5DC9B 3BN9C 1IM9D 1XYFA 5E1AA 5HYJD 5FD0A 3SCUA 3PP3H 4P2QD 4ONFL 5D7JC 4FQHA 1BVKB 1X3DA 1NGWB 5EOTB 3IFNH 3N1QC 1IGFH 3FO9B 1WFNA 4P7QA 2BNUB 5DHXB 3MA9H 4K94H 5BMFL 3QCTH 1ZMYA 1H5BB 5JIPA 4V1DB 5KOMC 4HULB 3MJ9H 4YDJB 1QI5A 3ZE1F 4KK9C 3QEUA 5C0AD 3SCMA 1JN6B 1HINH 2UY3A 4OIAA 3UBXG 1IJ9A 5D2LE 4OZHE 4X5XA 2H6PB 4GQ9L 4MJ2A 2R9HD 2B1AH 4Y19E 4TVDA 4D9QD 4LSDA 3TEUA 5BZDA 2GYSA 4JHAH 4F9LA 5KS9B 1YNKH 5D7SH 4XP4H 2DWEB 3DHUA 3WEZA 32C2A 3C09B 3E0GA 1B2WL 2VDNL 1ZTXH 1F45A 1NCBL 3LRLA 2FB4H 2OL3A 3ES6A 3OKYA 3OB0K 4X6CB 1RURL 1ZEAH 3CC1A 5D2NA 1S7WB 2PXYA 1BJ8A 1OBAA 1E4XL 2NNAA 1QEWA 3U7VA 4WNQB 2GCYA 1KXQA 1RUMH 5KAQG 1T80A 1R3LB 2IMNA 5D8JL 4GUPB 1MVFA 2QQQA 2X4PA 1ZGLM 3PTQA 1CFQA 3ZJKA 1HHIB 4HUNB 3WV0A 2IEPA 3IDXH 1VIWA 4OSUL 3MRGB 1G9ML 3UERA 5I1AA 1JNNH 5BYWA 3UTPD 2QKIA 1K4CB 2BVUA 2Z8RA 4WO4D 3RIKA 3RWJB 3F6LA 4X6BB 1TIUA 1B2YA 1ADQH 1HHKB 1KQYA 3RU8L 5GGVY 1CGWA 5HI3C 4FN0A 4AT6B 1A21A 3A0OA 2IFFL 3HUJE 3A22A 3IVKA 4OUOA 4APQD 1OD7A 3WCYA 3EFFB 1Q72L 2EICA 2XZZA 5ERWB 3ZOAA 5EUOF 2UY4A 5KS9F 1CG9B 4Q6IC 2XZCL 1KELH 3QIUC 3VSTA 2XN9B 2W9LA 3LS4H 1NWUA 3HMXA 5D5MB 2YBTA 5DWUH 1XIWC 3A5VA 4KUZH 5F7DA 1OLLA 4HWZA 3VG0L 4FF5A 1RIVH 2ORBH 2ZSWB 3EJJX 2R56L 5FO8B 4A3HA 2EH8L 3AHYA 1EFXB 4XH2B 4UU9B 1UM6L 3CLFL 3MJ9L 1KNOB 5AWNL 3CMOH 4TVUA 4JFDE 4P5TD 3GXMA 3VRJB 1E6SM 3VFUB 1FORL 1ZA3B 1U6AL 2X4RA 2DTSA 3QFDB 4JDTH 1NBYB 2C3GA 4WV1A 4AEHL 2OJZH 1CE1L 2EH7L 2PTUA 1FO0A 1QA9B 1OB0A 2WVTA 2W60B 2YKLH 1X5JA 3UESA 1ZLUH 4X6CE 4M62L 1MHEA 4Z2HA 3HE6D 2CLRB 3G04B 4PYGA 1E4KA 1RH9A 4E41A 1N6UA 2R2HB 1VFAB 1UR1A 3GTNA 1N0XL 3UJTL 4BF7A 3BT2H 4Q7NA 2ICWJ 3FFCB 1VACA 3WQWA 4HS6B 1R5IB 5D1QA 5E70A 1YMMB 3HMWL 1RUML 2HT2D 3F7YB 4XPFL 2PI6A 4JDZB 2AXJA 3THCA 4NC2B 4JL2A 3VG9C 4Z7WE 1BJMA 3UBXB 2WXDM 5C9KA 5CHNA 5TDPA 3OLEA 4KZEL 5JXEC 1CK0H 3C60A 3TZVB 3GH7A 1AGEA 4LHJB 1E27B 3P4NA 4AMWA 1I7TA 2GJ6D 5E4EC 4MNKA 4X7DC 3STZA 3TYFA 2R23A 3O4OC 4CD4A 3ULUD 2ZOKB 4MHHG 1R7AA 4PJAF 1IQDB 4I48A 1WBXA 1J0KA 4BQ3A 2E3ZA 1HHGB 1KJ2H 5BOZG 1CR9L 5F8QC 1C3FA 4HQQH 4Z7NE 1YMMA 2X4NA 4J4PD 2NY1D 4MZ2A 4Y5VB 4XGZA 5E6IC 5ESQA 4P46B 2V5DA 3CHFA 4K9EH 4PJ8D 3LMYA 2FZ3A 5E99H 3PZTA 5C0JB 3LQAH 4HUKB 5GJTL 3VJ6B 4XCNB 3BRFA 5E9DA 3W11C 1IC5H 4XNUH 3GXNA 3VVGA 4U1IB 1FV1A 2QMKA 2AABL 2DLGA 2A6KB 5B38B 3HC4L 3MOAH 2W9DL 4C55A 3B2VL 4Y2OA 3D5OF 4FFWD 3QPXH 2MPAL 3QGVA 1MRFH 2EPKX 5DJAB 5DMIH 4F7MB 5D9MA 1C08A 3BI9X 5FGBC 4Y5XB 5I8OL 4D6FA 3T0EB 3QDGD 3AU1A 1K8IA 5DVMA 4K3EH 5MHSD 2ARWA 4S1SL 4Z95H 2JCCE 3BHBB 2R2EA 4HFUH 1D6EA 1RZJC 4G8GB 1X5YA 2BSSB 4MCYA 4QHKI 5T1MA 3H9SE 1B3ZA 5TQ0L 3OJDB 4I0PB 3CPLB 1JAKA 4M3KB 3FFDA 1KR0A 3EJPA 4H0GA 1B3XA 2CLZB 4XAKE 1ZVHA 1CICB 4OBRA 5GGQH 1GOQA 1P69B 3RIFK 3FNDA 4IJ3B 4CAGA 3HAEH 2APBA 4GW4B 4OLWL 4Q9RH 2F54E 3HZKA 5MENE 1JWSB 1F8TH 3WELA 4PIRF 2D7NA 1KOAA 4I2XA 3EJTA 1IZKA 1DANU 1HKMA 3ULVD 2R0LL 1SMDA 5IMMB 2AQ1A 2ARJA 3AIVA 3LHPH 2A0LD 1E6OL 1M71B 3CUPB 3KPSE 1A6ZB 2BVPB 2XPGA 5F7EH 3F7VB 5HJ3A 3KXFD 3VX1A 1BWMA 1NFDB 1A3LH 4Y4HD 2YFNA 3NCFB 4HUVB 3LEYL 2OMBA 4FK9A 2A6DB 3WDJA 3GSXA 4UTAL 1JIBA 1JF1B 4OZFA 3SKNB 3UTTD 3SDAC 2BDNH 2DQIH 4RBPH 3T0XA 1TZHB 7FABH 3LS5H 2NXZC 4XMKH 3PWPE 4O51A 3M1BA 3PWNB 3GBDA 2V6HA 4RCAA 3RVWD 1PZ2A 2ZKHL 4HCRH 1RU9L 1NGWA 2NY3B 1IFHL 3S5LG 1NOWA 3VUPA 1XF4A 4G9DB 3ARGD 3GMLB 3RY6C 1BQCA 3D3VB 3ARTA 5BO1L 3IU4L 2OZ4L 2W5FA 4Z7OE 5KSVA 3EO1A 3ECQA 2A3EA 2CUHA 3L3GB 1RULH 4ATWA 3B4NA 4ZENA 3CHEA 2Q7YA 2D31B 1W2VA 4ZXBC 3LKOB 4LXFA 2KPNA 4MAYB 4W85A 4ODWB 2JJSA 5BZWA 4CGTA 3MYJB 3UBXA 1V7ML 4JGMA 2YPVH 3L3HA 1T03L 4JO1H 3TIDB 2OCFD 3FO0L 4UNIA 5DUBA 5IMKA 1M03A 3VD5A 1GJUA 1AXTH 2EC8A 4LAQH 2CHNA 4B15A 1BFTA 5E8PB 1MRFL 3QXDA 1I7UB 3OV6A 3BP7B 3UTQB 3MODH 4RE4A 4GRLC 3MV8A 5C8JA 3IDUA 4F33B 4XNYH 1RIUH 3IJHB 43C9A 3C9NA 3O2DH 1OARH 2JELH 5EZIL 3EDFA 2VR5A 1CXKA 3O2VL 3V0WH 4G7YH 2X41A 4ZOCA 2UY6A 1K6QL 4MAYC 2VDPL 1P2CB 4I5BB 1Y6KR 1YEDB 3MBXL 1RZFH 2DQEL 5I8CA 1J9YA 3WO4B 4EI6B 4BQCA 1CD0A 3MLZL 3DX8B 3A6BH 4NKDB 5IP4A 2Q6WB 1I7ZA 3H6JA 4M6OL 1NBQA 1T1YB 4ZE4A 2R0LH 2AGJL 4XBEH 5JW4Q 2G2RA 2YHGA 1QFPA 4LLVA 3PGDA 5C0CB 1I1FA 1J10A 4X4YA 5GGRY 4NCDA 2BVQA 1I3RA 4N0UA 3U0WH 1TMQA 4U5KA 4WI5A 1I9JH 3LZFH 4L4VA 1FNEA 1SVZA 1AC0A 1U8PA 1JMZA 1YC7A 4PLKD 1MWAA 2ZUMA 1UKQA 1J11A 4P4RA 1TPXC 4OLVL 3CDYA 1MY5A 3QCUL 4HKZB 4UT6L 2E6QA 4Z7NF 4L4JA 2G3JA 2XV6B 1I9RL 1WBZA 3N06B 4KROC 2WHKA 4LDEB 3WUBA 3IF1B 4PMDA 1KIPB 4HHAB 4PP2A 4EI6A 2R8SH 3LS5L 4XMKL 2YMXH 4EI5C 4ACYA 5I8EA 3TA3B 2V2TA 4YFDB 4F57L 1G7IA 4UOZA 1U8QA 2WC3A 5HXMA 1QLEL 3DUUA 3GSNB 1W1VA 4ZXLA 4QF1A 3RPIA 1V3KA 1IT9L 5F7MC 1J87A 2WLYA 5SX5H 5BQ7B 3HRZB 3PL6A 1UWSA 4JY4B 5F1IA 4ZDHA 5ISZB 4X6DB 4QRPE 4X99B 3EKCA 1DUZB 5I75C 2Z35A 3L3IB 4M1RA 2JF7A 4G9FD 4Y1AD 2XSBA 1RUAL 4W87A 2WMKA 1CF8H 3NDZA 2VLRE 3CH9A 5E94A 2Y6SC 4YHNB 3Q1SH 4CDHA 4I4WB 1O7DC 1MCEA 5A8PA 3SDCB 4MNGA 1DN0B 4CVUA 1QR1B 3H0TA 2VR9A 3UETA 1TQBB 5DHVH 5DD1H 3D39D 1CFNA 3SE4A 3LKNA 4PJHE 3LKPA 4GW1A 3MJ9A 3DMMB 3FQTA 5EZIH 4NT6A 1FNGA 3T0EE 3II1A 2V17L 5HHXH 1XCXA 2X8RA 3AIRA 5KVFH 2XA8H 3MBXH 1JWUA 3HCVB 5DQDL 4L3EE 3VXMD 5JDJA 4WEBL 1S7UA 1A7PL 5FYKU 4H8HA 1RHHB 4FFZH 5HTSA 4L4PA 3INUH 3MLRL 3UYPA 1TJHH 2ITCA 3UDWA 4YN5A 5C08D 2FGLA 1EEZB 3QEQD 2VCAA 1QWUA 5FECB 3KYAA 5SWZB 1RUQH 4FFWC 1SQ2N 2ZX6A 1KCSH 4HZAA 4NWUL 1EHAA 4XCEA 3FFCE 2F18A 2OQJB 2C4XA 1JTTA 4KDTA 4P3DA 2AJZA 2XZCH 1F4YH 3HUJF 2WVVA 2VITB 1SEQH 5DWUL 1UT9A 3N9GL 4D8PB 4JB9L 2D9CA 2H32B 5DGQA 1MFEL 3V6ZA 4Z2IA 3CXHJ 4JM2F 1K9EA 3CPLA 3WBDA 5KSUA 4DWSA 5AD0B 4EN3A 4OZFH 2F8QA 2DQUH 3KDMB 4PS4L 1Q6EA 4NRYB 2DL2A 4G6KL 2QV2A 1JRHL 2X4TA 4LLWB 1HHHB 1RJYB 4YC2C 4OV5B 5DZNA 3NIGF 1PKQA 4WW2B 1W3LA 1RUAH 2ICCA 2UWEE 2WUBL 3CXDL 4L9DA 4N8VA 4LRNH 5A6KA 3OZ9H 1YN6B 4MDJA 3MR9B 5CP7A 2VQ1B 1X9QA 3J7HA 5ALBL 4I0PD 2FX8H 4NZFA 4IHOB 3TO2B 4LLUA 5ITBH 1ECEA 4L8DA 3WJLA 4RFEA 5IF0B 1CL7L 1OAZH 5ADOH 2YZ1A 5B3JE 1HSBB 4LPVA 4WFFD 4NZJA 5GJSL 5B39A 2DI7A 1GGBL 1FNHA 5ID0A 4HU8A 2G5BB 4ONFH 2V9TA 5IBLD 4LSUL 1MW1A 1Z6JT 4QRRB 1HXMA 2BMKA 4XPFH 2YPKB 1FO0H 5D9NA 3KNBA 2GTWB 4GQ9H 3ZE1E 1BJ1H 4QHLB 3EW3B 2V7NA 3S35H 4D9LH 4HTYA 3PHOB 5CBAA 4N0RA 1RHFA 2NX5E 2V5RA 3WH9A 2OI9B 3BKCL 3BGFC 1D5ZA 3CDFA 2APTA 3C5SB 1S7QB 2VDNH 4WKHA 4D6HA 4OI7A 3E6FA 5L6YH 1SMOA 1WK0A 3ULUE 1DFBL 1W3HA 5EZLA 2G41A 2B1AL 2FEDD 1F4WH 3R06A 4F9LC 1M6OB 4LCCC 4JHAL 1A3QA 1I8KA 3C6LB 2FR4A 3OXSB 3EBAA 4YIQA 2XWJA 1DVFB 1E0OB 4FLQA 4X9YA 4NRXB 1GUVA 1FGNL 2AK4D 5FYKD 3D1MC 1MCIA 3K4ZA 5A69A 5F9WB 4A6YA 3OJVC 1NWRA 5A6SA 1T1XA 3G6JE 5IEKA 1ZVSA 2EEXA 5BV7L 1B1YA 1IAIM 3O2DA 3DVFA 2CKBB 4QOKA 2AXHA 1UR8A 3WL9B 4ZDHB 6CGTA 4KVNL 4Y4FD 1KEGH 4YFLF 1BOGB 3QH3A 5CMAA 1BM3L 9CGTA 3F7VA 5D8JH 1X5LA 4FLRA 4FZEL 1E4WL 3VFUA 1ZLWH 3W39B 1T83A 5DMIL 4IIQB 2MTPA 1N26A 4JZNA 3EJYC 3U4AA 2HP4A 4WENB 3AAZA 4DN3L 3RWGA 4GXUM 4XP5H 1OAQH 1E6ZA 3BVXA 4QP0A 3ULUF 4FTVA 5CEZH 3FB7A 4MS8D 3AXLB 5FO7A 4FLSA 2OJZL 2UY2A 1ZGLB 3VXUB 2XI9A 4JFQB 3V0VB 4HZ8A 2ESCA 5IBUG 3QIBB 5K9KA 2G60H 3PWVB 5GJSH 3TWCH 2HLAB 4F7TB 1JWMB 1CEOA 2P8MB 3L5IA 1EZVX 4JKMA 5AWNH 3TBSB 1KR1A 4PREB 2LTQC 4I77L 3WY2A 2Y8VA 2PW1B 3GZAA 2ZPKL 4AZIA 1BQLL 3MBEC 1EFXD 1UZ4A 2VDOL 4QLKA 5EBMB 1TE1A 4PLNC 1B3WA 2OTWB 4PJ7A 5BV7B 3WS3A 2R56H 2E9BA 1TTFA 1XGQA 1UA3A 2D20A 5DA4A 5L2KB 4TPRH 4M93B 2J8FA 5JOPE 2R1WA 4MDJB 2BFVH 4PRIA 1EEUA 3B9KA 2FYYB 4ZTPH 4N8CH 4GIAA 3IDGA 3HPLA 5JNYA 1CQYA 1QSFB 4G43B 3ZMRA 2YRPA 3FN9A 4KZDL 4EIZC 5HSFA 4EK7A 4H88H 1CE1H 2EH7H 4XGZB 5ESQB 3SE9H 1ORQB 2V2WA 2O5YL 4NQEA 5T1KD 1WZKA 4CJ1A 1UZ6E 1E1EA 5SWZE 2D3VA 1UFUA 3GBNH 3O3EA 3WKNA 1BLNA 2LTQB 2I5YH 3VXNA 1PG7W 2YC1B 2ZG2A 5I1LB 2XFFA 5CIPA 3B6SA 1Y6MR 2VDKL 2MNUA 4WSJA 3A4XA 4KZEH 1YEHH 3CVIL 3JWOC 5E99L 1P7KA 3F5KA 2HT4D 4YBHA 4PB0L 5F7YC 2P48B 4EUPG 3AIQA 3THML 3K2UH 2H1PH 5TFSH 5I15L 3CZ8A 3BWUC 4LAQL 4MQXC 3T1WA 4FZEH 3X3FH 3NJ3A 4S1DC 3SCQA 4I18B 4ZFOB 5JR1L 3EYFB 3KYNB 2VLJD 1DQML 4O4YH 3GEWB 4HEME 4D9RE 3FY1A 3QG6B 4RISL 4X83A 4MAZA 3BESR 5JPMB 1JGDA 1WZ1H 4B5EA 4E41B 1RQ5A 4LLUB 2CSPA 1WJ3A 4PBVC 4LPWA 2G3IA 5I1JH 1IC7L 1QFWH 5D70H 4FQHB 1T20B 3DV6B 4MNJA 2K7PA 3FTGA 4Y7MA 3UC0L 3LXBA 4YE4L 4WHDA 2VVSA 2E7BA 4B9YA 3SE8L 1A6WH 1OCWH 1WIPA 1OP5H 5SV3A 5K9OA 3QFJD 3WN5B 4JAMB 4DUWA 4OQTA 1OSEA 4P2YA 5JQ6L 1R3IH 1IVLA 1Z9SA 4FQQA 2YIHA 1ZBKA 1WIOA 3LKQA 1TJIH 2YN5A 1WDPA 4ZAKC 4MQXD 2BRQA 1REIA 3KPOB 4TVSa 2HA1A 3U0WL 2EDEA 2JJVA 3VGAC 3TJEH 4QHLA 3LDBB 4HPHA 4PJHF 4IRSC 4Y2DB 4EI5D 3O9NA 4KUCF 1AJ7L 4L4TD 1NCAL 3LEXA 5F7EL 5IHZA 5IFJB 4TSAL 5AG8A 4R90L 3L3DA 1GJWA 2OI9C 4HC1H 3UP1A 2EDOA 3GHEL 4LPXA 3TN0C 3KJ6L 4F9PC 3RTQB 1MIML 1A7NL 3D4YA 3EGSA 5I24A 4NFDA 3ZLQC 1YN7B 4DO5A 3PZNA 1J12A 5FYJU 3BQUA 4WWKC 4M1DL 4KJYA 2OK0H 3BUDA 4HWBH 2LVCA 3LKRA 2AXFA 5GGQL 1KPUB 4JANB 1IKFH 5FCZA 1A6UL 4M9OA 1AE6L 3BOVA 3PXJA 1KCUH 4MQTB 1T1WA 1U8KB 2O93L 4NNYB 2IUZA 3KL0A 2OZ4H 4KJPC 3ZO9A 1GGCL 1JPGA 1NDMB 2HFTA 2VC2L 1KTRL 1IGTA 3GSNL 3L3DB 4MAYD 1LP9A 3IDJB 4KGJA 3LEVL 4W4OA 3S37X 5DQJB 3T2QA 3THMH 3CH1A 3R0NA 1NC2D 3MGOB 4GAYB 4OAWA 1PS3A 1U8PB 4W8BA 4BK5A 4OKVB 5IOPB 2XGBA 5AZ2H 3ZL4L 4APQA 3RL1A 3FN0L 5C0CD 4YH6A 2GSGB 3T09A 1F42A 1U8NA 3LPFA 4G8FA 4KJWC 1KCKA 25C8L 2IQ9L 5B3NA 2WWKT 1AQ0A 3LPPA 3VE0B 2ZKHH 3MLVL 4JVPA 4IMKA 2CRZA 3QUKA 3DX9A 1MVUB 3EBVA 3D18A 5LA1A 1B0IA 2KZ1B 3UBXI 3BGAA 3HZVA 2RQ8A 2VDPH 2XPKA 5L0QB 5ESVA 5CLWA 5L8LB 2JJSC 4HKJA 2ZUQB 1HVQA 4X6DA 3SDXF 5T1KA 1JD7A 5FYJH 5HHVH 4F33A 4NZUL 4YDJA 1HQ4A 3RM4A 1RIUL 3RWFA 5DRNA 5TF1H 1EMTH 5IFHL 2P44B 1G7LB 4XBEL 3ZDZF 1I1WA 1MHHA 1KPVA 3OBAA 5ABFA 4LNRA 3SDAD 4GKZB 3SDCC 4M24A 1WWAX 2P5EE 3IS0X 4ZNEE 3HLAB 5HHOB 3BH8B 2D7TL 3OAUL 2DLTA 3LKPB 1HSAA 4HPYL 4HIHA 4L29B 5FB8B 1UQZA 3AS0A 4RQQA 3VXNB 2PCPA 1EFXA 1U33A 3UTSD 1VDGA 1I1YB 2VT0A 3KPRD 1XH3A 4FQ2L 5C0AA 5FOBB 5J06A 3GSOB 1ODUA 4X7FC 4GQQA 2VLKB 1PG7H 3MLYH 3WHXA 1FE8H 3MNWB 4P49A 5CLTA 1LG1A 4LMQI 2EZ0C 3UZQA 5L88H 4FNLH 4LRIA 3A6BL 5DLMH 1SZNA 1YUHB 3QHFL 1F6LL 5ILTH 4E5XA 3GSNH 3ZE2E 4MGXA 1U91A 4JLRB 3S37L 4PV9B 3MLSH 1FAIL 3C6LD 1UCTA 3F62A 4XMPH 3EOTH 5F70A 5EU6A 3F65A 5C0RH 4EANA 4UIMB 1GHRA 4PJ7B 4OZHA 5DD0H 3ZYOA 4OZGF 1E4XI 3WUZA 4G42B 4PP1D 3C9NB 3L4TA 1LO5A 4YXKL 1BREA 5GISL 2CKRA 1S3KH 3QIUB 4L4TE 4KJYB 3G6LA 5GSRA 1X5ZA 4UB0H 1SR0A 4WTZG 3RM8A 4OLXL 1VGEH 5ISZD 1NMCC 4OQ1A 4F57H 1X4ZA 4DAGL 5FYJD 1WCGA 4QRRD 3F5WA 4C56B 4DGVH 4XHJC 1U8JA 4AISA 3WEXB 3WHXB 4OF3A 1BX2B 4WTWA 5DI8A 2W61A 1DANT 2PTTA 4D0BB 3ZJ8A 4P5MB 2WINB 3BP6B 3EYVB 2P5WD 1LQSR 4JREB 4LLYA 1H8OA 3GSRB 3W81A 4YDIL 1QG3A 1NC4B 3QUYC 2ENYA 5DD6A 4NN5B 1N82A 1PW3A 2V17H 5HHXL 1E15A 4HMCA 2E0PA 2BC4A 3B5HA 1NGQL 3DURB 2Z0BA 4LGPB 4U0QB 4MA3B 2EXWC 3RHWF 4CD5A 4IMLB 4OFYD 4ORGB 4XCCL 1IGIH 5BV7H 1GGUA 3QDGA 1X6NA 3WS6C 4U1GC 2Q3AA 1LK2B 3M8OH 3MGTA 2YPLA 3IDNA 3NH7L 1YPZB 1SEBA 4YO0A 3PL6D 3RA7L 3DO7A 2OYMA 2MQ0A 1J5OH 4HWEL 4PJXF 3MRDA 3MV9B 2IALB 2JB5H 3IKCA 4NFBA 4FABH 1G6RH 3ORJA 1IM3B 3JWOL 3NIYA 4I48B 4MNHB 3E6FB 5E9DD 1DLFH 1MCKA 4XZBA 3OZPA 4GMTL 4J6RH 2PWFA 1D5ZB 3W0WE 4Y16A 1FYTD 2GK1A 2XFYA 2MKWA 2VAJA 4IRZH 5EU7E 1KB9J 3O0RH 3LX9A 3VTRA 3LSOB 4PJBF 5EN2B 2QADB 3K2MC 3DXAD 3CFEA 4I4WA 3SDXE 3R8BB 3WNOA 4PEEA 3LD8C 3HZMB 1TQSA 2YD4A 1XF4B 3KYKH 2LV4A 4G9DA 1JFXA 3VIIA 4P5TC 1DVFC 1W2PA 4ZAKD 1UR2A 2CBJA 2C7UB 5IBUB 4NC0B 1ORQA 5HYFA 2J6EA 1U93B 2FJGA 3KPNB 4GAGL 3BEVB 1IEAA 1H15B 4W8AA 1QLRB 4RMWA 2YPLB 1QFWM 2GDUA 4HJ0C 3AY4C 3V0AC 3VD7A 3AXHA 3ZTJH 1FJ1B 4R97C 2DJ4A 3JXAA 4K23H 2RAMA 5EPMA 5HGDA 4PS4H 4PTUB 3AQUA 1PIGA 1IC1A 4KKCD 1KGCD 4UIMA 3RVUC 1NWTA 2CLVB 2J7DA 5AYQA 3CX2A 1ZE3C 5FXCH 3RI5F 5GRJL 5CJOH 5T5FH 43CAA 2H2SC 4HK0B 4LSVH 4PGDB 2HAZA 3GXTA 2WAGA 2NY1B 3NFNB 4XVTH 4R26H 4H88L 1LDSA 4O2EA 2YD7A 2OLHA 1H5VA 2YD2A 3HZMA 1U8IA 1JGLH 5EWIL 3RZWA 2AJSH 2SEBA 3QI9B 1FGVH 4LSSL 1JDAA 5JMOC 3OPZH 5FOBA 3OJDA 1QNPA 2ZSWA 3MREA 4JJ5A 4MA7H 1RY7B 3FB7B 4X7TB 5DT5A 5I1CH 2AXGB 1OGAA 2AQ2A 2ADFH 5JBFA 3HG1B 1JGVL 1PLGH 5IW1A 2EE9A 1QWNA 4I3SH 2Y72A 3SKMA 3BXNA 3X12A 2B4CH 1BG9A 2ZP0T 3I50H 4HGMA 2X2HA 4R5EA 2AI0H 3QDJB 2EO7A 3K2UL 2CDEB 3W39A 3BKJL 3LH2H 1AGFB 1A9BA 4BQ8A 4X7CC 2EXWD 1MJ7H 3MRIB 4P4KD 2OBGA 4X6CF 4MXQD 3QH3B 1VPOH 4G80B 1VJZA 3D87B 3P30H 1KBBA 3DRTA 5T1KB 3MRPA 3QNZB 4XTRD 4K3DH 3D0LA 2B1HH 2D22A 1FHDA 4U7SA 3PDDA 1MI5A 3CSYB 3OL2A 1K9DA 2YWYA 5K93A 4M82A 2HT3C 1ZS8B 2JCCA 3KYKL 5ICYA 2WHJA 2A6IA 1A1NA 2R29L 2CBIA 4S3JA 1FA2A 2HTKD 2NNAB 4Z7UF 3DDFA 5E08H 2F74A 2VZUA 3QNXA 4UV7L 4RIRB 3WY1A 1DBJH 3QCTL 1XT5A 1V0MA 4B7LA 4A3YA 2PTTB 4D0BA 3R0MA 4S0SD 1EXUA 4U33A 2F7OA 4K23L 3TYGL 2GUOB 3MXWL 2NY0D 1JHKL 2V7NB 3QZWA 4PGBB 5KS9E 3OGCB 5BXPA 5HHMD 3GJFK 1TVHA 3MRNA 4ZS6D 2O9OA 1AGDA 2H26A 4GRLB 3L3IA 4K9EC 4MA8L 3VH8B 1QUNA 4JFDA 3BDYL 1QQDA 3TZVC 3LXCA 3PZIA 5DYOA 3ZYIA 2F53B 5D7SL 3SUWA 2NY5H 2WVSA 3P4MA 5IT2L 4ZUSA 4WU5A 2C4FU 3GXIA 3H55A 5BQ7A 3L3JB 4WUUE 1EEYA 1XHGA 4P2RE 1BQLH 1WKYA 3V2AR 2C8NA 1DWIM 5I30L 5M95B 5IMMA 3U7WH 5KSAD 1U2HA 2F19L 3O9WD 3N11A 3N15A 3S3PA 2VSDA 4RWYL 4JRYB 4PJXB 2R2BB 1K2DA 2RBLA 1L6XA 5A6JA 2YSSA 2BFVL 3AZSA 2DYPA 4HIJA 3KS0J 4EIGB 4WW2A 1CFQB 5BJTA 2CUIA 3N18A 4TNVK 4E4PA 2DMKA 1YEHL 1IZJA 5DJZA 2NXYC 5FYLD 2A6JA 3PP3K 1Q94A 2WMGA 3ULVC 5IVXA 1JTOA 2RB8A 4XCYA 3RU8H 3RDTD 1W1PA 3GBNL 2ATKB 3AU1B 2CMRH 3GMOB 3VCLA 3OKLA 2H41A 5HBBA 3VGHA 4D8PA 3Q3GA 2BVYA 2DI9A 4UTBH 3WIHA 1SFSA 2C1PA 1VFMA 4KI5D 5E0CA 3L7FB 1MSPA 4I0PC