1CGXA

Site directed mutations of the active site residue tyrosine 195 of cyclodextrin glyxosyltransferase from bacillus circulans strain 251 affecting activity and product specificity
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLLDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Site-directed mutations in tyrosine 195 of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 affect activity and product specificity.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
total genus 235
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1994-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgxA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgxA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cgxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cgxA01
1MEXL 1X5AA 2ZUWA 3BLPX 3TO2B 1WE5A 2E27L 1P4IH 3QQ3A 3LPGA 4LLVA 2DQXA 2O5YL 3EOTH 4AMKL 4HJJH 4Z18A 2OYLA 1VFMA 3JWOH 1U42A 4OJFH 4Q58C 3RJQB 2X42A 5BROA 2XFXA 3HE6B 5HHOA 1OGBA 5F9JA 1H11A 5GGVH 2CBJA 2F54D 2FWOA 5ISZE 4V2XA 1NAKH 1IQDA 1S7UB 3ARYA 3PDGA 4LNRB 1FZJA 3ZDXE 5TPWH 5LGJA 4X98A 4W4NA 3PF2A 1VDGA 4HKBB 1UACL 2K9UA 3RGVC 1KG0A 4TNWK 5GQBA 3PZTA 3LXBA 1FLTX 1AD0B 1PG7X 2R29H 2X2HA 4OZGA 2B0SL 4ZXBA 3ZZ1A 1L7IH 1NQBA 4JPIA 2FX8L 3KPSB 3S96A 3VMOA 5GGSA 1EV2E 2DLHA 2EDOA 5EPMA 1I1AD 3TNNA 3CH1A 1XAUA 2VCCA 4UZUA 1Q8MA 3SY0B 1EOMA 2VDML 2ERJB 2W60A 5GRVL 3RU8L 3VSVA 2WC3A 5TDOA 5DJDB 1UKQA 2GY7B 1EERB 1H15B 4I0PC 1XIWD 3NH7L 4K3DH 3S97C 4XPTL 1R5VA 1OCWH 2MKLC 3CLEL 4H5SA 1MWAL 1D5ZA 1HXMB 2C7UA 1OQXA 2DGAA 4KMTL 3MANA 4IOIB 2JIXD 4PGCB 4UNIA 4MDOA 4AIZB 1NBZA 2RR3A 4KTDH 4OD1L 1OLZA 4S10A 3I84A 3MRHA 4WW2F 3VXUA 3FOMA 1P4LA 1FSKB 2R9HD 3RWHA 1FP8A 5BW7A 1UD5A 1TVDA 1GORA 3PP4L 3HUJA 1JNEA 1QVBA 2WMKA 3H6JA 2OL3H 2R4RH 3F4VA 3IFPA 1UZ8B 1VFOA 4JAMB 4F7EB 3FO1A 2C1OB 5D7LB 4PREA 5T33L 5IV2A 2ADIB 5I17B 1XGRB 2R39A 4EXPX 4ZENA 5DD3H 2FD6L 1E70M 5FYKD 4Z7NE 3BUPA 1P84J 5JBEA 4BS0A 4MJIE 4KK9C 1QFWM 4TOQA 3O8XD 1OM0A 4L9LB 3GEWB 1BFOA 5EN2B 3U83A 3BP6B 1CPUA 3AB0C 3QFDB 4M6ML 3MO1A 1U2CA 4CL7A 3L2MA 4Z7VF 4PS4L 3ARBA 3V4PH 1IT0A 2OK0L 3K74B 1B2WH 4GKNA 3VXMB 4JY5H 4M5ZL 3DROA 3OLDA 3G9AB 1B3XA 3WUEA 1EPFA 2QSQA 1OP5K 1MCRA 3SKMB 3DECA 4L8SA 4P46A 1SJVA 1OAQH 5TDNA 1MFCH 4U33A 3AS0A 4O51B 4IM8A 3L4VA 1DR9A 4UFKA 1YQVL 1UKPA 1A1NB 3TJHC 3S34L 3UTPD 4MNQE 4Z76A 2LTQC 1Q9LA 3L95B 4HUNB 3PGDA 3CZSA 2DLFH 5GZND 4Y5VA 2AJXH 3EYQD 5I1AB 4WU7A 1OSPH 1TQSA 4FF5A 4KRTA 1OM3L 4JRYA 4PJ5D 4XRCA 3UBXI 3SDCC 1U3HD 4M00A 2DWEB 2YPVH 3B9KC 3GSWB 1V08A 1JL8A 4JO4L 1CD1B 3ZL4L 3QHZH 5JHDD 3VIOA 2XY2A 3PGCA 2NTFA 1RZKL 2E7MA 4AQOA 1A3RH 2MMXA 4NRYB 1RZJH 3SO3C 1XYFA 3LAFA 3MV9D 1TVPA 1XD1A 3V7MA 1X5KA 4L1HA 4G43B 5F3HB 4FQIL 2D20A 5MERA 5ENWA 1KIRA 4MQTB 5HHOB 4JDTL 2BVOA 2GTWB 4UZGA 3NCCB 2XWTB 3BGAA 3RTQB 2D7MA 5ICZB 1JE6A 4L4TE 1J8HA 2VT0A 2OR8A 2EKJA 2ADFH 4QEGA 3EYUH 4UIKL 4GXPA 2J1KA 3T2PA 4QNPF 3THDA 2GJ6B 4WK9A 1UC6A 3SO3B 2EYSB 3MJ8A 4DVRL 3LKOB 3HZMB 3NMEA 2WBJA 1QOKA 8A3HA 1HH6A 1HZHL 4JFTA 3MACL 4G6FB 3BZEA 5C0AD 4NI3A 1A14L 5D7SL 4D72A 4ZO7A 4TNVF 1U91B 2VLKA 1B6DA 3C9NA 3IJSB 4WEBH 1SVCP 4IISA 1EFQA 2X89A 3TN0A 1KQYA 4HK3J 2Z31D 3RWIB 2NXYC 3TYFA 3KL3A 4HS8L 2VXVH 3ZO0A 3CHFA 3WIIH 3TJEH 2DN7A 1YEJH 4F2MB 1TMCB 3WDRA 2WQRA 2F53A 4NBXB 4LARL 3KYNB 4GRLD 1JD7A 1W3LA 3S5ZA 1U8MB 3LEVH 1LVEA 4YH6A 5D9NA 4BSJA 1T7WA 2X4UB 3QDGB 1UM4L 2HTKD 1RZKC 4OLYL 4N8VG 4NT6A 1JHLH 1YY9D 4HF5H 4L4TD 1FCCA 4MXQD 1LNUA 1C12B 3BGFC 3HI5H 4V1DE 1TITA 4F7CA 4NQVB 1AXTH 2J7LA 1PG7H 2DQUL 5CCKL 2WZHA 3RWCA 3WE6A 4HX1B 2GY5A 4G42B 1SMOA 5DVMA 4LSVL 2J3SA 1Y6NR 4Z7UE 5EIIA 4OUEA 1K4CA 2C0HA 3LS4L 4YQXL 1FG9C 4JVWA 3G6JF 5I19H 2L7UA 3RJXA 1WTLA 4MAYA 3RCNA 2A3HA 3RJDA 2IFGA 4OJFL 5IHZB 1ZT1B 2YUXA 3G6JA 3QUXA 3BAJA 5D70L 1TQWA 4DO5A 1U8QB 4OOZA 2GK0A 1S9VA 3FT4A 1CE6A 1NKOA 3BD4A 4LQFL 4YXKH 1I8LC 1MHPL 4A6YH 4URTB 4BH8A 4NJAH 4PJ8A 3OR7A 3BCDA 3AYRA 1T03L 1T20B 2H1PL 4BH7B 1R3KA 1G7HB 1N6QL 5BV7C 3IFLL 4P3DA 4QRSA 1KB5A 3OGCB 4Q74A 5H35B 4IRZL 2DT0A 4KK5D 3SCSA 4PTMA 1AQKL 3P77B 3ARSA 1G9ML 2G3NA 2EE9A 3D4YA 4Y4HD 3TWCH 2IAMB 3W0KA 4DO4A 4XNMA 5DC0A 5TGBB 4WY7L 1W2VA 1CFBA 1IGMH 4KJPC 1WLHA 2J8HA 5ADPH 3PGCB 4H88H 1KB5H 1XR8A 2FRGP 1V0KA 1JNLH 1QSZA 4X4YA 3W9EB 4WW1B 4XVTH 3IDNB 2IXVA 1R5IB 3LV3A 4PRPE 5DQ9B 2KL6A 3HC3H 4G9FE 4V27A 1MCEA 5E7BA 3PWPB 4A6YA 1HNFA 4PRDA 3KGRA 1ORSA 3CUPB 3MV7A 3CSBA 4WU7B 3HZYB 3IDMA 5C6WH 3T3MF 4BA8A 5M17A 3SUVA 1U3HB 3CUIA 5KVDL 4ONFH 4S1SH 4WWKD 5E6IC 4D0DA 5IF0A 5E2VH 1B0RA 2V2XB 1D5BB 1ZEAH 4GI9A 3NIFE 3P3YA 1KLFA 2YPLA 1D6VH 3MV7D 5FV2A 2VXQH 5I74C 2QMJA 4XPFH 1OF2B 3UX9B 4JZOA 5HHQB 1W2PA 2V5RA 1FVEB 4NRXA 1JZ2A 5EWIL 3UTTB 5HYQB 1XV8A 4YK4C 1WDRA 3S35H 2A77H 5EZOH 4EN3D 1KLUA 3QP3A 4XNYL 1DQLH 3UMTA 4N9OB 3FT3A 1H3GA 1L6XA 4MNKA 3RWGB 1U33A 2QADB 4BQ3A 4ZG1A 1WNOA 3F6IA 4Y2DB 3V5HB 4V2CB 1NM9A 5C08E 5C3LD 5JW4R 1J87A 1ZJAA 2EH7L 5LXGL 1DQMH 3S9DB 4Z2LA 1A02N 1I9IH 1ZWIB 2OK0H 4YO0B 1NMCB 2F53B 2EEAA 5EBLA 3SDAC 2HH0H 3OPZL 4RNRA 3MLYH 1MJUL 2LTQB 1JJUA 3WH7A 1FLRL 3L7EA 1U58A 4ZUSA 1NEUA 4Z5RB 1EHLL 1WISA 4PJGB 4YPJA 1KXHA 5BOPA 2MOVA 3I2CH 5GSVA 5GHWL 3D85B 2D3NA 4ZYKB 5D9SA 1FFOA 2BP3A 1ED3B 1UM5H 3SCNA 1VENA 3L1OL 4KV5F 2A9NL 1EX0A 1YPZB 5J7CC 4D8PA 1I3VA 4QRRD 3NSXA 2DLFL 1KTKE 3O3UN 5K59E 4I3SH 2WMJA 1CICA 1V3MA 4AD5A 4PJXB 1X5IA 2CLVB 5TF1L 2CBUA 1MUJB 3U0PB 1E4XH 2ZXQA 2F7OA 4JKKA 3VXSE 1IAKA 3KL0A 3V6ZA 1LDPH 5JW3H 5JPMA 2HISA 2UWEB 4XCYB 4YHMH 3PGFL 5AC4A 3MCKB 3RDTB 5JMOC 1ISZA 4DWSC 4RWYL 1RK0B 1A6VH 4LEXH 3TOPA 3BT2L 2NY2D 4K9EH 5D7IF 2W92A 1S9KC 3CVIL 1Z5LB 3N9GH 1BAGA 3O0RH 2JF1A 1JFQH 4FXKB 5F1OB 2ICEB 4KHXL 3MKKA 4DCQA 3WUWB 1JK8B 2KQMA 4ODHH 3EOBB 3QNZA 2ARJB 3EYUL 2O61B 3D18A 3OB8A 1BVZA 6TAAA 3WQ6A 1CQYA 4KPHH 4PJ7E 5DJ0B 3WF2A 3IDXH 2OJZH 3DX8B 3RUGE 3IF1B 3RPMA 4PMRA 1ZGLA 1JGIA 2J8FA 3P77A 3UG5A 5F7WC 1GZPB 4R4NC 4I3GA 3EO9L 1RY7B 4XI5D 1AIFB 4L8DB 3HAEA 4CN6A 1C3FA 4NQCE 3BISA 2FNBA 1U8KA 3TH3T 3UTSA 3M8OH 1KPUB 5I2IA 4HS8H 3OGOE 4NDMB 4NZTH 4D3CL 1MFDL 4L4OA 4NWTH 2WSKA 2QQKL 3CFEA 2XHYA 5CMAA 2AJVL 1E6OH 2X4OB 3OHXB 2EXYC 3LEVL 3SKMA 2BK8A 3DI2B 4I2XA 3EZ8A 5IUSA 1K8IB 2ZPKH 4OLZL 1R33A 2A74A 3B5TA 1PLGH 1FIGL 1UA3A 4LIQH 4JL2A 3BMVA 1BZ9A 1DVFB 4PB9H 4ZS7H 4HKZB 4Q97A 5F7HA 2E7LA 3WFCH 5IB3A 1HI6A 2BRQA 2BDNL 1TETH 1NQ6A 1W1VA 2Y8KA 4XHJD 3AREB 3UTTA 4OBSA 3RY6C 4LSVH 3SN6N 5GS1A 3PUCA 3RWDA 4BCEA 3HMCA 4L3ED 1T7VA 1MCDA 2YD4A 4HWBH 3LPPA 3O2LA 3HMXL 1IC5L 5B3NA 1TZHB 1EVTC 4D0DB 1Q72H 1CGXA 3QYCA 1Q4NX 2EJ1A 1ZBVA 5DJ8B 3RWJA 5C0RL 5DFAA 5HYIA 4N0YL 2CSPA 1NAKL 1BMGA 2W65B 1G94A 3VFUB 2OSLB 2JB6A 2WMGA 1TQBC 1JGLH 1PX8A 3CGTA 1QNZL 5DT7A 3DURA 5HYQA 4NQXA 5GSRB 3LSOA 5T3ZE 3CMOH 2D7TL 3HE7B 2CIIB 1EGZA 2VL5B 3B8SA 2DQEH 1UM6L 3AI0A 4HQQL 1C12A 3RVXD 1AQDB 3MYJA 2QSVA 4K94L 1HKMA 2JLLA 4JCLA 4U2ZA 1Z9LA 3KJ4B 2FEDC 3F5WA 1TZ7A 4OGYH 2AK1H 4PGDB 3N0PB 3VO0A 4P23A 2HJFA 4HK3N 4CCCA 5T1DH 4R0LB 3F7YA 1JXJA 3QUZD 4WHYG 2C1PB 2OTUA 3QG7H 3WIFB 1MNUL 1IQDB 1S7UA 5H2BB 1RQ5A 3MUZ1 5I8KH 4ORGA 1MFVA 2EAEA 2DWEA 1AD0A 4CU7A 3JSSA 4OI8A 4K3EL 5FM5O 3OGCA 4J27A 4PJDE 3QUYB 2NX5E 5H8DA 4OCXL 3S36H 1RUPL 4DW2L 1IAIM 1SR0A 1U8OB 2J78A 4NM8H 5FHAL 4I0KA 4KUCF 4QCIB 1U92A 2VXTL 1P2CB 1MI5E 4H25B 3M45A 4WW2C 1CFVH 2NYYD 3AFLA 1A1NA 3D39E 1S9YA 5D1ZA 2F74B 1NCBL 1AC0A 5D7KD 4U6YA 3VWKC 1DN0A 3CU1A 4G8IB 3DV6B 1U95A 3OKNA 4UT7H 3FKUS 1RUKH 3EO1A 5KVGL 4RMWA 2VRQA 4ZOAA 3X14A 5TD4A 1GQLA 3EJYD 5EZJA 3BAWA 1INQB 1KJ2L 4U6XB 3HI1B 2PW2B 2YWYA 3S5LA 1AD9B 2FX9L 2YSSB 5I74B 2EPOA 1NBVL 4X5WA 2HLAB 2XQYK 5E00B 2EDYA 1GPFA 3TV8A 4JFHE 2ZUTA 3JTSB 4JG1H 4LLUA 3SDYL 1JGVL 3HG1A 3WFBL 1DSFL 1U8IB 2E3ZA 1BHGA 25C8L 5LQBL 3IXTB 4BQ6A 5E8DH 1J0ZA 7A3HA 5KOMC 1N26A 3T65A 3CUGA 1SEBB 3TA3D 2C1OA 1J0HA 3OJ2C 4I2XB 1I1RA 3HPLA 2VKWA 1RI8A 4G7VH 3BRFA 1WJ3A 3E2HB 4NO0D 3OKKB 3EJQA 1PKQA 5IT2H 3CFJB 6CGTA 5EUOB 2ARJQ 5E2TH 1UYWH 2IGFL 3C60D 3QO0A 1WP6A 1ZV5A 4P7OA 2C3VB 5L88H 1WT5C 1GONA 5ICYA 1KPUA 2WPGA 3V6FB 3O11B 5C0IA 2Q7YB 5JLZB 4L4JA 1XH2A 4GSDH 4LCWE 2PWHA 4N9GA 3WN5A 1U3YA 2X89D 4XV0A 1YC8A 2PWFA 2VR9A 5TGBA 2CKSA 1ODAA 1I1FB 1LK2A 2NY6C 3HFMH 4X7EC 3W39A 3SIMA 2P5WA 2L0DA 3B8YA 5JORA 1J9YA 3NCEB 3PP3K 5HHMB 1J10A 2WHJA 4AL8H 3VFPB 4M7LH 3BDBA 5A16B 5D1XB 4ZS6C 2DSZA 3U0TA 3PGFH 4V2BA 1F02I 3FQWB 1GYAA 1P84K 4WI2A 4FZEL 2XUCA 3FN0H 4ORGB 3ARED 1OGAE 4MAUH 4NFDA 5D1QA 2WWCA 4P3CL 5CJXA 3HI6H 4IRSD 3BUBA 1L0YA 2E40A 2QLYA 4NN6B 12E8H 2XXCB 1MRCL 3KS0H 4JFFB 4RFNB 3N11A 1INDH 3MRBA 4HLZG 4MDJB 3VFWA 4GZEA 5FGCE 4FFWD 5IJVB 2BV9A 3ZT5A 4J23A 5CS7A 1CLOH 2DL2A 3IAGC 1S9VB 3T1WA 4HX1A 5FKPA 4C59B 3ZYJA 1T1XA 4NKQB 4U1LB 2EYRA 3IFNH 1D5IL 4JM2A 2UZIL 3IXAB 5HDLA 2PNDA 3HKFA 4TTDC 3AS2A 3WFHA 4OFYA 3TONA 2Q6WA 4PJGF 2XVNA 3T2OA 1QFUH 5CJ8A 5FYJU 1MLBA 3F5KA 2MQ3A 4JREC 1UA6L 1BF2A 3GJFA 5KSAA 1G7HA 4ODUB 4HJGA 2BVUA 1DUZB 1QEWA 1ZVSA 1MY5A 4O2CB 4M9PA 2HT4C 4Q6IA 3K2UH 4R4BB 5HGBA 4BQ2A 4EE9A 4P2CG 5DT1L 4E5XA 3ET9F 2W38A 4PUBL 2VLLA 5CSBA 4BKLB 4OZHB 2NY5H 2Q86B 3ULVE 3QNXB 3LZFL 3QDJE 4Y19B 1UVQA 2NLJA 5EU7C 3LQZA 1SBSH 4FG6C 5MP6H 3C6LA 1FH7A 4NF7A 4JPKH 3KHQA 2W60B 3V8CA 1LE9A 1KUMA 1CR9L 5JHDA 2V2TA 1PZUB 2R56H 2IADB 5FF6B 2MJWA 2XPGA 4QO1A 1U6AH 1D6EB 1HHGB 1BAFH 4YLQT 2Z31A 1SMDA 4PR5A 4AT6A 1F6AB 3L5WA 4IIQB 2M8XA 1F4HA 4DWSD 4YWGL 1ZA6B 4UILL 4UT9H 4EEEA 2XZAL 4RGNE 1MW3A 4QTHB 1K4CB 3HA0A 3A6CL 1T80A 3DO7A 3AYSA 4LKXA 5EOTA 5CLWA 1TA3B 3NACH 5I78A 4D6JA 4PJIA 5F3BA 1G7MB 4LPVA 1KCUL 5ANME 3ULUH 2H32H 4AD1A 1VERA 3FT2B 2I24N 3D39A 2GTZA 3RIKA 4DM1A 2FX8H 1LEGB 4ZAKA 1C90A 3WLBB 2FX7L 4JAMA 4L4TA 4ESKA 2MQ0A 3JUZA 2J75A 4GRWF 3DOSA 4IMLB 1FZMA 2YL6A 2P5WD 2V7HA 3VIGA 2Y5TB 5F44A 3T0ED 1XF2A 2HKFL 1E4KC 1HTYA 2GJRA 3BHBA 3A24A 1RP8A 2NTFB 4DKFL 4GRWB 1OT2A 3LIZL 4IDLA 4QRRB 3WLWD 1FGNL 4BFIB 3OA5A 4MA7L 4ZD3L 2ZUMA 5C9JB 2Y36H 5FKYA 4JRYE 1E4WL 1JWMB 3RX5A 1XR9A 1N6QH 1XRVA 1I1YA 4YX2H 1NDMA 2H41A 3OG6B 4P5TB 2X7LB 3PV7A 3ILPA 4U6HB 4Y19A 5AZEL 1DHKA 1G84A 4HQQH 4ZPVA 1G0XA 5IVXB 5F9AC 1NGZB 2IADA 1LK3L 2E0PA 4G8GE 4WGWB 4DWSA 3RY5A 1WBXB 1R3JA 1E5NA 5D8JL 1LEIB 1BZQK 5IBUB 4KK8C 3WD2A 1XCWA 1H3XA 4MX7B 5JO5A 2YHGA 1ZLSL 1NCUA 3IJ8A 4ML4A 5E1HB 2YD3A 5FOBB 4FG6D 4DK6A 4Z7VE 5DJYA 5A2BA 4Y16A 2RAMA 5CZVL 1VJZA 3MC0A 4XBEL 2QPSA 4PRIB 5I8CA 1QRKA 2ZSWA 3SDCA 4EN3B 1VFBB 4YDJA 3FT2A 4N0CD 3QDHA 3VGAB 3GMRA 1GGCL 5JPMB 1KSRA 2CPCA 4W8BA 1OSZA 4M5ZH 1YNLH 1UEYA 4ODXA 4R2GB 1HX0A 4YUEH 4MJIA 1XIWB 4HUXB 1WC7A 4KVCL 5FAAA 3ZDYE 3GGWA 1WB0A 3GSVA 1ZBCA 3IDIB 3IDJA 1ZVHA 4MB4A 4JEGB 4NN5B 5E6ZA 4LMQE 3TT3H 2GFBB 1CXLA 3BH8A 4K71B 4LAQL 5KANG 3DHMA 5FO9A 3MROB 1MF2L 4TUJA 3NJ3A 1GC1L 4YGVB 1GOIA 1DBAL 1GQIA 2DH3A 5BCAA 4KROC 3O45B 4NZCA 2BSTB 4NQDD 5FCUL 4GBXA 5F70A 1WZKA 2P5ED 2AAVA 4GIAA 2EYTB 3RIAF 1QYGL 2CO6B 3RA7L 1WZLA 3U4EB 4JE4B 4U1GB 4P7LA 1NMBL 1AXIB 5E8OA 1OGTA 3D2UD 1KTLB 4N1CA 4X6DB 3W9DA 4PJHE 4MNQB 3SE9L 3U9PL 5L7XL 3RWFB 1Y6KR 2VDLL 4UIMB 1EFXD 4PP1D 4R90H 1HYSD 2WINB 5AYUH 1HHGA 1QFOA 3ZJKA 3DLQR 4HKXB 4QF1A 1YHTA 2VYRE 4BFIA 1P4IL 5AG9A 4M7KH 3DX9B 3CZKA 1JYWA 1PBYA 3R06B 1MXDA 1CS6A 3QIUD 1UWQA 1G7PA 5D7IA 1Q6FA 2YL5A 1CFNB 5AUMA 1KJ2B 4XVSL 2R0LH 3LQAL 5KN5B 4FMFA 1KTRL 1OVZA 2VXSL 1NLBH 3D25A 4JRXD 3EJUA 1OTTD 4Z78B 3STZB 1KELH 4YHGA 3K4AA 1BREA 4OLUH 1HJWA 3SCQA 5EZJB 3ULVF 4WTXA 1I1AB 4FLRA 5DMKA 4DWSB 5CQ1A 2OYKA 1S7TA 3HFML 4L9DA 5E56A 1AD9A 1Y0LA 2VITA 1HK6A 2WAGA 3V8OA 4HG4J 5GISH 5C0FB 3C2AL 3VIFA 3CFBB 1FFPB 5IMLA 4YC2B 5DJAB 4XI5C 5HGHA 3BLBA 3ULSA 4G3YH 1GVIA 2AK4A 5JW5B 1FDLL 4XPGL 4WFFD 2NY6B 1VBUA 4XZBA 3O2WH 3DGGA 3IU3B 3LPWA 2MCPL 3BZFA 2G41A 1CGTA 1G7IB 4KPHL 3WXVL 5KSBB 5FOOA 5JIIA 1E28B 2FDMA 1ES0B 3NABL 3DJ9A 4JFXB 1JRHI 5FA4A 1JTPA 4PB0L 1CD0A 3ZYIA 1E72M 3GIZH 4PJBF 4U5IA 4FQ2L 4JHWL 5JIWA 2JK5A 5DF0A 5EU5A 3CH1B 1I9EA 1V02A 3TZVD 4KTDL 3QAZB 4OD1H 1ZHKA 1YDPA 5CCKH 5DJ6B 1MCPH 2CDGA 3ZT6A 1DVFD 4JFFA 1O7AA 5FYJH 3QDGE 1T4KB 3IS0X 4UNVA 1MEXH 2C9AA 3ALPA 5HJ3B 2OQJA 3CDGA 3TIDB 5DZNA 2R1WA 2ZSVB 4OTXL 5D7LD 4O9HL 4HAFA 4Y2DA 3B2VL 1TVNA 3AHTA 3UTZA 5ALCH 4YDJB 5F9WC 3D5HA 3VRJA 4A3HA 2J7CA 3D1MC 3WDHA 5A2AA 3GMPA 1KB9K 1E6NA 5I1LA 1MRFH 32C2A 2VLMD 3QIWA 4U5KA 4ZS7L 4GRMB 3L5JA 1OB1B 3NA9L 1MCLA 3L6FA 1MRDH 4MX7A 2FGLA 1BVKB 3MV11 4OZHA 3GMOB 2QKIA 1DBJH 1NAMA 3HMWL 1KXVC 2PETA 2Y6SC 3PHOA 4ZPTB 4JO1L 4HAGA 3AGVA 3D69B 1FC2D 2FR4A 1DVFC 3VIKA 2EPMX 1T21A 3MRLB 2ATKA 4LVNC 4OCRL 3TBVB 1B9ZA 4HMCA 2EDJA 5F71A 2GHWB 1BGXL 4RRPG 5EN2A 1QX1A 3C08L 3QJFA 1O5DT 4DWHA 5CSYA 5GZNC 1A9BA 4PMZA 2NX5D 1SMAA 4XX1G 1INEH 4HV8A 5CXPA 4I18A 3O9WA 3HC4H 2AJXL 2BVDA 3RVUD 3E6HA 5CD3A 1K8DB 3NFPB 1OM3H 3BP4B 5E8NB 2GTZB 4AZ6A 3NCJL 1KIUA 1JGEA 3MYJB 1DBBH 4W4OA 3GIVB 4XPBL 5D2NE 2Q8BH 1HF6A 4H0HB 5EU6A 1HHIA 3WKML 2X6MA 4AG4H 1DBMH 1QQDA 3MNZB 5SX4I 3WH6A 5GGUA 1PGRB 1SQ2N 1HNGA 3BE1L 4ACZB 1MQRA 3I6GB 3MLWH 5JUVA 1AXSA 4P5KB 3IJYB 3V6OA 4S1SL 1EAPA 5EZLB 5HDQH 5DUML 5DI8A 5E5RB 4OZ4A 1WAWA 4RISL 2KUTA 3GJEA 5ESAB 4ZQKB 4MZ3A 5EOTB 3MFFB 1MVUB 5BW7C 2EIDA 3B4NA 1PZ2A 1II4E 2NZ9D 2YZ1A 3VXSD 1ZGLB 3MZGB 1E3XA 1ZT1A 4Q0XL 4QGYA 2WIMA 4ZDHA 3WIHH 4E9LA 2WCAA 4LP4A 5HVGB 2VTFA 3HE7A 4URIA 1T2QH 1JI1A 2VLKD 3A5VA 1BBDL 3HPLB 1XCQA 1WVZA 3Q5YA 2PO6D 1ZLWK 3UTTE 4K71C 3EHBC 5EO9B 3ARFB 3PWVA 3FOLA 1MCCA 3I50H 5J6GB 1V8HA 1RUQH 4M03A 3MCKA 3TO4C 1HN1A 4XBGA 4NJ9L 1B6UA 4KV5E 4OZFA 2X40A 1EHLH 5ETUB 1HL9A 3WBEA 2PN5A 1JWMA 5FYKH 3W25A 4K8RD 3MA9H 1RURL 4LNRA 2A83A 1E6ZA 4I0PD 4W6WB 3RZCC 1C16B 3QQ4B 2V7NA 3OLIA 3FFDA 4TOYL 2PBOA 1BBJB 4G6AD 1R86A 3U79A 4LSRL 3KYMA 2VWEE 4XCNB 3VXTA 1LEIA 5I8OH 3A22A 4FQHA 1E6RA 3DUUB 1Q9OA 2AXJA 2ZJSL 3VXUD 2VCAA 3LKRB 3OAYH 2DQGL 2QBWA 1WFTA 1PX3A 4MXVF 4OZHF 4LHUD 3ARGC 2HFGH 3S5LG 2E8ZA 4OLVL 5ID1A 3GXNA 2F8OA 1ZLUK 5B39A 5DK0B 4GKSB 2GJJA 3G5XB 1R24A 3HC0B 4FTVB 4QY8B 2A3BA 5LGHL 2NY4C 5DVOA 1S7SB 4WV1B 1AGFB 1HWGB 3LS5H 1YC7A 3L3GA 2O5YH 4AMKH 4I0CC 2FB4H 3O11A 5HI3D 2FHFA 5C0IB 1IEAA 3B3IB 5BXFA 1H0DA 2C4XA 3PTKA 3LKOA 4OM1H 3ZHKA 4UOW1 3MLVL 2YJQA 1MJJA 2YPLE 2X4PB 2BY2A 3BVNB 5E99H 2YBRA 4Q6IC 3RUGF 3EFFB 3NIYA 1P7KA 4NN6C 4KZEH 1CN4A 3RWGA 4DN3H 2AAAA 5E00A 4UNTA 5A2CA 4LSUH 2YD1A 4KDTC 1KCKA 1D5MB 3W81A 3MNVB 4CUCA 3VG9B 1AFVL 4ODSL 2EIBA 2X5PA 1Z0NA 1D3CA 1X5YA 3LQZB 2HKHL 1SM3L 3OSKA 4XVUD 1C5BL 3UXFA 3Q5TA 3BKYL 3PBGA 2GQHA 3LRHA 2ICWI 3GSQB 3WIIL 4J3SA 1MELA 3AXIA 3ARPA 4LEOB 5B8CB 5A1AA 5I1DB 3KLLA 1KPRA 1O6IA 3H0TB 1MRCH 3SE3C 1F6AA 3L5WB 4IIQA 2QQLL 5L0QB 1N59A 4ODVH 3TGXA 3GI9L 2EDHA 5F8QC 5I6XC 4XPTH 3WFHB 1BQSA 1JPTL 3GXIA 3AMKA 3QGVA 1YNKH 2QADC 3LV3B 4X8XA 2APWA 3W39B 3PABA 2DBLH 5E6YA 4APQA 2HT3C 3KPRB 3GSNA 3HZVB 2RB8A 4WWKC 4PB0H 4PLKD 3A47A 1IILE 3QEUB 2ZUYA 2IMNA 4APQD 5ACMA 2MNUA 1VPOL 1CLZL 3HZ3A 4LU5L 3VGBA 4OZIE 1IZJA 3BMWA 4Q9RL 3ZJ8A 3P30L 2HG5B 2P1YA 4PG2A 2YEZB 1HWHB 1OD0A 4Y0GA 3MGAA 1RZ7L 1ES0A 2ICWA 4EAMA 2GITB 3DXAB 1DUYA 3WBDA 1U8JB 1QSFB 3MCLH 3S4SG 3GSOA 1DCLA 1UWGH 2F5AH 3AM8C 3H9SD 5DJYB 2EO7A 5I2UA 1RZGB 2YXMA 5DRWA 3CZGA 4OZFG 4NCC2 1NFDA 4NKMA 3B9VA 3D51A 4F66A 3O6ML 4AWEA 1GOGA 1BLNA 3HLAA 5IW1A 1IARB 1ZWIA 2ESVD 2NY1D 3MYZA 4ENEC 2ZUQC 3WNKA 3H3PH 2WMPA 1YEEL 3BCFA 4JO2L 4R8WL 3PQYD 3GBNL 4FXGB 1X5XA 4NP4H 4RDQG 3U57A 4OBRA 1KLUB 2BVPB 1DWHM 1K3IA 2Y5TA 1T6VN 4XCNA 2YPKA 1J18A 4WO4A 2AJUL 3I2CL 3PXJA 4ATWA 4QRPE 1FORH 1VGEL 4Y4HB 4ZTPL 4JHBA 3O8XC 1JAEA 5E8PB 2WUCL 3MLTA 1NP0A 1UT9A 4FQXB 4H8UA 1TDQA 4QHUB 4OZOA 2X1WL 3B6SB 2IANE 4XP6L 3WQWA 1EEYA 5IBLC 1IBGL 4I9WD 3VG0H 3L4YA 1BEYL 2G5RA 3DO7B 1K6QL 4LCCB 4PJGA 2XM1A 1RUML 3B3IA 1IEAB 1K3ZA 1I9RH 1PAMA 2G2RB 4PRNA 5DHYA 3QXAB 3SCTA 4IM4A 4F9PC 2CRYA 2CK2A 1HXYB 1KPVB 3B2UC 3K8LA 4E0RB 3WH5A 5I23A 4B7IA 1JP5A 4G7YH 1LK3H 3BVNA 3TFKD 3WD4A 3LQMA 4M48H 1KJMB 3OB0H 3K4DA 3H7BA 4U2YA 3KPRA 2F18A 3AOFA 1QBBA 5E2UH 3MLUH 2DIBA 4XP9L 3QHMA 3BZ4B 4XHQA 1TVHA 4PRHB 4UIKH 3SGJA 5D1ZC 3BWAA 2ICES 3O0RL 4P9HH 4KFZC 1C91A 3BAXA 3WUWG 5EORH 4AZHA 4K2UL 4RSVA 1KJVB 2WC4A 3ALGA 3C60C 3A4WA 4LVHC 4MJIB 1X7QA 3VXOA 5B39G 1EJOH 4RMVA 4WW2A 5AY7A 3KWWB 3T0BA 3N13A 3UROR 1OAZL 2Z8WC 2R69L 4Z5RA 1XFPA 3V95A 4R9HA 4XH2A 1JZ4A 4EZMA 4F33B 4KVCH 3T0EB 2A6KB 2VUYA 2VLJD 4PJIF 1AR1C 1IAOB 2CLZB 4H8WH 2OWWA 2IBBA 1QWNA 4JFDB 5DJXA 4CJ1A 1EHAA 4HS3B 3C8KA 5E9DB 3IAQA 2VXUH 1S5HB 4NRXB 4PEEA 1F6FB 1UKTA 4JLRA 5SWSE 4WI3A 1HDMB 5IFAL 2I60H 3T0DA 3E1F1 3MODL 4JCMA 1U2HA 5CUSH 2ATKB 1H1NA 2RFXA 1BWWA 2VMFA 1QLEL 2G4FA 2H26A 3WHXB 4IDJL 1F90H 2X9YA 5JPNB 2XACC 2AJZB 4M1CD 3Q6FA 2VWEC 4MCYA 4F7CB 4Q9QH 3WFEL 2QSTA 4ISVB 5E9DD 1U3HC 3BP5A 3VGDA 1FIEA 2CETA 1RZGA 3C6SB 3TCLB 4LCWB 4EUPB 2VI0A 3U7AA 2FB4L 1T5WA 2ZX9A 3HU7A 4RIRA 4QOKB 1YPZA 3VRJB 1CDCA 1UH2A 3T4AA 5KTEL 2AKRA 2NNAB 4OIFA 1RZFH 4ZXBC 1G1CA 4MXQC 5D7JD 3IJYA 4FFVC 2VLJA 3O6FC 2BSED 4JFEB 4NPYA 1E4IA 1IE5A 1CVRA 4X6CB 2AP2A 2UZYB 5CBAB 3QDGD 3RVTC 3CMJA 1JGLL 4Z2HA 6A3HA 1NGWB 2E7HA 5BV7H 4RA3A 5IEHB 4OI9A 1K9EA 4EDXB 3RU8H 4NZJA 1FL6B 4XPAH 3M07A 2XTJB 2FE0A 2XNAB 5D2LA 4J7RA 3TBSB 3DVIA 3OKDA 3SDDB 5J6HA 4F7EA 3W5NA 4UFLA 3CLFL 2GSJA 3OR7B 4YZFE 2BFVH 2NT0A 3U7YH 2DTMH 4WEMB 1MFDH 3D0VA 2ATPB 1GSMA 1XGYL 3OJDA 2WNWA 4KK6C 3TZVB 1PG7W 3O4LE 5LG1A 4NZUL 3TF7C 4CCEA 3U9UB 1A7NL 4C56E 3NPSB 2OS7A 1IGCL 1X5GA 4POZD 1CR9H 3L6FB 3UC0L 2EE6A 3QH3A 4ZFGL 5JNYA 5CIPB 3GI9H 4HWEL 2E6JA 1EZVX 4JPVL 2VVSA 2EO9A 1H49A 2CIKB 1BAFL 4MLIA 4MJ6A 4HZ6A 2JJTA 3GIZL 1BVLA 4FQXD 1HP4A 1G01A 3U5UA 1GRWA 2AOSA 2NZ9C 3BPNC 4QCIA 1IQWL 4Z8FH 3HCVA 4PIRF 4GT7A 1B4JL 4LYQA 4TVPE 1HXMA 4HGKC 5I6XB 1BG4A 1WKYA 5GZOD 4KUCD 1I4FA 3WF3A 3GJFK 3ILPB 1CLZH 4D6CA 2KBGA 5L2KE 1B0RB 2V2XA 4PD4J 3E3QE 4N5ED 4LNVA 1P7HL 5HI4C 1XCXA 4XBPA 3RNQB 8FABA 5EBMB 5FUZH 3WO4B 1XIWC 1MFCL 3BUTA 5IB1B 1EDGA 1Z2KA 2NY3C 1CTOA 3DV4A 1E4JA 3MRBB 4JGJA 4F2MA 3ZR5A 2O5ZH 4R4FL 3JWDL 1S3KL 2DM4A 3KPNA 2J88L 5BO1L 1GH7A 3S88L 1W72A 2WWMC 2ESVE 3QCTH 1QNZH 4GINA 5DJ6A 1TVBB 4C56D 3E6FA 4XRCB 3TJHD 4JGUA 2EE3A 1N6UA 2VZUA 4AD2A 3GSXB 2YPVL 3H9SB 4MA7H 3HMWH 4UU9B 3A67L 5HPMA 4N0FB 1U8JA 3Q48A 1RZKH 4RAHA 3MJ7B 1IVLA 3VXRB 5FO7B 1ZMYA 1ZHLA 1FHLA 2VLJB 5CIPH 1EAJA 5ID0A 4NXSA 1AI1H 3QWRD 4GRWE 4WW2B 1SYSB 3DGCR 2X1QA 4N5EC 3BZDA 1S9WA 1CGWA 1J0IA 1NL0H 2A83B 5I1LB 4FLSA 2AJUH 1MFAL 4RAUB 2VZOA 4AD4A 1UYWL 2IGFH 4LCCC 5ISZD 1JG9A 3JZ7A 3KYMB 4MA8H 4G8EB 5BXSA 4MAYB 3ARGB 1A4KA 3TVMC 4K3EH 1U8QA 4J1UA 4KC3B 4KRLB 3K80A 3RILA 1FNSL 4PLKC 4D6DA 4FQXC 5FV1L 5IHZA 2Z0BA 4LSDA 4ALAH 4O5LH 2QKIB 2A3CA 1YEGH 2J6EL 3R8QA 2ATPA 4K94C 1IM3B 3BI9X 1Q0XL 2YIHA 4PRPA 1MAKA 4KAQL 3MA7B 4Q22A 2X70B 3BQUC 4LRNH 1GZQB 4XCFH 2FYVA 1BJMA 5CEZD 1KN2H 1FPTL 5CSGA 3U4BH 4DVRH 1RUKL 5KVGH 2GFTA 2VXVL 2VQTA 2X41A 3IFPB 3WBAA 4UMGA 4U6XA 1P69B 1EEYB 5CP3H 3BSHA 4L4PA 2IG2L 5D6CB 4W7UA 4YDIL 1B2YA 2V9QA 4HXAH 4F7PB 3I6LE 2CIPA 4OFIA 2BSSB 4GAJL 2IAMD 5JMRA 4KXZH 3QAZC 2ZNXA 4FQPA 1GL4B 5M3WA 5CJBA 3I85A 1FVDA 1P6AB 3A6BL 4CDHA 1K9FA 3MRGB 3ARBB 25C8H 1J12A 1S8DA 1N4XL 1XGQA 1OAZH 1UYQA 4GRLB 1CLYL 2VKXA 3IF1A 3T3ME 2DPEA 4GG6B 4L8DA 2ZWLT 3G6JE 4XMKH 1CECA 4F37K 3KXFB 3CZJA 3LRSB 5IT2L 4HJJL 5EUKA 4OLEA 3RVVC 4WIQA 1LP9E 3SO5A 2VRJA 5CZXD 4XCEA 2DD8L 1IKNA 1T04B 1T0NB 5D9OA 1QFHA 1NH6A 3SUSA 4UTBL 4XTRD 2VC2H 5GGVL 5INDB 4PJ9D 5D9MA 5BJTA 3OGRA 2DSKA 1FIGH 2GK0B 2WBWB 4N68A 3PHAA 3E3QC 4OIIL 3QEQE 5E0CA 3FT3B 4YQXH 2OW6A 1AQDA 7TAAA 4JIEA 4ELKB 1G7MA 1TETL 3C5SA 1T21B 3MRLA 4UNUA 2XZAH 4DQOH 4QRSB 4PSRA 3GB7B 3N12A 2B0SH 3MRJA 2CUIA 3H0TA 3T65B 4PJXE 3ARRA 1NMAL 5FB8B 4QHLA 4ZAKD 3DDFA 2YD5A 3VXRD 3BPCB 4G43A 4MHHG 4XAWH 5A40E 1GNXA 1U3ZA 2YUWA 5ABFA 4JVPA 5C09D 5IW6A 4JFZH 1FFOB 1AE6H 5A8QA 5CSZA 4KKLD 3HG4A 4IRSB 3VFRB 5AAWA 2GEEA 4JDZB 5E08L 1CL7I 4G80B 1A6WH 3NCYP 4YXLH 1R34A 4GLRI 4GZIA 4NGHL 4AZ5A 2P8MA 1R75A 3LKRA 1AQKH 1FFRA 4S3KA 3UYRL 1L4IA 1AXSB 4LCIL 3MRDA 2D7TH 1UA6H 3X13A 3P9MB 4JKWA 3DIFA 4ZD3H 4YDVA 1TJGH 2BNRE 3DV6A 3QNYA 2WZPD 2N7AA 4WENB 5E1QA 1W0WB 4F9LA 4UV4H 1VFFA 4H88L 2NW2A 3F7PC 4YHYC 5MEQA 4RZCA 3QEHB 4OGYL 2NY4B 3H9SA 5KAQG 4Y4KC 3WEXA 3UPRB 2PTTB 4R7NA 4P3WA 5HD8D 3FB8B 4TXEA 1WGOA 1UQZA 2XIDA 5ENWB 2J47A 3OKMA 2GVYA 3BD5A 3RDTD 3AQUA 3P11H 4OFYD 5SWZD 1CLVA 2WWKO 1YNKL 2BNUA 5LVEA 2XFXB 1QO3A 3W28A 2A77L 2C1PA 4K7PL 3TBWA 3NCYS 3TV3H 1BIHA 3QHNA 4R26H 4NO0B 3GSRB 4ZPVB 5IVXA 2DDQL 3ARGD 4XZUB 2VXTH 4XGZA 1U2YA 2CMRH 3QIUC 1FFQA 3ES6B 1ESWA 4P2RA 2VLLB 5FIPA 2BHZA 4M80A 4NWUL 2V38A 5C9KA 1BZ7A 1MOEA 2H26B 1QNOA 3BESR 4ZUVB 3IDJB 3N9KA 1RJZA 2ZICA 5JDSA 2NXYB 3U46A 4M02A 2IGTA 1FOBA 1MIEL 4F7MB 4GQRA 2OI9C 3BKML 4S1DC 5ESAA 3ZT7A 4LGPB 2NY7H 4MJ5B 2A2QT 2LV4A 2D4FA 3VXTB 4P46B 5CJXC 4ERSH 2X44D 4NQDA 2PR4H 1XCTB 5DDHA 3IFOB 5DQJB 4NQTA 4OIBA 4YHYB 1MF2H 4ZFFB 3L1OH 4CKVX 1QLFB 4QYOB 1TTUA 1A7PL 3S88H 3D6GA 1KWKA 1WDQA 5EO1B 5TDPB 5SWZE 2H32B 4BM7A 1I7ZB 1QKZH 4MNQA 1OD7A 3I75B 2B1HH 5EZIL 4M3JA 4PTXA 3MUHL 1RVFL 5IHSA 1M05A 5K93A 5TH2A 2QHAA 1E4XL 3VKKA 4U0RB 2J62A 2GAZA 3SGEI 1XF3A 1CICC 4RMQA 4YHML 3MLWL 1YYLL 1FP9A 3VWJA 3FQRB 1FA2A 3EMCA 5IWLC 3H8NA 4Z7WE 1OTUD 2BHUA 2HVKA 4P2YA 1CFTA 5HDRA 2I07A 4P7NA 3EDDA 2LU4A 2VDNH 3BIKA 5JXEC 4LKCB 4X80H 5CZVH 2FO4A 5IVNA 3B9KB 4ONHB 1FNGB 4J4PC 5FYLH 3WD5H 2OW7A 1CD9B 1QSED 5JOFA 5IHUH 1UGNA 2J5LC 3BGMA 5DMIH 2H9GB 1WWAX 4XMLH 1PIGA 3GI8L 4JFED 1JAKA 3BPCA 4KHTL 3SDAA 3DMMA 1KELL 1V0MA 2A38A 1M6OA 1KF9B 5C1MB 3HRPA 3SJVE 4B53A 3UTSB 3DVGB 1FHGA 2OR7A 2IALA 5DJZA 5C92A 3LMJL 4K7FA 2IH3A 2EDTA 1K9TA 2EDBA 1RUQL 1GIGL 3OR6B 1RULH 1EVUA 4P3CH 5BZDB 3A21A 3BVUA 4P4KB 3WUBA 1KEGH 1ACYH 3MR9A 2OWCA 1OARL 4RL3A 3ZKMD 4NWTL 4D6EA 5F7NC 1HL8A 5FCUH 3GHBH 3QPQC 4HV8B 4P4KC 1I75A 2YBRB 5C0CB 3QDGA 4P2RD 2Z8RA 2PI6A 2YSSA 1W8OA 3ZJ7A 2AQ1A 3VJ6A 1A4JB 5BS0B 1EJOL 4LPTA 4KI1A 5C07A 3S4SA 3IRPX 4PTTA 4KI5C 5FYLD 3RZCA 1T2JA 4JFDA 5J1SC 1NDGA 4UQ2A 4FNRA 5E5MA 4PCSA 2VLRB 1I7RB 4C55A 5J89A 1CK0H 4J1UB 3ARDD 4D9LH 2NY2B 3RHWF 4M24A 4N90E 3SE8H 1PY9A 1UD8A 1EK3A 4U6YB 2ZX8A 3OZOA 4ZO6A 1PLGL 1QO3B 5C2BH 2VR5A 3BLKA 4RGMC 4IRJC 3HE6D 1PYWA 3F12A 5KW9H 5J1TC 3FNDA 3KPMA 1MVUA 3WFCL 1J8HB 5EULV 1MCNA 4N1EA 2I25N 2WLYA 4FFYH 1KJVA 4L8BA 2QSCL 1R6VA 4CD4A 1XHGA 1H41A 4LCWD 4OD2A 3TESA 1MAMH 3BJ91 4E42A 1T2XA 4RZCB 4XGZB 5D1XC 1FRGL 3DYMA 3PZQA 4GW1A 5DUPL 4NSKA 2NW3A 2Y06H 2R1YB 1ADQH 1IC7H 4GQPH 2EDWA 3T1FA 2NXZB 5F88A 3FFCB 1ZTXL 4MS8D 3X3GL 1H3UA 3Q5OA 4NJAL 3WJLC 3O9NA 4FNPA 3MRKB 3CHDA 4PUDA 3CMOL 4PJ8B 4RFEB 1DBJL 3PZNA 1XZ0B 3FOLB 4PJIB 5F3BB 1MHEB 1NMAH 1ADQA 3QRGL 4LKXB 1YMMA 2DLIA 1AJ7H 5A95A 3F7YB 2B2XL 3DBXA 4M5YH 1RUAL 5IB1A 5KVFL 1WK0A 3O2WL 3Q1SL 4BZ1L 5CEZE 4NNXA 4WV1C 4CMMA 3EGSA 3W4RA 1FAKT 2ICCA 2PO6C 4P2QD 4EQ2A 4P5TC 1BVKA 3S4SB 1GHFL 1CGSH 1GZQA 3CSPA 1QG3A 5DQDH 3PHOB 5GGTL 2D2OA 1MCHA 2R4SL 3O3BA 1CG9A 3I02A 4OLXH 1KCSH 4G6FD 2E9IA 2ZOKB 3VM7A 1HKKA 2CKBB 5GZOC 1H15A 3IJHA 1M4KA 1DBKH 3MRQA 4XXCC 5DJDA 4D1IA 1IRAY 4H25A 4I5BB 3TCLA 2X2IA 1W3HA 3IB4A 2FECI 1UCBH 5CSZB 2DTML 1ZHNB 3HR5A 3KPRE 1A7QL 2X7LA 3KPQB 2R8SL 4OKVA 2ED8A 4ZO9A 1JDDA 1RZ7H 4M43L 4HCRA 4UT7L 2FZ3A 2EZ0C 5F72S 3BP4A 3GMQA 2OMNA 4R96A 5EMYA 3ROOB 4QHLB 1K85A 3SDAB 4OZHE 3Q3GB 3UYOD 4TTGA 4GBXD 1MRFL 2OX5A 5D1XD 5BOZG 1FL5B 1FZOA 1UB5A 4QXWA 5C0CD 4RQQA 3FQTB 3BVTA 1UWSA 2FJGA 3WIHL 2MKWA 5IV2B 2A0LC 4LVEA 5JOPD 5EU7E 4KVNL 1QUNA 1ZSDB 3PHSA 4R5EA 2ITDB 2AABL 2VDPH 2F15A 3FB8A 4YNYA 5K9KA 3C8KB 4Q9CA 1NOFA 4U4BA 2COQA 3SDYH 3WFBH 3IDUA 4Z7VA 2EADA 4RGNB 5C7XL 5MEPA 1B3YA 1WC7B 4UDUB 4Z0BH 3RVXC 4KGJA 4RCAA 5HVHC 4XWGL 2FL5A 1MCJA 3N1MC 5ANMB 5D6CA 1UM5L 2W63A 5D1ZB 4D0CA 1HJXA 1SYVB 3BXNA 3SBWC 5CIPA 4G8GA 3L4UA 1SJHB 1IMHC 2VLME 1JV5A 3MROA 2PF0A 3G6DL 4X6FB 5TDOB 4YDLB 1AKJB 5CP7B 1KLGA 2DQCL 4AYGA 3ECQA 2AJYL 3QIBA 1LO0L 2HVMA 1HJSA 5E95B 2AVGA 5LGJB 1FFNA 2KPNA 5FK9B 3X12B 4X6BA 5E7FA 2OWXA 3ETBF 4M6OL 3QFJE 5MEND 1UWTA 4CJ0A 4JRYB 1KG0B 4LLUB 2I9LB 5ADOH 4M29A 4MCZA 1XF5A 1U93A 3CVIH 2PF6A 4WHCA 5EO1A 1S5HA 5TDPA 4C56A 1LQSR 3KPTA 3TP4A 2O5XL 1J1OH 3LB6D 3L5HA 3M1BA 3UDWA 4P9HL 3WIHA 5E2WL 4WJ5B 1CGVA 2XN9A 2J8UF 4HA3A 3CC5A 5J6HB 4OLUL 4YDKH 1YEGL 2J6EH 3I3BA 5DGQA 4LHUG 4XMLL 4HGWA 5C0BD 5EBWA 3OKMB 4K3JH 2DQIL 3W38A 5CKGA 2WKGA 4LARH 3MNZA 1QHZA 1C1EL 1HOCA 1G9NL 4MCYB 1QVOA 3I50L 3VXMA 2PWDA 3OX8B 3WHE0 4HFUH 4Z77A 1V05A 4PRDB 2ZE0A 1NWUA 1MFNA 4OLYH 4O2FB 5DA0B 3L7EB 4W5ZA 4QCFA 4AD3A 3PWLB 4U1JA 1UWXK 1ZS8B 1CXKA 2E8YA 5BJTB 3AMGA 4AIOA 4GUPA 3HZKA 2GFBA 3H55A 1MQQA 2MHAB 5DVKA 3RX7A 1X5FA 1AGDB 2EKSA 3QCUH 1EEQA 4AZIA 3C60A 5IFAH 3MRJB 3LN5B 3MRIB 4HULB 3KDMA 1T3FA 3UPCA 3VD9A 2FEEI 2DBLL 1QBLL 1GQKA 3CFDA 1A22B 1C92A 3V52L 3VXME 3KLAB 1CDGA 1U8NB 4XVJL 3EYPA 3LRKA 2CRIA 3KS0J 2YEZA 3FO9B 5IQ9B 1KCRL 2IH1A 3KPOA 4CGTA 1K2DB 4PJEF 3I3DA 3HRZB 4RMRA 4Q9RH 4U1NB 3H3BC 4LPUA 3WFDL 3RHWK 4F9PA 3WUFA 3AAZB 3WKNA 5T1LA 3NGBB 1J9CT 1WIUA 3AIBA 5E0QA 1KXTB 4MAZA 4JY4A 4IPNB 3EKCA 1BFTA 5AZ2H 5JQHC 4TVCA 3R1GH 3F62A 2PWEA 1KCUH 1J1XH 4JQXA 3QIBC 4YHOL 2QHRL 1N7ML 5C0JB 4D9QE 1MIMH 2V5YA 1V6YA 2VIRB 2DM2A 5DI8B 3RGVA 3GH4A 4YIQB 6FABL 4PJXA 4Y4FB 5I30L 1JNDA 1S9WB 4LASH 2OJEB 2A6JA 4XCCL 4JO2H 3H53A 4L3AA 5AZEH 1OP5H 2CGRH 2XN2A 5FUCE 2X4TA 4NP4L 3IGUA 3ARXA 1A7OH 1MCKA 3CLFH 4B0MM 5DJXB 4FFWC 5HHOE 1WEJH 4ZSOA 3LKPB 3PDOB 5F7UA 5E8PA 2UY4A 1TNMA 4QXGH 1JGUH 2Z31C 1WAAE 3OJMB 2G60L 3AREC 2XTJE 1G6RH 4N0CC 3QOKA 3QCVH 2FIKA 4Q2ZA 4G9DB 2WUBL 4L8CA 4ZS6D 1NJ9B 1D6VL 5DYOA 5DO8A 3ZIZA 1CDJA 3BPOC 4OGZA 5DEGA 4KMTH 3M17A 2GJZA 5J11B 5CJOH 5CPSA 1ISXA 2B8OT 1OWWA 2VAAB 4WI9A 2RIKA 2DQHH 4N0FA 5FYLE 3SBWA 4IIQC 3VWJD 3VCLA 4ZAKC 1DQLL 1FN4B 1YN7B 3U7BA 2NR6C 1QACA 5EIIB 4IRSA 3VFRA 4W68A 3D39D 3TH2T 4MDPA 5GNYA 4AEHH 1G7LA 3PWJB 1VGKA 4WFHD 5T33H 1DN0B 3BC9A 2NLJB 3HNVH 1DP0A 1OD8A 2F61A 3EYSH 3MX0A 1VRXA 1KXQE 1IGIL 3R0MA 3VA6A 1Z32X 2TAAA 2O5ZL 3BO8A 3QA3B 2R0ZH 2OYPA 2AV7A 1NBYB 4LDOB 4HPHA 3P4MA 1E0XA 3HI1A 4LAJH 4MSWB 4LDLB 3T0XA 4HUVA 4NNXB 4KZDH 2WC7A 4D6GA 1INQA 3ECBB 3T0VA 3B9KD 5ERWA 2YUVA 5EFDA 2VN7A 3TT3L 4CVXB 4UAOB 3ZKQD 4HCRH 4OCSH 5L2JB 3P2TA 1IM9D 1RU9H 3D0LB 1OCQA 4BJLA 4KGLA 1NCAL 3CXDL 3IXAA 5A6MA 3JV4A 5IHRA 2CK0L 3SQOH 4Z7QE 1IGTB 2ESVB 4UQ3B 1PBGA 1TPXB 4I48B 1FBIL 3MXWL 1R0AH 1N6VA 4PJDF 4C83B 1Z9OA 1VFAA 4G5ZL 3W82A 4NCC1 4U1IA 2W0FA 2YN5A 4XWGH 4P57A 1V3LA 3VFNA 5HBBA 4M56A 1E1FA 4A3YA 3WNMA 3H9ZA 5DMGD 4DZBA 1MWAB 4RMTA 3JVGC 1UR8A 1A6ZA 4HUUA 2FDBP 1FO0A 1NCTA 1A7PH 3MV8A 1TMQA 2BERA 1CLCA 2DQJH 5EA0H 1IEBA 5J1AA 5IB4B 5EZIH 1MW0A 3P4NA 1NCWH 3IDNA 2DIEA 3BT2H 1XT5A 4P99A 2WWDA 1TE1A 1HHKB 4WUUA 1FL3B 1WBYB 2IBZX 4N9GB 3WN5B 1GC1C 3BQUD 1MREH 4PJXF 3C6SA 4NFCA 1NGXA 2A6DB 5F97E 3L4TA 3FQNB 2FJGB 4M6OH 4FQQB 1NCCL 1WICA 3MOQA 3HG5A 4YNYB 3G9VA 5K9KB 1LILA 3DUSA 4U1MB 5D2LF 3WMBA 2HFTA 3RDTC 4XNXL 3OV6A 5DQJA 5IJKA 4LLDB 2ZCLH 2AERT 3CCHA 5E03A 1FNHA 3PZGA 1TQUA 3VW3L 3L3OA 1LO4L 3RGVB 2VC9A 1DWAM 4KZEL 5DMIL 5IJVA 1V02E 2RGLA 3TM6A 3WXVH 4HT1H 3UZQA 3GRWA 5DD6A 3AJ7A 3AS3A 1ZLVH 1WO2A 2QV2A 2YA0A 4IOSD 2X1XR 1A1OB 1HHJA 3VMPA 3LOWA 1CDBA 1Z5LA 5BV7L 3GH5A 1WWWX 3OR6A 3BAYA 3KWXA 1H3PH 1HSBA 2WLZA 4HS3A 1QFWL 4TSCL 2XVLA 1MCOL 4WEBL 3ZSTA 3WY3A 2FH8A 3LQAC 2FBOJ 2NY5L 3GBLA 3DX2A 4MADA 2APXA 3UJIH 5F8RC 1A6TA 5K9OA 2EYSA 5A6BD 2LE9A 2HN7B 3CVHH 1OAKL 2QQNH 4OZ4B 5DO2C 3QXWA 3OKNB 1U95B 2BCKA 2V7NB 3MODH 1YEDB 1UWIA 2XTKA 3VDHA 3J7HA 3DMMD 1AIFA 2AW2A 2BJMH 5I1KH 1P1ZA 2KZ1B 2P8LB 2DSUA 1Z3GL 1MVFA 3BSZH 4IS6A 4XMPH 4MLSA 7CGTA 5GRJL 3VE0B 5KJRL 3OHXA 1JNNL 5C08B 4GXUN 2WP3T 2XVKA 2W0FB 1IQWH 4Z8FL 43C9B 3JV6B 1FNLA 3KJ6L 3ZOAA 2F53E 1U8MA 2X1OA 3VMNA 3VIJA 1T1WA 1I3GH 4LYRA 1LE5A 3RNQA 3VI3F 3EFDL 1T20A 1AH1A 4CRPA 3ZE1F 2I5YH 2WW8A 1WFOA 5CP7A 2Z1SA 4GQ9L 1F45A 3GMRB 4YN5A 3QDME 4PJFE 3S7GA 1KT2B 4OZGF 1BZ9B 1DVFA 1F8TL 1FAIH 2X4NB 1VADA 1LLOA 4NQCD 2HG5A 2F9BT 3UYPA 1J01A 1UFUA 5F7MC 4LLAA 1OAXH 1AE6L 4OZFB 2V3GA 4KRUA 2HKFH 1OINA 1ULVA 3QPQD 2DQFA 4PD4K 3TVMB 2XGBA 3QUXC 4R4FH 1ADQL 1HSAB 2H2PD 1PEZA 3WL0A 5FA3A 1I3RA 4I0PB 1JHKH 3ULVH 5HHPB 4HC1H 1JK8A 5ESVB 4WDIA 2WZIA 2QHRH 1R7AA 1U8LA 5GS0C 1XF4B 4XPAL 3IYLW 5GRUH 5I1IH 1BGXH 1JFHA 2YS4A 2EBNA 1C5CH 1YA5A 5GJSH 5I3DA 3CUPA 2HTKC 1ZGLM 2I27N 4NO5A 3TZVA 1S9YB 5HHOD 3DDGA 4OF7A 1NDMB 2W65A 1HQ4A 1MCBA 4M61B 2IAMC 1ETZA 4NKDB 3NCMA 5JNYB 3AIVA 3DARA 3PZIA 4FS0A 4UUJB 5I1DA 2W9DH 2E9WA 1CXEA 5A2IH 4UAOC 2E9JA 1BD2B 3LEYH 3W2DL 1MCWW 5DJ2B 2VURA 2Z35B 3NA4A 3L7FB 4HA1A 1G6RL 1GOQA 1ERNA 4UV7L 1KIQA 3RIAK 2AEWA 3T0WA 2OZ4H 3MJGX 3W0WD 1OBAA 2UZXB 3JV6A 2A74B 3O2DL 4GUPB 1MCIA 4Z7OF 3GSUB 1AO7B 3P9LA 4Z95L 2XSBA 4XNQB 4TSAH 4U6VL 1B0GA 4X4MA 3FQXB 1OOAA 3CPUA 3FY1A 5IG7B 1I3UA 5MI0C 1IL1B 3NFPA 4J2XA 1N0LA 2BRRL 3N50A 2OZ4A 4ONFL 5CFHA 5B38G 4GQQA 2BNQD 2R1XA 3Q3GA 1NBVH 1HCFX 2EIZB 1FHDA 1HQRA 4N0RA 2CKNA 4GLRH 2HRPL 3BKMH 5EOCJ 4AEHL 4ACZA 2J4WL 3JWDH 1DQJA 1C8YA 4OIAA 1RIHH 4OLWH 4WFHE 5D2NA 5FO9B 2DYPB 5EORL 4HUWB 4DGVL 5ILTL 4TVSa 1Q1JH 3S35L 3ROLB 3WV0A 1X9QA 3GJFH 3K8MA 3S37H 4P59H 1NUFA 1KGCE 2AJ3B 1Q9OB 4P5TD 5CILH 1WFNA 2FIRT 4YXHL 4HU8A 1W9UA 5I75B 3F58L 4PG9A 1NUNB 2EH7H 5LXGH 1JTOA 1FVEA 2D3VA 2FLRT 3IGAB 1TCRA 1R3IL 4IOIA 3WUZA 4DGIL 5F89B 3U82B 2ZCHH 1DLFL 1HHHB 1A6AA 2HH0L 4NC0B 5LWYL 1IGYB 3AXLA 4H1LA 3SQOL 3KPQA 1W9VA 5LA0A 1QI5A 2J7BA 4ZOCA 5DK3A 1CD1A 3VSUA 1EDTA 1H8SA 4S1RL 1A4KB 4XCYA 4GW1B 3WENA 1BOGA 2OCFD 1Z9SA 4HHAB 4NSBA 1OY3B 4CADA 1US2A 3E0GA 3QIBB 3O3DB 4DOHE 5L9DH 3RIFF 4MGXA 4MNHA 1JD9A 4TQEH 3TPUA 4BUHA 2P46B 5IMKB 4IDJH 4JY6B 4IRJB 1KBKA 3VD7A 4X6BB 1OPGH 1MI5A 1LO0H 3KPLB 3HS0A 3CK0H 3KXFA 3SCUA 1DE4B 1JGEB 5J3HD 4EI5B 1A5FL 5MEPB 3MXVL 1M7DA 4MJ2A 3QDJD 1FO0H 2DWDB 1O0VA 4KQ3H 3OG2A 5JXAL 4D0CB 2Z4QA 4TSBL 4MAVA 1GZPA 4UINL 1HILB 1EO8H 1EMTL 5T1LB 1KIQB 1FG2A 3CFCL 1TQCB 2O5XH 4HZLA 4LF3B 4K8RL 5IBLD 1T1WB 5T3ZL 5I79A 2P7TA 3B9AA 4DGYL 5IKCA 4HWNA 2V9RA 1CDHA 3PABB 5ESQA 1EXUA 4QHUA 3CPLB 3QJFB 3ULUF 1NOUA 3T1FB 2FHCA 1X5HA 4JFXA 1HINH 1SJEA 2B31A 2L4OA 1JZ3A 1CXFA 1M01A 1E28A 3ZE2E 3SQBA 4NM4L 4XP1H 4S11A 2F5BH 2UY3A 2RQ8A 4ODVL 3U36B 4MCZB 1HKJA 2Y24A 4JN1L 2XG9A 1AHWC 3GUTB 4RA0C 3GMLB 4TSCH 3D39B 2B5IB 5D96B 1UXWB 2IBGA 3LKNA 1KFAL 4JFYB 1QSEB 1JF1B 1RJLA 1SY6L 4PJ5A 3KLSA 2DD8H 4Q9BA 4PMOA 3T0EE 4AZGA 4ZXBD 5TE4H 3BPOB 5CBEA 2CCRA 2EDXA 4PJEA 1UB6B 4JFDE 4NO2B 4D9QD 2BZDA 5B8CC 1X44A 5I1CH 4P9ML 5E9DE 4OD3L 3H9HB 2JB5H 1DLHB 1UXSB 3P30H 5IF0B 5SWSB 5H37G 1NFDB 2AS5M 3D25B 4ZYKA 4XC3H 4GRMA 2F53D 3GKWL 1W1YA 1NSNH 3DMMB 1MJ7H 2XG5A 4U7SA 1U8PA 3MCLL 4LLYA 5CWSB 3LDBC 4OV5A 3T08A 3UCQA 3S3SA 4P4RA 3LKPA 3MOBL 2A3AA 5DS8B 5EU3B 4QT5A 5F1IB 2HFEA 3BUYA 5TQ2L 3RTQD 1L0PA 3REVB 1BF8A 4XAWL 4W89A 3GTNA 1I3GL 4HIEA 1NGYA 5F9JB 4H26B 3G5XA 5E6IA 2XG4A 2N56A 4I2XE 3CZFB 3C9NB 1S78D 3TIEA 1T0OA 3ARDB 5C07E 4JKLA 3W53A 2OTWA 4BZ1H 5E08H 4H7VA 1SBBA 1NGXB 4P46D 3P0YL 1NANH 2AXHA 4M8QA 5H35A 2OP4L 3BFOA 1KTDA 5E94A 5C0RH 2X4RB 1KR0A 1QA9B 3QFJD 1A6TB 5K9OB 4EANA 1L7TH 3KYNA 3CH8A 3O9WB 3HG3A 1U8HB 3EO0B 4HZAA 4QWWD 5GGTH 2Q8BL 4XPBH 4G8FA 4QCEA 5FO8B 3GMNB 3LD8C 1TQTA 4JFEE 3RO8A 2QPUA 2F7PA 3U30C 3OKOA 4EK7A 1EUUA 1MY7A 1N3NA 5F1SA 5IK3A 4UV4L 3STZA 1FYTD 3O8XA 1OW0A 5BYWA 5EFIA 2CGRL 4JFSA 2XA3A 3RL1A 4M8UA 2JKXA 3INUL 4JZJA 4PJEB 1DJSA 4B3LA 4ZFFA 4U1GC 1ZAGA 5FCZA 1FYTA 4WI4A 5I5RA 1YY8A 4CN1A 2BSSA 2WM0A 4YFEA 4NQDE 1K6AA 1I3RB 4I0PA 1D5XA 5EZLA 5HSFA 2PWGA 4L8SB 1NBZB 4L8BB 4XP9H 3EBAA 3VVGA 4PMUA 2JELH 2CNCA 3PV6A 3E2HC 4YBQC 1EFXB 3LKSA 5SWZA 1MNUH 5DURB 1AR2A 4Y5YA 4P8WA 5JA9A 3ALXA 4UQEA 3ES6A 4P2RE 2B4CC 1N8ZB 2YRZA 4PJBA 1P7QB 3OXRB 1OAYL 1BOGB 4JANB 1OGTB 1RV6X 3KNBB 2ZG3A 4HIEB 3X17A 3HNTL 4K7FB 4M1RA 4U1LA 4N8CH 5ITBH 4J8RA 4U49A 1VCAA 3VFGH 1DANT 4MXWL 1TJIL 4EUPH 5DWUH 1XCQB 4KK5C 4HKXA 2ZXDA 3GFUA 1NEZG 1U41A 4M7ZB 4WJXA 4W93A 5L2KB 3QUKB 5LBSH 2DTSA 2PYED 2XYCA 4V1DB 1Q38A 1DDHA 1UCTA 3WFLA 4FNLH 4PJ9A 4CVZB 2DF3A 3SCPA 3UJJL 1P7QD 1HEZB 1DFBL 4HUXA 2HFEB 1QOXA 2OLHA 4WJ5A 3T09A 3U4AA 3DX6B 2ZOKA 2EIEA 4Z7UB 5EBWB 3BJLA 4OKDA 5DD1H 3OWEA 3WL9A 4JG1L 3Q2CA 1I7UB 3GXMA 4ONGL 1UWXH 4IUGA 4X7SL 1R85A 2ZCHL 5IMLB 2DSWA 4OQTL 1M71A 1ZOXA 5F6IB 4ZE4A 5BWFA 5IFJB 1CGUA 2FCBA 4ZPTA 4ZUWA 3B9KA 4ONHA 5HHNA 2H45A 5C71A 4JQVC 4UFMA 3PQYB 5HNNA 4RE3A 4HBQA 1OAUL 2VLJE 3KYAA 1LWRA 1X4YA 5GJTH 2CEQA 2EDFA 3DV4B 4LLQB 2YK1L 1Z0MA 1H3WM 4YHIA 5ACZB 3SJVA 3VRLF 4AIEA 1H3TA 4UUJA 1NWTA 4ZDHB 3BVXA 3H42H 4NC1C 2BY1A 4JLRB 3KPNB 1C5DB 1XH3B 2DI7A 1ZTXH 3W6LA 4P0DA 4HU0A 1MREL 4UBDC 5GIRA 1C8QA 3CUHA 2ERJC 2X1PA 1EBAA 2Z91A 4GRLC 3QWOA 3MV8D 1CFQA 2DKSA 5FDWB 5J06A 3GM8A 2CR6A 4M1GH 3L3HA 3ARVA 2BNUB 2OSLA 1ZVYA 3REWA 5I0DA 4U3CA 4KTEH 1TZIB 1KGWA 2XQBL 2W9EH 1XGYH 1U8HA 1ZT7A 3EO0A 4WUUD 2BXYA 1R46A 3EJYC 3HI6L 3QUML 1NLDH 1AGBA 2A6IA 3Q1SH 4JZ5A 4TNWF 3O6FD 4GKNB 3V4VH 2VITB 1RPKA 1T5XA 3U0WH 1KV3A 2VISA 4YHLL 2WHMA 3WS3A 2BSTA 1ED3A 4I1NB 2I26N 3LHPH 5IBUG 2FECL 4Y5VC 1N5AB 4NKOB 2XZZA 4NQSA 4UI2A 1TJGL 4PJ7A 3SKNB 1JVKA 4LSQH 3UAJD 3TTOA 2Q1EA 1KTDB 5E94B 2XFYA 1FH9A 2QMKA 5K9QG 2D4DA 1UZ6F 2MPAH 3ARBC 4WFEE 2V5DA 3QNYB 2OL3A 5T1KB 4X5WB 2YRLA 5A2LH 4TTUA 3SURA 4JM4H 1BPVA 1I8MA 4P4KA 2RBLA 2Y23A 4ZAKB 3GMQB 4R96B 4X8JB 1ZJBA 3GSWA 3QO1A 2QSCH 5IB3B 1W91A 4MSWA 5C0BB 4QAWA 3KZSA 2E7BA 2FD6H 3I75A 3VE0A 1XGTA 5E24E 3UBXB 4KY1L 1IGYA 3K3QA 4JFDD 2Y06L 1LG1A 3P73A 3BSZL 4N8VA 3CX5J 4WUUE 3MMDA 4W6XB 1AY1L 2YD9A 1G7PB 5DURD 4RMUA 2PXYD 3MLRH 3PWUB 4B41A 2J2ZA 3DX7B 5TDNB 4ZNCD 3C5SB 3VINA 2CDFA 2DM3A 2FJFA 3UTZB 3DMMC 3VOCA 4X9FA 1HT6A 4LCUA 4P7RA 1PKQE 3VFUA 1INEL 2BNQA 1FE8H 5EB9A 4Q7NA 3HC4L 1IC4L 2RJMA 4OM0L 3IFLH 3MV7B 4D9RD 4TUOB 1QPKA 4OF5A 1I1YB 4ELME 2B39A 4KRPD 5LGKA 1NL0L 2W59A 5BRZA 5F7YC 5L2KD 3FO0H 5EUKB 5CD5D 4AG4L 5DQDL 1BM3H 1ISWA 3BE1H 4QKXB 1TLKA 1J05B 5T1MA 1WUNT 5EBMA 1JNLL 4P48A 5HYSG 3TBTA 5C08A 5F7LB 4HZLB 4LF3A 1I7ZA 3MRKA 3O6AA 3SDCB 4EN3A 2EC9U 1JWUB 1S9XA 5IFJA 1GZJA 1MCQA 2ZZUT 2W67A 1I9RL 1FH8A 4FN0A 3VI4E 3AIWA 1UJ3C 2VX4A 2YL8A 2BOCA 1TVBA 3NAAH 3BXNB 4Q0XH 5H2BA 1C8PA 4JHOA 3RWEB 2BNRB 2UUDH 3QIWD 3V6FA 3SCMD 5KG9A 3C5JA 1XIWA 5E2UL 1PX4A 4G6KL 2QR0A 4KI5D 1A7BA 2VLRD 1DQTA 2EDKA 3VGGA 4L4VA 3WNPA 5HGHB 4CADB 2EQDA 3RZCB 5IGXH 4YDIH 5H37H 1XR9B 1ZSDA 2P47B 3WQVA 2CBIA 2R0ZL 2Z91B 5FDWA 4DM2A 1E3ZA 4G80A 3W24A 2AXGA 5CJQH 1DTUA 2VDPL 4NQCB 2ZG1A 3VM5A 1MQ8A 4EI5A 1PSKH 1UJ3B 4HDIA 4JQVA 2X4RA 2BRRH 2A9ML 5IBTL 3B43A 3HTLX 4M7JL 3FB6A 3FAWA 4JPIB 4DEPC 4FLOA 1WAAA 2AK4E 1R8LA 2XTJC 5F7EL 4DN4L 4QXTB 1N82A 3S5LB 2UVFA 2G8ZA 3VFGL 1LP9A 1FLRH 4NRSA 4TYUA 4OKVB 4ENED 2WINA 2DYPA 3JTSA 5IB2A 2FLBT 2GYSA 3TBYA 1HJVA 4NQVA 5C8BB 2B4CH 3QEHA 1H2JA 2FSEB 2ICWJ 1LQ0A 2E4TA 3WDJA 2YKLL 1Q1JL 2VN4A 2E5EA 1Q6GA 3EFFA 1D9KA 2FATL 1CYGA 4P59L 5I18L 5IB5A 1UM4H 4PBXA 4PG9B 5CGTA 3BVVA 3MLTB 1X5ZA 3R0NA 1NARA 5A6KA 2A73B 3WJJA 5E1AB 1E4LA 5IVXF 4JJHA 3QSKB 1TTGA 1G7QB 1IAIH 1B0GB 1ORQA 2EC8A 4PYSA 4FZ8L 2W91A 5EU6E 2JFEX 4HIJB 1N5YH 3IETA 3VA2C 1V0LA 4BA0A 5TJWK 4D8PB 3PG2A 1W32A 5TFSH 5FKPB 3SKUD 1EGJH 3ROLA 1A6VL 2P5WB 2FJHA 5KTEH 4J8RB 3SCRA 3WY1A 3PWPA 1PZ5A 4A6YB 4QTHA 3D9AH 2J8OA 3CMGA 3CZ8A 1FP5A 1C5BH 1G5AA 1UACH 3MREA 2YK1H 3VW3H 2AQ3A 5JIKA 4L3CA 1OL0A 1YYML 1K4DA 2AXFA 3G5YB 3ME0A 3ARBD 4TN9A 3MOAH 4LHUB 1F58H 2WIIB 2GJ6D 3ECBA 3JUYA 3IT8D 3WLBA 2A6JB 1K8IA 2NW3B 4NSKB 3T77B 4ZUUA 4OF6A 1EJ6A 1YQ2A 3O6LH 3NPSC 3C5ZC 3C6LB 3BUYB 4XWOD 4QHKJ 6FABH 4XC1L 1LWJA 3BH9B 4LASL 1N0XH 2P43B 1GHSA 3WO4C 1G6VK 5A3ID 5DRZA 3SCOA 4U7KA 4J28A 4WTWA 1B0WA 4X0VA 3SDDC 3SCWA 3N15A 1YMHB 4MMXC 2N4IA 1QFWI 4F8QA 4HWEH 1QZ1A 3NVQA 2AEPH 1JGUL 2VJXA 3VFMA 2DQDH 3CLEH 5GIRB 2CJUH 3SCMC 3F7VB 3BUDA 1F4XH 5GSVB 1TZHA 5IW6B 2JCCF 4LEOA 4PJ5E 4QDMA 1MI5B 2CR3A 1UH3A 2R4RL 4KKAD 1MWOA 2GJPA 4HBCL 5FL1A 2MSPA 4GW5A 4JG0H 2WVVB 3AUVA 5LAXB 4BK4A 4RE2A 2NY6D 3WF0A 5D5MB 5JW4Q 4PMNA 1NC2B 4RFOH 1AP2A 5D4QA 2JJSA 4YHEA 4PJAA 3LRLA 3WFDH 2APVA 4W85A 4UZSA 2BNRD 2XKNA 3VGAC 5HHVL 2XXMB 2DDQH 2IH3B 3QA3A 1J0YA 2X4UA 5I8EB 1KCVL 2UWEA 1NBYA 1UR0A 1T0PB 3QPXH 4WNQA 3WEZA 3BO8B 4WCYL 4ERSL 1QPPA 4Y4HC 1F4YL 1LNUB 2LABA 3LEXB 4Y4FC 1YEFL 4JRYD 2AJSH 2WBGA 3O3EA 5DD5L 1W72B 3TT1H 5HGAA 1RIUH 3DUHA 3D0LA 5DZLA 1NSNL 1ZB5A 5A3HA 1JIBA 1JHKL 4MJ4A 5F1KC 1QKZL 1F3JB 4DZ8A 2CKBL 3WF1A 2FJHB 3V5KA 4QRQA 1NDGB 3FQXA 1DN2A 1JN6A 3HE7C 1H0IA 4OGXL 5M95B 2J77A 3D52A 5A94A 4KJYB 5MENA 2GJXA 5EUOE 4LQ1A 5M94B 3F65A 4FK9A 5IHBA 2GJ6A 1YQVH 2EIZA 4PJIE 4AZBA 3MJ9H 4Q2ZB 4DK3A 1OB0A 2AK1L 2CDEB 3TPUB 5CKAA 5ID0B 5E8EB 2G60H 5ABFB 4GS7C 3HAEB 5DJCB 3L4ZA 2YPLB 3G6DH 2EEBA 2IANA 1FCGA 1UKSA 1T1YA 2VO5A 5DTFA 5SX5K 5IXEA 4NNYA 5HHME 2BVQB 3WD1A 5I75C 2HAZA 3NCJH 1OLLA 1E73M 4BH7A 2OJEA 3D3VA 4NM8L 5FHAH 3ZKSD 1BD2E 1UD3A 4GO9A 2C3GA 4E2OA 4L5FL 3O4LD 3E8UL 3T0EA 2ICEA 4NN7C 3II1A 3NPZB 5EOQL 1MHCB 5J6GA 2W61A 3G08B 5BVPH 3WY2A 4X6EB 1RK1A 5EU5B 1CXHA 5EO9A 3SKNA 3VFVB 8FABB 2GCYA 3IVKB 2P44B 1J1OL 4IPLA 1IEBB 5J1AB 1DUYB 5A2FA 4PGEA 1EEZA 5DXWA 5HYJD 5GPRA 4ZXLA 5E70A 1JPFB 1S7QB 4DGVH 2FEDD 4QLJA 3U1SL 2V3DA 3P4OA 2QJDA 4RFNC 1PFCA 3BZ4A 5H94A 4BQ4A 3MU7A 3RWEA 5HHPA 4XP4L 5J12B 4KKBD 5AAMA 3A0OA 3HRZA 5DRWB 2XN9B 1CLYH 3MFFA 4O51A 4HFUL 4KKLC 4Y89A 3RBSA 4Y1AD 1QNRA 2D03L 2JIXB 3EO9H 3JTTB 1CL7L 3FL7A 4XMKL 4BQBA 3RWJB 2UUDK 5FKAA 1QFWH 3C09B 1JI2A 3BP5B 3VU2A 2CRMA 2R2BB 4OZIB 2R0KH 5KEZA 1MCFA 4EUPG 2ZXBA 2NY0B 2PXYC 5ICZA 4W88A 3GXFA 1HKIA 4HWUA 3IDGA 1YEDA 3QCUL 4M62L 2NNAA 2B4CL 1NP2A 1HIMH 3QFDA 4GJTB 35C8H 4C57C 1RZJC 3SE3A 4Q9QL 1NUDA 2O9RA 2JIEA 4KWUA 3AREA 5D1QD 2WCGA 4S1QH 5A8NA 3TBVA 5L0QC 4FP8H 1JPGB 3ZKND 1BQLL 1JGDB 4P23B 1Y18B 1DEEB 1NGWA 2E6PA 4K3HA 1UOKA 1Y7VA 3B6SA 1ORSB 1T83C 5DFTA 5K9JH 1H8OA 3FB7A 1XGRA 1DZBA 4FFYL 2UY2A 5CHNA 4WWKA 5I19L 3WJLA 3CFKB 4W5UA 4G6ML 1CDUA 1MAML 4HIIB 3ZO9A 4HLZH 2BS9A 3ELAT 3BEWA 1BSIA 3DX8A 4YE4L 3OZPA 4JFOA 4DOHB 2R1XB 2XQYG 3OF6A 4U1NA 3BKCH 5FO7A 3FO9A 5E1AA 4M5YL 4HWBA 4H41A 5DQ9A 4ODTH 5H94B 3CV5A 5T3XH 1FV1B 2X4QB 1HEZA 4JDVB 5D71L 4MPKA 5C09E 4P8UA 5F7DB 4WI8A 3HJEA 2ARWA 3VTRA 5C0AE 5B39B 2EXOA 2B5IC 3IFNL 5D96C 3MOAL 1AGCB 1FGVL 5MERB 2X4OA 2HJKB 3G5VA 1F3DH 5IMOA 1LEKA 2GCYB 3QUMA 3IVKA 1C08B 4EKJA 1QFUL 4LLMB 4WU5B 3OGSA 4XCCH 1MCOH 4PJHA 5J11C 4DUVA 1TQVA 1AKJD 3DNKA 2BY0A 2Y4SA 1CIDA 2VH5L 3EYFA 3VNYA 5HGAB 4I4WA 4M4PA 3WIFA 4HLJA 3BP7B 2FZ3B 4OB5H 3W6MA 3BIAX 4U1JB 2AXGB 3NZ8B 3LRSA 1UWUA 2IF7A 4PRNB 2XICA 1ZHKB 3QUMH 4C7DA 5A6AA 1HVQA 2W9DL 3NTCH 2CO7B 1QFPA 1E5JA 3SOBH 3V4VL 1E4XI 1RD6A 1JMZA 3DXAA 3BRDA 1BQHG 5DJ0A 2Y72A 3ZE2F 2J8UA 2ZX5A 1BQCA 2XZCL 2CJUL 5J9PB 3BH9A 3FN9A 4PSPA 1F4XL 1NFIB 4E5XB 4LSQL 4JKMA 3QEGL 4ZFOL 3AMDA 3V4UL 2IMMA 5B8CA 1GAFH 4TULH 5T5FL 4OCXH 4DW2H 4KKCD 4AY0A 4HFWA 4JG0L 3G04A 2JB6B 3O9WC 4HPYH 4MB5A 1F3RB 4QLKA 1EEZB 1G9EA 4LSSH 4DZBB 3AMLA 4NNYB 4D2NA 5EZOL 1NCBH 3RVWD 2AV1A 4NQEB 3LY6A 1CE1L 5SV4A 5I24A 4P46C 4XPHH 4O58L 3ARDC 4MB3A 4JY4B 1UWGL 1M7IB 3JUGA 1DQML 1VGKB 4BELD 3AICA 5D1QB 1V5JA 5GGUB 1YEFH 4PRID 1AI1L 4PJHB 3RTQC 3AS1A 1UR9A 1WIOA 1BGGA 3TT1L 3IANA 4ZODA 2EDEA 5EOCL 3I9GL 2XYLA 3H3PL 4ZUWB 3DETC 4I77L 3PZMA 4GAGH 3CFDB 4UQ9A 5KS9A 4RBPH 1NAML 3L5XL 5F7DA 5JOPE 4E8CA 3TA3B 1H5BA 3V6OE 3UERA 1BIIA 1HYRC 1S7VA 2JCCB 5EU4B 4B16A 3DUUA 4HZ8A 4ZFMA 4HP5A 2PXYA 3S6CA 5CGYC 4DKEL 3MMUA 3QJHA 2DQJL 2JELL 3BWAB 5DFWH 1JN6B 2OZ4L 3HZYA 3IDMB 5KANI 1TFVA 5GGRY 3MLSL 2DL9A 3NIGF 4KK8D 3CAFA 4RDQF 4WSJA 5DA4A 2CBVA 1I1CA 4LCUB 1EH9A 1IC1A 5E2WH 1NMCC 2E6QA 5ADOL 3UR8A 4DEPB 2R15A 1E9LA 3QIUA 1WITA 4Z77B 1AQMA 4GAYB 5MI0B 2CKBA 1K6QH 2XWEA 4LK4A 4OZGB 1G0CA 5FGBA 2HA1A 1T22B 4OCYH 1BP3B 1C1EH 4WUKH 1SZNA 1JPGA 4ZUTA 4AEFA 1CNVA 3E8UH 3HZVA 3DHJA 2V9TA 1ECEA 5JXAH 4CMHB 3F7RA 2CRZA 3PN8A 1VESA 2XWJB 1F4AA 3CX5K 4F33A 4MA1C 1FNEB 3WS3B 3GK8L 1TQCC 1RHFA 3QI9D 1EHNA 3SGJC 3VXUE 1G9NH 3S98A 1A7RH 3ARFA 4HFWB 4BFGA 3CDYA 3GBEA 1XF5B 2YD6A 4HDIB 3KPPB 2XI9A 3S8WA 2WXDM 1JHLL 3U1SH 2KH2B 1S78C 5CJQL 4EI5C 4X7DC 2YWZA 1D5IH 4NRZA 4HSQA 2R2CA 3U0PA 2MFNA 1XSKA 1W8NA 1HILA 1JZ7A 1WZAA 1ZU8A 3K81A 3C5JB 4R97B 1ITXA 2IAMA 4DGIH 4XX6A 4JRWA 2R69H 2VB5A 5GGSY 1Q6EA 2Q3ZA 4WKHA 3D85A 2C26A 4XZUA 1F11B 3JWOL 1OTSD 2VLRA 4JRXA 1CD8A 3M8OL 1I1AA 4XVJH 5F9DC 1V0NA 1JPFA 2H2PC 3CC1A 3FB5B 1FVDB 5KAQF 2R0KL 5IM7A 2APFA 3FRPA 3GNPA 4L3CB 4X7FC 3T3PF 3I3EA 2RCSH 2VOTA 1AGEB 5MP6L 3VG9C 4TVUA 1YJDH 1MFBH 3CDFA 2R0WL 4K23H 2LU7A 2R2EB 5BQ7A 3BEVA 5EC2B 3AM8A 5JW4N 1IEHA 2VABB 2VQUA 2VQ1A 1Z3GH 4RX4D 2BC4A 3L3GB 2R29L 4ATLA 4QHMB 4S1QL 1UQSA 3P0VL 1AGFA 5GRJH 4NC2B 2D9CA 4KQ4H 1S5IH 3H42L 3T4YA 2D7NA 4W7WA 2Z8VC 5CBAA 3DWTA 2PCPA 1HCVA 1Q9KA 3PL6B 2GW5A 1UZ8A 3GKWH 4Y5YC 1F3DJ 1AQ0A 3WSQH 2YL9A 2XV6B 3DVGA 4PGBB 5KVMC 1TTFA 4HWBL 2VDMH 4MQ7B 1KIRB 5E6ID 1NGYB 2Y1VA 4YJZL 5HI5C 1ZHBA 1KN4H 5FXCH 4PP1C 3FRUA 4CD8A 1UD4A 5E5UB 1J05A 1V6WA 2LAAA 4K8RH 1H5BC 3LXCA 4NYLB 4LBEB 3GBMH 7FABH 3TWCL 2RHEA 3DBXB 4KJQC 5I30H 3U9UA 1RZFL 5CHNB 2GJZB 5T1LD 1HKFA 5JR1L 3VXPB 2Q86A 3QB7C 4FHBD 1A8JH 1CF8H 2WUBH 4DKFH 3VJ6B 1E0OB 2V2WA 1ORQB