1CGXA

Site directed mutations of the active site residue tyrosine 195 of cyclodextrin glyxosyltransferase from bacillus circulans strain 251 affecting activity and product specificity
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
686
structure length
686
Chain Sequence
b'APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLLDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
publication title Site-directed mutations in tyrosine 195 of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 affect activity and product specificity.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 235
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1994-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgxA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgxA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cgxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cgxA01
5B39G 2ARWA 3EYQC 1IAOB 3V6FB 2GY5A 4I0KA 3POCA 4GQ9H 3SHSA 2BSSB 4BFIB 1DBBL 4HOZA 1FZMA 5HHOA 4CVZA 5DRZB 1G9NH 3DBXB 1JGIA 2VL5A 3BW9B 1WNOA 1U95B 2JJVA 1XF3A 4R7DA 2DIJA 4H1LA 3Q5OA 4KVCL 4XBPB 5IKCB 4U1IA 1U8LB 4N0CC 4PRNB 4KI5F 1NSNL 1LDSA 1IC7L 2ZIDA 5D7JB 1XF4B 1CE1L 1KGCE 4O58H 3AI0A 2YMXH 5CBEA 4U1NB 5F1NA 1ZLVK 4PMRA 3DX4A 3QIWB 3GMNA 1OM0A 4XP4H 2XXMB 1U9KA 2MNUA 1U42A 3M17A 4JRXE 1XF2A 1IM9D 4Q9RH 1QPKA 4L4VD 1QPPA 3M45A 5KN5A 2DQGL 4CN6A 3X12B 1A4KA 4CRPA 4DGYH 1FNLA 1C12B 4LBEA 4CUCA 3AIWA 3RHWF 4P5TB 3LXCA 2JIXD 1CN4A 4I18C 4F8XA 3GSXA 5GHWL 5DUPH 3CUHA 3NH7L 4HIIB 1DHKA 5IMMA 1I7RA 1ZVYA 2OJEA 3J7HA 4M3JA 3O4LB 2LU3A 3X14A 4P9HC 1DLHB 1JRHL 3GMMB 4JG1L 4PRPD 5E1AA 2IFGA 5CP7A 1ZGLB 3O2DH 1U8IB 4P9ML 1GPOH 2GJ6B 5EC1B 4C56A 3QDGD 2OX5A 2XQBH 2B1AH 1CXKA 2LTQB 3GBNH 5CD3B 1NAMA 1T1ZA 1N64H 2LFGA 2DQUL 4IMLA 3BFOA 3CFBA 3T8XA 1BVLA 3RWIA 1OARH 5I76B 3LRKA 2VL4A 4FFZL 3QPXH 3SY0B 1G7JA 1YNLL 5ACZB 3QXDB 4LCUA 1I7UB 1TQWA 4ZFGL 1JWMA 1TQTA 1FFRA 1BMGA 1F45A 3SQOH 4Q97A 2X1OA 2VSDA 5E8OA 1NC2B 3MLXL 3FO9B 1K5NB 5I1AB 3T1FB 4LLDA 4AISA 1KYOK 3WKMH 5B8CC 3GUTB 1JHKL 2Q7YB 3QIUA 1YEJH 2WWCA 1A4JB 3Q1SL 4G7VH 3RKPA 2GTWA 4P23B 2CIIB 3TPKA 1YPZB 2J74A 1G0DA 5ALBH 3C9NB 3P4LA 1RIHL 4KJWC 1YEGH 4WW2B 3SGKC 2J47A 4LARH 5AYIA 4KJQC 4L4TB 3NAAL 1G01A 2PB1A 4NZUL 5CSZB 4CCEA 3BYTA 3QIUC 3T09A 3RVXD 1R0AL 4B9ZA 3RGVB 3E3QE 3QUXD 4NCC1 2VLLA 3WL1A 3O8XB 3LKOB 4NJAH 3HG3A 3LEVH 1PDKA 1CDGA 1NGYA 4JGUA 5IEHB 2EC9U 5JA9A 3ILPA 3UTZA 2VIRB 1XH3B 3TA3A 2WKGA 5IXEA 1XMWA 1FNEA 1I75A 1OB1B 2YA0A 4QRRD 4OCWH 2X1PA 1DQJB 3OAZH 4FQXD 5F7DB 3L2LA 3T2QA 3D0LB 2B31A 1NPUA 5AUMB 1D5XA 5CEYB 4QTHA 1R3LB 4N9OB 2Z93A 3TA3C 3RMEA 4JHWL 3R0MA 3P9MB 5HGDA 1CFTA 4ZUTA 4S2SA 1EHNA 1KELL 3BZFA 4R97C 3VRLE 4CL7A 5B38A 5K9KB 4E2OA 3DXAA 1EO5A 1CF8L 1CD9B 4HKXA 1HVXA 1M7DB 3ZE1E 1ZB5A 2CLZA 3FO1A 2F15A 3WD5L 5TFSL 1LG2A 3AIRA 1DSFL 1SY6A 1T2QH 2JFEX 2F5AH 3AHXA 4YHEA 3OR6B 1FJ1A 3EO9H 1QVOB 5IBTH 4P46D 2JELL 2YUXA 2BRRH 1RPKA 4Y4KB 2DMBA 4EVNA 5JOPE 4GXUM 2X4UA 3ULVD 3KPRA 4J3UA 5C2UB 1EMTL 3BT2H 3V5HB 3UDWC 1EBAA 4OLZL 3GMLA 1N2RA 4K3DH 4MA8L 3SCWA 1BLNA 4YBLC 3HRZA 5T1DH 4BH7B 2VXSL 4NZRL 2UZIL 3IDNB 5C8JA 3RKDC 5JBDA 1S5HA 2J79A 4J2XA 3CO4A 4PJIF 1CQKA 1KJ2H 4JCLA 3RZWA 1AD0B 3TNMB 4F7EA 1IGCH 1IEHA 4XX6A 2YC1A 4D9QD 5K9JH 3DYPA 2DTMH 4URIA 1JFQL 3P77A 1OGGA 4U1GB 4NFBA 3GJEA 4KDWA 3SDCB 3L4XA 4N9GB 3MXWH 4KTDL 3DDGA 2WCAA 4LLVA 4JEGB 2G4FA 3L5WA 3GIZH 2ICEB 3VO0A 3P9LB 3JWNC 4QHMB 3C5ZB 4TULH 5SWSD 2XWBA 4PTWA 1DCLA 5E99L 4XX1G 1RUPH 4O4YH 4G6FB 5D5MA 1P4BH 5F7KC 4MVBC 1MWAH 1C08A 1F4XH 3P2TA 1WBYB 3QUMA 3MJ8A 1DQML 4OZHA 2JK5A 3ARUA 2LE9A 4XPGL 1WTGT 1G7IB 3AGVA 1KIPA 3EYPA 3RL1A 3SOBH 2BZDA 1A6AB 3IKKA 1J88A 4N90D 5CWSB 4ZXBA 3BEWB 4A4AA 1R24A 3IDJA 3S34H 3VGEA 2TAAA 1MRCH 4P3CH 4NYLA 2RR3A 1BOGA 5H8DA 4TTGA 2JEPA 4AZ5A 3WS6A 3FMGH 1X7QA 3VXMD 4EBQL 4X6BA 4JM4L 3IDGB 1BFVL 5DD0H 3LHPL 4ZXBC 2CESA 3DI3B 4RIRA 5F9OH 2A83B 2WHLA 1ADQA 2FDMA 2J3SA 2DQHL 2PWHA 2X4TA 3S5ZA 5C0EA 3BMVA 4YDIL 1LO2H 2AGJL 4W5ZA 1WISA 4NWUL 3FN0H 5IVZB 4NN5B 3JV6A 4HWZB 4ETYA 2CDFB 3WJLA 2NMSA 3O3EB 4OSUH 5JUEL 3SDDA 1OTSD 2MKLC 4YBQD 4N42A 4PJ9A 5T3XL 4Q7NA 3G5VB 3W37A 5E00A 4HH9A 2BNQD 3TO2B 5BMFH 1DWFM 4GLRH 2MCPH 3GSRB 1IQWL 4FZEL 4DW2H 1NGXA 1M6OA 4V2BA 3IJ7A 4G8GA 3CH1B 3VFPB 3WJLC 1TQCC 2IGFL 3WN5A 5I24A 4FTVA 4HKZA 3SDDC 4NQDA 1C5BL 1NGQL 2A3HA 2PKDA 5K9QG 3NSNA 3VH8G 1R3JB 3CX5J 5EWIL 2X70B 5C07B 2FRGP 4PJ9C 5D1ZD 5KJRH 4BFGA 3ARDA 3S6CA 3U0WL 4JDTL 4BS0A 3DX9B 3QWRD 5FOOA 3EO0B 2FJGB 2KPNA 3O11B 4AJ0A 3HUJF 4W85A 3WN5C 1NUNB 4FQPA 4LMQE 1UXSB 4UTBL 4GOSA 4YDLB 1Z5LA 3OG2A 1OP3H 3I3BA 4L4VE 2W0KA 1KT2B 3MA7B 1NWRA 3CUIA 3ARDC 1I4FA 3H7BA 3MOBL 2ZE0A 5DLMH 3MFGB 4FP8H 1YN7B 3RTQD 1YEHH 1A7OH 4K23H 1BJ1H 1OLLA 1XSIA 3EYVA 3GJFK 3U4BL 3MLRH 3JV5A 5D72H 4GQPH 4XBGB 3RWCA 3WMCA 2R9HD 3ARGA 1DBJL 4PRPE 1J9CT 4KUZL 4XNMA 3QRFM 4M1DL 3CV5A 4M48H 3QDGE 1E6JL 3AXLB 3VFTA 1V7NL 1A1NA 5DJAA 5EFIA 3RL2B 2BHZA 1JAEA 5I66B 5AYBA 2XPGA 4NPYB 3SDAA 3ARGC 5T1KD 2XI9A 2ZUXA 1TJHL 3OKYA 1W72H 43C9B 4X6EA 3AU1A 4YQXL 4HX1A 5TF1L 3L4TA 2XM2A 3MTRA 3CFJA 2MANA 4U1HA 1OQXA 4JFDB 3T3PF 3B9DA 4I2XB 5H35B 5HVHC 3LQAC 4W87A 2EH7H 3SDAC 3M46A 1IZKA 3ME0A 3WIIH 1WWBX 2BRQA 4TX6A 1JD7A 1CFVL 4NGHL 2MJWA 1MFEH 5DMKA 3U83A 3OJ2C 2GK1B 4XI5C 4Y19B 1XCQB 1A22B 1FNSL 3IGAB 1NWSA 1MPAL 1KV3A 5KS9F 3SKMB 5HI5C 3MRLA 1UKTA 4I0PC 4HF5L 5EZLA 1OSZA 4DUWA 1A3QA 2FX7H 3QHTC 1XF5A 3BQUD 1DUZB 4OLUH 4JFOB 1QWNA 1RJYA 3RVTD 4DO5A 3GMRB 3OB8A 1K2DA 1T0OA 3KPMB 4QT5B 2ZSVA 2ZX7A 1LWJA 3F58H 3OXSB 3ARFB 1FYTD 1FP5A 1NOUA 1EGJA 1ZA3B 2HFTA 2NY0D 4QRRE 1FDLL 4N5UA 4X7TA 1KXVA 3IK2A 5JOEA 1TNNA 1HHJB 5HJ3B 1UYWH 4B16A 1IEAA 1OD9A 5ELIA 1NANH 4PGBA 3QIBA 2ZCKL 5CGTA 3GXNA 3IU3A 3TTYA 3BD4A 1Z9MA 3C6SB 2X2JA 5E4EB 2MPAH 5DJ8A 3WQ4A 1H11A 1QG3A 4OF3A 4LOUC 4L4OA 3MNWA 4C7DA 1KXVC 1LP9A 4A2LA 5A16A 4TUKL 2CYGA 2NXYB 4PD4J 2WNWA 3QIBC 1RK1A 1HYSD 3QCVH 4NWTL 1CLZH 2J7EA 5A8NA 5KSVA 3UTQA 3F6LA 3OWEA 2P44B 1Q94B 1UCBH 1GPFA 3NZHH 1FVEB 3GIVA 3VX0A 4KJPD 5IHBA 3TTSA 4QWWC 3BWAA 4JAMB 4LSPH 3ULVE 1FGNL 1YEKH 3ZOAA 4R26H 2ZUNA 5HNNA 1NBVL 2GW5A 3LIZH 4IJ3C 1FO0H 4MDIB 5EPMA 2VLKD 4NBZB 4CAGA 4JY4A 5AWNL 4NO3B 1I8MA 5DJDB 4N8VB 3TIDA 4UIKL 4XPAH 1QX1A 4GAYA 4XPFL 3GYCA 4GO8A 3EJSA 4W6WB 5HHMB 5GS0L 5HI4C 4LVOC 1HKFA 4GQRA 5JLZA 4W8LA 2D4DA 5B21A 4D9QE 43CAA 1QBMH 2WMJA 4JN2A 1G94A 1Q9KA 3S5LA 1MF2L 2VXQH 3WFHB 4M7LL 4LRNL 4XGZA 1IL1B 5JW4R 3TO4D 4TQEH 4KZDL 2ZUMA 4O2CA 3QP3A 5SWSE 1KIRA 1N5YH 4QHLB 4ERSL 1AGBA 1QSEA 3CK0H 3HS0B 3DVNB 3IS1X 2NTFB 3EBAA 3MCKB 3MRFA 4X7DC 3D18B 3KPPB 4U6VH 2FGLA 5EFDA 4S3KA 1VFBA 5DO8A 1QO3A 2D03L 2WMGA 3DSNA 4XZWA 2W9EH 3E6HB 4QCFA 4IISA 2Y36H 3QDHA 2IAMD 3O0RH 4Y5XA 1GVYA 4N90E 1OPGH 5FK9B 3VG0L 5DGRA 1MHPH 3U0PA 2H3NB 2O92A 2AI0L 4PBXA 4WENB 1K85A 3GHEL 1HI6B 3HNSL 3UBXI 4NKQB 2A38A 4PJDE 3E0GA 4IRSA 4Y4FD 5TD4A 1U58A 2FD6H 3ZZ1A 1JXJA 5D7IE 1QNPA 2PR4L 3VXME 3ZIZA 4L8DA 4NNYB 1CQYA 1SJHA 4XC1L 4V2CB 2CUIA 2ADIB 4Y5XC 4P48A 4PEEA 4MZ3A 2W63A 3L9RB 3TCLA 4Y16B 3SDXE 4AXNA 5DEGB 2NY2B 1GHRA 4I77L 3RU8H 1KF9B 1LK2A 1TETH 3DUUB 2CUMA 4MNJA 4YX2L 3ZDXE 1FL5B 2J7HA 3BKJL 1XZ0A 5DD3H 5FOBB 1ZS8B 1T0PB 2CGRH 3MJ9A 3PHOB 2HMID 1UD4A 5D2NB 1UQYA 2IXUA 1X5HA 4DKDC 3MS8A 3MUAA 3CSYA 3K8MA 3NCMA 3VFSA 4UIMA 1HSBB 4WI2A 3IFLL 1NLBL 2DSKA 3ETBF 2QHAA 1F4WL 1OAZL 2BNQE 4TSBH 4Z2IA 1HJWA 1KC5H 3AXXA 3VIOA 1U8PA 3CHEA 3QO0B 4WF7A 3D3VD 2BCKA 3SE8L 5IQ7L 4UTAH 2HN7B 5BZWB 1R7AA 1QQDB 3ILQC 3QDJA 2CKRA 5KTEH 2C5DC 1T3FB 1J0JA 1UZ6F 5TPWL 5KAQG 3NCFB 1ZHBA 4PJCF 2E7MA 2I24N 1NAKH 4P57B 4XX1E 1U3YA 4AYGA 4PGDB 4Z7VE 1SEQH 3D50A 4U49A 1JWUA 2JCCF 3TZVD 3WDQA 3VDBA 1KCRH 3IAPA 4KRPD 4MA3A 5IROA 4JRXA 5HBBA 1IKNA 5GS1A 3VDCA 5DQDL 5E6ID 3FB5B 1F5WA 3DX7A 5I1DA 5MEOA 2OP4L 2YZ1A 1R5VA 4G7YL 4X99A 1RFDH 4IRZH 3DGGA 4X7FC 4DQOL 4F7MB 1QI0A 5JW3H 2EEBA 2FSEB 5IROC 4XC3H 2XWJB 3NN8A 3HPJA 4HXAL 4N1EA 1HEZB 3IFOB 5GS1C 4M6NL 3T2NL 2V3FA 5GJTL 2D0GA 3E6FB 4RA0C 1NUFA 1JPFA 2VLJD 1C8QA 1I3UA 3V6FA 4UU9A 4NQCB 1NAML 2LU7A 2P5WD 2XPKA 1GJUA 3KLHC 1BAFH 4L4JA 5IFHH 1CZ8H 4FQHB 4YR6A 4YXHL 4DZBA 2ORBH 2OXHA 3ECBA 5DRZA 1SR0A 3ZE2F 5DJ2A 5FKYA 3M1BA 5I16B 1HZHH 1U95A 3CXHJ 1MREL 3QI9B 4PP2B 4WUKL 4HUUB 4WFFD 2EDYA 1BBDH 5J0BA 4HHAB 5D9SB 1MLCB 3EYUL 1WP6A 1X5GA 2DSWA 5I0DA 3L4VA 3FQRB 4P2QD 4CD8A 4TX8A 1RP8A 2YK1L 2VT0A 1GGTA 2RAMA 4U1NA 2BVUA 2X89A 4XP9H 1WZLA 3FCTA 1JV5A 3QEUB 3I6LD 3MRJB 4D6DA 1NGPH 1I3RA 3VXNB 4PB9H 3MV8B 2GK0B 3P11L 2K3TA 4HKJB 4UFKA 2DF3A 2ARJB 1CG9A 4MADA 4MXVF 2DRUA 2ED7A 2FZ3A 4X8JA 5L88L 2VITA 1IMHC 4LSSH 1V3HA 2OK0H 2IQAA 5IFAL 1BWWA 1P7QD 4I1NB 2D9CA 1QFHA 1UKSA 1J87A 2AEQH 3JTTB 5IHLB 3QXTA 4HK3J 3LPPA 1HT6A 5FYKD 5DJ6B 1DLHA 3MBXH 1Y6KR 3B2UC 4OQTH 5TH2B 5K9OB 2KUTA 7A3HA 1ZGLA 3RWJB 1FOBA 3NTCH 1T5WB 5CD3A 1FYTE 1OGAD 2ICWI 4EIZC 3RFZC 3E3QC 1W9UA 4APQA 5I76A 3FONA 2D7PA 3SY0A 3EHBD 4X5WA 5H94A 1HHHA 5DO2D 3UJJH 2CJUL 1UQSB 3TFKC 3LN4B 4PTUB 1ZANL 3F12B 3WDJA 3IJ8A 4GKZB 1CLYL 1D5BA 1AGEA 4PPTA 4G8EA 2BDNL 2WW5A 1QOKA 2C3VA 5HYQA 4R6UA 5FHAH 5DI8A 4W86A 4K94H 4APQC 4KU1A 1E6OL 5ABGA 1R3HB 3UZQA 1A4JA 3TBSA 4GSDH 3AFBA 3TWCL 4NHCL 3H9HB 3H9SA 3UO1H 3OHXA 4RDQF 1SY6L 1L0PA 1E0XA 2NLJA 2VRKA 3C9NA 4ODWA 3HG1B 3STZA 3X11B 4AEFA 1CVRA 2NR6C 4UAOC 4XHJC 1BYCA 1Q9LA 4WU5B 4O2EB 2M2DA 1IAIM 1J0IA 1JNDA 3UTOA 4EE9A 2G3NA 4LHJB 4JL1A 3CLWA 1JNLH 3O8XA 3ZKXC 2X4NA 3DDFA 2VLKE 2I5YH 1N3NB 2I25N 2GJZB 4YHLH 2W4XA 4GRWE 4PV9A 1ODZA 1UWEL 3NIDE 4K9EH 1QR1A 2VQTA 1S3KL 4OZFB 1LD9B 1UYQA 5GGUA 1QI3A 3QRGH 1IGTB 1OB1A 1DQJA 1LO3H 5CGYD 4JN1L 1A2YA 1EFXD 1YMHA 1GORA 1JVKA 2CETA 2J6EH 5CZVL 3V8OA 4EI5D 4I9WD 5GPRA 4BUGA 5JIWA 5CEYA 5C6TL 1Q6EA 1B6UA 1BQHG 1T20B 5A6BD 1VSCA 1A3RH 2HJFB 5E2TH 2AOSA 4Z2HA 5CILL 5C3TA 2VTFA 4NUGH 4MQXD 2WBGA 4TUOA 5E09A 4R96B 4PG9A 5ICYA 1MCWW 1ZMYA 5KVFH 5IVOA 3T4YB 2OSLB 3S37X 3MRHB 1ZBWA 3M7SA 5MEPA 4X5XB 1EA9C 1KEMH 1RHFA 1WBZB 5FA4B 1MJ7H 3B3IA 4PJ7E 2QADC 2UWEE 2XACC 5C0AD 4G6MH 3QFDB 1AR1C 4W8AA 4DUVA 1KENL 3L3OA 4OUUB 3MMEB 4MX7B 1K6QL 3BH8A 2Q20A 1ZLWH 5KVEH 2Y8KA 4NM8L 3V5HA 2YD2A 4Y89A 4WSKA 5DURB 4IEFB 4JLRA 4W4NA 3MLZL 1ZT7A 4XP5L 4BKLA 2BJML 3IDNA 3JSSA 1J1XH 1HN1A 1ADQL 1I3VA 4DFIA 4OLYH 3RJDA 1BEYH 4W8BA 1ZJBA 5T5FL 1L6ZA 2UY5A 5C7XL 1KR0A 3WDPP 5BV7C 3FTGB 3REVA 3AZSA 2FDBP 3CFKB 2I9LA 4LVNC 4FQLL 2YHGA 3BE1L 3L3KB 4S0SD 1A0QL 1QLRB 5C9KA 4DWHA 3D39B 1JFXA 5ERWA 3KYOB 3ZL4H 2ICEA 3G5YB 1WAAE 4L8BB 5I6XC 2HWZH 4OD2A 4UQ3A 1A9BB 4DCQB 4LCIL 2VDPH 3QAZC 2V2XB 5M3WA 3N17A 1QFWI 5GRVK 1YMMB 5E5UB 2QBWA 3D3VE 3DO7B 3BAJA 4OM0L 4U33A 3S4SA 1EAJA 1S7RB 1MFCL 1WFNA 5FUCE 1SBBA 3VD9A 2IJ0C 2JB5L 2DM7A 4I48B 2DQIL 1DUYA 4OZOA 1Q6FA 3WL9A 5FM4A 4JFVA 5D1QD 2J8FA 1MQKL 3NABH 5EUOB 5EC2A 1CGXA 1YQVH 1CCZA 3QSKB 2ZCLL 1W0WA 5JXAL 4BQ2A 1S7SB 1A1MB 3QUKB 3PP3H 1IGML 1FG9C 4WIQA 1JWSB 4B53A 4HFUH 2AS5M 1IM9A 1AQ0A 3MBEB 4L4VA 2D3NA 3OAYK 3U36B 5FUZH 2PUQT 1A3HA 3PWUB 1I1YB 3VXPB 2IH1A 5L2JB 3EO1A 2XVPA 4D0CA 2JIXA 3VGAC 3R0NA 3TNNA 4AC1X 2WVTA 2RGSA 3QH3A 1UM5L 5IVZA 2EE9A 5IT2H 5TGBB 4JY5L 4OBSA 4PTTA 5GGRY 3E1F1 2FHCA 4FNSA 3T65B 1RUAH 1W9DM 3O3EA 3VI4F 2XFYA 1C7SA 2MQ3A 2WW8A 4L8CB 2VLJE 2P5WE 5LA2A 4MDJB 3QDGA 1L4IA 3G5VA 5FXCH 1SJEA 1XD0A 4QLKA 3KYNA 3K8KA 3SKOB 3TYGH 4MA7L 3O6LL 5DYOB 2D7NA 1W1PA 2D9QB 2MCG1 4W7WA 4IM4A 4G8FB 3CTTA 3HI5L 5I1CL 4WFFE 3U6RB 4R4BB 3N1GC 4P2OB 4EUPH 3MV9B 5B39A 3NGBB 4XHQA 5GNXA 2DQCH 4P2QE 4KRNA 2FLBT 4YO0A 1RZIB 2R1YB 5IW6A 3LRHA 2VURA 4EAMA 3FT2A 3RWHB 3O45B 2Z9TA 2D0FA 5E0FA 3VXRD 4CD6A 4S10A 5HGHA 4X5LA 2E9LA 4JB9L 5DXWA 1N6UA 5BVPH 2AVGA 4JQVA 3I6LE 4KGLA 1KJVA 3NFSH 4Q2ZB 1MHEB 5HYSB 4PTXA 3MA7A 4LF3A 2DPEA 3WXWH 4P0DA 4ODUA 2B0SH 1DBKH 4G6JL 3U9UA 4BK4A 3W11D 3LOWA 1BPVA 3B9KB 3U2SA 2XOTA 2ATKA 1AQHA 3PG2A 2IQ9L 1OAQH 3GBLA 3S3SA 3QUXA 4MQTB 4WV1B 4XBGA 4GKSB 4XCNB 3S36X 5FYKE 1VKXB 5F6IB 1IE5A 3AISA 3RO8A 1Z9LA 1C16B 4MJID 4M6MH 3ALPA 1U3ZA 2P24B 1JGEB 5I30L 4TXEA 1JNHA 1HNGA 3C2SA 4ZMAT 1OGAE 5D6DA 3RVXC 1L7IH 5DVMA 3QUXC 1S7WB 4QRRA 5I66A 4ZSOB 1E4XL 4Z77B 3TN0D 4M24A 1HKMA 1GC1H 1A6TB 3QHFH 4FQXA 3U4EA 3S88L 2G5BA 5EU4A 2XHYA 5L9DH 4W84A 1D5IL 3X13A 4FF5A 1MI5D 5ANME 3WY1A 2J2ZA 2EYRB 2IPUG 2M26A 3EOAB 3S35X 5JR1H 4RFNB 5IMLA 3H42H 1SMOA 3GSUB 1G6RL 3N11A 4U1JA 2GSIA 4I3RH 4X6CF 3CGTA 5DRWA 4LLWA 5HDLA 5EORH 4LCCA 1I7TB 4QTIH 4BUHA 1LL4A 4FQXC 2CH8A 4S1RL 1VJSA 1KPVA 5D2LB 3VG9B 3NDZA 1HKIA 2PYFA 5E4IA 2P43B 5FGCB 3U7YL 2ZJSH 3CUJA 5I71C 4Y8AA 4KZEH 1XCQA 4P46A 3IGAA 1EEZB 5HY9B 3MV7D 5IB2A 1H41A 3L5HA 2RGLA 1ISWA 3KPQA 1T22B 3DLQR 3HHRB 3SKMA 2E8ZA 4LCCC 2OJZH 3VXTB 4OF0A 4HUMB 3BD5A 3FT4B 5C0DB 4WFED 4RAUA 1WDSA 1ZT1B 1QYGL 5J3HD 3LN5A 1QRND 3ZSTA 1KLUB 3PHAA 2FCBA 3GMRA 4OT1L 1NGZA 4P46C 1GNXA 4OFVA 2A73A 4QT5A 4MAVA 4RE2A 1TZIB 3ULVC 1G1CA 2EDKA 3JUYA 4AD5A 5A8PA 3P4MB 3PABB 4F7PA 4PJ8D 4CD7A 3EUUA 4FXKA 4O9HL 5FYJL 2NY6D 4M6OH 3EKCA 4ZQKA 3UERA 3GH5A 5GZOD 2GCYA 1QI2A 4LPTA 4I9WE 2X6MA 1AO7B 4AMWA 5CHNA 3QR3A 2HG5B 2D24A 2WQ8A 3V8CA 5FKAA 4B9YA 2XXCB 3U46A 1GL4B 5SWSA 2EZ0D 4HWEH 4PJGB 3LSOB 5FL0A 3EDEA 2VAJA 3CZJA 1CDUA 1ORSB 3GBNL 4NO0B 4QHKJ 5HYFA 1BFTA 1N64L 3DI2B 1HQRB 1HH9B 3BAEH 4EDWL 2GFBB 3WO4B 3APGA 5BJTB 5J6HA 1OARL 4LVHC 3BRGC 3TV3L 1KJ2B 3K7UA 5C0AE 1BQHB 1JF5A 4JDVB 3WBAA 2VDKH 4YWGL 3WIHA 4JAMA 8FABA 1ZHLB 1KPUB 3CVHA 3QFJB 4Y5YB 2ZXAA 4AIEA 1IC4H 4ZUVB 4Z0XA 5ID1B 3TBTA 5DC9B 4XB7A 1AXTL 2DLFL 3WKML 5D7IA 3QCTH 2F8QA 1BQCA 4GO6B 3TPUB 1YEJL 2H45A 3O3AA 2DKSA 1TPXB 1KG0A 3MRRB 1FZOA 5ALBL 5E08H 3PZUA 3IJYB 4S1SH 3J8F7 1UM6H 3F7RA 1MWAB 4XCCL 1T1XA 5D6CB 5GS2H 3WFHA 4F33A 4ZFZA 1MUJB 3TBVA 4HA3A 2IALB 4OKDA 3THMH 1HL9A 1NLDH 4UNVA 1ZGLM 4LEOB 1U33A 5AYUL 3C60D 2EACA 4NJAL 1ZHKB 1V3IA 2BNQA 1I8KB 3G9AB 4UT6H 3LEVL 3WY3A 5FO7A 3S35H 1FNGB 1XR9B 4HLZH 2WHJA 2CLRB 5BXFA 5AD0B 2BVQB 2NTFA 4ODXA 1BFOA 3RNQA 3KPPA 4Z7WF 1FH5L 3GI8L 5AAMA 1F4HA 2ZPKH 4X6DE 1OTSC 1IC5H 1QSZA 1NL0H 2K7QA 3QZWG 1GAFL 4JGMA 4YBQC 4NQTA 5FGSA 5SX5K 4OCWL 1W2KT 3IJHA 2UY4A 4YGVB 2YWYA 1F6AB 3VFRB 5GGVY 1UACH 4OLEA 4ODHL 3QWRA 5DJYB 4QHNA 1LLOA 3JUGA 4Z7VA 3LEYH 1RZGB 2IBZX 5C0CD 2IMNA 3MLUH 1XGUB 3O2VH 4EQ3A 4MDOA 1DDHB 4Y16A 4EI6A 2PN5A 2FX9L 4WSJA 3FFCD 5F89B 4DN3L 3DUUA 3HE6D 3RTQA 3MRQA 1K4CB 3DIFA 1BM3H 3GO1L 1S7XB 5FOBA 1NFDE 3B8YA 1MFAL 2B39A 3QXWA 5FECB 3IJSB 3WL0A 5I77A 1PQZA 3QDMB 4JANB 5CJOL 1OLZA 3SCTA 1JF6A 4PV8A 4LQFH 1YNTB 2E7CA 4R90H 1HSBA 5HYJB 1UG6A 2F8VA 3GMQB 4XCEA 3RTQC 1S7UA 2NY7L 2Q7NA 1G7LA 3HAEG 1K8IB 4YLQT 3QXVA 5HPCA 2DN7A 1F11B 4HC1A 2R9HC 4RMQA 2V3EA 5GISH 4YH6A 1CD1A 1IGCL 2YFNA 4PYSA 4JFPB 2DTML 3CDFA 4M82A 4BCEA 5D9NA 5I15L 4NN6C 4RBPH 1JP5A 1XGTB 4KY1L 3MXWL 3FO0H 1CICD 3BP7A 1ZLSL 1PAMA 3UCQA 2DTSA 2JIEA 1AGDA 3A6BH 3VXRE 2IADA 4HZ7A 5CSUA 3QG6B 4NKOA 3SKJL 2PYEA 4OLVH 3KXFB 3VGHA 2VVSA 5HI3D 3K2UH 2AJXH 4ZO6A 3NFPB 3VH8A 1NC4B 4Z7UB 2BMKB 3RDKA 1TJIH 1LHZA 1AHWB 1U3HD 2XGBA 5FA3B 2WMFA 2R29H 3A4WA 1HKJA 1YZZA 1HSAA 2OZ4A 1DWHM 1AE6H 1MNUH 1W72B 3IFOA 3S34L 3BQUA 4ZXLA 1VRXA 3SJVB 3L3HA 1MRCL 4MJIE 1V02E 4J1UB 3PGDA 4UINL 3ARXA 3ULUF 3IDYB 2CDGA 4FQJH 4HCRH 1WEJH 2ITDA 2E9MA 2NXZB 5IJKA 1EHLH 2VH5H 3JVGA 5F9OL 3BQUC 3QI9A 3BSZH 1YYML 1TZHA 3RVTC 1X4YA 2R0WL 3V79C 3Q5YA 4HHAA 3MRPB 3WFZA 1SQ2N 3BVNB 1MI5E 1P7KB 2CK0H 1G7MA 4HXBL 5IJKC 5CSGA 4OSUL 2NY0C 1JBJA 3TT1H 3HE7D 3IDIA 3V5DA 3JVGC 1PJ9A 1TVHB 1C5CH 3DHMA 5GGSB 3MNVA 1UD5A 4X7SH 1MCWM 3NPSB 1LL7A 5JW4M 4CBPA 5IR1A 3S5YA 3WFDL 3MRJA 3VDAA 5HHPA 1AVAA 1E6NA 4TVPD 4DW2L 4HPYH 4PJIE 2EXOA 2G60L 3V5KB 3MV7E 4DKFH 5BRPA 4ATLA 4FFYL 1S7VA 1A7PL 2FWOA 3BRFA 4JFYA 1EK3A 5KJRL 4X98A 1I1CA 1PSKH 3VFUA 4WFEE 1HYSC 2VLKA 1QRNE 4EJ1C 3IDXH 3QCUH 5EU6D 3ZTJG 1NBQA 5ECJE 4LPCA 4GXVL 3LAFA 5IGXH 4KJPC 5GS3A 3B43A 1K6AA 3BZEB 4ZXOA 3NZ8A 1GH7A 2IGTA 3BP4A 5D93C 3U57A 3RWEB 3G6AA 5I75B 4PJEF 3S7GA 2VABA 2OWXA 3JV4B 1QSFD 1DANU 5HBFA 2X10A 1UB6A 1UQSA 3LRSA 4GKZA 5C0FB 3TO4A 4BFBD 4PRPB 4PJFE 4Q9CA 4U1SB 2P49B 1BWMA 1DN2A 2F54B 4NO5B 3GSOA 4TSCL 1FO0B 3VXSD 4HWBA 1R3HA 3L2MA 5DVOA 5D7SL 2WIIA 4PGEB 2OL3A 4QXGH 2I07B 5JW5B 3QG7L 1RHHA 32C2A 3NDYA 3R8QA 5EU5A 3TO4C 5CEXB 4NDMB 3X11A 5L8KB 1UR8A 4IS6B 1T6VN 2IAMA 2UWEA 3L6FA 5JQHC 2A9MH 4O2EA 1KIQA 1TMCB 5I73C 1AKJD 3HI6H 3ZJKA 3F6IA 1PG7H 3KPTA 1QPXA 1JK8B 1W72L 2APFA 4UB0H 5IVXF 2ADFL 1ZKAA 3FRPG 1CI5A 2AXFA 2WMIB 2VXVH 5LA0A 3QDAA 1TLKA 2Q1EA 1WSST 4W6YB 1QLEL 4LDLB 2FIKB 3LV3A 3QQNA 1J10A 5FF6B 5E8NB 3VFGL 2GUOB 4OZGF 1A21A 2IAMC 2EH7L 3ARED 3O6MH 3SCMD 5KSBF 1D6VH 4D0DB 4Y5VA 3UTTB 4AYSA 2ZUVA 3VD7A 3HNVH 4NUJA 3C8DA 4GMTL 2WBJB 3BPOB 4Q6YA 3ZYZA 4M3KB 2OTUA 3RA7H 4PJHB 4CGTA 3QHMA 2XT1B 5FV1L 1XC6A 4Y4FC 1F8TL 4AD2A 2HFGH 5BQ7B 1C5DA 4LSDA 3OMZA 4P4KB 5E56A 1NMCB 3WFBH 1MXGA 4I8DA 4Z8FL 4Y5VC 1MFNA 3GXIA 3VGBA 2FX7L 2HJFA 4GW1B 3RWDA 1WAAA 2V9RA 3HUJE 3MZTA 4AL8H 3AZTA 2C3HA 3WO3B 1NKOA 1VJZA 2DQTH 1Q9OA 1HINH 3DYMA 1FH7A 2HMIC 1RV6X 3HI1B 3UPAA 3I50H 2EC8A 3GZAA 3D3VA 1A64A 1WBZA 4N0FA 4K71C 1U8HB 1ZGLP 1ZEAL 1W91A 2Q87A 5EBWA 2HLAB 4FQIH 3F4VA 4LP4A 3U79A 3VI3E 3LZFL 4G9DA 1UUQA 4OUUA 3GTNA 2ALWA 4GG8B 1GIGL 2MPAL 1TFVA 4ODTH 3TZVA 2NPLX 2IC2A 1FVDB 1VESA 4HPOH 4JR9L 4TVSa 5FUCC 5C0CE 1GJWA 3PTMA 5E95B 3FQUA 4WKHA 4N0YH 3S9DB 3H8NA 3CC5B 4KPHL 4FZ8L 3BRDA 1OF2A 4TNVK 1S7TB 2VLRE 5I1JH 3FFCE 4IDJH 5FD0A 3DHJA 4RDQG 3D85D 4OCYH 4BSVB 5I1GH 3BJLA 1UCBL 1A02N 4KUCF 2NSXA 1CK0H 1X4ZA 3TZVC 4IPLA 4KRPC 3U4AA 2N7BA 3OX8A 4H8HA 3KNBB 1E28A 2V2TB 4PREB 1VFUA 4JFHD 2AQ2A 5E6IC 5GJSH 3CLEH 1SBSL 5GQBA 3KYKL 4RNRB 4Y2OA 3KYOA 3ZT7A 2ESVB 1FO0L 3OZOA 3T3PE 3G5YA 4KK8D 2P5WA 4W68A 4NRXB 3OLIA 3C5JB 4U1LA 2VR5A 2W59A 2O61A 3RUGF 1BQUA 4Y7MA 5GRUL 5ISZD 3C5SA 1KUMA 1YMMA 2DOCA 2QSQA 1BVKB 4DO4A 3EDFA 5JTWA 3VSVA 3B9EA 1TG7A 1DR9A 1JYXA 4J27A 5KANI 1DQLH 1YECL 3D25B 1JPSL 4EOWH 1FLRH 1ACYH 4P2QA 1YDPA 1E72M 4HK0B 1MAJA 5EUOA 4MXQD 4XXCA 4X9BA 4L9LA 4UFIA 1S7SA 1QSVA 5DJCB 3DPBA 1MCIA 4TQEL 4DM1A 3PUCA 3WE6B 5E8DH 4AW7A 4UILL 3A22A 5EU3B 4NN7B 3AHZA 3IXTB 4ORZC 3K1KC 5IBUG 2YIHA 5EO1A 2ITCA 5HHXH 4FQCH 4FQ2H 4WI8A 3VXPA 2CR6A 5KG9B 1QW8A 2EYTA 9CGTA 4XXCC 4L9LC 3RPMA 5JORA 3C6LB 5KSAD 4FA8A 1B0RB 4N8CL 3U7BA 1NBYA 5TGBA 1TVBB 1KYOJ 5BXPA 5CS7A 5MERB 1H0DB 4PJDB 4C83A 3LXAA 5I8OH 3GH7A 1MIML 2FEEL 3BAKA 5IK3A 5J6GB 2FD6L 4HDIA 4LEXL 3IF1B 1OGAA 3HMXA 2MQ0A 3RBGA 4G8FA 5E9AA 5FM5O 3BXWA 3QNZB 4P2OA 4TRPH 5TDNB 3PN8A 1HYRC 4WWID 5ANMA 1UA3A 5DD3L 2AV7B 4L3AA 1Y0LA 1U8KA 2F53E 4M4RA 2PBGA 5F9JA 2ZOKA 2EIZB 3BP6A 2J78A 4GZJA 2YEZA 3EHBC 2LVEA 2DD8H 5DO2C 2HTLD 3STLB 1MFBL 1UR4A 3O2DA 4TVPE 1KC5L 1F90L 2JLLA 3SURA 5SX4H 3FB6B 4PB0L 1VADA 5D1ZB 1MAMH 5KTEL 4KMTL 3H9YA 1SMDA 4RAVB 4WWKA 3K0WA 3R4DA 1NAKL 3HFMH 4U7MA 3SO5A 1EDGA 2C26A 5EU6E 1SEBA 3F5WB 4DWSD 4QY8B 4RWYH 2AK4B 4HWUA 3MNZB 2XTKA 4MAUH 5F3HA 3EJUA 3Q6GL 1AGFA 1S7WA 1KXTB 4CNIA 5F7FA 2P8MA 1IARB 1VBUA 5IEKA 1F3DJ 3W24A 4OTXH 2D1ZA 1A7RH 1QSFE 5I2IA 4X8XA 1JN6A 4D9LL 1JZ5A 1EFXA 2OXGA 1GGCL 4YHNA 1FORH 1U93A 1M7XA 1FCGA 2DIBA 4EI5A 2DIAA 2EQDA 2DLGA 4DOHE 2CKBH 2BSED 2Z31B 3ARTA 4L1HA 4RQQA 4ZDHB 3A47A 2JEQA 2EKSB 5A6BA 1U2CA 2WUCL 4HWNA 1M71B 5JHDD 4QGYA 1GGUA 4PGCA 3VXSE 1J8HD 1ISZA 1CT8A 5D70H 1PZ5B 3T04D 1EO8H 5GRJL 3MREA 5ADOL 4K7PL 2FL5A 1XCXA 1H5BA 4DFHA 5CGYC 5DT7A 1J86A 1BAFL 2NNAB 5D2LA 3RI5K 1V6UA 3F7VA 3BJ91 3PGCA 1QFWH 4HGMA 4EI5C 3BPLB 4PJXE 2O26U 4DEPC 4XRCB 3U7WH 4PJ5D 3WLBA 3DX6A 1D9KD 4ONHB 3SCSA 4MQXC 4JDZA 3CVHL 1TNMA 1JPTL 1KOAA 5DUMH 4H88H 1BBDL 3TVMB 5ADPH 5T33L 4WY7H 1C8YA 1H5BC 2ERJC 4NI3A 3B2VH 3FT4A 3CZFB 4G80A 2Y4SA 4LSVH 3NCCB 4I3SL 3F5JA 4I13B 2VMFA 3VNYA 3MLYL 4V1DD 3LQZA 1UWIA 4AH2A 3VFOB 4AENB 3ES6B 1ZHNB 3VMOA 1WFTA 2ZG2A 2A6KB 4LKXB 3VD4A 4BQ5A 1PKQE 5C92A 4XPTL 1LO0H 1T0MA 3BDBA 1YEDB 3MA9H 4O02H 5I1LA 1CGTA 1S9XA 2D31B 1H1NA 3LRMA 1UZ6E 2OK0L 3WHXA 4PJCE 1EUTA 4CCCA 1FG2A 3NIYA 1SYSA 2Z35A 1G9EA 1Q0XH 4YPGA 3IKCA 2IG2H 3QNYA 2ADJB 4OQTL 1X6LA 2X0YA 2JCCE 5EBMA 4YHPB 4ALAL 1NOFA 3NTCL 1JMZA 5C6PB 1ORSA 1MVUA 3LVEA 2WCGA 1R86A 3KPNB 4NO0A 1HH9A 3OB0H 2X4RA 5FO9B 5BZDB 3WDIA 1NOWA 1KJ2A 1IAKA 1BQHA 4PD4K 3KPSD 3UJJL 1LK3L 1JNJA 5D1QA 4KVCH 1KPUA 3WH7A 3FFDA 1NSNH 3LB6D 3MR9A 5BCAA 5F7MC 1IC7H 1R5WB 3W4RA 3RWFB 3DVFA 1AQDA 5F8QC 4PJBB 1RMFH 4G42A 1V7ML 4HS3A 2YKKA 4QRPD 4GSDL 1UJ3A 5D1QC 4PGZA 2KH2B 3H9ZA 3GBML 4QOKB 3WCYA 2DQGH 3F7YB 4MB3A 2H32H 5DZNA 5CINL 4CKVX 3I75B 3L3DB 5GHWH 1WVZA 1K9DA 2DQDH 4JFHE 3NH7H 2WVSA 1UJ3C 3QUYD 4U0RB 3BGFC 2OWWA 3PV7A 4WTZG 1T1YA 4KHXH 5FO8A 2DYPB 3IDMA 3Q3GB 3NACL 4WU7B 2I5YL 4JG1H 3P4NB 4YHLL 4OCNC 3UTPD 5F44A 1INQB 4OUOA 3EYFA 1XR9A 4P9MH 2V5TA 5ISZE 4K9EL 4HMCA 2V7NA 3A21A 3KG5A 5DS8A 1Q9WB 2DQUH 4CMMB 4PCSA 2GAZB 1YPZF 3QRGL 4CJ1A 4ORGA 3QWOB 4WW2F 4FFZH 3OJMB 4MSWB 3VFRA 3PJSB 3QQ4B 4XB3A 2FO1A 2J6EL 3ZQ9A 4U1MA 4AY0A 1HQ4A 1MIEH 1UWGL 5LAXA 4U3HA 3VXRA 5IIEB 3PDOA 3MLXH 1A3RL 1XRVA 1FIGH 3D2UD 5GRYA 4WJ5B 5IMKB 1KWKA 2HFEB 1JHKH 4WDIA 2K9UA 3BP5B 4OCMC 1XGUA 3Q1SH 4OZIB 2Z91B 1LVEA 5KVFL 3DURB 1OWRM 4Z76A 1HH6A 4MAYD 4PJ7B 4UV4L 2EDXA 1RIHH 1MJ7L 2HP4A 4OFPA 5ICXA 1K4CA 3MO1A 3WD1A 4OIIH 5T3ZD 3CFEA 4NZUH 4G6ML 4EUPB 4D2NA 2X8RA 4X7EC 2ZCHL 1IBGL 4CW1A 1UZ1A 4MJIA 4Y4FB 5K93A 1GOIA 4PRBA 4IIQB 2W60B 3W11C 3FAXA 2Q3ZA 1GGIH 3GMQA 2VZUA 3FQXB 3KDMA 3MJ7A 1K8IA 3DMMD 5DJ0B 3KLKA 5T1MB 5JOFB 3MLVL 4IPNB 2ZP0T 4X0NA 3VSTA 3T0EA 3SE4A 1YUHB 5HPMA 4ZPVB 1H15A 2IXVA 2C1PB 4PRDA 5ITFB 1NCBL 5E2VH 3A4AA 2HJKB 1RIUL 5A2FA 1ITBB 3PTQA 1Z9SA 4K2UL 2YPLA 1AY1L 4JPIB 2YLLA 3SE4C 2O5YH 2ENSA 3QG6A 4JHWH 3TN0C 4UDTA 3MGTB 4PS4L 3S3PA 1KELH 5CZKA 3JBG7 2QQNL 5BWFA 2ICES 2JKXA 4NSBA 5ICZB 1KPRB 2BHUA 3AAZA 4PJIA 3OKLA 1DBAH 3MV7A 4GFTB 5HHOD 1E4LA 3V4UH 2QR0A 3FNDA 4IBLT 5I1KL 3NCJL 3WBDA 2NY3D 4JFFD 3AB0C 2JELH 1MELA 4GT7A 3GKZA 3RJYA 3RZCB 1KGUA 5I8CB 1T4KB 3VE0B 4OI7A 4TUFA 5FCZA 1LEGA 4L29B 3QA3B 5J12C 5KVDL 4EIGB 1EMTH 1QRNA 3WQ5A 4NBYB 2VX7A 1ZS2A 3P73B 3L3JA 5E94B 4OLZH 1GOGA 1ZT4B 5FKPA 4Z78B 5IP4A 3V6ZB 5C08B 4MA8H 3VFVB 5IHZA 1AC6A 3CZ8A 3SCVA 3DETD 4UMGA 2VXSH 1I1RA 4NZRH 2UZIH 5FUZL 4HKBA 4B3LA 2WUBH 3SGDI 4PJ8A 2FJFB 2EJ1A 4FXGA 5J3HC 1FV1A 3VFWA 1PBGA 1E4XI 5HDRA 4OOZA 3D5OF 1KLGA 1JFQH 3TYFB 1CBVH 1RZKC 3I6KB 3THCA 1RUAL 3BLBA 4HWBL 5HOSA 4KTDH 3C87A 5GIRB 5JHDE 1J8HE 1CNVA 4PJ8C 3PZOA 1V0KA 3W81A 1SVCP 2NY6C 3FZUD 5GZOC 5F70A 5HHNB 4WHTB 5E99H 5MP6L 4PY7A 1C91A 2YPVL 2WVVA 1BZQK 1RZ8A 4ZOEA 3BUYA 2BVPB 4PJ5E 4D71A 3MFFA 5INDB 2MSPA 1HHIB 4AZ7A 1DQMH 2EZ0C 4X9IA 2BC4B 5J4MA 4XPGH 3LKSB 4Q6IB 4KWUA 4JFEB 1XGRA 2ATPA 1A8JH 1R8LA 4F2MA 5LGKA 1A3LH 4GH7B 5ILTL 4A6YL 3NA4A 2RBLA 1EDTA 5I78A 4UV7L 5F1SA 1R3IL 5SWZB 1I8IB 1HK6A 1OSEA 4V1DE 5F8RC 3OLEA 4H0IA 1PYWB 4EKXA 3V0VB 4EBQH 2AJ3B 1Q6GA 1BFVH 4FLSA 3RWEA 1U36A 3LHPH 3WXWL 2B0SL 4D0BB 5IB4B 1QLFB 4GBXD 4MNLA 2DQHH 1P7QB 1UA7A 3NA9L 4RGNB 2AGJH 2QLYA 5C0FA 2YBTA 4NWUH 5CIPH 2E6JA 4XMLL 1FVCB 4L4PA 1G0YR 5JUEH 4N5ED 4YDVA 3HUJA 1XR8A 1O0VA 3BEVA 4YHGA 4TVCA 4M6ML 5EN2B 1K8DB 4KQ4L 2HJLA 1NBZB 3NIGF 2CEQA 4LVEA 4MAZA 4HLJA 3DVGB 3QQ3B 5T3XH 4G9FD 5JA8B 1E6QM 2JF6A 1EIBA 2GDUA 1JDCA 3DHPA 4GI6A 1HHGA 1IQWH 1BZ9B 1YY8A 3GB7B 1U8MB 1UB5B 4FZEH 5LYRA 1T5XB 4Q7DA 2ZUTA 3H6JA 4JJ5B 1TVDA 3OKOA 3C60C 1TVPA 3KPSE 1C5BH 3QHFL 1N7ML 5T1LD 4HGWB 3QO1A 1JK8A 1G7QB 3BYYA 5E2WL 1S46A 3HLAA 2EDLA 1WCBB 3OXRB 1J1PL 5LVEA 3U0WH 3VI4E 2Z4QB 4JDTH 1T04A 5ID0A 5C0RL 3FXYA 1J0HA 4PG2A 5BO1L 4I3RL 1QEWA 3BXNB 5C0CA 2R2HB 2XVGA 5GSVB 2IANB 4QRPE 1BVZA 4QTIL 3ARVA 4UTBH 4WO4D 4QEGA 4FQ1L 1QFUL 3H3PL 3RJQB 3NFNA 4MA1C 2X7LB 3BHBA 3FFCA 2ZJSL 5B4MD 2O5XH 4KZEL 5AYQA 4GW5B 5JNYB 1SFSA 4WIWA 4F7CA 4PG2C 4KDTA 1GGBL 2YSSB 2OJZL 6CGTA 4F3FB 3ZYJA 4L3ED 2AMGA 1ZWIB 3U4BH 3QR2A 2VKXA 2ZX9A 4QYOB 3KPRD 4X6CB 4GRLD 1DBJH 3BKCL 3HE6C 3U1SL 1B6DA 4KUZH 3BOVA 3W27A 2W9DH 1UKPA 4E42A 2VRQA 3TLRA 4YHIA 5JIPA 4YHYC 2VXTH 2P7TA 1OP9A 1U92B 4KDTC 1CGSH 4GI9A 2QHRL 1V7NH 5GGRA 2IBBA 2CIKA 3D4YA 1TQBC 2IMMA 4E4PA 3MRNB 3KLAA 2W65B 5KS9A 3H3KA 3INUL 4HUVB 1EUUA 1TJHH 1PBYA 5JBEA 1CICA 4YQXH 5TF1H 1M4KA 1M04A 4M9PA 4GG8A 3N1FC 1IT0A 1SJXA 2H2SD 2J8UB 2VAAB 2VWEE 3QEQB 4M8VA 5C0JB 1KTLB 5IUSA 3CXDL 3NPZB 1BD2B 3GXDA 2XTJD 4HWEL 3ULUD 3BPNC 5L0QC 4C4KO 1DQQB 3AIEA 4NO2B 2WYSA 1S7TA 1CICC 4AIZB 1U3HA 4WRLA 1K9EA 1CFVH 1OOAA 1R5IB 2E27H 3N1QC 1FNSH 5T3ZE 1MPAH 4DKEL 1EVUA 1MCCA 5FYKL 4JQXC 2QSVA 2FNBA 2V2TA 5HI3C 1XEDA 2NZ9D 5F96H 3RBSA 3UCRA 1XGQA 4HF5H 1VEOA 5KVGL 2J7FA 4JO3H 1U3HC 5CMAA 4HJ0D 4ZTPH 3C5JA 3QCTL 3PQYD 4P2RB 4XXDB 4E41D 4ZYKB 3PF2A 5EO9A 3WIFB 4PMDA 2X4QA 1GJIA 4X4ME 4JFZL 1F13A 5FYLD 1BVKA 4M5YH 2ZX8A 2WIMA 3ORJA 3D25A 3LXBA 5C0BD 4D6JA 5J9PB 3GMOA 4K8RD 3SDYH 3NUKA 1UD2A 5DMGD 4XPBL 1LO4L 2ZCKH 3HAEA 3V6OA 2P8PB 2C0HA 4HQQL 4OUEA 5INCA 1AD9B 4M80A 3LKNB 2R2CA 2XNAA 3IJ9A 1EERB 3ARBD 4GG6B 2R1WA 4UT6L 1HWGB 3ZT5A 3IAQA 4L9DA 4TUKH 4DO6A 4YNYB 4RFOL 3IRZA 5DRNA 3O6AA 4NQSA 3OGSA 5HHOE 3HE7C 1NGWB 2X9YA 4NWTH 4YFLF 2EADA 1DVFB 2NW2A 5DFWH 1EO7A 3QPQD 3RI5F 4G8GD 1E73M 3EAKA 4GKOA 4JFFE 1RJLB 4MB4A 1I1AD 1U8JB 3CZKA 2CCRA 2F7QA 4ZE4A 5C09B 2XVLA 1FGNH 5DQ9B 1BG9A 2J8OA 4MQ7B 1QHOA 4NRRA 3DV6A 4AIXA 5EU6A 1K4DA 3LEYL 3W0KA 1F4YH 5AWNH 2F8XC 1F6LL 3PWLA 1EPFA 2NY5H 4D6HA 2X5PA 4XPFH 3Q6FB 3WLWC 2PNDA 2C7UA 4JM2B 1V3JA 5GS0H 1QSFA 1IQDB 1ZVSB 3OAZK 3UPRB 1TQVA 1B2WH 3L3IB 3IVKA 2AKRA 4JZNA 5FHBH 3VD3A 1MQQA 1WKYA 3ALFA 4LRNH 4UUJB 3U82B 5ITBH 1VCAA 4LQFL 3VXSA 1U8QA 3BKMH 7FABL 4KZDH 3UBXB 4D6EA 1V08A 2ZUSA 5EIVA 1JZ8A 3MRDB 3K8LA 2P8LB 1BX2B 3QB7C 4KMQA 4BA8A 4ZENA 1RK0B 2G9HB 5DHVH 5GISL 2D03H 1AKJA 1MQRA 2CHOA 3VXQB 1H3PL 3W9DA 4RZCA 4WTXA 1AR2A 4OIFA 5EUKB 3KLDA 4LKCA 4IOIB 1CE6B 4ZNEE 4NQVA 1WBXA 4XV0A 3P0VL 3VOCA 3QEHA 3A6BL 4X9FA 2AI0H 5I74C 3VD5A 1RVFL 1ES0A 3GHEH 3HNSH 2P4AB 4WHYG 5DK2B 4C7FA 1B4JL 1DE4B 1G0XA 4RISH 2XKNA 3OKDA 4M93B 5CLTA 2PR4H 4NJ9L 4R3SB 1V6YA 4XC1H 4DGVL 4HUNB 5F6HI 1PKQA 3RHWK 4NQXA 4Z7WE 1ODAA 1MRFL 3AIBA 4I77H 3O81A 2R29L 3VWKD 1EAPB 1GZQB 2A6JA 1J0KA 3AREC 1EDQA 3SCMC 1D5ZB 1OWWA 3GGWB 1INDH 3T1WA 1D5MA 3BKJH 1TQUA 4PJCA 5D1XD 4ZDHA 2YRZA 5F7EH 2ICWJ 2UUDH 1UH3A 5SWQA 2R69H 4NQEB 3UX9B 3G08A 5J1AB 2JCCA 1VIWA 1NLBH 3PZTA 4G9FE 2ZNXA 5E24E 4H25A 2NNAA 1F4WH 1OAZH 2R23B 1HILB 1R47A 2DBLL 1RI8A 3TIEA 1QRKA 4H1LH 4XRCA 5J1TC 1FN4B 5IQ7H 3SE8H 1KCUL 4ZOBA 3WH9A 2EDHA 3TVMA 1AQMA 2YLAA 4KUCD 4ZAKB 4AMCA 5HD8D 5L6YH 1HL8A 1VFFA 2VDOH 2DMKA 2EKJA 3CZFA 5C0ND 4AM0B 1MJ8L 4XZUA 5EIIB 3T77B 4D8PB 3TT1L 1GHSA 4ETQA 2UV3A 3ZMRA 3TH3T 3DV4B 3LD8C 1U8OB 2IWGA 3ES6A 3G6JB 3GSQA 4TSAL 3LKRB 4P9HH 3SBWA 2A74A 3W6MA 2A6KA 5IQ9B 2XRAL 1KNOB 5AEAA 5DQDH 2V7HA 3KPLB 5CJXA 3FRPA 3D85A 2Q6WB 3PZNA 1GXEA 2OP4H 3K4AA 1VHPA 1CLXA 1UR9A 4FNQA 1F00I 1ETZA 3RWGB 4L3EE 3EMCA 5LCVH 3TH2T 2DSZA 3CZGA 3SBWC 1YEIL 2AXGA 1BBJB 4HXAH 4QHUB 4ACPA 3OA5A 3OL2A 3KPRE 4W81A 2H6PB 1GQIA 4YDJB 4ODSL 2ADJA 3PWNA 3QCUL 3EDDA 5EO0B 1QBBA 15C8H 1Q8MA 1HWWA 1H2JA 1NAMH 1FFOA 3UG3A 4B3KA 5M7QA 1TDQA 5IMOA 5FO9A 4XCYB 3JTSB 5BZDA 4M81A 4MYWB 5B3NA 3KPOA 1F42A 4KK8C 1MREH 3PWPB 3QNXB 4L8SB 3WEXB 3WF1A 2ZUQB 4WUKH 4D6FA 3UETA 4YAQB 1XIWD 2W0FA 4PJFB 3EYUH 4X6FA 3O3UN 1NDGA 3EJYD 3MQIA 2XFFA 4HUWB 2P47B 2YK1H 4LMQI 3PL6D 3P3YA 3GSVA 2GDVA 2FX8L 2XTJE 3OKNB 3ULUE 1PEZA 4TPRL 1OP3K 3EJTA 3FB7B 4Y88A 4YC2C 4QXGL 4AZCA 4FABH 2ZWLT 4BJLA 4MXQC 2L7UA 1RUKL 4JHBA 4JZOB 5D5ME 3UTSD 2OSXA 2AJZB 3P11H 5KSAA 3MROA 2ICWB 1JDAA 5AC5A 3F7YA 2MHAA 4IRJB 4PJEB 1OGBA 5TDPA 4GS7C 5CJ8A 3S97C 2FR4A 5L88H 3I75A 4OZHE 5EB9A 4JAWA 1PG7L 4LLQA 2NY1D 2A6DA 4QXUL 4UB0L 3HPLA 5IFAH 2ADGA 2VOTA 1HDMB 5C0GB 3ZM8A 4CVXA 3RDTB 4WU7A 5F88B 5KSAC 4XNYL 3OKEB 3P4NA 3PQYE 4AIOA 4E41E 4ZD3L 4OGYL 3AOFA 3NSMA 1S8DB 4HOWA 3BGMB 1D6VL 3P30L 2VRJA 4IRSD 2R1XB 2Z92B 4XVJL 5FYLE 1JXKA 2C4FU 3HR5A 1E0WA 3FOLB 3ALGA 3REWB 4AMXA 3PIQB 3WV0A 4WUUB 5C0BE 5EG6C 4S1DD 3JWOC 4RMTA 4MNQD 2OMBA 2HFGL 2CJUH 4OAWA 4F7TB 2HH0L 1CLYH 4UQ2B 1NWUA 2BDNH 4ML4A 2CRMA 4Q22A 1E6OH 3DGCR 1F97A 4HJGB 3TWCH 2Z91A 3VIMA 4NHCH 5F1OB 3MSGA 4QDMA 3RM8A 4YBHA 3QULB 5C9JB 1SY6H 3E2HC 4HV8B 4Q74A 2CBUA 2GJJA 4GKNA 2PWFA 4FOMA 4G8GE 4Y2DB 1HWHB 1MW1A 2AK1L 5HHQA 1IT9L 5HYIA 3RIKA 3BIAX 2HTLC 4MA1B 4NRSA 1NJ9A 1LILA 3BPCB 2BVEA 2YKLL 2E3VA 3UMTA 3ZHKA 1E0VA 3A67L 3QDJD 2J75A 1KGWA 2YRPA 5DEFA 1UKQA 1UKOA 5ECUA 1C8PA 3WSQL 4IIQA 2W60A 1RZKL 4RE4A 1QTYT 4DWSA 1F2XK 4BQ8A 2FEEI 3EDJA 1QOXA 4LNRB 4XTRD 4MB5A 3ZHLA 2X1QA 1O7VA 1FNAA 2VLRB 2P5ED 1UWEH 3U30B 4U1KA 2UZXB 5E2UH 3RX8A 5JOFA 1GONA 5LA1A 3HZYA 4MNGE 1S3KH 1B3YA 4TOQA 1CS6A 4ZPVA 2C1OB 2E40A 1Y18B 3IFNH 5IHSA 1LEKA 3G5ZB 1PKOA 3C2AH 5I1GL 1UZ8B 4DWSC 3W39B 3NIFE 1CK0L 3OV6A 4HEME 4JZJC 2OQJB 4JN1H 4AT6B 5IVXE 4DVBA 1E4NA 1OB0A 2GSGB 3QISA 5JHDA 2B7DT 5C6TH 4ZUSB 2RFXA 1BIIA 1M1SA 2R56L 4PLKD 5DHXB 1B0GB 1BYBA 4OZGE 5CILH 5E5MA 5KSBE 5JQ6H 1T0NB 2L7JA 2XY1A 1XCTB 4NFCA 4PFEA 1H3VA 4NRZA 1MAKA 2Q8BL 1KPRA 2GIYA 5JMOC 4MD0B 4D9RD 4PJ5A 4P2YA 4ZFOB 1B0WA 2JB6B 4PMUA 3U7VA 4R4ND 5DJXA 2J77A 1I85A 1DQLL 2P1YA 5L0QB 3ZE0E 2I9TB 1V5JA 4OV5A 4TVUA 1VGKA 4HOXA 2XKSA 4UNIA 4HSQA 1E70M 1KENH 3OJDB 5DD6A 3QA3A 2WANA 1K6QH 1U91B 3V0WL 5BS0B 1S9YB 2CKBB 1M05B 4V1DA 3GJFA 5E8DL 4TN9A 1CD0A 2BVTA 4WW1A 2Y72A 4JKKA 4R2GB 1I85C 2CPCA 1AIFB 3RUGB 1V3MA 2LABA 3G9VA 2BJMH 3QIWD 3EJZD 5HDOA 1US2A 5JMRA 1ADQH 4G43B 1C92A 2XY2A 2GTZB 3KS0J 5C7XH 5JW4Q 3PGFH 4HAFA 2VDLL 4DZ8B 3U48A 4P5TD 1CDHA 1I9RL 4FQLH 2KL6A 4XAKD 3BE1H 5A43C 1A0QH 4LLMA 2CR3A 3VIFA 4B50A 4UFJA 2IPKB 5GSRB 3O4LD 1LEIB 4Z95H 1TENA 2F18A 3DNKA 2J5LB 5I18L 2GJ6D 1MJJB 1LO5A 2Z0BA 2V5CA 2WC3A 1X5FA 5INDA 4MDPA 2CXKA 3KPSA 4OM0H 4FMVA 1MFCH 1ED3B 4TRPL 4MTVA 1N5AB 3L7EB 2VX4A 2BY0A 2JB5H 1XGYL 2F53B 2B5IC 2DQIH 2DAVA 3LDBC 1MQKH 4HFWB 4BA0A 1YN6B 1PY9A 3AM8C 1RH9A 3FOMA 2ZNWA 1DBML 5HGBA 2X44D 4QRPA 2QL1A 3P0YL 3PDGA 1FZKA 4H5SA 1A14L 1IGMH 1S9WB 4FNTA 5CJBA 1OAXL 2R2BB 1DWIM 2NW3B 4HUXA 3TH4T 3LB6C 1X5ZA 2VLMD 3H9SD 4P23D 1MVFA 1AI1L 2X1IA 4JFQB 4ZFFB 2XA3A 4P59L 1A7NL 1H9VA 1DN0A 1OGTB 4FN0A 2EPOA 5A2BA 3MRBB 1NFIA 1UM5H 4L4TD 5J13C 1FL3A 2AV1B 4JY5H 3MLPA 4YZFF 2BY3A 1FVCA 1V6VA 3GSWB 1KR1A 4ELMB 3RGVD 1CFQA 3BH4A 2Y5TA 3MLWL 3ZO9A 3W9EB 5IF0A 3O8XD 1W9XA 3SO3C 5F9WB 5LXGH 2A2QT 1JI2A 3FB8B 3UZEA 3MGOB 1EXPA 3BO8A 4MAUL 3QUYC 3WDRA 4GAFB 4MA7H 3LQAH 1BZ9A 2BOBA 1U8MA 1UB5A 3KWWB 4ZFOL 3WF0A 2O93L 2VDQH 1TTUA 3KHQA 4L1DA 1A7RL 3TCXA 3HI5H 5I1CH 4QXTA 5MI0B 3VFNA 4DOHB 1BLIA 2H32B 1MCFA 3D0VB 3TJHD 3AYRA 2IH3B 1LE5B 4OZ4B 4P8VA 1H3GA 4OIBA 4HZ8A 4PTMA 3L95B 3D2UA 5IV2B 2B1HL 5D70L 5GSVA 5IBLD 4JB9H 1KULA 1MEXL 3ZYIA 4PJXB 3O9NA 2NY4B 4MAYA 5I74B 3ROLA 2FJHA 3FY1A 2P46B 1D6EB 3UTSE 2YXFA 4JRYB 1REIA 5EMYA 1PLGH 4G6JH 4GW5A 2CRIA 2VWEC 3SGJA 5A6SA 2W07A 4PTVA 3SIMA 1MCQA 3MUGA 4F3FA 1KB5A 2FBOJ 5D8JL 2CBJA 2BSRA 1ZWIA 3B2VL 4MAYC 4Y4KD 4QYOA 5ENWA 3UJTH 4NT6B 4X6CA 3SN6N 4WTWA 4R0LB 4WNQB 5FV2A 5CCKL 3DMMA 12E8H 2LAGB 1SJVA 3QUZA 3SGJC 4DK6A 5I30H 1JAKA 5JO5A 3N0PB 1EGJH 3GRWA 1WC7B 3SKNB 3D48R 3WF4A 1LO0L 5ESQB 4WTZA 4PLJD 1E4XH 4O02L 2BNUA 2APVA 4MNQE 4P4RA 4OJFL 3OPZL 2GJXA 1RJZA 4HUVA 1H49A 2FO4A 3DMMC 2AJUL 2Y6SC 3VWJA 3S88H 1BJ8A 3QUZC 1D5IH 4X0KA 4QRSA 3VIHA 1HXYA 3SDCD 4X9GA 3QEQA 1EXUA 2IG2L 4TVPL 1G6RH 1KTLA 3BIKB 1DEEB 2BNRB 3PWVA 5KVMC 1XYFA 2GT9B 2KZ1B 3FO2A 3KJ4B 1KTBA 5K9QI 3I2CL 2M8XA 1U8NB 2PTTA 4C7GA 4S1RH 2PXYB 1CXLA 3W29A 3PE9A 3QJFA 2DWEA 3EYSH 1R33A 3N18A 3U7YH 4POZC 4E0RA 2JIWA 2FATH 3IDUA 4G6FD 4XMPL 2X05A 4M61A 3IAGC 3RY6C 1MCSA 1VFAB 1W0YT 4JFFA 5DWUL 1E6RA 5D7LB 4Y4HB 2QEJA 3BZ4B 3ROOB 3AICA 4TUJB 1GHFL 1JZ7A 3QDJE 5JBFA 4OFIA 1T89A 4J8RB 5JDSA 4BFEA 1CXIA 2H8PA 4LLAA 5MHSD 4M8QA 2E7HA 1QYGH 4UQ9A 1RMFL 1PY4A 2XVKA 3L3GB 5M94B 2WV3A 5IB3B 4OT1H 2NY3C 2EIEA 2P5EE 4PJGF 5DUBB 4U6YB 1FL6B 3CMJA 4OJYA 1T89C 4JKLA 4MPKA 5E9DB 1ND0B 1HP5A 5GRZA 4O9HH 4XNZB 5FYJH 3DTXB 2YWZA 2W0PA 3DETC 5IM7A 2DQDL 4LLUA 1J05B 5IB1B 3VRIB 4BH8A 4KHXL 4M1GH 2UYLA 3BAXA 1EJ6A 1NQBA 3OKMA 4NF7A 1OD8A 3ZTNL 1OD0A 3HN3A 3LPOA 3R06B 4IMKA 4D9RE 2X2IA 4U5IA 2OYKA 1LWRA 3ZHDA 2FH8A 4EDWH 5BROA 4M62L 1B90A 1DVFA 3QT2A 3MCLL 3PV6A 3RM4A 3TV3H 1RJLA 3OR7B 2EO7A 3FZUC 4YWGH 5ESVA 1C8XA 1IZJA 5DQ9A 3PWJA 5C07D 4ZNEA 4MQ7A 5JDJA 3VMPA 1MIEL 4IMKC 2EABA 2VB5A 1R34A 2DQFB 4WLCA 5JIHA 1FIGL 1XAUA 4MJ5B 3CFDA 1R3KB 1AXTH 2DLFH 3ZO0A 1HXMB 1WLHA 3O3BB 1WT5A 2HT3D 3QXAA 3V4PL 1A6UL 4Z7WA 3ZDYF 1G7HA 1MCLA 5C3LD 2XM1A 1MLBA 4GBXA 1YC8A 1DEDA 5IHRA 2E9IA 4F15B 5BW7A 3MX0A 3F5LA 1BZ7B 4GUPB 2X4PB 4XCCH 1FFNB 3MJ9H 5TE7L 1PG7W 3TA9A 4OIIL 5DHYA 5TQ2H 4MCYB 5B3JF 1T7WA 1FZJA 1Z2KA 4XAKE 3G04B 1R85A 1WT5C 1MCJA 5F7YC 2IPTL 3G5XA 1H3XA 3O4LE 4Q0XL 4GBXC 5AYUH 5J11B 1GGIL 2FECL 3L1OL 5BW7C 4G9FA 3P9WB 4MD4A 4P5MB 5IB5A 1JZ3A 5ESAB 4KV5F 2WZEA 1BX2A 3EW3B 1YYLL 3ZE1F 4ZTOH 1JHTA 4P7RA 1FH5H 2YUZA 4LCWB 4N5EC 25C8L 3GI8H 3OKKA 4GW4B 5MENB 1HJSA 5T1LA 4WFHD 4KROB 5E2VL 2GJPA 1MH5B 1XGPB 1GAFH 1O7AA 2VDNH 5EUKA 4WCYL 3IT8D 5DQJA 2VNCA 1ZLWK 1VBRA 4U3AA 4IOIA 1CE6A 4CU8A 4ODHH 1T21A 3T0DA 5A3HA 4MD5B 2ESCA 3PXHA 5CIPB 4HIHA 2BSTB 3T2PA 2O5YL 1L9MA 1XV8A 4Z9KB 1ITXA 1DE4A 4W4OA 4WO4A 3RPIA 3QHNA 5GGVL 2EDNA 1LWHA 5GRWA 2QSCL 1PX8A 4QAWA 2NT1A 2VLME 3H9SE 4RMRA 1FCCA 1YPZE 4J3WA 1DBAL 2F9BT 2FX9H 4TNWK 5TE4L 4EN3B 3BAYA 1G7PB 3OGCB 4DN3H 4X7CC 4N8VG 3U0TA 3V4UL 1H8OA 4ODVL 1D5ZA 4Y19D 1NCDH 5DDHA 5TE6H 3GO1H 4L3EA 4L4TE 3WDHA 4WO4C 3MRKB 4U0QB 1MFAH 3EGSA 3KR3H 3VIPA 3KL5A 2OS7A 5F9AC 5DMYA 5CJOH 2GITA 5B4MC 4GRLA 4GAJL 2X4OB 5J1AA 1LF1A 2YL5A 1MSPA 4FQQA 1W32A 2OYMA 2F5BH 3D9AH 4LLYA 2NY7H 3KZSA 3LY6A 1PZ3A 1QNZH 2WUBL 3S96A 5LQBL 4Z7UF 3ARFD 2VO5A 2Y5EA 4GRLC 2UZYB 4QLLA 5KZCB 3QJHB 4LASL 4ZAKA 3B5TA 1CBVL 5I15H 1F58L 1RSFA 5EIIA 1ZSDA 4KY1H 1P4LB 1FSKB 4NNXA 1ZLSH 1ISYA 3PP3K 2OW7A 4UDUA 4JJHA 1RQ5A 3SKJH 1BG4A 5CKGA 3O6FB 5DD1H 1WK0A 3FRUA 2B20A 2W38A 2NXYD 2NX5B 3B9VA 1D9KB 2Q6WA 3SUUA 2H2SC 1MWOA 3EZJB 5F1IB 3FW6A 3SPVA 5HGAB 5KOVC 3HCVB 1MHHB 2YN5A 5IG7B 3WQVA 2XTJC 3ULUC 5E8PB 2MQCA 1WB0A 3VJ6A 2XWTA 1VERA 4OD1L 1NCAH 2DMCA 3JWOL 1BBJA 1E6PA 1A3LL 3O3DA 4QHUA 4YK4C 2OR9L 1TA3A 2H6PA 2CO6B 3GNOA 3JWDC 3OG4B 3PQYA 4E41A 3F62A 3CH8A 1QI5A 4UINH 3OLGA 1OAYH 1M7IA 5EZJB 3T4AB 1LL6A 5J7CC 2NZ9C 1OIFA 3AXHA 1KN2L 5I17A 4I4WB 4U6XB 5C0BA 4HJ0C 2QKIB 3QNXA 4QRQA 5HHMD 1HXJA 2ARJQ 1YYMH 2E7LA 4NNPH 4YAQA 2R0WH 3WS6C 4P5KA 3OTTA 5BVJB 1B3JA 1I7ZB 2F74B 4LGPB 4A3HA 2VDML 3M07A 4HXBH 4I5BB 2YDQA 3HZVA 5L2KB 3ARBA 4RGMC 2B5IB 1TITA 3OKNA 4HMEA 5BYWA 3NSXA 2WINA 4QF1B 4K8RC 2WHMA 1F3JA 4MJ6A 3GK8L 5DK0B 2J7CA 5DMGC 4M7ZB 4L3CA 1J1OH 3WFDH 2VN7A 5I23A 3SCPA 2YXMA 3UYOD 4PJEA 3UEQA 4ZS6D 3VIIA 2G60H 1C3FA 4LK4A 1DWGM 1I1AA 4YEEA 3LEXB 4FFYH 1A7PH 1LNUB 3ARBC 3I85A 2DKUA 3LH2H 4LHUB 5C70A 3T0WA 5F3BB 4YHML 4HS6A 4BSWB 5MHSE 3CHFA 5JPMB 3P4OA 4HIJB 1OTTD 1IFHL 3OKEA 3QPQC 4Z2GA 4W70A 3MJ6A 3A23A 4MB1A 4GXVH 1I1AC 3TESA 1IEBA 2R1XA 5H37H 1ZOXA 3JUZA 4M29A 4MNGA 1MHCB 1BP3B 4XP6H 1IM3B 2I60L 4M8UA 2YA1A 4D94A 2CLVB 3O9WB 2O5XL 4Y16D 2NY2D 3A24A 3QUYB 1HJUA 3AUVA 2Q8XA 4QRUA 5IVXA 4PBVC 1QA9A 4EZMA 1JNEA 1IKFL 3O6KL 5BXSA 2HVKA 1E55A 1WZAA 4JFWA 1MW3A 2C3GA 3G6DL 4OZGA 3W0WA 4TSCH 2L4OA 4HS8L 5KSBA 3DUSA 3SUVA 1T66D 1AGCB 2W9DL 3O4OC 1JFHA 3CUFA 2GI7A 3T3MF 5D7SH 3TBWB 3VMNA 1JPST 2VXTL 1ZBVA 4NQUA 3DX8A 4HPHA 1CGSL 4G8IB 3QG7H 4PRHB 1QFOA 3AHVA 1VB9A 3WQ8A 1DLFH 4RE3A 4PJHF 3I3DA 1N4XL 3FQNB 2GSJA 3RQ3A 4DVRL 5EZIL 3WEZA 2BVOA 3LS5L 5C07E 3CNKA 3MRIB 1FLTX 5BV7H 2ADFH 3HZ3A 4X4YA 2EIDA 4H04A 4RFEA 4Z7OE 1T83A 1A1OA 4PRIB 1QLEH 3GSNA 1GYAA 1UH2A 3THDA 3VFGH 3H2WA 3NIGE 1K3IA 2X4SB 2R0KL 3EFFA 3W2DL 1VFOA 1EHAA 1MCPH 3C8KA 2H9GB 2PYED 3PNWA 1KTDB 4GMTH 4LHQB 1UWTA 1Y18A 3RAJL 3VCLA 5KEZA 3VWKA 2O9RA 1V6XA 3G5ZA 1T83C 4W6XB 5DHVB 2E27L 1EVTC 1F8TH 1S9VA 4ACZB 5D1XA 3I84A 4ZODA 2XN9B 5F96L 4Z8FH 3EDKA 2GFTA 4W5UA 3RPKA 3UESA 3DOSA 4JO3L 1BSIA 3PZQA 1GOKA 1BFNA 2DICA 4J4PA 3VWKC 1P1ZB 5DJZB 1W0VB 4PJAB 4ZTPL 1N8ZA 2ILLA 4NQCD 2PW1A 4ELKB 1KLFA 5D1XC 3LKQB 2GJRA 1JYWA 4M5YL 3AFLA 3RNKB 4R7NA 2JB6A 1XSJA 5DA0B 4WFHE 1H4PA 1JPGB 1ZEAH 3QI9D 3SDYL 3EOBA 1W9BM 4YIQB 1AXSB 3PXJA 2AJVL 1EEQA 3LZFH 3O41A 5KSUB 1IGJB 3HC0B 2DQXA 3BDYL 1GIGH 3B4NA 1EQCA 3OF6D 1DP0A 3VIKA 3QXUA 4JR9H 2OYLA 1UXWB 3RUGA 2XN1A 4HEPG 5HD8C 4J3XA 3VXUB 4KPHH 1LJYA 1FZMB 1L0YA 5BRZB 2SEBA 4FZ8H 5C0NC 1KCVH 2VL5B 2GTZA 3BH9A 4FFVD 4JO4L 4KI1A 3V6BR 2NY3B 1QBLL 4R7DB 1XF3B 3MV8D 1WCGA 4H1LB 4GMSL 4ZO7A 5CP3A 4ZUWA 1QVBA 4Y19E 2Y2WA 3IFPA 5H2BA 4U1IB 4OZFG 4JFXA 3TJEH 2EO9A 3L7FB 1OAKL 3AMLA 4MQSB 3L4WA 3IXAA 1SBSH 3KYKH 3K4ZA 5CBEB 5F1NB 4I18B 3N06B 4QLRA 3T2OA 3GMNB 2QQQA 1F4YL 1WWCA 5I6SA 4EKJA 3S36L 3WY4A 5D4YA 3M17B 1BGGA 3PDDA 5F71A 5GRUH 5E5RB 2NY5L 1GOQA 3CFIC 4NC1E 3RY5A 4HG4J 5KN5B 1A4KB 1QACA 4LBEB 2CO7B 2YPKA 1S7QA 3EOTH 1B2WL 1XIWA 1YECH 2JJTA 3EOYG 1JPSH 3GSXB 4NKMA 1SYVA 4K7PX 2EDQA 1P2CA 5IMMB 1I7RB 2OJEB 2E5EA 5FHBL 1I1WA 5E8EA 3X14B 3PL6A 5ITBL 1RJCA 4PJDF 5E1AB 2AJYL 3BKML 5CP7B 3RJXA 2VQ1A 3HB3D 1JGUL 3T08A 2BY1A 4TTDD 2VXUL 2PBOA 3CCHA 4UILH 4C56B 1XIWC 4LAQH 1NAMB 1T1ZB 2HKFH 4KK9D 3UTSA 1GCYA 3SDXF 3TTQA 3CFBB 3EJYC 3T8XB 1BVLB 5T3ZL 1BJMA 2VE6A 3RWIB 4CDHA 5B8CB 4N0UB 2CSPA 4M5ZL 1PIFA 3PL6C 1G7JB 1FH8A 4YUEL 5I1IL 4LCUB 4N8CH 5C2BH 3E8UL 5BXTA 1JWMB 1GVIA 2ZKHL 2QPUA 5E8OB 4ELMA 2V2WA 4JPVL 2QF8A 4JHOA 3WHE1 4M43H 5M17A 3V0AC 1VEPA 1MIMH 3QIUB 3GRWL 4NKDB 1UCTA 5ACLA 4RISL 1JZ2A 2HFFB 2GTWB 4LEXH 2NY1C 1IGIH 4HIEA 1ISVA 2WWDA 3BC9A 3TM6A 2UVEA 3FHQA 3QHOA 4MNQA 3HZMA 2ZOLA 1W2PA 3D51A 2OSWA 4RBPK 4RMSA 3D0VA 1INDL 4IRSC 3MRMA 1ULVA 1MFUA 3OZPA 1NEUA 2DS4A 5F7EL 2VLLB 2DSVA 4DAGH 4OCLC 4F8QA 3CZNA 1UWXH 2R69L 5ABFA 4S1DC 4NRYA 1KCLA 1NGYB 3WXVH 1MFBH 4JREC 1HIML 3UTZB 1C7TA 1H3UA 1F90H 3TA3B 4JRYA 1WDQA 1Z32X 5EOTA 3NCEB 1FNEB 4R97B 5GGTA 1T1WA 4PB0H 3ULVH 4MLSA 4XAWH 1CL7I 5IW3A 4C54A 2X42A 5L6YL 4KMTH 2VDOL 3CPLA 1D5XB 5I79A 4QTHB 3CUPA 3O2LA 2PO6A 5HGDB 1CFTB 4ZUTB 2GHWB 4S2SB 3BZFB 5B38B 3DXAB 1JGLH 3DX2A 2P5EA 5DURD 3BLPX 2AAAA 3AIQA 4OQ1A 4P9HL 1UWSA 4HKXB 3SKNA 3WNLA 2B2XH 1E27A 1OP5H 3Q6GH 2CLZB 3FO1B 2JJSA 3VXOA 1N82A 4LYPA 2DDQL 4XWOD 1UR2A 1ITCA 4YBLB 1PVHA 1ORQA 4ZPTB 1GGYA 2BOCA 5EBGA 4M7JL 4D9LH 4XTRC 2PETA 3SE9L 1NM9A 1GGCH 1GOOA 1YJDC 4YHKL 4EVNB 2YD9A 3BUPA 5LCVL 2DM3A 4MNHA 5D2NE 1P69B 1IKNC 2WUCH 3MRGA 3D39D 3GMLB 4MJ4A 1N2RB 5JUVA 4XMKH 5GRJH 5FB8B 5IDIA 1BLNB 5ADOH 4OLXL 4K7PH 2ED8A 4BZYA 4L5FH 15C8L 1IAOA 3HRZB 2BSSA 4BFIA 3KWXA 1S5HB 1WO2A 1BREA 3MRCB 3DBXA 3BW9A 4F7EB 1YMMD 4PLKC 3ET9F 1QHZA 1KCSH 2YC1B 3WIHH 5D7LA 2DEPA 3ROOA 3ALXA 3AVEA 3P77B 4GIAA 5HYSG 3CVHH 4XBPA 1JPTH 1VA9A 5T33H 5IKCA 1U8LA 1YEFH 3IGUA 4PRNA 4U2ZA 5D7JA 4U31A 1XF4A 4LLVB 3L5WB 4H8UA 1JI1A 4I3SH 4R4NC 3KGRA 3MLYH 5EOCJ 3WMSA 5IB3A 3QIWA 1ZLUH 3SUWA 4YK4B 2YDRA 2CKNA 4XUYA 1HJVA 1AFVH 2PYEE 4PLNC 5D5MB 2DB8A 4FABL 2EXWD 3MBED 1C08B 1E56A 4XPTH 3X12A 3MJ8B 4G6KH 1C12A 2WKLA 3OBAA 4WHDA 3DTXA 4P5TA 5EBLB 3PHSA 1KIPB 3RL1B 4Z7NF 1WFUA 4KVNL 3AY4A 3QIWC 4LFHG 3EJZC 4HIIA 2XIDA 1R24B 4TNWF 4ZXBB 4UZUA 5A69A 2Q86B 3O4LA 4NYLB 4ONGH 3GMMA 4M7KL 5GGQL 4PJBF 2K7PA 4M1CD 4HP5A 1U8IA 4NQCE 2GJ6A 4X6BB 5EC1A 4P5TC 4ALAH 2AEPL 3MCG1 1MCDA 3AY4C 3U9PH 1CIDA 4RIRB 4XBEL 5TF0A 4Y1AB 1WPCA 3LPWA 2X4TB 2Z8SA 2ZUUA 5C0EB 3CZLA 5ACZA 3QXDA 3WD0A 1LK3H 1UT9A 1U41A 4P2OD 4W89A 3WNNA 1I7UA 3JV6B 3MV9D 2PWEA 2WHKA 1R46A 1TQCB 4AIUA 5EU7E 3SDDB 2LTQC 1NC2A 1UH4A 4AD4A 5IFJB 3FO9A 1K5NA 5I1AA 4MJ5A 4TTUA 3T1FA 2EICA 4PJ9B 3GUTA 1V7MH 2Q7YA 4HH9B 3WD3A 3P40A 4P23A 2CIIA 2QQKL 1NGXB 4Z2JA 1M6OB 2UWFA 1YPZA 4G8GB 4QFUA 3WN5B 2GK2A 1TJGL 4FTVB 3GBMH 1NP0A 3MV8E 4WW2A 4ATDA 4HKZB 4NQDB 4JY6B 1I8LA 5JXED 5I3DA 1JUFB 5I0ZA 5ABDE 4L4TA 5CINH 3B9KD 5CSZA 3MOAL 2XZCH 1PGRB 2E0PA 5HYEA 3ARDB 4YFEA 5IHUL 1BQSA 3RGVA 4DK3A 4P23C 2ZICA 4WWKD 1UENA 4MNKA 3NACH 3LKOA 2AABH 4WW2C 3MUHL 3WUWG 2CD0A 1CDIA 1I8LC 4CN4A 2HISA 4KC3B 4E5XB 2Y07L 1Z5LB 2QSTA 4HC1H 5IEHA 1UFUA 5E2UL 4OZIF 5AG9A 2VIRA 1XH3A 1W2VA 1X44A 4XVSH 2APBA 3ZR6A 2PF0A 3H7BB 3RGVC 3IFNL 4PJ7F 4U6HB 4PY8J 4LFHD 2WVUA 5GGSY 3C2AL 3O8XC 2BVDA 5DTFB 3VIJA 5F7DA 3D4ZA 2W67A 3EYVB 3FJTA 4UQAA 3D0LA 3RWCB 2D7TH 1T6WA 2RHEA 3ULUL 5AUMA 3UG4A 4TOYL 3ARGB 4ZE5A 1UWGH 1YEEH 1R3LA 4PUBH 3P9MA 4XNMB 4WI6A 3BVUA 4WJXA 5FIPA 2X09A 6FABH 1LGVA 5JQ6L 5K9KA 2Z1KA 2XSAA 2BVYA 1YNKL 3TJHC 3VFTB 1UADC 1A1NB 3T0BA 2FLRT 4HGKC 5DJAB 1M7DA 5HVHB 1PPIA 3QUML 2YBUA 2ZSWB 3DHUA 4UV4H 3SDAB 5I8EB 5SX4I 5IBLC 3OR6A 1QVOA 3MJGX 4ONFL 2EPNA 4XZBA 4X6EB 3AU1B 4HX1B 1U0QA 4Y4KA 2EDOA 1E5JA 3CFJB 2JTDA 3CH9A 2D3VA 2ZCHH 4U1HB 1IBGH 3FKUS 4G6AD 2EDJA 4FK9A 5FYLL 2C8NA 1GOWA 3AS3A 4D6CA 4I0PB 2RB8A 4D3CH 2F1AA 2GQHA 2BK8A 4BH7A 4K8RL 2CERA 4Y4KC 3MLVH 1KTRL 2QPSA 5DMKB 2WK2A 1AD0A 5C0IB 3TNMA 1NCBH 3ABZA 3PGFL 4PGJA 1CFNB 4PYHA 5FUOL 4UBDD 1JJUA 1RIUH 3MRLB 1X5KA 3GMPB 2AERT 5EZLB 1OSZB 2HYMA 4K2UH 4NOFA 3SDCA 1AY1H 4KI5D 4N9GA 5K59E 5DZLA 1XF5B 1AO7D 3HRPA 3W82A 4PLJC 4HA1A 3P9LA 1SMAA 4PS4H 1K2DB 4QHMA 4Z95L 3C5ZA 2QQNH 3SE3A 2DIEA 4BQCA 3VGDA 4NFDA 4U1GC 5ABEA 1AP2B 4HK3N 1J0YA 1MCHA 3SDCC 4NO0D 5IESH 4X7TB 1IJ9A 2CRYA 1MHHA 1WBYA 5ABHA 1IEAB 2HT2D