1CHIA

Structural studies of the roles of residues 82 and 85 at the interactive face of cytochrome c
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
107
Chain Sequence
TEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWDENNMSEYLTNPKYIPGTKMAYGGAKKEKDRNDLITYLKKATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C
publication title Structural studies of the roles of residues 82 and 85 at the interactive face of cytochrome c.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport(heme protein)
total genus 32
structure length 107
sequence length 108
ec nomenclature
pdb deposition date 1994-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1chiA00
2YK3A 2GC4D 2ZXYA 2MTAC 2V07A 1CSVA 1H1OA 4AAOA 1CIHA 1KYOD 1C52A 1NU1D 3L75D 1CRJA 1B7VA 4PD4D 1COTA 351CA 3H1JD 2FYNB 3VRDA 5B6QA 1DVHA 1DW1A 4FA5A 1C75A 2BCNB 1YFCA 1LMSA 2A06D 5C0ZA 3O0RC 3L73D 3HQ6A 2C2CA 1N15A 1IRVA 1QKSA 5TISV 1C2NA 4FA1A 3O20A 1LC1A 1WVEC 5CYTR 3WFDC 3X39A 1MG2D 1CTYA 1GJQA 3M97X 3ORVA 451CA 1BE3D 1CHIA 3SWSA 2BCCD 2B12B 2PCBB 3PXSA 2MHMA 1CIGA 3RN1A 1IQCA 4GEDB 3MK7B 3RLMA 2DVHA 1GQ1A 2FRCA 1H9YA 5KAIV 4EICA 2VHDA 3L4MA 5KAFV 5DJQB 1I8OA 2N18C 1NTKD 4XXLA 1FI7A 1CCHA 3WFCC 1N9CA 2D0WA 4WQ8A 2B0ZB 2CA3B 2CXBA 1FHBA 1W5CT 1U74B 3ZOYA 1M70A 3O5CA 1CRGA 3BCCD 1M6ZA 2OZ1B 5C9MA 1QL4A 3HQ7A 1SQQD 1NMLA 4EIEA 2LIRA 3VNWA 1K3HA 4EIFA 1EB7A 3NBSA 2B10B 1HRCA 1K3GA 1H9XA 3OA8B 5CIHB 1CTZA 2BH4X 3WU2V 1HCMA 1DW0A 3HQ8A 2DGEA 1IRWA 2PACA 5CIBB 2CA4B 1R0QA 1H33B 1FOCA 1QYZA 3O1YA 5CICB 1S5LV 1CHHA 3WFBC 2N3BA 4AAMA 4WQDA 3DR0A 4WQEA 1AYGA 3CX5W 4WQ7A 3SVWA 1CRCA 1CYJA 4FA9A 2XTSB 2PCCB 1JDLA 4AX3A 4QAOA 4Y5RA 1A56A 5KKZB 1BCCD 1S6VB 1FI9A 2ZOOA 1U75B 2QJPB 3H1LD 1CNOA 4L3HA 3A9FA 4FANA 4O1WA 5DF5A 1RAQA 1C2RA 4H0KA 1H32B 4H0JA 4P4QB 1YIQA 3SLEA 2ZONG 5GTIV 4WQ9A 2AXTV 2BH5X 1KX2A 1SQVD 2YCCA 1CIEA 2BLFB 3WUIA 3ZIYA 4UB8V 1OAEA 1CEDA 1I54A 1W2LA 1CSWA 1H31A 1LS9A 1CYCA 3L74D 4FB1A 2AIUA 1NTZD 2IBZD 1F1FA 3ZOXA 2GIWA 1EZVD 3DMIA 5AURA 1DW3A 1A8CA 1YEAA 2C1DA 3TYIA 3L71D 2BGVX 1CSUA 3C2CA 1IO3A 3CP5A 4JCGA 1IZL0 3PXTA 2EXVA 2YQBA 1BGYD 2ZBOA 1SQPD 5CIDB 5DFSA 1FCDC 4YE1A 3CX5D 3CWBD 2N9IA 1BL9A 1HH7A 5H2FV 1AKKA 2GC7D 1GU2A 1RZ5A 4Q5PA 3KZIV 4WQAA 1PP9D 4DY9A 1L0ND 3CYTI 4RSZA 3VYMA 4D6TD 1WEJF 3MK7C 3CU4A 1ETPA 2N3YA 1L0LD 1FJ0A 3A0BV 3L72D 1YEBA 3L70D 4WQCA 1CTJA 5DJQC 1QL3A 1DIIC 2C1UA 3RN0A 1AOQA 1NIRA 1KX7A 1QN2A 2QJYB 3ZOOA 2ZZS1 5B66V 3DP5A 2C9XB 3CXHW 1KV9A 1ZZHA 4K3IA 1I5TA 4AANA 2B4ZA 3PXWA 4PW9B 1CRYA 1HROA 1SQBD 4L3GA 4PJ0V 1CIFA 3SJLA 2YIUB 3JBTB 3A0HV 1E2RA 2N18B 1CSXA 1LFMA 2ORLA 1DIQC 4FAVA 2V08A 1L9JC 2C1VA 1SQXD 3OCDB 1M60A 4PWAA 1C6SA 2OZ1A 1CXCA 1CRHA 1E8EA 1L9BC 4O1QA 1CXAA 5CIGB 1C7MA 4J20A 1RZ6A 3HQ9A 3L4OA 1CYIA 5CIFB 1FI3A 4WQBA 2B11B 5E79V 3WFEC 1F1CA 1HJ5A 1DT1A 3OA8A 1AOFA 1J3SA 1I55A 2FWLA 1KIBA 1KB0A 2N9JA 2JTIB 3RMZA 2D0SA 1NTMD 1KYOW 2HV4A 3TGUD 1CCRA 1LC2A 2CE1A 2JQRA 1H33A 2L4DA 3H1KD 4V2KA 4NFGB 4L1QA 1N90A 1A2SA 4KMGA 3H1ID 3ZBMA 1CRIA 1YTCA 2C8SA 1P84D 2CE0A 4MU8A 2FYUD 4EIDA 4LJIA 1CC5A 5CIEB 5EXQA 1MZ4A 4UB6V 1I6DA 5KLVD 3SXTA 1HJ4A 2QJKB 3PH2B 1GKSA 2AI5A 1N50A 1KB9D 1NMIA 2LITA 3CXHD 1VYDA 1YCCA 1GIWA 1ZRTD 2BPBB 4U3FD 3ZOWA 3NWVA 1CHJA 5B5EV 3H1HD 1C6RA 3ZCFA 1DVVA 5KLIB 2GB8B 4N0KA 1I8PA 1RAPA 2I8FA 1H32A 1E29A 4IL6V 4XYDB 1CO6A 1OCDA 1NNOA 1GDVA 3OCDA 1H31B 1HZUA 1CORA 1DW2A 5GTHV 1MG3D 5IY51 3NBTA 4AALA 1YICA 1I6EA 4FA4A 4GYDA 1PPJD 1HZVA 1HJ3A 155CA 2C1DB 3WC8A 1C6OA 1YNRA
chains in the Genus database with same CATH superfamily
2YK3A 2GC4D 2ZXYA 2MTAC 2V07A 1CSVA 1H1OA 4AAOA 1CIHA 1KYOD 1C52A 1NU1D 3L75D 1CRJA 1B7VA 4PD4D 1COTA 351CA 3H1JD 2FYNB 3VRDA 5B6QA 1DVHA 1DW1A 4FA5A 1C75A 2BCNB 1YFCA 1LMSA 2A06D 5C0ZA 3O0RC 3L73D 3HQ6A 2C2CA 1N15A 1IRVA 1QKSA 5TISV 1C2NA 4FA1A 3O20A 1LC1A 1WVEC 5CYTR 3WFDC 3X39A 1MG2D 1CTYA 1GJQA 3M97X 3ORVA 451CA 1BE3D 1CHIA 3SWSA 2BCCD 2B12B 2PCBB 3PXSA 2MHMA 1CIGA 3RN1A 1IQCA 4GEDB 3MK7B 3RLMA 2DVHA 1GQ1A 2FRCA 1H9YA 5KAIV 4EICA 2VHDA 3L4MA 5KAFV 5DJQB 1I8OA 2N18C 1NTKD 4XXLA 1FI7A 1CCHA 3WFCC 1N9CA 2D0WA 4WQ8A 2B0ZB 2CA3B 2CXBA 1FHBA 1W5CT 1U74B 3ZOYA 1M70A 3O5CA 1CRGA 3BCCD 1M6ZA 2OZ1B 5C9MA 1QL4A 3HQ7A 1SQQD 1NMLA 4EIEA 2LIRA 3VNWA 1K3HA 4EIFA 1EB7A 3NBSA 2B10B 1HRCA 1K3GA 1H9XA 3OA8B 5CIHB 1CTZA 2BH4X 3WU2V 1HCMA 1DW0A 3HQ8A 2DGEA 1IRWA 2PACA 5CIBB 2CA4B 1R0QA 1H33B 1FOCA 1QYZA 3O1YA 5CICB 1S5LV 1CHHA 3WFBC 2N3BA 4AAMA 4WQDA 3DR0A 4WQEA 1AYGA 3CX5W 4WQ7A 3SVWA 1CRCA 1CYJA 4FA9A 2XTSB 2PCCB 1JDLA 4AX3A 4QAOA 4Y5RA 1A56A 5KKZB 1BCCD 1S6VB 1FI9A 2ZOOA 1U75B 2QJPB 3H1LD 1CNOA 4L3HA 3A9FA 4FANA 4O1WA 5DF5A 1RAQA 1C2RA 4H0KA 1H32B 4H0JA 4P4QB 1YIQA 3SLEA 2ZONG 5GTIV 4WQ9A 2AXTV 2BH5X 1KX2A 1SQVD 2YCCA 1CIEA 2BLFB 3WUIA 3ZIYA 4UB8V 1OAEA 1CEDA 1I54A 1W2LA 1CSWA 1H31A 1LS9A 1CYCA 3L74D 4FB1A 2AIUA 1NTZD 2IBZD 1F1FA 3ZOXA 2GIWA 1EZVD 3DMIA 5AURA 1DW3A 1A8CA 1YEAA 2C1DA 3TYIA 3L71D 2BGVX 1CSUA 3C2CA 1IO3A 3CP5A 4JCGA 1IZL0 3PXTA 2EXVA 2YQBA 1BGYD 2ZBOA 1SQPD 5CIDB 5DFSA 1FCDC 4YE1A 3CX5D 3CWBD 2N9IA 1BL9A 1HH7A 5H2FV 1AKKA 2GC7D 1GU2A 1RZ5A 4Q5PA 3KZIV 4WQAA 1PP9D 4DY9A 1L0ND 3CYTI 4RSZA 3VYMA 4D6TD 1WEJF 3MK7C 3CU4A 1ETPA 2N3YA 1L0LD 1FJ0A 3A0BV 3L72D 1YEBA 3L70D 4WQCA 1CTJA 5DJQC 1QL3A 1DIIC 2C1UA 3RN0A 1AOQA 1NIRA 1KX7A 1QN2A 2QJYB 3ZOOA 2ZZS1 5B66V 3DP5A 2C9XB 3CXHW 1KV9A 1ZZHA 4K3IA 1I5TA 4AANA 2B4ZA 3PXWA 4PW9B 1CRYA 1HROA 1SQBD 4L3GA 4PJ0V 1CIFA 3SJLA 2YIUB 3JBTB 3A0HV 1E2RA 2N18B 1CSXA 1LFMA 2ORLA 1DIQC 4FAVA 2V08A 1L9JC 2C1VA 1SQXD 3OCDB 1M60A 4PWAA 1C6SA 2OZ1A 1CXCA 1CRHA 1E8EA 1L9BC 4O1QA 1CXAA 5CIGB 1C7MA 4J20A 1RZ6A 3HQ9A 3L4OA 1CYIA 5CIFB 1FI3A 4WQBA 2B11B 5E79V 3WFEC 1F1CA 1HJ5A 1DT1A 3OA8A 1AOFA 1J3SA 3D0WA 1I55A 2FWLA 1KIBA 1KB0A 2N9JA 2JTIB 3RMZA 2D0SA 1NTMD 1KYOW 2HV4A 3TGUD 1CCRA 1LC2A 2CE1A 2JQRA 1H33A 2L4DA 3H1KD 4V2KA 4NFGB 4L1QA 1N90A 1A2SA 4KMGA 3H1ID 3ZBMA 1CRIA 1YTCA 2C8SA 1P84D 2CE0A 4MU8A 2FYUD 4EIDA 4LJIA 1CC5A 5CIEB 5EXQA 1MZ4A 4UB6V 1I6DA 5KLVD 3SXTA 1HJ4A 2QJKB 3PH2B 1GKSA 2AI5A 1N50A 1KB9D 1NMIA 2LITA 3CXHD 1VYDA 1YCCA 1GIWA 1ZRTD 2BPBB 4U3FD 3ZOWA 3NWVA 1CHJA 5B5EV 3H1HD 1C6RA 3ZCFA 1DVVA 5KLIB 2GB8B 4N0KA 1I8PA 1RAPA 2I8FA 1H32A 1E29A 4IL6V 4XYDB 1CO6A 1OCDA 1NNOA 1GDVA 3OCDA 1H31B 1HZUA 1CORA 1DW2A 5GTHV 1MG3D 5IY51 3NBTA 4AALA 1YICA 1I6EA 4FA4A 4GYDA 1PPJD 1HZVA 1HJ3A 155CA 2C1DB 3WC8A 1C6OA 1YNRA
chains in the Genus database with same CATH topology
2YK3A 2GC4D 2ZXYA 2MTAC 2V07A 1CSVA 1H1OA 4AAOA 1CIHA 1KYOD 1C52A 1NU1D 3L75D 1CRJA 1B7VA 4PD4D 1COTA 351CA 3H1JD 2FYNB 3VRDA 5B6QA 1DVHA 1DW1A 4FA5A 1C75A 2BCNB 1YFCA 1LMSA 2A06D 5C0ZA 3O0RC 3L73D 3HQ6A 2C2CA 1N15A 1IRVA 1QKSA 5TISV 1C2NA 4FA1A 3O20A 1LC1A 1WVEC 5CYTR 3WFDC 3X39A 1MG2D 1CTYA 1GJQA 3M97X 3ORVA 451CA 1BE3D 1CHIA 3SWSA 2BCCD 2B12B 2PCBB 3PXSA 2MHMA 1CIGA 3RN1A 1IQCA 4GEDB 3MK7B 3RLMA 2DVHA 1GQ1A 2FRCA 1H9YA 5KAIV 4EICA 2VHDA 3L4MA 5KAFV 5DJQB 1I8OA 2N18C 1NTKD 4XXLA 1FI7A 1CCHA 3WFCC 1N9CA 2D0WA 4WQ8A 2B0ZB 2CA3B 2CXBA 1FHBA 1W5CT 1U74B 3ZOYA 1M70A 3O5CA 1CRGA 3BCCD 1M6ZA 2OZ1B 5C9MA 1QL4A 3HQ7A 1SQQD 1NMLA 4EIEA 2LIRA 3VNWA 1K3HA 4EIFA 1EB7A 3NBSA 2B10B 1HRCA 1K3GA 1H9XA 3OA8B 5CIHB 1CTZA 2BH4X 3WU2V 1HCMA 1DW0A 3HQ8A 2DGEA 1IRWA 2PACA 5CIBB 2CA4B 1R0QA 1H33B 1FOCA 1QYZA 3O1YA 5CICB 1S5LV 1CHHA 3WFBC 2N3BA 4AAMA 4WQDA 3DR0A 4WQEA 1AYGA 3CX5W 4WQ7A 3SVWA 1CRCA 1CYJA 4FA9A 2XTSB 2PCCB 1JDLA 4AX3A 4QAOA 4Y5RA 1A56A 5KKZB 1BCCD 1S6VB 1FI9A 2ZOOA 1U75B 2QJPB 3H1LD 1CNOA 4L3HA 3A9FA 4FANA 4O1WA 5DF5A 1RAQA 1C2RA 4H0KA 1H32B 4H0JA 4P4QB 1YIQA 3SLEA 2ZONG 5GTIV 4WQ9A 2AXTV 2BH5X 1KX2A 1SQVD 2YCCA 1CIEA 2BLFB 3WUIA 3ZIYA 4UB8V 1OAEA 1CEDA 1I54A 1W2LA 1CSWA 1H31A 1LS9A 1CYCA 3L74D 4FB1A 2AIUA 1NTZD 2IBZD 1F1FA 3ZOXA 2GIWA 1EZVD 3DMIA 5AURA 1DW3A 1A8CA 1YEAA 2C1DA 3TYIA 3L71D 2BGVX 1CSUA 3C2CA 1IO3A 3CP5A 4JCGA 1IZL0 3PXTA 2EXVA 2YQBA 1BGYD 2ZBOA 1SQPD 5CIDB 5DFSA 1FCDC 4YE1A 3CX5D 3CWBD 2N9IA 1BL9A 1HH7A 5H2FV 1AKKA 2GC7D 1GU2A 1RZ5A 4Q5PA 3KZIV 4WQAA 1PP9D 4DY9A 1L0ND 3CYTI 4RSZA 3VYMA 4D6TD 1WEJF 3MK7C 3CU4A 1ETPA 2N3YA 1L0LD 1FJ0A 3A0BV 3L72D 1YEBA 3L70D 4WQCA 1CTJA 5DJQC 1QL3A 1DIIC 2C1UA 3RN0A 1AOQA 1NIRA 1KX7A 1QN2A 2QJYB 3ZOOA 2ZZS1 5B66V 3DP5A 2C9XB 3CXHW 1KV9A 1ZZHA 4K3IA 1I5TA 4AANA 2B4ZA 3PXWA 4PW9B 1CRYA 1HROA 1SQBD 4L3GA 4PJ0V 1CIFA 3SJLA 2YIUB 3JBTB 3A0HV 1E2RA 2N18B 1CSXA 1LFMA 2ORLA 1DIQC 4FAVA 2V08A 1L9JC 2C1VA 1SQXD 3OCDB 1M60A 4PWAA 1C6SA 2OZ1A 1CXCA 1CRHA 1E8EA 1L9BC 4O1QA 1CXAA 5CIGB 1C7MA 4J20A 1RZ6A 3HQ9A 3L4OA 1CYIA 5CIFB 1FI3A 4WQBA 2B11B 5E79V 3WFEC 1F1CA 1HJ5A 1DT1A 3OA8A 1AOFA 1J3SA 1I55A 2FWLA 1KIBA 1KB0A 2N9JA 2JTIB 3RMZA 2D0SA 1NTMD 1KYOW 2HV4A 3TGUD 1CCRA 1LC2A 2CE1A 2JQRA 1H33A 2L4DA 3H1KD 4V2KA 4NFGB 4L1QA 1N90A 1A2SA 4KMGA 3H1ID 3ZBMA 1CRIA 1YTCA 2C8SA 1P84D 2CE0A 4MU8A 2FYUD 4EIDA 4LJIA 1CC5A 5CIEB 5EXQA 1MZ4A 4UB6V 1I6DA 5KLVD 3SXTA 1HJ4A 2QJKB 3PH2B 1GKSA 2AI5A 1N50A 1KB9D 1NMIA 2LITA 3CXHD 1VYDA 1YCCA 1GIWA 1ZRTD 2BPBB 4U3FD 3ZOWA 3NWVA 1CHJA 5B5EV 3H1HD 1C6RA 3ZCFA 1DVVA 5KLIB 2GB8B 4N0KA 1I8PA 1RAPA 2I8FA 1H32A 1E29A 4IL6V 4XYDB 1CO6A 1OCDA 1NNOA 1GDVA 3OCDA 1H31B 1HZUA 1CORA 1DW2A 5GTHV 1MG3D 5IY51 3NBTA 4AALA 1YICA 1I6EA 4FA4A 4GYDA 1PPJD 1HZVA 1HJ3A 155CA 2C1DB 3WC8A 1C6OA 1YNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YK3 A;  2GC4 D;  2ZXY A;  2MTA C;  2V07 A;  1CSV A;  1H1O A;  4AAO A;  1CIH A;  1KYO D;  1C52 A;  1NU1 D;  3L75 D;  1CRJ A;  1B7V A;  4PD4 D;  1COT A;  351C A;  3H1J D;  2FYN B;  3VRD A;  5B6Q A;  1DVH A;  1DW1 A;  4FA5 A;  1C75 A;  2BCN B;  1YFC A;  1LMS A;  2A06 D;  5C0Z A;  3O0R C;  3L73 D;  3HQ6 A;  2C2C A;  1N15 A;  1IRV A;  1QKS A;  5TIS V;  1C2N A;  4FA1 A;  3O20 A;  1LC1 A;  1WVE C;  5CYT R;  3WFD C;  3X39 A;  1MG2 D;  1CTY A;  1GJQ A;  3M97 X;  3ORV A;  451C A;  1BE3 D;  1CHI A;  3SWS A;  2BCC D;  2B12 B;  2PCB B;  3PXS A;  2MHM A;  1CIG A;  3RN1 A;  1IQC A;  4GED B;  3MK7 B;  3RLM A;  2DVH A;  1GQ1 A;  2FRC A;  1H9Y A;  5KAI V;  4EIC A;  2VHD A;  3L4M A;  5KAF V;  5DJQ B;  1I8O A;  2N18 C;  1NTK D;  4XXL A;  1FI7 A;  1CCH A;  3WFC C;  1N9C A;  2D0W A;  4WQ8 A;  2B0Z B;  2CA3 B;  2CXB A;  1FHB A;  1W5C T;  1U74 B;  3ZOY A;  1M70 A;  3O5C A;  1CRG A;  3BCC D;  1M6Z A;  2OZ1 B;  5C9M A;  1QL4 A;  3HQ7 A;  1SQQ D;  1NML A;  4EIE A;  2LIR A;  3VNW A;  1K3H A;  4EIF A;  1EB7 A;  3NBS A;  2B10 B;  1HRC A;  1K3G A;  1H9X A;  3OA8 B;  5CIH B;  1CTZ A;  2BH4 X;  3WU2 V;  1HCM A;  1DW0 A;  3HQ8 A;  2DGE A;  1IRW A;  2PAC A;  5CIB B;  2CA4 B;  1R0Q A;  1H33 B;  1FOC A;  1QYZ A;  3O1Y A;  5CIC B;  1S5L V;  1CHH A;  3WFB C;  2N3B A;  4AAM A;  4WQD A;  3DR0 A;  4WQE A;  1AYG A;  3CX5 W;  4WQ7 A;  3SVW A;  1CRC A;  1CYJ A;  4FA9 A;  2XTS B;  2PCC B;  1JDL A;  4AX3 A;  4QAO A;  4Y5R A;  1A56 A;  5KKZ B;  1BCC D;  1S6V B;  1FI9 A;  2ZOO A;  1U75 B;  2QJP B;  3H1L D;  1CNO A;  4L3H A;  3A9F A;  4FAN A;  4O1W A;  5DF5 A;  1RAQ A;  1C2R A;  4H0K A;  1H32 B;  4H0J A;  4P4Q B;  1YIQ A;  3SLE A;  2ZON G;  5GTI V;  4WQ9 A;  2AXT V;  2BH5 X;  1KX2 A;  1SQV D;  2YCC A;  1CIE A;  2BLF B;  3WUI A;  3ZIY A;  4UB8 V;  1OAE A;  1CED A;  1I54 A;  1W2L A;  1CSW A;  1H31 A;  1LS9 A;  1CYC A;  3L74 D;  4FB1 A;  2AIU A;  1NTZ D;  2IBZ D;  1F1F A;  3ZOX A;  2GIW A;  1EZV D;  3DMI A;  5AUR A;  1DW3 A;  1A8C A;  1YEA A;  2C1D A;  3TYI A;  3L71 D;  2BGV X;  1CSU A;  3C2C A;  1IO3 A;  3CP5 A;  4JCG A;  1IZL 0;  3PXT A;  2EXV A;  2YQB A;  1BGY D;  2ZBO A;  1SQP D;  5CID B;  5DFS A;  1FCD C;  4YE1 A;  3CX5 D;  3CWB D;  2N9I A;  1BL9 A;  1HH7 A;  5H2F V;  1AKK A;  2GC7 D;  1GU2 A;  1RZ5 A;  4Q5P A;  3KZI V;  4WQA A;  1PP9 D;  4DY9 A;  1L0N D;  3CYT I;  4RSZ A;  3VYM A;  4D6T D;  1WEJ F;  3MK7 C;  3CU4 A;  1ETP A;  2N3Y A;  1L0L D;  1FJ0 A;  3A0B V;  3L72 D;  1YEB A;  3L70 D;  4WQC A;  1CTJ A;  5DJQ C;  1QL3 A;  1DII C;  2C1U A;  3RN0 A;  1AOQ A;  1NIR A;  1KX7 A;  1QN2 A;  2QJY B;  3ZOO A;  2ZZS 1;  5B66 V;  3DP5 A;  2C9X B;  3CXH W;  1KV9 A;  1ZZH A;  4K3I A;  1I5T A;  4AAN A;  2B4Z A;  3PXW A;  4PW9 B;  1CRY A;  1HRO A;  1SQB D;  4L3G A;  4PJ0 V;  1CIF A;  3SJL A;  2YIU B;  3JBT B;  3A0H V;  1E2R A;  2N18 B;  1CSX A;  1LFM A;  2ORL A;  1DIQ C;  4FAV A;  2V08 A;  1L9J C;  2C1V A;  1SQX D;  3OCD B;  1M60 A;  4PWA A;  1C6S A;  2OZ1 A;  1CXC A;  1CRH A;  1E8E A;  1L9B C;  4O1Q A;  1CXA A;  5CIG B;  1C7M A;  4J20 A;  1RZ6 A;  3HQ9 A;  3L4O A;  1CYI A;  5CIF B;  1FI3 A;  4WQB A;  2B11 B;  5E79 V;  3WFE C;  1F1C A;  1HJ5 A;  1DT1 A;  3OA8 A;  1AOF A;  1J3S A;  1I55 A;  2FWL A;  1KIB A;  1KB0 A;  2N9J A;  2JTI B;  3RMZ A;  2D0S A;  1NTM D;  1KYO W;  2HV4 A;  3TGU D;  1CCR A;  1LC2 A;  2CE1 A;  2JQR A;  1H33 A;  2L4D A;  3H1K D;  4V2K A;  4NFG B;  4L1Q A;  1N90 A;  1A2S A;  4KMG A;  3H1I D;  3ZBM A;  1CRI A;  1YTC A;  2C8S A;  1P84 D;  2CE0 A;  4MU8 A;  2FYU D;  4EID A;  4LJI A;  1CC5 A;  5CIE B;  5EXQ A;  1MZ4 A;  4UB6 V;  1I6D A;  5KLV D;  3SXT A;  1HJ4 A;  2QJK B;  3PH2 B;  1GKS A;  2AI5 A;  1N50 A;  1KB9 D;  1NMI A;  2LIT A;  3CXH D;  1VYD A;  1YCC A;  1GIW A;  1ZRT D;  2BPB B;  4U3F D;  3ZOW A;  3NWV A;  1CHJ A;  5B5E V;  3H1H D;  1C6R A;  3ZCF A;  1DVV A;  5KLI B;  2GB8 B;  4N0K A;  1I8P A;  1RAP A;  2I8F A;  1H32 A;  1E29 A;  4IL6 V;  4XYD B;  1CO6 A;  1OCD A;  1NNO A;  1GDV A;  3OCD A;  1H31 B;  1HZU A;  1COR A;  1DW2 A;  5GTH V;  1MG3 D;  5IY5 1;  3NBT A;  4AAL A;  1YIC A;  1I6E A;  4FA4 A;  4GYD A;  1PPJ D;  1HZV A;  1HJ3 A;  155C A;  2C1D B;  3WC8 A;  1C6O A;  1YNR A; 
#chains in the Genus database with same CATH topology
 2YK3 A;  2GC4 D;  2ZXY A;  2MTA C;  2V07 A;  1CSV A;  1H1O A;  4AAO A;  1CIH A;  1KYO D;  1C52 A;  1NU1 D;  3L75 D;  1CRJ A;  1B7V A;  4PD4 D;  1COT A;  351C A;  3H1J D;  2FYN B;  3VRD A;  5B6Q A;  1DVH A;  1DW1 A;  4FA5 A;  1C75 A;  2BCN B;  1YFC A;  1LMS A;  2A06 D;  5C0Z A;  3O0R C;  3L73 D;  3HQ6 A;  2C2C A;  1N15 A;  1IRV A;  1QKS A;  5TIS V;  1C2N A;  4FA1 A;  3O20 A;  1LC1 A;  1WVE C;  5CYT R;  3WFD C;  3X39 A;  1MG2 D;  1CTY A;  1GJQ A;  3M97 X;  3ORV A;  451C A;  1BE3 D;  1CHI A;  3SWS A;  2BCC D;  2B12 B;  2PCB B;  3PXS A;  2MHM A;  1CIG A;  3RN1 A;  1IQC A;  4GED B;  3MK7 B;  3RLM A;  2DVH A;  1GQ1 A;  2FRC A;  1H9Y A;  5KAI V;  4EIC A;  2VHD A;  3L4M A;  5KAF V;  5DJQ B;  1I8O A;  2N18 C;  1NTK D;  4XXL A;  1FI7 A;  1CCH A;  3WFC C;  1N9C A;  2D0W A;  4WQ8 A;  2B0Z B;  2CA3 B;  2CXB A;  1FHB A;  1W5C T;  1U74 B;  3ZOY A;  1M70 A;  3O5C A;  1CRG A;  3BCC D;  1M6Z A;  2OZ1 B;  5C9M A;  1QL4 A;  3HQ7 A;  1SQQ D;  1NML A;  4EIE A;  2LIR A;  3VNW A;  1K3H A;  4EIF A;  1EB7 A;  3NBS A;  2B10 B;  1HRC A;  1K3G A;  1H9X A;  3OA8 B;  5CIH B;  1CTZ A;  2BH4 X;  3WU2 V;  1HCM A;  1DW0 A;  3HQ8 A;  2DGE A;  1IRW A;  2PAC A;  5CIB B;  2CA4 B;  1R0Q A;  1H33 B;  1FOC A;  1QYZ A;  3O1Y A;  5CIC B;  1S5L V;  1CHH A;  3WFB C;  2N3B A;  4AAM A;  4WQD A;  3DR0 A;  4WQE A;  1AYG A;  3CX5 W;  4WQ7 A;  3SVW A;  1CRC A;  1CYJ A;  4FA9 A;  2XTS B;  2PCC B;  1JDL A;  4AX3 A;  4QAO A;  4Y5R A;  1A56 A;  5KKZ B;  1BCC D;  1S6V B;  1FI9 A;  2ZOO A;  1U75 B;  2QJP B;  3H1L D;  1CNO A;  4L3H A;  3A9F A;  4FAN A;  4O1W A;  5DF5 A;  1RAQ A;  1C2R A;  4H0K A;  1H32 B;  4H0J A;  4P4Q B;  1YIQ A;  3SLE A;  2ZON G;  5GTI V;  4WQ9 A;  2AXT V;  2BH5 X;  1KX2 A;  1SQV D;  2YCC A;  1CIE A;  2BLF B;  3WUI A;  3ZIY A;  4UB8 V;  1OAE A;  1CED A;  1I54 A;  1W2L A;  1CSW A;  1H31 A;  1LS9 A;  1CYC A;  3L74 D;  4FB1 A;  2AIU A;  1NTZ D;  2IBZ D;  1F1F A;  3ZOX A;  2GIW A;  1EZV D;  3DMI A;  5AUR A;  1DW3 A;  1A8C A;  1YEA A;  2C1D A;  3TYI A;  3L71 D;  2BGV X;  1CSU A;  3C2C A;  1IO3 A;  3CP5 A;  4JCG A;  1IZL 0;  3PXT A;  2EXV A;  2YQB A;  1BGY D;  2ZBO A;  1SQP D;  5CID B;  5DFS A;  1FCD C;  4YE1 A;  3CX5 D;  3CWB D;  2N9I A;  1BL9 A;  1HH7 A;  5H2F V;  1AKK A;  2GC7 D;  1GU2 A;  1RZ5 A;  4Q5P A;  3KZI V;  4WQA A;  1PP9 D;  4DY9 A;  1L0N D;  3CYT I;  4RSZ A;  3VYM A;  4D6T D;  1WEJ F;  3MK7 C;  3CU4 A;  1ETP A;  2N3Y A;  1L0L D;  1FJ0 A;  3A0B V;  3L72 D;  1YEB A;  3L70 D;  4WQC A;  1CTJ A;  5DJQ C;  1QL3 A;  1DII C;  2C1U A;  3RN0 A;  1AOQ A;  1NIR A;  1KX7 A;  1QN2 A;  2QJY B;  3ZOO A;  2ZZS 1;  5B66 V;  3DP5 A;  2C9X B;  3CXH W;  1KV9 A;  1ZZH A;  4K3I A;  1I5T A;  4AAN A;  2B4Z A;  3PXW A;  4PW9 B;  1CRY A;  1HRO A;  1SQB D;  4L3G A;  4PJ0 V;  1CIF A;  3SJL A;  2YIU B;  3JBT B;  3A0H V;  1E2R A;  2N18 B;  1CSX A;  1LFM A;  2ORL A;  1DIQ C;  4FAV A;  2V08 A;  1L9J C;  2C1V A;  1SQX D;  3OCD B;  1M60 A;  4PWA A;  1C6S A;  2OZ1 A;  1CXC A;  1CRH A;  1E8E A;  1L9B C;  4O1Q A;  1CXA A;  5CIG B;  1C7M A;  4J20 A;  1RZ6 A;  3HQ9 A;  3L4O A;  1CYI A;  5CIF B;  1FI3 A;  4WQB A;  2B11 B;  5E79 V;  3WFE C;  1F1C A;  1HJ5 A;  1DT1 A;  3OA8 A;  1AOF A;  1J3S A;  3D0W A;  1I55 A;  2FWL A;  1KIB A;  1KB0 A;  2N9J A;  2JTI B;  3RMZ A;  2D0S A;  1NTM D;  1KYO W;  2HV4 A;  3TGU D;  1CCR A;  1LC2 A;  2CE1 A;  2JQR A;  1H33 A;  2L4D A;  3H1K D;  4V2K A;  4NFG B;  4L1Q A;  1N90 A;  1A2S A;  4KMG A;  3H1I D;  3ZBM A;  1CRI A;  1YTC A;  2C8S A;  1P84 D;  2CE0 A;  4MU8 A;  2FYU D;  4EID A;  4LJI A;  1CC5 A;  5CIE B;  5EXQ A;  1MZ4 A;  4UB6 V;  1I6D A;  5KLV D;  3SXT A;  1HJ4 A;  2QJK B;  3PH2 B;  1GKS A;  2AI5 A;  1N50 A;  1KB9 D;  1NMI A;  2LIT A;  3CXH D;  1VYD A;  1YCC A;  1GIW A;  1ZRT D;  2BPB B;  4U3F D;  3ZOW A;  3NWV A;  1CHJ A;  5B5E V;  3H1H D;  1C6R A;  3ZCF A;  1DVV A;  5KLI B;  2GB8 B;  4N0K A;  1I8P A;  1RAP A;  2I8F A;  1H32 A;  1E29 A;  4IL6 V;  4XYD B;  1CO6 A;  1OCD A;  1NNO A;  1GDV A;  3OCD A;  1H31 B;  1HZU A;  1COR A;  1DW2 A;  5GTH V;  1MG3 D;  5IY5 1;  3NBT A;  4AAL A;  1YIC A;  1I6E A;  4FA4 A;  4GYD A;  1PPJ D;  1HZV A;  1HJ3 A;  155C A;  2C1D B;  3WC8 A;  1C6O A;  1YNR A; 
#chains in the Genus database with same CATH homology
 2YK3 A;  2GC4 D;  2ZXY A;  2MTA C;  2V07 A;  1CSV A;  1H1O A;  4AAO A;  1CIH A;  1KYO D;  1C52 A;  1NU1 D;  3L75 D;  1CRJ A;  1B7V A;  4PD4 D;  1COT A;  351C A;  3H1J D;  2FYN B;  3VRD A;  5B6Q A;  1DVH A;  1DW1 A;  4FA5 A;  1C75 A;  2BCN B;  1YFC A;  1LMS A;  2A06 D;  5C0Z A;  3O0R C;  3L73 D;  3HQ6 A;  2C2C A;  1N15 A;  1IRV A;  1QKS A;  5TIS V;  1C2N A;  4FA1 A;  3O20 A;  1LC1 A;  1WVE C;  5CYT R;  3WFD C;  3X39 A;  1MG2 D;  1CTY A;  1GJQ A;  3M97 X;  3ORV A;  451C A;  1BE3 D;  1CHI A;  3SWS A;  2BCC D;  2B12 B;  2PCB B;  3PXS A;  2MHM A;  1CIG A;  3RN1 A;  1IQC A;  4GED B;  3MK7 B;  3RLM A;  2DVH A;  1GQ1 A;  2FRC A;  1H9Y A;  5KAI V;  4EIC A;  2VHD A;  3L4M A;  5KAF V;  5DJQ B;  1I8O A;  2N18 C;  1NTK D;  4XXL A;  1FI7 A;  1CCH A;  3WFC C;  1N9C A;  2D0W A;  4WQ8 A;  2B0Z B;  2CA3 B;  2CXB A;  1FHB A;  1W5C T;  1U74 B;  3ZOY A;  1M70 A;  3O5C A;  1CRG A;  3BCC D;  1M6Z A;  2OZ1 B;  5C9M A;  1QL4 A;  3HQ7 A;  1SQQ D;  1NML A;  4EIE A;  2LIR A;  3VNW A;  1K3H A;  4EIF A;  1EB7 A;  3NBS A;  2B10 B;  1HRC A;  1K3G A;  1H9X A;  3OA8 B;  5CIH B;  1CTZ A;  2BH4 X;  3WU2 V;  1HCM A;  1DW0 A;  3HQ8 A;  2DGE A;  1IRW A;  2PAC A;  5CIB B;  2CA4 B;  1R0Q A;  1H33 B;  1FOC A;  1QYZ A;  3O1Y A;  5CIC B;  1S5L V;  1CHH A;  3WFB C;  2N3B A;  4AAM A;  4WQD A;  3DR0 A;  4WQE A;  1AYG A;  3CX5 W;  4WQ7 A;  3SVW A;  1CRC A;  1CYJ A;  4FA9 A;  2XTS B;  2PCC B;  1JDL A;  4AX3 A;  4QAO A;  4Y5R A;  1A56 A;  5KKZ B;  1BCC D;  1S6V B;  1FI9 A;  2ZOO A;  1U75 B;  2QJP B;  3H1L D;  1CNO A;  4L3H A;  3A9F A;  4FAN A;  4O1W A;  5DF5 A;  1RAQ A;  1C2R A;  4H0K A;  1H32 B;  4H0J A;  4P4Q B;  1YIQ A;  3SLE A;  2ZON G;  5GTI V;  4WQ9 A;  2AXT V;  2BH5 X;  1KX2 A;  1SQV D;  2YCC A;  1CIE A;  2BLF B;  3WUI A;  3ZIY A;  4UB8 V;  1OAE A;  1CED A;  1I54 A;  1W2L A;  1CSW A;  1H31 A;  1LS9 A;  1CYC A;  3L74 D;  4FB1 A;  2AIU A;  1NTZ D;  2IBZ D;  1F1F A;  3ZOX A;  2GIW A;  1EZV D;  3DMI A;  5AUR A;  1DW3 A;  1A8C A;  1YEA A;  2C1D A;  3TYI A;  3L71 D;  2BGV X;  1CSU A;  3C2C A;  1IO3 A;  3CP5 A;  4JCG A;  1IZL 0;  3PXT A;  2EXV A;  2YQB A;  1BGY D;  2ZBO A;  1SQP D;  5CID B;  5DFS A;  1FCD C;  4YE1 A;  3CX5 D;  3CWB D;  2N9I A;  1BL9 A;  1HH7 A;  5H2F V;  1AKK A;  2GC7 D;  1GU2 A;  1RZ5 A;  4Q5P A;  3KZI V;  4WQA A;  1PP9 D;  4DY9 A;  1L0N D;  3CYT I;  4RSZ A;  3VYM A;  4D6T D;  1WEJ F;  3MK7 C;  3CU4 A;  1ETP A;  2N3Y A;  1L0L D;  1FJ0 A;  3A0B V;  3L72 D;  1YEB A;  3L70 D;  4WQC A;  1CTJ A;  5DJQ C;  1QL3 A;  1DII C;  2C1U A;  3RN0 A;  1AOQ A;  1NIR A;  1KX7 A;  1QN2 A;  2QJY B;  3ZOO A;  2ZZS 1;  5B66 V;  3DP5 A;  2C9X B;  3CXH W;  1KV9 A;  1ZZH A;  4K3I A;  1I5T A;  4AAN A;  2B4Z A;  3PXW A;  4PW9 B;  1CRY A;  1HRO A;  1SQB D;  4L3G A;  4PJ0 V;  1CIF A;  3SJL A;  2YIU B;  3JBT B;  3A0H V;  1E2R A;  2N18 B;  1CSX A;  1LFM A;  2ORL A;  1DIQ C;  4FAV A;  2V08 A;  1L9J C;  2C1V A;  1SQX D;  3OCD B;  1M60 A;  4PWA A;  1C6S A;  2OZ1 A;  1CXC A;  1CRH A;  1E8E A;  1L9B C;  4O1Q A;  1CXA A;  5CIG B;  1C7M A;  4J20 A;  1RZ6 A;  3HQ9 A;  3L4O A;  1CYI A;  5CIF B;  1FI3 A;  4WQB A;  2B11 B;  5E79 V;  3WFE C;  1F1C A;  1HJ5 A;  1DT1 A;  3OA8 A;  1AOF A;  1J3S A;  1I55 A;  2FWL A;  1KIB A;  1KB0 A;  2N9J A;  2JTI B;  3RMZ A;  2D0S A;  1NTM D;  1KYO W;  2HV4 A;  3TGU D;  1CCR A;  1LC2 A;  2CE1 A;  2JQR A;  1H33 A;  2L4D A;  3H1K D;  4V2K A;  4NFG B;  4L1Q A;  1N90 A;  1A2S A;  4KMG A;  3H1I D;  3ZBM A;  1CRI A;  1YTC A;  2C8S A;  1P84 D;  2CE0 A;  4MU8 A;  2FYU D;  4EID A;  4LJI A;  1CC5 A;  5CIE B;  5EXQ A;  1MZ4 A;  4UB6 V;  1I6D A;  5KLV D;  3SXT A;  1HJ4 A;  2QJK B;  3PH2 B;  1GKS A;  2AI5 A;  1N50 A;  1KB9 D;  1NMI A;  2LIT A;  3CXH D;  1VYD A;  1YCC A;  1GIW A;  1ZRT D;  2BPB B;  4U3F D;  3ZOW A;  3NWV A;  1CHJ A;  5B5E V;  3H1H D;  1C6R A;  3ZCF A;  1DVV A;  5KLI B;  2GB8 B;  4N0K A;  1I8P A;  1RAP A;  2I8F A;  1H32 A;  1E29 A;  4IL6 V;  4XYD B;  1CO6 A;  1OCD A;  1NNO A;  1GDV A;  3OCD A;  1H31 B;  1HZU A;  1COR A;  1DW2 A;  5GTH V;  1MG3 D;  5IY5 1;  3NBT A;  4AAL A;  1YIC A;  1I6E A;  4FA4 A;  4GYD A;  1PPJ D;  1HZV A;  1HJ3 A;  155C A;  2C1D B;  3WC8 A;  1C6O A;  1YNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...