1CHPD

Surprising leads for a cholera toxin receptor binding antagonist; crystallographic studies of ctb mutants
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLADKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Surprising leads for a cholera toxin receptor-binding antagonist: crystallographic studies of CTB mutants.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
molecule keywords CHOLERA TOXIN B PENTAMER
total genus 22
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1995-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1chpD00
1PTOC 1LT5D 1EU3A 1PZJD 3BVMA 2Z8LA 4RHRA 3BYYB 4RGMA 3R2TA 5ELFA 4C56C 1D5XC 1ET6A 5I4DA 1SXTA 1GOZA 3TSSA 5ELDA 1HTLD 1LLRD 2QILA 2XRQD 3CHBD 1FGBD 1SE4A 1LT6D 1I4XA 1S5DD 1HQRD 1PZKD 1LTBD 1TS4A 2XN9C 4UDUC 4RCOA 1RF2D 1SBBB 1TY0A 1I4PA 1CK1A 1JWSD 1PRTB 1BXTA 4RGOS 1EFID 1CT1D 1B44D 2NTTA 1BCPC 4RFBA 4TSSA 3KLSX 1BCPD 1SEBD 1CHQD 1SE3A 3W2DA 1KLGD 1F77A 1B1ZA 1EU4A 1I4GA 1PYWD 1ENFA 1S5CD 1XXGA 4BWGB 1D6EC 3BVGA 2NTSA 5TSSA 4DXGA 3URYA 1TS3A 1LTSD 1SJHD 1SJED 1BCPB 1EEID 4ZYSA 1JWUD 1TY2A 3O13A 1LTRD 1AN8A 1KTKA 1QILA 1FNVA 1PRTF 2WV6D 3BZDB 2QEJC 4OHJA 1FD7D 3MFGA 1T5XD 1S5BD 4RGNA 1MD2D 1PRTC 1EEFD 1M4VA 1PRTD 3SEBA 3DWQA 1LTID 5FK9C 5D3IB 1D5MC 1FNUA 4Z9CB 1G8ZD 1UNSA 1JWMD 2IPKD 1RD9D 1PTOH 2AQ3B 1V1PB 3BYTB 1LT4D 2RDHA 2J4XA 3R8BA 4K6LA 5ELEA 1LTGD 1UUPA 4L63B 1JR0D 3BVZA 1PTOF 2O2LD 1PZID 2AQ1B 1ET9A 1S5FD 1BCPF 1LT3D 3GP7A 4L6TB 2TSSA 1HXYD 4O1NA 1LTTD 1TS5A 1D5ZC 2XNAC 3MC0B 1HA5A 2IJ0A 1S5ED 5D3DA 4RHSA 1I4QA 3OWEB 2RDGA 4DXFA 1RDPD 1LO5D 1EWCA 3V05A 3R2IA 1L0XB 1AW7A 1KLUD 1SE2A 2CHBD 2SEBD 2XRSD 1L0YB 2R61A 1CHPD 1PTOB 1JQYD 3EA6A 1I4HA 1XTCD 3EFXD 1RCVD 5ELCA 4RGTA 3DWPA 2ICIA 4RH6A 1LTAD 1V1PA 2AQ2B 1V1OA 1TS2A 2G9HD 1STEA 1DJRD 5ELBA 1DYQA 3DWAA 1ESFA 5FKAC 1FNWA 1JCKB 1I4RA 1CQVA 1PTOD
chains in the Genus database with same CATH superfamily
1VDZA 1QVGA 2EYFA 1TIID 4HEDA 4A76A 1S4ZA 3EIVA 5JVG3 1KD1C 1DOLA 5E3FA 4JI3L 5E4WC 1LLRD 4RAUC 2Z6KA 1ONLA 4FF3A 1AE3A 1HQRD 1PZKD 2B2WA 2RDFA 3SVMA 2R93G 2UUBQ 2WKDA 1TY0A 1STGA 3CCRA 4FF1A 1BNZA 3QWNA 4YCWA 3MA2B 2DJFC 1BCPC 4KJNA 4NXML 3E0EA 1Y8PB 2NVTB 3CPWA 4TKOB 3T56B 4KMUC 1KLGD 4GLAC 1L1OA 4DV7Q 4IOAA 4YY3L 3HOWG 3HP3A 3PQIA 3K81C 3S2DB 2EY2A 3PO2G 4CKBA 1JWUD 4Q0FA 4CGYB 2BDNA 1ASYA 3O13A 5FLXc 1VQOA 1YNNC 1QUQA 3J80i 3F2BA 2JK8A 1YITA 4LF5Q 4KHZA 1KNEA 2UXBQ 2L15A 3CMAA 3EJIA 3S16B 1N33Q 1F9SA 5DM73 2HDLA 1EY6A 3I4NG 4P72A 1PA6A 4LAAA 1PRTD 4DUZL 2WAQE 5F2DA 1U4MA 4PZ7A 4JI5L 3I4MB 3G6JB 1G8ZD 1X55A 2N88A 3SR1A 3S24A 3T4AC 2ZT9C 1Q8KA 4A3FG 1GHJA 2J4XA 5FLMG 3SE0A 3RZDB 1B7YB 3OOCA 1K0RA 1GUOA 1PH5A 4DN4M 3K7UC 2UXDL 1S40A 3HS0C 1HUNA 3SXHA 3TEHB 4DV3L 2Z4HA 4KHPL 5FLXL 2PZUA 4R4TA 4JW0A 4JI4Q 1Q86C 4JOIC 3NWSA 2NVYH 3T51B 4R4IA 5C6AA 5CMDA 5M3MG 4YWLA 4GZYC 3M3YH 1VQ6A 5JPNC 1XTCD 1VQEA 4YY3Q 2UU9Q 3MXPA 3K0YA 3PO3H 4X3TA 4ZAIA 4DV1Q 4MIUA 1PTOC 1I94Q 2Z8LA 2F0JA 2Z6KC 5FOBB 4Y52H 4C3HB 5GQOA 4DA2A 2KHIA 2K1BA 5I4DA 1DONA 1GOZA 1QWYA 5EJWA 3BDCA 4XTCS 3MZ5A 2OF1A 1A62A 4DNTB 2PW5A 4DF7A 1B70B 1G6ZA 2QGQA 1SMXA 4EQPA 1I3QH 3OWFA 3S1MB 4R4CA 5M9OA 1HNWQ 1XPUA 2NN6I 2GN5A 1BF4A 2JA5B 3TP6A 4V0BA 3UE0A 4HSPA 3J81L 4B3SL 4TSSA 3D6WA 1MBYA 4G4KA 4RCNA 2VXWA 4X3UA 4V190 3GTLB 2L1BA 5I9OA 1PMRA 2XIWA 2MO0A 3VYSA 4POFA 4BBSB 5EPLA 2NTSA 4DV3Q 4JC0A 3CCJA 3QB3A 1M8AA 2ZTCA 4FVMA 3CCSA 3A5ZB 4JI2L 3KJOA 4FYDA 2MJ8A 1U4LA 2O5JC 3BZKA 1WJJA 2CFMA 2EY6A 4O2DA 4LW1A 1II3A 5BN5A 4FF4A 2HD3A 4X66L 4OHJA 1FD7D 2EJFC 5KGUA 4IO9A 4QUCA 4OGQC 2I5HA 4CDEC 4C3IG 1NCVA 1FJGL 2R93H 1IYJB 4JI0Q 2Z1CA 4HCSA 5IT9L 1ZKOA 3D0FA 1C4QA 2K5WA 3PUZA 2JA5H 2LS01 2SNMA 3ZYYX 1QB5D 4IALA 3K5MA 1WFQA 1Q82C 1K8AC 3HFZB 2K33A 3JAMi 1SMYD 1I5FA 1IYVA 3S16H 3M7GA 3BJUA 4KKUA 2WB1E 5BR8Q 2K5NA 3OIQA 2E2HH 3N52A 4LF8L 1B3QA 1VMPA 2L4NA 1NUCA 2B63G 1I6HH 1PFMA 4AQYQ 2A8VA 1B2TA 3RNUA 2K52A 2B2UC 4DR2L 4RGTA 1WCMB 1GM5A 3PO2H 1OXTA 1VQAA 3PIP3 5JJLA 1EYAA 3BVMA 1PXUA 3PF5A 4HJ5A 2J0TD 1PH4A 4GS3A 2HDMA 5IT9E 4A3FB 2KENA 4A93H 4K8JA 1WYDA 2F0TA 1PHJA 1X54A 5I6WA 4F8MA 5JAVA 4YCVA 3G6EA 3L3OC 1U9RA 4A3FH 1UE6A 3WOEA 1XWEA 1AZPA 2C35B 2EYJA 5LMUQ 3CRLC 1Q81C 4IUQA 1D1KA 3CCQA 2BH8A 3GD7A 5GAHC 1LTSD 4LF8Q 1SYBA 1SN8A 3SGIA 1BBXC 4LF7L 1XMOL 2A73B 2RCNA 1G2SA 2J7ZA 3CU7A 1PDQA 1C8CA 3X3MA 2F0IA 4A3BB 2WV6D 3A0JA 2QEJC 5CV7A 1XMQQ 2FXQA 1OTCA 4A3KH 2HT1A 2NWGA 1SNOA 1EUJA 3PUYA 1LTID 3AFPA 1RIPA 1TU2B 1D5MC 2JA8G 3K7AH 2K14A 1VS0A 5BN3A 1PH7A 4NXMQ 4A93G 1LTGD 1X9NA 5AJ3Q 3NBIA 1UE5A 5K36G 4G7OC 3MC0B 2H4OA 5IP7H 3TZUA 4WRDA 1UEAB 4K14A 2Q2HA 2OTLA 1L0XB 4ALPA 3ZJYC 4YWMA 1I3QB 5JEAG 2R61A 4XQJA 1IBKL 1JQYD 3NTKA 4A3JB 1SYEA 4OIJA 3KBGA 5EBDA 2XTIA 4RH6A 1N33L 1LTAD 1Y8OB 3PIPA 1AP0A 1JE5A 3VR3A 2CCZA 4LF9Q 2F1MA 3MTSA 5IGCA 5ISRA 5JJIA 4I7ZC 3NEMA 5EAYA 1JJCB 3A8IE 5ELFA 5L37A 5FLXE 2WFWA 3UDGA 3HRZC 4U68A 3TSSA 3VR2A 4BY7G 2L55A 2EYOA 1LT6D 4NP5A 2F0QA 3MXNB 2XN9C 1MJCA 1VQKA 2E75C 1RF2D 1BVSA 1J5EL 4KI0A 5J1ZA 4CKEA 2B2TC 2TMPA 3D4WA 1B44D 4JPBW 1N36Q 1XNQL 3KLSX 4TRDA 3GTJH 4HIMA 2L9HA 1K0SA 3R93A 1L1OB 5HURA 1T9HA 3S14H 4QY7A 1I4GA 3BVGA 1VQMA 4A3BG 3S15H 1B50A 4ME3A 4OELB 3NPPA 5EQ0A 1EQQA 1EWIA 1STAA 3X3NA 1RTNA 2HIXA 2ATWA 5IIFA 3JAME 1IBKQ 1TWHH 2IT1A 2MQHA 2AUJD 3KF8B 4DAMA 4OX9Q 4Q5VA 2EYMA 4NXNL 1YHAA 2OT2A 3PCOB 2NVQB 3H6MA 4OWXB 4MN3A 2EYHA 3P1HA 2JA7H 3QG1A 4GN3B 1XPRA 4FF2A 1AEXA 3HOZB 3NE5B 3KDFB 3BG3A 4JG2A 2YTXA 3TDQA 3MWYW 4FDBA 1X3EA 2IPKD 4A3CH 1PH1A 1P16A 3BYTB 3BZCA 4K8IA 4B3SQ 3T53B 1ICWA 2VS1A 3HOYG 2KEEA 5GROA 5CBEE 1HCZA 1A8VA 3VYTA 2LXKA 4LF6L 4CJ0B 2B8FA 4DV6L 3I4LA 3H3VI 1N36L 1F2LA 1I4QA 3T16A 1F9QA 3DHQA 1OXXK 3RUZA 4BBRG 1NY4A 4EQOA 3CCEA 1L0YB 1HH2P 3FDTA 4DV4L 1H9MA 2A6EC 1Y8NB 3WDNA 2VL6A 1GUWA 1NSNS 2RQXA 3A74A 4DR5L 1TS2A 1UEBA 4TVAB 2R92B 2B2VA 1VQ4A 4PZ6A 3DXJC 1TXYA 4RHRA 4RGMA 3GTMH 3HOZH 2VNUD 1F9PA 5G3LF 3J80L 3C3LA 4B9WA 4C2MB 2ALYB 3J7YW 4GOPB 2QILA 1SE4A 4K2KA 2F52A 3HKZG 1SBBB 4KN4C 3K5LA 3KK7A 3H3VH 3P75A 3CW2C 1GUGA 1JOOA 1BCPD 1Y69U 1NR4A 4BY1H 5CV5A 1E2ZA 4JI6L 4OIKA 5ELOA 3GTOB 5C3EH 2IWHA 5I9PA 2Q2UA 5DAUA 4F87A 3KOJA 4A3JG 2ZM6Q 1EIFA 4P71A 2C9OA 4PQXA 4DUYL 3Q8DA 1EZ8A 1C9OA 1QVCA 1V1QA 3IRBA 1SAPA 4QL5A 1IHZA 3S1MH 3NENA 3BDOA 4P2CB 5HGQA 1PRTC 1EEFD 1H9KA 3U9SA 3FEWX 1O7IA 3RN2A 1STYA 3KLSA 3HOVB 1B4OA 1JWMD 1RD9D 3ER0A 3N6RA 5IGBA 2F0SA 4POGA 3W1BA 5CBAE 4HIDA 1HQMC 3CMEA 4UHVA 4IN3A 1IKMA 1HXYD 4BBRB 2E8GA 3U9OA 1GVPA 4L5SA 2B2UA 3H09A 5M5XB 1X3GA 1GUSA 2KOLA 2EVBA 1EWCA 3WOFA 1Z47A 4A3EB 4L5RC 4JI6Q 1CHPD 3VR4A 3LGJA 4DV2Q 5K36H 4AYBG 2I5LX 4IQZA 4PMCA 2IX3A 1HA6A 4JI8L 1STEA 1NNXA 3IKJA 1FNWA 3MEFA 1PTOD 4FO2A 3M9BA 1EU3A 2ZM6L 3GO5A 5E1FA 4DUYQ 3KFUA 3I55A 1DD2A 1B9MA 4BY1G 1TWAB 4KHPQ 1F2YA 2IW3A 3MEHA 4GN5A 3KUPA 5AJ3L 1IW7D 1VQCA 1VQNA 2JA9A 4B3MQ 1YIJA 1F2MA 2EYPA 2WAQG 5IP7G 4OWWB 5FO7B 3S1NB 4HSVA 2UU9L 4NW2A 3NBHB 1B3AA 3W2DA 1WCMH 3OHXC 4NDXA 2OTJA 1SFOH 1HJPA 3IL8A 1LACA 3M4OB 1NMGA 4HMIA 3V2TA 2I5MX 4CJ1B 1JT8A 2K4KA 1GHKA 5IGDA 1L2FA 1N9WA 4A3DG 2ID0A 1LTRD 5M5XH 5ELNA 3OPOA 4IURA 4WFN3 3GTPH 4HJ7A 3S2DH 2A5HA 1E2VA 1HZBA 1LABA 5LL6S 4JK1C 3ITPA 4DV2L 4XYQA 1HNWL 3MFGA 2AKWB 3HOWH 3CRKC 1EWHA 1BO0A 4X65Q 4WJ4A 2XWBB 4JBWA 4HJ8A 4RKBA 1K8GA 3CPFA 2XWJB 3A56A 1J5EQ 2O5IC 1AZQA 3ND8A 3FRPB 2CWAA 2RDHA 5DLQE 3CF5A 5C0XI 2PW7A 2OQKA 1WTXA 2ES2A 1O78A 4DR6L 2Q8RE 2HHHQ 1LT3D 2PNRC 1RL2A 2EY1A 3J7ZC 4JI2Q 4A3EG 4B3ML 1D5ZC 1VQPA 5C3EG 2F0HA 2IJ0A 4IPCA 3VR6A 4AYBB 3GTOH 1MSGA 3EN2A 5IP9G 2FMMA 1RCVD 1MIUA 5CYUA 5J3BA 2ICIA 2OQ0A 3C46A 1C7YA 2JA8B 5FKAC 1ESRA 2ENBA 1TWCB 2F0UA 1DZ1A 4L5QA 1RTOA 1JE4A 4HCEA 1N32L 3VDYA 4L8JA 1K83B 2FHTA 1HTLD 5BR8L 3CAMA 1FGBD 3VYRA 4UDUC 3Q22A 2UUCQ 1G2TA 2KVMA 1CK1A 1JWSD 3K8AA 2K6AA 2EXDA 1EFID 3PIOA 1CT1D 2OEOA 1EY8A 4DR7Q 3SHLA 2DN8A 4PNYA 3UDFA 1KNAA 1O7YA 4HMJA 4DV4Q 1Y1WH 1HR0W 5C0XH 1ENCA 2YTVA 1FYCA 1KAAA 1PVOA 3M4QA 4IOCA 3KDFA 3RLNA 1MKHA 3H94A 1SNQA 3RD4A 1A15A 2F3IA 3UDXA 1PFSA 3JAML 1KTKA 5IYCG 1UE7A 2WIIB 4DK3C 1VQDA 2CKZB 2QEXA 3STBD 1CA6A 2FFKB 4P74A 2Y0SG 3DWQA 4A93B 1KDBA 1N32Q 4WORA 4IUTA 2SDFA 3S1QH 4GKKQ 1EY9A 2Z0SA 1EOTA 1PTOF 2NN6G 4ZK9B 3U4VA 3OSOA 3P20A 3PO2B 1HUMA 4QGUA 5M5WB 1W2BA 1NTGA 3D31A 4HTHA 1VMCA 1VCIA 1GKHA 4DXFA 2F0GA 4NB3A 2BOSA 3CXCA 4A3DB 4IFDI 2WP8J 4I65A 2CVRA 1Q8IA 1PTOB 4A75A 3GTGB 2B2TA 1I4HA 3EFXD 3FVQA 3HKSA 2ICEC 4EX5A 3AB9A 3PUXA 1NBWA 1X56A 4QB4A 3WWVA 1HNZQ 2OWOA 3GTJB 1STBA 2JA7B 2R7FA 2EQSA 2G9HD 3W3AA 3VYUA 3G4SA 1I50H 4A3DH 1Z7TA 1CKNA 4AH6A 1SFOB 3UI2A 3F2UA 1A2TA 2DY8A 4ULLA 1VQ8A 4HR7B 3HOYB 1Q90A 5M3MH 4CDCC 2B2WC 2AWNA 3GTKH 3D8GA 3L2PA 1KAWA 4ZUJA 1G91A 2HUGA 1PFNA 3I72A 1TS4A 1LTBD 1VQGA 4BXXG 4A3EH 3NHHA 2YU9B 1C0AA 3J81E 4XQQA 1KRSA 2MFIA 1IL8A 1GUNA 3S2HB 1VQ7A 3T1YQ 2E76C 1MHWC 4KN7C 5HGTA 5IYDG 4DR3Q 3NXWA 2CW0C 4AIMA 1UAPA 3E3XA 4YCUA 1XXGA 1CZWA 3TQYA 1PH8A 1M1KC 4PZ8A 1GO3E 2JYOA 3LWUA 3U4ZA 5M5WH 3J81j 4X3KA 4JI8Q 1K8MA 1TY2A 4X3SA 3PMFA 1SNDA 4GNXC 1XPOA 1CSQA 4XYOA 3LNNA 5K5PA 2C5CA 1MGSA 4GOPC 1TR5A 1HNZL 1K9MC 1EQVA 3AQQA 4KTAA 4DV0L 1MD2D 4RWSC 4C1NI 1DGSA 2JA6B 3U58A 4CBVA 1ILQA 4GNXA 3QJYA 2VW9A 1FNUA 1NE3A 2RSNA 2K28A 2EIFA 1Q12A 2AQ3B 3EROA 4M1UB 3C1EA 3RLFA 1TWCH 1HZAA 1UUPA 4DR1Q 2AQ1B 2IHFA 4L6TB 1J9OA 3GV3A 4KKSA 2QA4A 5C0XG 1KQSA 1TS5A 3AYHB 1K83H 1YZ6A 2XNAC 3NUCA 4MZ9A 3D6CA 1QZHA 3TP8A 4UP7A 2E74C 2IX0A 2R92G 3ERQA 1K28A 4YIJA 2PZWA 4Y7NH 1AE2A 3DWPA 5CV4A 4C1NK 1U0LA 4C2MH 1TVXA 2B39A 4DPGA 2L11A 1R9TB 1DJRD 1BUVT 2DUDA 2L0CA 1Y1VG 1YHQA 1A63A 4ZRZA 4HJAA 1YNJC 1S3OA 4IPGA 4UP8A 3HOVH 3KF6B 3R2TA 2PO4A 4C56C 1BOSA 3A54A 1EIYB 2UXDQ 3P7JA 2QDLA 4DV0Q 2EOTA 2M9VA 1K3BC 1SSOA 1X3FA 3CD6A 5GAGC 1HRJA 2R3ZA 2Z9HA 3C2PA 1KDAA 4LUOA 3LX0A 4R1JA 4RCOA 2IL8A 5C44H 3PGZA 4XT1B 1H95A 2B63B 4JV5Q 3DEOA 2EXZA 3K57A 4A3CG 2D5DA 2DY7A 3TS2A 2V4DA 4RFBA 4A3JH 1I6VC 4P73A 1O7LA 1BQQT 4JI7Q 1VQLA 3DMUA 3MFYA 1VQBA 1KABA 1N8RC 4K5VA 1JORA 3URYA 5CC4A 3T13A 2LFNA 3TBIB 1WI5A 2WINB 1SJED 3ULLA 1XYIA 1IXRA 5IWAQ 3OYYA 1HTPA 4BS9A 4NKLA 5DNFA 2L5TA 3I90A 4KY7A 4DV5Q 4LF4Q 1EQRA 4G7HC 3H0GG 2A69D 4WJ3M 3DM1A 1S5BD 2QCPX 4DKAC 3F2CA 1Q46A 3NTHA 1OXUA 4ABNA 2KCCA 2UUAQ 1FL0A 1R4QB 4OO1G 5LHY1 5KNCA 2F0DA 5IYCH 1WTHA 3CC7A 4DK0A 1YJNA 4OL7A 2SOBA 4A3GG 3PF4A 1HNXQ 4L63B 3BVZA 3D4RA 1S5FD 2D2CC 2FJ2A 4JV5L 4OONA 1Y1VH 3L9AX 2VY3A 4IUVA 2KBNA 2LXJA 3I8ZA 5EGTA 4X66Q 2D9UA 1D1IA 2HCIA 2RDGA 4Y7NB 2R7ZB 3ICEA 2KCMA 2SEBD 1SE2A 1KLUD 2A1AA 2XRSD 3K6OA 1PV4A 5IYDH 4BA1I 5ELCA 5IYBH 5FJ8G 1V1OA 1SMYC 3TN2A 5IE8A 2R93B 1EY0A 5IWAL 1WD1A 2PMZE 4APVA 1LT5D 4LF4L 2E2HB 1QZGA 4LK1C 1YEZA 2KCNA 1SXTA 1PH2A 4QIWE 2UXCL 2VUMH 2BE5D 2A74C 1EFWA 4MNOA 4UY8C 1G6PA 1IYUA 1I4XA 3B6YA 1O80A 1WTVA 1B9NA 4QQBX 2Q2IA 1Q1BA 3MVVA 2YTYA 2B3GA 4AQYL 4HN7A 3SDZA 4K6DA 1EYDA 1BBWA 3C1FA 3AU7A 2QKIC 4IUUA 2Q8IB 3TP5A 2KJXA 1OO9B 3V96A 4B3TQ 1EY4A 4XQNA 1L0WA 1XNRQ 3M85A 4EVOA 3M3YB 2X69A 4DAYA 3HOUH 1WOCA 3FKIB 4FXDA 3K59A 3MHBA 3RLOA 1Y1VB 1HR0L 3BS1A 1FNVA 3TS0A 2NVXB 3I73A 3W1GA 3CCMA 1CTMA 4KK7A 2PQAA 5EPKA 1LYLA 1LM0A 1ASZA 4A3BH 2K32A 2KECA 1WTPA 3SEBA 3J7A5 3PV0A 1TWGB 5M5YH 1U4PA 3CC2A 1IZ6A 3HKZE 5M3MB 1GD7A 2I46A 1SLJA 4ZCKA 5KNBA 3K5OA 2KHSA 4RKLA 2R7ZG 3GP7A 3NBHA 2RVLA 1H9JA 4O1NA 1ENAA 4LF7Q 5EKLA 1HA5A 4OEMB 4B9XA 1TWFH 2VB2X 2LY7A 4IJLA 2D62A 3OMCA 4R4OA 2GA4B 2I07B 4M8AA 5IODA 3M4PA 2CHBD 1KDCA 2MO1A 4B3TL 4JBKA 4X65L 1PH9A 1XNRL 4FXKC 4MTNA 4JOIA 5JPMC 4U673 1SYDA 5IY0A 2VZAA 2P5ZX 2NVTH 1OXVA 4LFCL 3PUWA 2XVSA 1DYQA 3S1NH 3HOWB 1I4RA 1CQVA 1HR0Q 2K5HA 4J1MA 2B63H 3EVQA 4O0AA 1DOKA 5CV9A 4FXGC 2I0QA 2HHHL 2IY5B 3GTPB 2NUCA 3A5UA 3SK6A 3A7AB 4C3HH 3IFTA 3NTIA 4A4IA 4ZKCB 4DR1L 5C3WA 2F4VQ 4L5TA 5BN4A 2NVQH 3HOUG 4FP5D 4KLKA 2K50A 2A19A 1K8OA 2Y0SE 1VQJA 1SYCA 3QOLA 2B8GA 2AWOA 2NTTA 1DOMA 2KCTA 1E22A 3GQBA 1CHQD 1QG7A 3ULJA 1DM0B 1F77A 5C4JH 4A3KG 2H5XA 4LF9L 4IZ8A 2VQEL 2PPBC 2KQ3A 4KJOA 1I50B 4YWKA 1PH3A 1BCPB 2F0WA 4ZYSA 1IW7C 2PI2E 3HZXA 4N9TA 2JN4A 2RHSB 2ASBA 1AN8A 5C3XA 4DR4L 1QILA 5IP9H 2JJQA 4PMBA 2N55A 2RF4A 3I7FA 2UUCL 1HPCA 2N3SA 1W3SA 2E2IB 4KY6A 3I2ZA 1HZCA 2CW0D 3E0JA 4DR2Q 1HZ9A 2ZJRA 1R9TH 3TRZA 3G48A 4RA8A 3VR5A 5FO8B 5KRUA 2RSOA 2JSOA 4Z9CB 1BBUA 2E2JB 2B2YA 1EY7A 3ONAB 4NMZA 2DNCA 1G291 1VF7A 3D4DA 5COYA 5JJZA 3R8BA 4A3MH 1SNCA 3A8KE 1WCMG 3E9HA 1TQOA 4YHHQ 3LWEA 1JJGA 4IPHA 3PUVA 3ULPA 3G71A 2PI2A 1ICFB 4H7BA 4K5WA 3DEPA 3PO3G 2GVAA 4GNXB 3I4MG 5LMNQ 3OWEB 4OX9L 5I2XA 1CM9A 3V05A 2FINB 4NXNQ 2HCCA 2QF7A 2CQAA 4DV5L 3S1RH 5I2YA 1E3PA 2VQEQ 1XX8A 4BY1B 2KA7A 2ZXRA 4HIKA 2VUMB 1D7QA 2AQ2B 3FKIG 5LMUL 2JQOA 3QOJA 2XSCA 3KJPA 4DR4Q 5M3FG 4F88A 4BBSH 1PZJD 4DGZA 1LV9A 1CZGA 1H9SA 2SNSA 2CH4W 3BYYB 2CWPA 4JI1Q 1D5XC 1IBML 3J81c 1XMOQ 4GN4B 3OW7A 4XDXA 3SK8A 1N34Q 2QW7A 2AUKA 3M7NA 1S5DD 1XMQL 1HNXL 1VQ9A 3OTOQ 1YHBA 4PMWA 2K5QA 1ML0D 3GDEA 5JEAJ 1M90C 3L7ZC 1BXTA 4PG3A 4JYAQ 2FMCA 4DAPA 4G57A 1B8AA 2F03A 4N8X1 1X32A 3KF6A 2GVBA 4ME5A 3STBC 1SRUA 4B3RQ 3SK4A 4EGVA 4X6AH 2OCEA 1TS3A 4P75A 2PCFB 5LMNL 5C5MA 1XJVA 1CUKA 3KYHC 5HY6A 2RA4A 1A3UA 1CSPA 2F4IA 2K5DA 5C4XH 2N49A 4CHTB 3BZDB 5IGFA 4QUFA 1AFPA 2MUYA 3VA5A 1J8IA 4RMFA 4A3IG 3Q23A 1A6XA 2K03A 2B29A 2UXCQ 3QR8A 3KBXA 5C4JB 1SNPA 2E2JH 1CKMA 1HFNA 4JBJA 2EZVA 4RG1A 3HEJA 5FK9C 1IBMQ 1UNSA 3RZDH 4GKJL 4UP9A 3I3CA 1PTOH 2G9DA 1ILPA 1N34L 3H0GH 5ELEA 3BU2A 1Q3LA 2A68C 3OTOL 2O2LD 1PZID 5A35A 4JI3Q 4BXXH 4C3IB 2BDOA 3I91A 1LTTD 3J7AV 1QNUA 3IFDA 1BR9A 2F0EA 5T1IA 3T1HQ 4H0LC 3OMGA 5KYIA 5EPJA 2ZJQA 3H0GB 3S15B 2F0KA 2HQEA 3JAMc 2Z4IA 4DU9A 5M3FB 2N78A 1XNQQ 1KXLA 1TWFB 4LUZA 3TP7A 3CKIB 3GTGH 1CFMA 2M00A 1F2ZA 5ELBA 4ZLTF 4DV7L 1PYBA 2WB1G 1D8LA 4R4QA 1ZXTA 1BDOA 5IGGA 1LUZA 1E7ZA 3AEVA 3VA7A 4E6IA 1VQIA 4A3GB 2Q2TA 1GUTA 2IHEA 5C4XB 5M5YB 3HOYH 3S9WA 4LF5L 5DM63 2XRQD 2UXBL 2OXPA 1QJOA 2K04A 1QUQB 2PZTA 4GLXA 4ZKBB 1CKOA 1AH9A 3GTQH 2BH2A 4UPAA 2A6HC 1TWHB 4RGOS 1TWAH 2KUMA 1Q7YC 3S14B 1TWGH 2D0OA 1EOVA 4HAEA 1WTWA 4JI5Q 4BBRH 4J15A 1A0IA 1HHVA 3RZOH 3NP8A 5EBCA 4H02A 4QF4A 4EQNA 3AFQA 1JB3A 4DXGA 2EE1A 3T1HL 1JOKA 2F0FA 2NVXH 2V1CC 4DK6C 4IFDH 3TMEA 1EQTA 4QIWB 1K3RA 4LF6Q 1IBLL 4NPSA 3Q0AA 1YNND 1RHPA 5J22A 1V43A 4JI4L 5A2QE 2K05A 3L0OA 3H91A 4RGNA 1FVIA 4A3LG 2WACA 1RKNA 4DNRB 5I6YA 3DUZA 3HOXG 2F4VL 3K7AB 2O4XA 2MHVA 3F8TA 1MSHA 1B53A 4DR5Q 2EY5A 2K7VA 4JI7L 2ZJPA 3KLWA 4F7XA 3PSIA 2VQFQ 1SDFA 2A6ED 4DV1L 5J39A 3DLLA 1JC7A 3K80C 1EYGA 2YYZA 4XIGS 2MNAA 2MPMA 1VQHA 1SE8A 1BCPF 1JMCA 5FJ8H 5IYBG 3Q24A 1A3TA 1KC8C 4K0KL 1Z9FA 2MGSA 1U4RA 2F0LA 5JOBA 1PH6A 1E2WA 3GTQB 1LO5D 3RMHA 3NK9A 1AW7A 4OO1I 1QE6A 2CH4A 4LNQA 3CP0A 4N8FA 3EA6A 2M2LA 4JVZA 2UUAL 4QJFA 2NN6H 5GAEC 4H44C 1V1PA 1YBYA 4A3IB 2RKSA 1J6QA 2A6HD 1KHIA 4C3IH 5IOCA 4A3MB 5C3EB 1IBLQ 4KD4A 5C5LA 1LTLA 2AMCB 1SNMA 5KEEA 3RZOB 2PNHA 5D65A 2IX1A 2R92H 2K75A 1Q1EA 5C0XJ 3S2HH 3CQZH 2JA6H 1W6KA 3S17B 2Q8TA 3CQZB 4LFAQ 3CHBD 1KRTA 1CQFA 3J80c 1YJWA 1GJXA 4IJHA 4MHEA 2NYZD 4AYBE 1I4PA 4CKCA 3I4NB 2JA8H 1WVLA 3HG9A 2D0PA 1PRTB 4J6HA 4KKTA 2R7DA 4CDFC 4DNIA 1SROA 2X6GA 1FJGQ 3TREA 4JI0L 3HOZG 3E9IA 1PFBA 4A3GH 3MAQA 5CV6A 1JJ2A 3OW2A 2R7ZH 5H1SE 3S1QB 4LUVA 1EU4A 3I4NH 4K0KQ 1NJIC 2NZ1D 1I6HB 1IL2A 1EEID 2RBMA 3K5NA 1IKLA 2PYKA 2YV5A 5AFWA 1L1OC 5M3FH 2AHOB 2EJGC 4C3JG 4HJ9A 3H3VC 4BBSG 3QO2A 1X6OA 4ILWA 3CCUA 2F0OA 4KV6A 2H1EA 2JP1A 2K01A 5FO9B 5C44B 4K2LA 1RODA 2WB1B 4BA2I 4R8NA 1EIHA 1JOQA 2KHJA 1WTQA 3H15A 1GXDC 3CCLA 3MXNA 1VQ5A 3NSWA 4DAYB 5C4XG 2LKVA 2CQOA 3I4OA 4JYAL 1NR2A 1OXSC 2F0NA 3A8JE 5JEAH 3E5SA 3PIO3 4C3HG 4N9PA 3DM3A 1JB7A 1JR0D 4B3RL 1E0BA 3S17H 4X62Q 2NB0A 1MI2A 1H9RA 4XXEA 2F3VA 3QIAA 2PQAB 1YJ9A 5KYLA 2ZTDA 1H9SB 1W6JA 1JICA 2RHQB 5DEHA 2JEBI 2JA5G 1STNA 1QOHA 2DJGC 4I7AA 2BE5C 4A3MG 1XTDA 4ID6A 3RR5A 3J81i 2JA6G 1TT2A 1E1OA 2LSSA 1EL0A 3DWAA 2F3WA 3HOXH 4K5XA 1QVFA 2K5VA 3HOXB 1CI3M 1KIXA 4TQUS 1X3PA 1NAPA 1FGUA 3MXUA 4CDDC 1STHA 2QDBA 2B2VC 1D2BA 3FKIH 4KY5A 4IUNA 3CC4A 4DUZQ 2JA7G 1RJTA 3JC66 4IUPA 1A3VA 4O42A 1ZYRD 2G5DA 2E5LQ 3FP9A 4A3KB 5CORA 1PLFA 4DAVA 5E7NA 4LFBL 4UAIA 5EKKA 4ZQ3A 1SR3A 4LMQD 4ZUIA 1SEBD 3F1ZA 5KIXA 2VUMG 2JEAI 1VQFA 3J7AF 5C4ZA 4LFCQ 4X62L 2HIVA 1KL9A 1B1ZA 4OWTB 2EPBA 1K73C 1PYWD 1S5CD 1ENFA 4X64L 1D6EC 3HKZB 1E24A 4DR6Q 1R4PB 3K0XA 5GADC 1YI2A 3F2DA 4KHVA 2MP1A 1WTOA 3NELA 4KD3A 2EDGA 3NQIA 5FLMH 2E2IH 1Y1WG 3M4YA 3NQTA 2BA0A 4QCLA 1TKWB 2A69C 1Y14B 1PYSB 5CGKA 1WD0A 1DCZA 3FHWA 1M4VA 3OIPA 4CJ2C 4GOPA 2N8NA 1X3QA 3IAYA 1I94L 3FPUB 2VB3X 5C4HA 5CV8A 3T1YL 4IFDG 3I4MH 1X65A 1EIGA 1CA5A 1V1PB 4G7ZC 1FR3A 4FNFA 2JE6I 3PO3B 5IGEA 4K6LA 3M4OH 1SYGA 4WJWA 1C48A 5KNDA 2E5LL 2B2YC 4B08A 1T5EA 4R9WA 4OO1H 3GTMB 5G3LD 4DK1A 5D3DA 1S5ED 4MTKA 2NVYB 4RHSA 4LFBQ 2ZTEA 2BCOA 3HOVG 1RDPD 1EYCA 2RCFA 4C3JH 1UE1A 4OXPA 3SK5A 4X64Q 1VF5C 4DR7L 3HGBA 1DXMA 1ZYRC 3KLRA 4IPDA 2A68D 3CCVA 3K58A 4A3LH 5C44G 1V8QA 2BA1A 3E6ZX 1JCKB 3KF8A 3G7LA 3ND9A 4C3JB 2NZOA 5D14A 4IFDJ 5A2QL 4QMGA 4GLVB 1ET6A 1NMFA 2ZXOA 4YHHL 3GTKB 4JCVE 4A3IH 2VQFL 3TZDA 3AMUA 2KEDA 4EQ5A 5JJKA 4H13C 2ZXPA 1ZEQX 1A2UA 1WTRA 3GV6A 2F0VA 1EY5A 5E4XA 1S72A 2Z6BA 2F0PA 3FPPA 1YNJD 3I56A 3EQLC 4LWCA 3UDIA 2F0MA 1SE3A 1EZ6A 3U50C 1YVCA 4DFAA 1O7ZA 4BWGB 3S1RB 4JBMA 1BKBA 5TSSA 5LMNW 4GKKL 1SJHD 2Y0SB 1E1TA 4JI1L 1Y1WB 2WAQB 2EJMA 5JVH3 3A7LA 1QNKA 3GTLH 3I70A 4DV6Q 5IT9c 1YNXA 1PRTF 3UE1A 1U5KA 2JXMB 2DNEA 1T5XD 5NUCA 4LFAL 4J8QA 1V9PA 2PQEA 1SYFA 1QCBD 2UUBL 2R6GA 4S3SA 3RN5A 2X6LA 1LT4D 2E2DC 2NBFA 2PMZB 3R3OA 2NZHA 3MXGA 1UWVA 2L12A 3Q6SA 5LL6X 3D3RA 2XGTA 5D3IB 5ELDA 4R8IA 1ET9A 2LMCB 5T1GA 4HIOA 2TSSA 4BY7B 4ODGA 3BDLA 3J80E 2WKCA 3W5OA 1G51A 3ERSX 5CR3A 3R2IA 2EYLA 4PV1C 4XT3B 3A55A 3FMCA 4LJZC 4BY7H 5EKIA 1HFGA 1Z6HA 1MJEA 3EBEA 1P8LA 4DR3L 2HQLA 3HOUB 1F9RA 2DGYA 4GKJQ 1ESFA 1CKNB 2YU9H 3NWTA
chains in the Genus database with same CATH topology
1VDZA 2EYFA 1TIID 4HEDA 1S4ZA 5JVG3 1DOLA 5E3FA 5E4WC 1LLRD 4RAUC 1ONLA 4FF3A 1HQRD 1PZKD 2B2WA 2RDFA 3SVMA 2WKDA 1TY0A 1STGA 4FF1A 1BNZA 3QWNA 3MA2B 1BCPC 4KJNA 1Y8PB 2NVTB 4TKOB 3T56B 4KMUC 1KLGD 3HP3A 3S2DB 2EY2A 4CKBA 1JWUD 4Q0FA 4CGYB 2BDNA 3O13A 1YNNC 4KHZA 1KNEA 3EJIA 3S16B 1F9SA 5DM73 2HDLA 1EY6A 4LAAA 1PRTD 5F2DA 1U4MA 3I4MB 3G6JB 1G8ZD 2N88A 3SR1A 3T4AC 2ZT9C 1GHJA 2J4XA 3SE0A 3RZDB 3OOCA 1GUOA 4DN4M 3HS0C 1HUNA 3SXHA 2Z4HA 5FLXL 2PZUA 3NWSA 3T51B 5C6AA 5CMDA 4GZYC 5JPNC 1XTCD 3MXPA 3K0YA 4X3TA 4ZAIA 4MIUA 1PTOC 2Z8LA 2F0JA 5FOBB 4C3HB 4DA2A 2K1BA 5I4DA 1DONA 1GOZA 1QWYA 5EJWA 3BDCA 4XTCS 3MZ5A 2OF1A 4DNTB 2PW5A 4DF7A 1G6ZA 4EQPA 3OWFA 3S1MB 5M9OA 2NN6I 1BF4A 2JA5B 3TP6A 4V0BA 4HSPA 3J81L 4TSSA 3D6WA 1MBYA 4G4KA 4RCNA 2VXWA 4X3UA 4V190 3GTLB 2L1BA 5I9OA 1PMRA 2XIWA 3VYSA 4BBSB 5EPLA 2NTSA 3QB3A 1M8AA 4FVMA 4FYDA 2MJ8A 1U4LA 2O5JC 2EY6A 1II3A 5BN5A 4FF4A 4OHJA 1FD7D 2EJFC 5KGUA 4QUCA 4OGQC 4C3IG 1NCVA 2Z1CA 4HCSA 5IT9L 1ZKOA 1C4QA 2K5WA 3PUZA 2LS01 2SNMA 3ZYYX 1QB5D 4IALA 3K5MA 2K33A 1SMYD 1IYVA 3M7GA 4KKUA 3OIQA 3N52A 1VMPA 2L4NA 1NUCA 1PFMA 1B2TA 2B2UC 4RGTA 1WCMB 1OXTA 3PIP3 1EYAA 3BVMA 1PXUA 2J0TD 2HDMA 5IT9E 4A3FB 4K8JA 2F0TA 5I6WA 4F8MA 5JAVA 3L3OC 1U9RA 3WOEA 1XWEA 1AZPA 2EYJA 3CRLC 4IUQA 1D1KA 3GD7A 1LTSD 1SYBA 1BBXC 2A73B 1G2SA 2J7ZA 3CU7A 1PDQA 1C8CA 3X3MA 2F0IA 4A3BB 2WV6D 5CV7A 2QEJC 2NWGA 1SNOA 3PUYA 1LTID 1TU2B 1D5MC 5BN3A 1LTGD 3NBIA 5K36G 4G7OC 3MC0B 2H4OA 3TZUA 4WRDA 1UEAB 4K14A 1L0XB 1I3QB 5JEAG 2R61A 4XQJA 1JQYD 3NTKA 4A3JB 1SYEA 4OIJA 3KBGA 5EBDA 4RH6A 1LTAD 1Y8OB 1AP0A 3VR3A 2F1MA 3MTSA 5IGCA 5ISRA 4I7ZC 3A8IE 5ELFA 5FLXE 3HRZC 4U68A 3TSSA 3VR2A 2L55A 2EYOA 1LT6D 4NP5A 2F0QA 2XN9C 2E75C 1RF2D 4KI0A 5J1ZA 4CKEA 2B2TC 2TMPA 3D4WA 1B44D 3KLSX 4TRDA 2L9HA 3R93A 5HURA 1I4GA 3BVGA 1B50A 3NPPA 5EQ0A 1STAA 3X3NA 1RTNA 5IIFA 3JAME 2IT1A 2AUJD 4Q5VA 2EYMA 2OT2A 2NVQB 3H6MA 4MN3A 2EYHA 3P1HA 3QG1A 4FF2A 1AEXA 3HOZB 3NE5B 3BG3A 3TDQA 3MWYW 2IPKD 3BYTB 4K8IA 3T53B 1ICWA 2KEEA 5CBEE 1HCZA 3VYTA 4CJ0B 2B8FA 3I4LA 1F2LA 1I4QA 3T16A 1F9QA 3DHQA 1OXXK 3RUZA 4EQOA 1L0YB 3FDTA 1H9MA 2A6EC 1Y8NB 3WDNA 1GUWA 1NSNS 2RQXA 1TS2A 2R92B 2B2VA 3DXJC 4RHRA 4RGMA 2VNUD 1F9PA 5G3LF 3J80L 3C3LA 4B9WA 4C2MB 3J7YW 2QILA 1SE4A 4K2KA 1SBBB 4KN4C 3K5LA 3KK7A 3P75A 1GUGA 1JOOA 1BCPD 1Y69U 1NR4A 5CV5A 1E2ZA 4OIKA 3GTOB 2IWHA 5I9PA 5DAUA 4F87A 2C9OA 4PQXA 1EZ8A 1SAPA 1IHZA 3BDOA 4P2CB 1PRTC 1EEFD 1H9KA 3U9SA 3FEWX 1STYA 3KLSA 3HOVB 1B4OA 1JWMD 1RD9D 3N6RA 5IGBA 2F0SA 5CBAE 1HQMC 4IN3A 1IKMA 1HXYD 4BBRB 3U9OA 2B2UA 3H09A 5M5XB 1GUSA 2KOLA 2EVBA 1EWCA 3WOFA 1Z47A 4A3EB 1CHPD 3VR4A 5K36H 4IQZA 4PMCA 2IX3A 1HA6A 1STEA 3IKJA 1FNWA 1PTOD 4FO2A 1EU3A 3GO5A 5E1FA 1DD2A 1B9MA 1TWAB 1F2YA 2IW3A 3MEHA 3KUPA 1IW7D 1F2MA 2EYPA 5FO7B 3S1NB 4HSVA 4NW2A 1B3AA 3W2DA 3OHXC 4NDXA 3IL8A 1LACA 3M4OB 4HMIA 3V2TA 4CJ1B 1GHKA 5IGDA 2ID0A 1LTRD 3OPOA 4IURA 4WFN3 2A5HA 1E2VA 1LABA 5LL6S 4JK1C 3ITPA 4XYQA 3MFGA 3CRKC 1EWHA 1BO0A 2XWBB 4JBWA 4RKBA 2XWJB 3A56A 2O5IC 1AZQA 3ND8A 3FRPB 2RDHA 5C0XI 2PW7A 1WTXA 1O78A 2Q8RE 1LT3D 2PNRC 2EY1A 1D5ZC 2F0HA 2IJ0A 3VR6A 4AYBB 1MSGA 2FMMA 1RCVD 5CYUA 2ICIA 3C46A 2JA8B 5FKAC 1ESRA 2ENBA 1TWCB 2F0UA 1DZ1A 1RTOA 1JE4A 4HCEA 4L8JA 1K83B 2FHTA 1HTLD 1FGBD 3VYRA 4UDUC 3Q22A 1G2TA 2KVMA 1CK1A 1JWSD 2K6AA 1EFID 1CT1D 2OEOA 1EY8A 3SHLA 2DN8A 4PNYA 1KNAA 1O7YA 4HMJA 5C0XH 1ENCA 1FYCA 1KAAA 3H94A 1SNQA 3RD4A 1A15A 3JAML 1KTKA 2WIIB 1CA6A 2FFKB 3DWQA 4A93B 1KDBA 4WORA 4IUTA 2SDFA 1EY9A 1EOTA 1PTOF 2NN6G 4ZK9B 3OSOA 3P20A 3PO2B 1HUMA 5M5WB 3D31A 4HTHA 1VMCA 1VCIA 4DXFA 2F0GA 2BOSA 4A3DB 4IFDI 2WP8J 4I65A 2CVRA 1Q8IA 1PTOB 3GTGB 2B2TA 1I4HA 3EFXD 3FVQA 2ICEC 3AB9A 3PUXA 4QB4A 3GTJB 1STBA 2JA7B 3W3AA 2G9HD 3VYUA 1Z7TA 1SFOB 3UI2A 1A2TA 4ULLA 2DY8A 3F2UA 4HR7B 3HOYB 1Q90A 2B2WC 2AWNA 3D8GA 4ZUJA 1G91A 2HUGA 1PFNA 3I72A 1TS4A 1LTBD 3NHHA 2YU9B 3J81E 4XQQA 1IL8A 1GUNA 3S2HB 2E76C 5HGTA 4KN7C 3NXWA 2CW0C 1UAPA 1XXGA 1CZWA 2JYOA 3LWUA 4X3KA 1K8MA 1TY2A 4X3SA 3PMFA 1SNDA 4XYOA 3LNNA 5K5PA 2C5CA 1MGSA 1TR5A 1EQVA 4KTAA 1MD2D 4RWSC 4C1NI 2JA6B 4CBVA 1ILQA 3QJYA 1FNUA 2RSNA 2K28A 1Q12A 2AQ3B 3EROA 4M1UB 3C1EA 3RLFA 1UUPA 2AQ1B 4KKSA 1J9OA 3GV3A 4L6TB 5C0XG 1TS5A 2XNAC 3NUCA 3D6CA 3TP8A 2E74C 2IX0A 3ERQA 4YIJA 2PZWA 3DWPA 5CV4A 4C1NK 1R9TB 1TVXA 2B39A 2L11A 1DJRD 1BUVT 2L0CA 4ZRZA 1YNJC 3R2TA 2PO4A 4C56C 1BOSA 3A54A 3P7JA 2EOTA 2M9VA 1SSOA 1HRJA 2R3ZA 3C2PA 1KDAA 3LX0A 4RCOA 2IL8A 4XT1B 2B63B 3DEOA 2EXZA 3K57A 2D5DA 2DY7A 2V4DA 4RFBA 1I6VC 1O7LA 1BQQT 3DMUA 3MFYA 1KABA 4K5VA 1JORA 3URYA 5CC4A 3T13A 2LFNA 3TBIB 2WINB 1SJED 1XYIA 1HTPA 4BS9A 4NKLA 5DNFA 2L5TA 3I90A 4KY7A 4G7HC 2A69D 3DM1A 1S5BD 2QCPX 3NTHA 1OXUA 4ABNA 2KCCA 1R4QB 4OO1G 5LHY1 5KNCA 2F0DA 4DK0A 4OL7A 2SOBA 4L63B 3BVZA 3D4RA 1S5FD 2D2CC 2FJ2A 3L9AX 4IUVA 3I8ZA 5EGTA 4Y7NB 2D9UA 1D1IA 2HCIA 2RDGA 2R7ZB 3K6OA 2SEBD 1SE2A 1KLUD 2XRSD 4BA1I 5ELCA 1V1OA 1SMYC 3TN2A 2R93B 1EY0A 1WD1A 1LT5D 2E2HB 4LK1C 2KCNA 1SXTA 2BE5D 2A74C 1IYUA 1I4XA 1O80A 1WTVA 1B9NA 1Q1BA 3MVVA 4HN7A 3SDZA 4K6DA 1EYDA 3C1FA 3AU7A 2QKIC 4IUUA 2Q8IB 3TP5A 2KJXA 1OO9B 3V96A 1EY4A 4XQNA 3M85A 4EVOA 3M3YB 2X69A 4DAYA 3FKIB 4FXDA 3K59A 3MHBA 1Y1VB 3BS1A 1FNVA 2NVXB 3I73A 1CTMA 4KK7A 5EPKA 2K32A 2KECA 1WTPA 3SEBA 3PV0A 1TWGB 1U4PA 5M3MB 2I46A 5KNBA 3K5OA 2KHSA 4RKLA 3GP7A 2RVLA 3NBHA 1H9JA 4O1NA 1ENAA 5EKLA 1HA5A 4B9XA 2VB2X 2LY7A 2D62A 3OMCA 2GA4B 2I07B 4M8AA 5IODA 2CHBD 1KDCA 4FXKC 5JPMC 4U673 1SYDA 1OXVA 3PUWA 2XVSA 1DYQA 3HOWB 1I4RA 1CQVA 4J1MA 3EVQA 1DOKA 5CV9A 4FXGC 3GTPB 2NUCA 3SK6A 3A7AB 3IFTA 3NTIA 4ZKCB 5C3WA 5BN4A 4FP5D 1K8OA 1SYCA 3QOLA 2B8GA 2AWOA 2NTTA 1DOMA 3GQBA 1CHQD 1QG7A 1DM0B 1F77A 4IZ8A 2PPBC 2KQ3A 4KJOA 1I50B 1BCPB 2F0WA 4ZYSA 1IW7C 3HZXA 4N9TA 1AN8A 5C3XA 1QILA 4PMBA 2N55A 1HPCA 2E2IB 4KY6A 3E0JA 2CW0D 4RA8A 3VR5A 5FO8B 5KRUA 2RSOA 2JSOA 4Z9CB 2E2JB 2B2YA 1EY7A 3ONAB 4NMZA 2DNCA 1G291 1VF7A 3D4DA 5COYA 5JJZA 3R8BA 1SNCA 3A8KE 1TQOA 3LWEA 3PUVA 4H7BA 4K5WA 3DEPA 3OWEB 5I2XA 1CM9A 3V05A 2FINB 2HCCA 2QF7A 2CQAA 5I2YA 1XX8A 4BY1B 2KA7A 2ZXRA 2VUMB 2AQ2B 3QOJA 2XSCA 4F88A 1PZJD 4DGZA 1LV9A 1CZGA 1H9SA 2SNSA 3BYYB 1D5XC 3OW7A 4XDXA 3SK8A 2AUKA 3M7NA 1S5DD 4PMWA 2K5QA 1ML0D 5JEAJ 3L7ZC 1BXTA 2FMCA 4DAPA 4G57A 2F03A 1X32A 4ME5A 3SK4A 4EGVA 1TS3A 2PCFB 5C5MA 2RA4A 1A3UA 2F4IA 2K5DA 4CHTB 3BZDB 5IGFA 4QUFA 1AFPA 2MUYA 3VA5A 1J8IA 3Q23A 1A6XA 2K03A 3KBXA 5C4JB 1SNPA 1HFNA 2EZVA 3HEJA 5FK9C 1UNSA 3I3CA 1PTOH 2G9DA 1ILPA 5ELEA 1Q3LA 2A68C 2O2LD 1PZID 5A35A 4C3IB 2BDOA 3I91A 1LTTD 3J7AV 1QNUA 3IFDA 1BR9A 2F0EA 5T1IA 4H0LC 3OMGA 5KYIA 5EPJA 3H0GB 3S15B 2F0KA 2HQEA 2Z4IA 4DU9A 5M3FB 1TWFB 3TP7A 3CKIB 1CFMA 2M00A 1F2ZA 5ELBA 4ZLTF 1ZXTA 1BDOA 5IGGA 3VA7A 4E6IA 4A3GB 1GUTA 5C4XB 5M5YB 3S9WA 5DM63 2XRQD 2OXPA 1QJOA 2K04A 2PZTA 4ZKBB 2A6HC 1TWHB 4RGOS 2KUMA 3S14B 4HAEA 1WTWA 1HHVA 3NP8A 5EBCA 4QF4A 4EQNA 1JB3A 4DXGA 2EE1A 1JOKA 2F0FA 4IFDH 3TMEA 1EQTA 4QIWB 3Q0AA 1YNND 1RHPA 5J22A 1V43A 5A2QE 2K05A 3H91A 4RGNA 2WACA 1RKNA 4DNRB 5I6YA 3DUZA 3K7AB 2O4XA 2MHVA 1MSHA 1B53A 2EY5A 2K7VA 4F7XA 1SDFA 2A6ED 5J39A 1JC7A 2YYZA 4XIGS 2MPMA 1BCPF 3Q24A 1A3TA 2MGSA 1U4RA 2F0LA 5JOBA 1E2WA 3GTQB 1LO5D 3RMHA 3NK9A 1AW7A 4OO1I 1QE6A 3EA6A 2M2LA 2NN6H 4H44C 1V1PA 4A3IB 2RKSA 2A6HD 5IOCA 4A3MB 5C3EB 4KD4A 5C5LA 1SNMA 5KEEA 3RZOB 5D65A 2IX1A 1Q1EA 5C0XJ 1W6KA 3S17B 2Q8TA 3CQZB 3CHBD 1CQFA 1GJXA 4MHEA 2NYZD 4CKCA 1I4PA 3I4NB 1WVLA 3HG9A 4J6HA 1PRTB 4KKTA 2X6GA 1PFBA 3MAQA 5CV6A 3S1QB 1EU4A 2NZ1D 1I6HB 1EEID 2RBMA 3K5NA 1IKLA 2PYKA 5AFWA 4C3JG 2EJGC 3H3VC 3QO2A 4ILWA 2F0OA 4KV6A 2H1EA 2JP1A 2K01A 5FO9B 5C44B 4K2LA 1RODA 2WB1B 4BA2I 4R8NA 1EIHA 1JOQA 1WTQA 1GXDC 3MXNA 3NSWA 2LKVA 1NR2A 1OXSC 2F0NA 3A8JE 5JEAH 3E5SA 3PIO3 4C3HG 4N9PA 1JR0D 1E0BA 2NB0A 1MI2A 1H9RA 4XXEA 2F3VA 3QIAA 5KYLA 1H9SB 1W6JA 1JICA 5DEHA 2JEBI 1STNA 1QOHA 2BE5C 4ID6A 1TT2A 1EL0A 3DWAA 2F3WA 4K5XA 3HOXB 1CI3M 4TQUS 1X3PA 1NAPA 3MXUA 1STHA 2QDBA 2B2VC 1D2BA 4KY5A 4IUNA 1RJTA 4IUPA 1A3VA 4O42A 1ZYRD 4A3KB 5CORA 1PLFA 4DAVA 4UAIA 5EKKA 4ZQ3A 4LMQD 4ZUIA 1SEBD 5KIXA 2JEAI 3J7AF 5C4ZA 1B1ZA 2EPBA 1PYWD 1S5CD 1ENFA 1D6EC 3HKZB 1R4PB 1WTOA 2MP1A 4KHVA 4KD3A 2EDGA 3NQIA 3M4YA 3NQTA 2BA0A 4QCLA 1TKWB 2A69C 5CGKA 1WD0A 1DCZA 3OIPA 1M4VA 4CJ2C 1X3QA 3IAYA 3FPUB 2VB3X 5C4HA 5CV8A 4IFDG 1EIGA 1CA5A 1V1PB 4G7ZC 1FR3A 4FNFA 2JE6I 3PO3B 5IGEA 4K6LA 1SYGA 4WJWA 1C48A 5KNDA 2B2YC 4B08A 1T5EA 4R9WA 4OO1H 3GTMB 5G3LD 4DK1A 5D3DA 1S5ED 2NVYB 4RHSA 2BCOA 1RDPD 1EYCA 3SK5A 1VF5C 3HGBA 1DXMA 1ZYRC 3KLRA 2A68D 3K58A 4C3JB 1V8QA 2BA1A 3E6ZX 1JCKB 3G7LA 3KF8A 3ND9A 5D14A 4IFDJ 5A2QL 4QMGA 1ET6A 2ZXOA 3GTKB 3TZDA 3AMUA 2KEDA 4H13C 2ZXPA 1ZEQX 1A2UA 1WTRA 3GV6A 2F0VA 1EY5A 5E4XA 3FPPA 2F0PA 1YNJD 3EQLC 2F0MA 1SE3A 1EZ6A 4DFAA 1O7ZA 4BWGB 3S1RB 5TSSA 1SJHD 2Y0SB 1Y1WB 2WAQB 2EJMA 5JVH3 3A7LA 1QNKA 3I70A 1PRTF 2JXMB 2DNEA 1T5XD 5NUCA 4J8QA 2PQEA 1SYFA 1QCBD 2R6GA 4S3SA 2X6LA 1LT4D 2E2DC 2NBFA 2PMZB 3R3OA 3MXGA 2L12A 3Q6SA 5LL6X 3D3RA 5ELDA 5D3IB 4R8IA 1ET9A 2LMCB 5T1GA 2TSSA 4BY7B 4ODGA 3BDLA 3J80E 2WKCA 5CR3A 3R2IA 2EYLA 4PV1C 4XT3B 3A55A 3FMCA 4LJZC 5EKIA 1HFGA 1Z6HA 3HOUB 1F9RA 1ESFA 3NWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PTO C;  1LT5 D;  1EU3 A;  1PZJ D;  3BVM A;  2Z8L A;  4RHR A;  3BYY B;  4RGM A;  3R2T A;  5ELF A;  4C56 C;  1D5X C;  1ET6 A;  5I4D A;  1SXT A;  1GOZ A;  3TSS A;  5ELD A;  1HTL D;  1LLR D;  2QIL A;  2XRQ D;  3CHB D;  1FGB D;  1SE4 A;  1LT6 D;  1I4X A;  1S5D D;  1HQR D;  1PZK D;  1LTB D;  1TS4 A;  2XN9 C;  4UDU C;  4RCO A;  1RF2 D;  1SBB B;  1TY0 A;  1I4P A;  1CK1 A;  1JWS D;  1PRT B;  1BXT A;  4RGO S;  1EFI D;  1CT1 D;  1B44 D;  2NTT A;  1BCP C;  4RFB A;  4TSS A;  3KLS X;  1BCP D;  1SEB D;  1CHQ D;  1SE3 A;  3W2D A;  1KLG D;  1F77 A;  1B1Z A;  1EU4 A;  1I4G A;  1PYW D;  1ENF A;  1S5C D;  1XXG A;  4BWG B;  1D6E C;  3BVG A;  2NTS A;  5TSS A;  4DXG A;  3URY A;  1TS3 A;  1LTS D;  1SJH D;  1SJE D;  1BCP B;  1EEI D;  4ZYS A;  1JWU D;  1TY2 A;  3O13 A;  1LTR D;  1AN8 A;  1KTK A;  1QIL A;  1FNV A;  1PRT F;  2WV6 D;  3BZD B;  2QEJ C;  4OHJ A;  1FD7 D;  3MFG A;  1T5X D;  1S5B D;  4RGN A;  1MD2 D;  1PRT C;  1EEF D;  1M4V A;  1PRT D;  3SEB A;  3DWQ A;  1LTI D;  5FK9 C;  5D3I B;  1D5M C;  1FNU A;  4Z9C B;  1G8Z D;  1UNS A;  1JWM D;  2IPK D;  1RD9 D;  1PTO H;  2AQ3 B;  1V1P B;  3BYT B;  1LT4 D;  2RDH A;  2J4X A;  3R8B A;  4K6L A;  5ELE A;  1LTG D;  1UUP A;  4L63 B;  1JR0 D;  3BVZ A;  1PTO F;  2O2L D;  1PZI D;  2AQ1 B;  1ET9 A;  1S5F D;  1BCP F;  1LT3 D;  3GP7 A;  4L6T B;  2TSS A;  1HXY D;  4O1N A;  1LTT D;  1TS5 A;  1D5Z C;  2XNA C;  3MC0 B;  1HA5 A;  2IJ0 A;  1S5E D;  5D3D A;  4RHS A;  1I4Q A;  3OWE B;  2RDG A;  4DXF A;  1RDP D;  1LO5 D;  1EWC A;  3V05 A;  3R2I A;  1L0X B;  1AW7 A;  1KLU D;  1SE2 A;  2CHB D;  2SEB D;  2XRS D;  1L0Y B;  2R61 A;  1CHP D;  1PTO B;  1JQY D;  3EA6 A;  1I4H A;  1XTC D;  3EFX D;  1RCV D;  5ELC A;  4RGT A;  3DWP A;  2ICI A;  4RH6 A;  1LTA D;  1V1P A;  2AQ2 B;  1V1O A;  1TS2 A;  2G9H D;  1STE A;  1DJR D;  5ELB A;  1DYQ A;  3DWA A;  1ESF A;  5FKA C;  1FNW A;  1JCK B;  1I4R A;  1CQV A;  1PTO D; 
#chains in the Genus database with same CATH topology
 1VDZ A;  1QVG A;  2EYF A;  1TII D;  4HED A;  4A76 A;  1S4Z A;  3EIV A;  5JVG 3;  1KD1 C;  1DOL A;  5E3F A;  4JI3 L;  5E4W C;  1LLR D;  4RAU C;  2Z6K A;  1ONL A;  4FF3 A;  1AE3 A;  1HQR D;  1PZK D;  2B2W A;  2RDF A;  3SVM A;  2R93 G;  2UUB Q;  2WKD A;  1TY0 A;  1STG A;  3CCR A;  4FF1 A;  1BNZ A;  3QWN A;  4YCW A;  3MA2 B;  2DJF C;  1BCP C;  4KJN A;  4NXM L;  3E0E A;  1Y8P B;  2NVT B;  3CPW A;  4TKO B;  3T56 B;  4KMU C;  1KLG D;  4GLA C;  1L1O A;  4DV7 Q;  4IOA A;  4YY3 L;  3HOW G;  3HP3 A;  3PQI A;  3K81 C;  3S2D B;  2EY2 A;  3PO2 G;  4CKB A;  1JWU D;  4Q0F A;  4CGY B;  2BDN A;  1ASY A;  3O13 A;  5FLX c;  1VQO A;  1YNN C;  1QUQ A;  3J80 i;  3F2B A;  2JK8 A;  1YIT A;  4LF5 Q;  4KHZ A;  1KNE A;  2UXB Q;  2L15 A;  3CMA A;  3EJI A;  3S16 B;  1N33 Q;  1F9S A;  5DM7 3;  2HDL A;  1EY6 A;  3I4N G;  4P72 A;  1PA6 A;  4LAA A;  1PRT D;  4DUZ L;  2WAQ E;  5F2D A;  1U4M A;  4PZ7 A;  4JI5 L;  3I4M B;  3G6J B;  1G8Z D;  1X55 A;  2N88 A;  3SR1 A;  3S24 A;  3T4A C;  2ZT9 C;  1Q8K A;  4A3F G;  1GHJ A;  2J4X A;  5FLM G;  3SE0 A;  3RZD B;  1B7Y B;  3OOC A;  1K0R A;  1GUO A;  1PH5 A;  4DN4 M;  3K7U C;  2UXD L;  1S40 A;  3HS0 C;  1HUN A;  3SXH A;  3TEH B;  4DV3 L;  2Z4H A;  4KHP L;  5FLX L;  2PZU A;  4R4T A;  4JW0 A;  4JI4 Q;  1Q86 C;  4JOI C;  3NWS A;  2NVY H;  3T51 B;  4R4I A;  5C6A A;  5CMD A;  5M3M G;  4YWL A;  4GZY C;  3M3Y H;  1VQ6 A;  5JPN C;  1XTC D;  1VQE A;  4YY3 Q;  2UU9 Q;  3MXP A;  3K0Y A;  3PO3 H;  4X3T A;  4ZAI A;  4DV1 Q;  4MIU A;  1PTO C;  1I94 Q;  2Z8L A;  2F0J A;  2Z6K C;  5FOB B;  4Y52 H;  4C3H B;  5GQO A;  4DA2 A;  2KHI A;  2K1B A;  5I4D A;  1DON A;  1GOZ A;  1QWY A;  5EJW A;  3BDC A;  4XTC S;  3MZ5 A;  2OF1 A;  1A62 A;  4DNT B;  2PW5 A;  4DF7 A;  1B70 B;  1G6Z A;  2QGQ A;  1SMX A;  4EQP A;  1I3Q H;  3OWF A;  3S1M B;  4R4C A;  5M9O A;  1HNW Q;  1XPU A;  2NN6 I;  2GN5 A;  1BF4 A;  2JA5 B;  3TP6 A;  4V0B A;  3UE0 A;  4HSP A;  3J81 L;  4B3S L;  4TSS A;  3D6W A;  1MBY A;  4G4K A;  4RCN A;  2VXW A;  4X3U A;  4V19 0;  3GTL B;  2L1B A;  5I9O A;  1PMR A;  2XIW A;  2MO0 A;  3VYS A;  4POF A;  4BBS B;  5EPL A;  2NTS A;  4DV3 Q;  4JC0 A;  3CCJ A;  3QB3 A;  1M8A A;  2ZTC A;  4FVM A;  3CCS A;  3A5Z B;  4JI2 L;  3KJO A;  4FYD A;  2MJ8 A;  1U4L A;  2O5J C;  3BZK A;  1WJJ A;  2CFM A;  2EY6 A;  4O2D A;  4LW1 A;  1II3 A;  5BN5 A;  4FF4 A;  2HD3 A;  4X66 L;  4OHJ A;  1FD7 D;  2EJF C;  5KGU A;  4IO9 A;  4QUC A;  4OGQ C;  2I5H A;  4CDE C;  4C3I G;  1NCV A;  1FJG L;  2R93 H;  1IYJ B;  4JI0 Q;  2Z1C A;  4HCS A;  5IT9 L;  1ZKO A;  3D0F A;  1C4Q A;  2K5W A;  3PUZ A;  2JA5 H;  2LS0 1;  2SNM A;  3ZYY X;  1QB5 D;  4IAL A;  3K5M A;  1WFQ A;  1Q82 C;  1K8A C;  3HFZ B;  2K33 A;  3JAM i;  1SMY D;  1I5F A;  1IYV A;  3S16 H;  3M7G A;  3BJU A;  4KKU A;  2WB1 E;  5BR8 Q;  2K5N A;  3OIQ A;  2E2H H;  3N52 A;  4LF8 L;  1B3Q A;  1VMP A;  2L4N A;  1NUC A;  2B63 G;  1I6H H;  1PFM A;  4AQY Q;  2A8V A;  1B2T A;  3RNU A;  2K52 A;  2B2U C;  4DR2 L;  4RGT A;  1WCM B;  1GM5 A;  3PO2 H;  1OXT A;  1VQA A;  3PIP 3;  5JJL A;  1EYA A;  3BVM A;  1PXU A;  3PF5 A;  4HJ5 A;  2J0T D;  1PH4 A;  4GS3 A;  2HDM A;  5IT9 E;  4A3F B;  2KEN A;  4A93 H;  4K8J A;  1WYD A;  2F0T A;  1PHJ A;  1X54 A;  5I6W A;  4F8M A;  5JAV A;  4YCV A;  3G6E A;  3L3O C;  1U9R A;  4A3F H;  1UE6 A;  3WOE A;  1XWE A;  1AZP A;  2C35 B;  2EYJ A;  5LMU Q;  3CRL C;  1Q81 C;  4IUQ A;  1D1K A;  3CCQ A;  2BH8 A;  3GD7 A;  5GAH C;  1LTS D;  4LF8 Q;  1SYB A;  1SN8 A;  3SGI A;  1BBX C;  4LF7 L;  1XMO L;  2A73 B;  2RCN A;  1G2S A;  2J7Z A;  3CU7 A;  1PDQ A;  1C8C A;  3X3M A;  2F0I A;  4A3B B;  2WV6 D;  3A0J A;  2QEJ C;  5CV7 A;  1XMQ Q;  2FXQ A;  1OTC A;  4A3K H;  2HT1 A;  2NWG A;  1SNO A;  1EUJ A;  3PUY A;  1LTI D;  3AFP A;  1RIP A;  1TU2 B;  1D5M C;  2JA8 G;  3K7A H;  2K14 A;  1VS0 A;  5BN3 A;  1PH7 A;  4NXM Q;  4A93 G;  1LTG D;  1X9N A;  5AJ3 Q;  3NBI A;  1UE5 A;  5K36 G;  4G7O C;  3MC0 B;  2H4O A;  5IP7 H;  3TZU A;  4WRD A;  1UEA B;  4K14 A;  2Q2H A;  2OTL A;  1L0X B;  4ALP A;  3ZJY C;  4YWM A;  1I3Q B;  5JEA G;  2R61 A;  4XQJ A;  1IBK L;  1JQY D;  3NTK A;  4A3J B;  1SYE A;  4OIJ A;  3KBG A;  5EBD A;  2XTI A;  4RH6 A;  1N33 L;  1LTA D;  1Y8O B;  3PIP A;  1AP0 A;  1JE5 A;  3VR3 A;  2CCZ A;  4LF9 Q;  2F1M A;  3MTS A;  5IGC A;  5ISR A;  5JJI A;  4I7Z C;  3NEM A;  5EAY A;  1JJC B;  3A8I E;  5ELF A;  5L37 A;  5FLX E;  2WFW A;  3UDG A;  3HRZ C;  4U68 A;  3TSS A;  3VR2 A;  4BY7 G;  2L55 A;  2EYO A;  1LT6 D;  4NP5 A;  2F0Q A;  3MXN B;  2XN9 C;  1MJC A;  1VQK A;  2E75 C;  1RF2 D;  1BVS A;  1J5E L;  4KI0 A;  5J1Z A;  4CKE A;  2B2T C;  2TMP A;  3D4W A;  1B44 D;  4JPB W;  1N36 Q;  1XNQ L;  3KLS X;  4TRD A;  3GTJ H;  4HIM A;  2L9H A;  1K0S A;  3R93 A;  1L1O B;  5HUR A;  1T9H A;  3S14 H;  4QY7 A;  1I4G A;  3BVG A;  1VQM A;  4A3B G;  3S15 H;  1B50 A;  4ME3 A;  4OEL B;  3NPP A;  5EQ0 A;  1EQQ A;  1EWI A;  1STA A;  3X3N A;  1RTN A;  2HIX A;  2ATW A;  5IIF A;  3JAM E;  1IBK Q;  1TWH H;  2IT1 A;  2MQH A;  2AUJ D;  3KF8 B;  4DAM A;  4OX9 Q;  4Q5V A;  2EYM A;  4NXN L;  1YHA A;  2OT2 A;  3PCO B;  2NVQ B;  3H6M A;  4OWX B;  4MN3 A;  2EYH A;  3P1H A;  2JA7 H;  3QG1 A;  4GN3 B;  1XPR A;  4FF2 A;  1AEX A;  3HOZ B;  3NE5 B;  3KDF B;  3BG3 A;  4JG2 A;  2YTX A;  3TDQ A;  3MWY W;  4FDB A;  1X3E A;  2IPK D;  4A3C H;  1PH1 A;  1P16 A;  3BYT B;  3BZC A;  4K8I A;  4B3S Q;  3T53 B;  1ICW A;  2VS1 A;  3HOY G;  2KEE A;  5GRO A;  5CBE E;  1HCZ A;  1A8V A;  3VYT A;  2LXK A;  4LF6 L;  4CJ0 B;  2B8F A;  4DV6 L;  3I4L A;  3H3V I;  1N36 L;  1F2L A;  1I4Q A;  3T16 A;  1F9Q A;  3DHQ A;  1OXX K;  3RUZ A;  4BBR G;  1NY4 A;  4EQO A;  3CCE A;  1L0Y B;  1HH2 P;  3FDT A;  4DV4 L;  1H9M A;  2A6E C;  1Y8N B;  3WDN A;  2VL6 A;  1GUW A;  1NSN S;  2RQX A;  3A74 A;  4DR5 L;  1TS2 A;  1UEB A;  4TVA B;  2R92 B;  2B2V A;  1VQ4 A;  4PZ6 A;  3DXJ C;  1TXY A;  4RHR A;  4RGM A;  3GTM H;  3HOZ H;  2VNU D;  1F9P A;  5G3L F;  3J80 L;  3C3L A;  4B9W A;  4C2M B;  2ALY B;  3J7Y W;  4GOP B;  2QIL A;  1SE4 A;  4K2K A;  2F52 A;  3HKZ G;  1SBB B;  4KN4 C;  3K5L A;  3KK7 A;  3H3V H;  3P75 A;  3CW2 C;  1GUG A;  1JOO A;  1BCP D;  1Y69 U;  1NR4 A;  4BY1 H;  5CV5 A;  1E2Z A;  4JI6 L;  4OIK A;  5ELO A;  3GTO B;  5C3E H;  2IWH A;  5I9P A;  2Q2U A;  5DAU A;  4F87 A;  3KOJ A;  4A3J G;  2ZM6 Q;  1EIF A;  4P71 A;  2C9O A;  4PQX A;  4DUY L;  3Q8D A;  1EZ8 A;  1C9O A;  1QVC A;  1V1Q A;  3IRB A;  1SAP A;  4QL5 A;  1IHZ A;  3S1M H;  3NEN A;  3BDO A;  4P2C B;  5HGQ A;  1PRT C;  1EEF D;  1H9K A;  3U9S A;  3FEW X;  1O7I A;  3RN2 A;  1STY A;  3KLS A;  3HOV B;  1B4O A;  1JWM D;  1RD9 D;  3ER0 A;  3N6R A;  5IGB A;  2F0S A;  4POG A;  3W1B A;  5CBA E;  4HID A;  1HQM C;  3CME A;  4UHV A;  4IN3 A;  1IKM A;  1HXY D;  4BBR B;  2E8G A;  3U9O A;  1GVP A;  4L5S A;  2B2U A;  3H09 A;  5M5X B;  1X3G A;  1GUS A;  2KOL A;  2EVB A;  1EWC A;  3WOF A;  1Z47 A;  4A3E B;  4L5R C;  4JI6 Q;  1CHP D;  3VR4 A;  3LGJ A;  4DV2 Q;  5K36 H;  4AYB G;  2I5L X;  4IQZ A;  4PMC A;  2IX3 A;  1HA6 A;  4JI8 L;  1STE A;  1NNX A;  3IKJ A;  1FNW A;  3MEF A;  1PTO D;  4FO2 A;  3M9B A;  1EU3 A;  2ZM6 L;  3GO5 A;  5E1F A;  4DUY Q;  3KFU A;  3I55 A;  1DD2 A;  1B9M A;  4BY1 G;  1TWA B;  4KHP Q;  1F2Y A;  2IW3 A;  3MEH A;  4GN5 A;  3KUP A;  5AJ3 L;  1IW7 D;  1VQC A;  1VQN A;  2JA9 A;  4B3M Q;  1YIJ A;  1F2M A;  2EYP A;  2WAQ G;  5IP7 G;  4OWW B;  5FO7 B;  3S1N B;  4HSV A;  2UU9 L;  4NW2 A;  3NBH B;  1B3A A;  3W2D A;  1WCM H;  3OHX C;  4NDX A;  2OTJ A;  1SFO H;  1HJP A;  3IL8 A;  1LAC A;  3M4O B;  1NMG A;  4HMI A;  3V2T A;  2I5M X;  4CJ1 B;  1JT8 A;  2K4K A;  1GHK A;  5IGD A;  1L2F A;  1N9W A;  4A3D G;  2ID0 A;  1LTR D;  5M5X H;  5ELN A;  3OPO A;  4IUR A;  4WFN 3;  3GTP H;  4HJ7 A;  3S2D H;  2A5H A;  1E2V A;  1HZB A;  1LAB A;  5LL6 S;  4JK1 C;  3ITP A;  4DV2 L;  4XYQ A;  1HNW L;  3MFG A;  2AKW B;  3HOW H;  3CRK C;  1EWH A;  1BO0 A;  4X65 Q;  4WJ4 A;  2XWB B;  4JBW A;  4HJ8 A;  4RKB A;  1K8G A;  3CPF A;  2XWJ B;  3A56 A;  1J5E Q;  2O5I C;  1AZQ A;  3ND8 A;  3FRP B;  2CWA A;  2RDH A;  5DLQ E;  3CF5 A;  5C0X I;  2PW7 A;  2OQK A;  1WTX A;  2ES2 A;  1O78 A;  4DR6 L;  2Q8R E;  2HHH Q;  1LT3 D;  2PNR C;  1RL2 A;  2EY1 A;  3J7Z C;  4JI2 Q;  4A3E G;  4B3M L;  1D5Z C;  1VQP A;  5C3E G;  2F0H A;  2IJ0 A;  4IPC A;  3VR6 A;  4AYB B;  3GTO H;  1MSG A;  3EN2 A;  5IP9 G;  2FMM A;  1RCV D;  1MIU A;  5CYU A;  5J3B A;  2ICI A;  2OQ0 A;  3C46 A;  1C7Y A;  2JA8 B;  5FKA C;  1ESR A;  2ENB A;  1TWC B;  2F0U A;  1DZ1 A;  4L5Q A;  1RTO A;  1JE4 A;  4HCE A;  1N32 L;  3VDY A;  4L8J A;  1K83 B;  2FHT A;  1HTL D;  5BR8 L;  3CAM A;  1FGB D;  3VYR A;  4UDU C;  3Q22 A;  2UUC Q;  1G2T A;  2KVM A;  1CK1 A;  1JWS D;  3K8A A;  2K6A A;  2EXD A;  1EFI D;  3PIO A;  1CT1 D;  2OEO A;  1EY8 A;  4DR7 Q;  3SHL A;  2DN8 A;  4PNY A;  3UDF A;  1KNA A;  1O7Y A;  4HMJ A;  4DV4 Q;  1Y1W H;  1HR0 W;  5C0X H;  1ENC A;  2YTV A;  1FYC A;  1KAA A;  1PVO A;  3M4Q A;  4IOC A;  3KDF A;  3RLN A;  1MKH A;  3H94 A;  1SNQ A;  3RD4 A;  1A15 A;  2F3I A;  3UDX A;  1PFS A;  3JAM L;  1KTK A;  5IYC G;  1UE7 A;  2WII B;  4DK3 C;  1VQD A;  2CKZ B;  2QEX A;  3STB D;  1CA6 A;  2FFK B;  4P74 A;  2Y0S G;  3DWQ A;  4A93 B;  1KDB A;  1N32 Q;  4WOR A;  4IUT A;  2SDF A;  3S1Q H;  4GKK Q;  1EY9 A;  2Z0S A;  1EOT A;  1PTO F;  2NN6 G;  4ZK9 B;  3U4V A;  3OSO A;  3P20 A;  3PO2 B;  1HUM A;  4QGU A;  5M5W B;  1W2B A;  1NTG A;  3D31 A;  4HTH A;  1VMC A;  1VCI A;  1GKH A;  4DXF A;  2F0G A;  4NB3 A;  2BOS A;  3CXC A;  4A3D B;  4IFD I;  2WP8 J;  4I65 A;  2CVR A;  1Q8I A;  1PTO B;  4A75 A;  3GTG B;  2B2T A;  1I4H A;  3EFX D;  3FVQ A;  3HKS A;  2ICE C;  4EX5 A;  3AB9 A;  3PUX A;  1NBW A;  1X56 A;  4QB4 A;  3WWV A;  1HNZ Q;  2OWO A;  3GTJ B;  1STB A;  2JA7 B;  2R7F A;  2EQS A;  2G9H D;  3W3A A;  3VYU A;  3G4S A;  1I50 H;  4A3D H;  1Z7T A;  1CKN A;  4AH6 A;  1SFO B;  3UI2 A;  3F2U A;  1A2T A;  2DY8 A;  4ULL A;  1VQ8 A;  4HR7 B;  3HOY B;  1Q90 A;  5M3M H;  4CDC C;  2B2W C;  2AWN A;  3GTK H;  3D8G A;  3L2P A;  1KAW A;  4ZUJ A;  1G91 A;  2HUG A;  1PFN A;  3I72 A;  1TS4 A;  1LTB D;  1VQG A;  4BXX G;  4A3E H;  3NHH A;  2YU9 B;  1C0A A;  3J81 E;  4XQQ A;  1KRS A;  2MFI A;  1IL8 A;  1GUN A;  3S2H B;  1VQ7 A;  3T1Y Q;  2E76 C;  1MHW C;  4KN7 C;  5HGT A;  5IYD G;  4DR3 Q;  3NXW A;  2CW0 C;  4AIM A;  1UAP A;  3E3X A;  4YCU A;  1XXG A;  1CZW A;  3TQY A;  1PH8 A;  1M1K C;  4PZ8 A;  1GO3 E;  2JYO A;  3LWU A;  3U4Z A;  5M5W H;  3J81 j;  4X3K A;  4JI8 Q;  1K8M A;  1TY2 A;  4X3S A;  3PMF A;  1SND A;  4GNX C;  1XPO A;  1CSQ A;  4XYO A;  3LNN A;  5K5P A;  2C5C A;  1MGS A;  4GOP C;  1TR5 A;  1HNZ L;  1K9M C;  1EQV A;  3AQQ A;  4KTA A;  4DV0 L;  1MD2 D;  4RWS C;  4C1N I;  1DGS A;  2JA6 B;  3U58 A;  4CBV A;  1ILQ A;  4GNX A;  3QJY A;  2VW9 A;  1FNU A;  1NE3 A;  2RSN A;  2K28 A;  2EIF A;  1Q12 A;  2AQ3 B;  3ERO A;  4M1U B;  3C1E A;  3RLF A;  1TWC H;  1HZA A;  1UUP A;  4DR1 Q;  2AQ1 B;  2IHF A;  4L6T B;  1J9O A;  3GV3 A;  4KKS A;  2QA4 A;  5C0X G;  1KQS A;  1TS5 A;  3AYH B;  1K83 H;  1YZ6 A;  2XNA C;  3NUC A;  4MZ9 A;  3D6C A;  1QZH A;  3TP8 A;  4UP7 A;  2E74 C;  2IX0 A;  2R92 G;  3ERQ A;  1K28 A;  4YIJ A;  2PZW A;  4Y7N H;  1AE2 A;  3DWP A;  5CV4 A;  4C1N K;  1U0L A;  4C2M H;  1TVX A;  2B39 A;  4DPG A;  2L11 A;  1R9T B;  1DJR D;  1BUV T;  2DUD A;  2L0C A;  1Y1V G;  1YHQ A;  1A63 A;  4ZRZ A;  4HJA A;  1YNJ C;  1S3O A;  4IPG A;  4UP8 A;  3HOV H;  3KF6 B;  3R2T A;  2PO4 A;  4C56 C;  1BOS A;  3A54 A;  1EIY B;  2UXD Q;  3P7J A;  2QDL A;  4DV0 Q;  2EOT A;  2M9V A;  1K3B C;  1SSO A;  1X3F A;  3CD6 A;  5GAG C;  1HRJ A;  2R3Z A;  2Z9H A;  3C2P A;  1KDA A;  4LUO A;  3LX0 A;  4R1J A;  4RCO A;  2IL8 A;  5C44 H;  3PGZ A;  4XT1 B;  1H95 A;  2B63 B;  4JV5 Q;  3DEO A;  2EXZ A;  3K57 A;  4A3C G;  2D5D A;  2DY7 A;  3TS2 A;  2V4D A;  4RFB A;  4A3J H;  1I6V C;  4P73 A;  1O7L A;  1BQQ T;  4JI7 Q;  1VQL A;  3DMU A;  3MFY A;  1VQB A;  1KAB A;  1N8R C;  4K5V A;  1JOR A;  3URY A;  5CC4 A;  3T13 A;  2LFN A;  3TBI B;  1WI5 A;  2WIN B;  1SJE D;  3ULL A;  1XYI A;  1IXR A;  5IWA Q;  3OYY A;  1HTP A;  4BS9 A;  4NKL A;  5DNF A;  2L5T A;  3I90 A;  4KY7 A;  4DV5 Q;  4LF4 Q;  1EQR A;  4G7H C;  3H0G G;  2A69 D;  4WJ3 M;  3DM1 A;  1S5B D;  2QCP X;  4DKA C;  3F2C A;  1Q46 A;  3NTH A;  1OXU A;  4ABN A;  2KCC A;  2UUA Q;  1FL0 A;  1R4Q B;  4OO1 G;  5LHY 1;  5KNC A;  2F0D A;  5IYC H;  1WTH A;  3CC7 A;  4DK0 A;  1YJN A;  4OL7 A;  2SOB A;  4A3G G;  3PF4 A;  1HNX Q;  4L63 B;  3BVZ A;  3D4R A;  1S5F D;  2D2C C;  2FJ2 A;  4JV5 L;  4OON A;  1Y1V H;  3L9A X;  2VY3 A;  4IUV A;  2KBN A;  2LXJ A;  3I8Z A;  5EGT A;  4X66 Q;  2D9U A;  1D1I A;  2HCI A;  2RDG A;  4Y7N B;  2R7Z B;  3ICE A;  2KCM A;  2SEB D;  1SE2 A;  1KLU D;  2A1A A;  2XRS D;  3K6O A;  1PV4 A;  5IYD H;  4BA1 I;  5ELC A;  5IYB H;  5FJ8 G;  1V1O A;  1SMY C;  3TN2 A;  5IE8 A;  2R93 B;  1EY0 A;  5IWA L;  1WD1 A;  2PMZ E;  4APV A;  1LT5 D;  4LF4 L;  2E2H B;  1QZG A;  4LK1 C;  1YEZ A;  2KCN A;  1SXT A;  1PH2 A;  4QIW E;  2UXC L;  2VUM H;  2BE5 D;  2A74 C;  1EFW A;  4MNO A;  4UY8 C;  1G6P A;  1IYU A;  1I4X A;  3B6Y A;  1O80 A;  1WTV A;  1B9N A;  4QQB X;  2Q2I A;  1Q1B A;  3MVV A;  2YTY A;  2B3G A;  4AQY L;  4HN7 A;  3SDZ A;  4K6D A;  1EYD A;  1BBW A;  3C1F A;  3AU7 A;  2QKI C;  4IUU A;  2Q8I B;  3TP5 A;  2KJX A;  1OO9 B;  3V96 A;  4B3T Q;  1EY4 A;  4XQN A;  1L0W A;  1XNR Q;  3M85 A;  4EVO A;  3M3Y B;  2X69 A;  4DAY A;  3HOU H;  1WOC A;  3FKI B;  4FXD A;  3K59 A;  3MHB A;  3RLO A;  1Y1V B;  1HR0 L;  3BS1 A;  1FNV A;  3TS0 A;  2NVX B;  3I73 A;  3W1G A;  3CCM A;  1CTM A;  4KK7 A;  2PQA A;  5EPK A;  1LYL A;  1LM0 A;  1ASZ A;  4A3B H;  2K32 A;  2KEC A;  1WTP A;  3SEB A;  3J7A 5;  3PV0 A;  1TWG B;  5M5Y H;  1U4P A;  3CC2 A;  1IZ6 A;  3HKZ E;  5M3M B;  1GD7 A;  2I46 A;  1SLJ A;  4ZCK A;  5KNB A;  3K5O A;  2KHS A;  4RKL A;  2R7Z G;  3GP7 A;  3NBH A;  2RVL A;  1H9J A;  4O1N A;  1ENA A;  4LF7 Q;  5EKL A;  1HA5 A;  4OEM B;  4B9X A;  1TWF H;  2VB2 X;  2LY7 A;  4IJL A;  2D62 A;  3OMC A;  4R4O A;  2GA4 B;  2I07 B;  4M8A A;  5IOD A;  3M4P A;  2CHB D;  1KDC A;  2MO1 A;  4B3T L;  4JBK A;  4X65 L;  1PH9 A;  1XNR L;  4FXK C;  4MTN A;  4JOI A;  5JPM C;  4U67 3;  1SYD A;  5IY0 A;  2VZA A;  2P5Z X;  2NVT H;  1OXV A;  4LFC L;  3PUW A;  2XVS A;  1DYQ A;  3S1N H;  3HOW B;  1I4R A;  1CQV A;  1HR0 Q;  2K5H A;  4J1M A;  2B63 H;  3EVQ A;  4O0A A;  1DOK A;  5CV9 A;  4FXG C;  2I0Q A;  2HHH L;  2IY5 B;  3GTP B;  2NUC A;  3A5U A;  3SK6 A;  3A7A B;  4C3H H;  3IFT A;  3NTI A;  4A4I A;  4ZKC B;  4DR1 L;  5C3W A;  2F4V Q;  4L5T A;  5BN4 A;  2NVQ H;  3HOU G;  4FP5 D;  4KLK A;  2K50 A;  2A19 A;  1K8O A;  2Y0S E;  1VQJ A;  1SYC A;  3QOL A;  2B8G A;  2AWO A;  2NTT A;  1DOM A;  2KCT A;  1E22 A;  3GQB A;  1CHQ D;  1QG7 A;  3ULJ A;  1DM0 B;  1F77 A;  5C4J H;  4A3K G;  2H5X A;  4LF9 L;  4IZ8 A;  2VQE L;  2PPB C;  2KQ3 A;  4KJO A;  1I50 B;  4YWK A;  1PH3 A;  1BCP B;  2F0W A;  4ZYS A;  1IW7 C;  2PI2 E;  3HZX A;  4N9T A;  2JN4 A;  2RHS B;  2ASB A;  1AN8 A;  5C3X A;  4DR4 L;  1QIL A;  5IP9 H;  2JJQ A;  4PMB A;  2N55 A;  2RF4 A;  3I7F A;  2UUC L;  1HPC A;  2N3S A;  1W3S A;  2E2I B;  4KY6 A;  3I2Z A;  1HZC A;  2CW0 D;  3E0J A;  4DR2 Q;  1HZ9 A;  2ZJR A;  1R9T H;  3TRZ A;  3G48 A;  4RA8 A;  3VR5 A;  5FO8 B;  5KRU A;  2RSO A;  2JSO A;  4Z9C B;  1BBU A;  2E2J B;  2B2Y A;  1EY7 A;  3ONA B;  4NMZ A;  2DNC A;  1G29 1;  1VF7 A;  3D4D A;  5COY A;  5JJZ A;  3R8B A;  4A3M H;  1SNC A;  3A8K E;  1WCM G;  3E9H A;  1TQO A;  4YHH Q;  3LWE A;  1JJG A;  4IPH A;  3PUV A;  3ULP A;  3G71 A;  2PI2 A;  1ICF B;  4H7B A;  4K5W A;  3DEP A;  3PO3 G;  2GVA A;  4GNX B;  3I4M G;  5LMN Q;  3OWE B;  4OX9 L;  5I2X A;  1CM9 A;  3V05 A;  2FIN B;  4NXN Q;  2HCC A;  2QF7 A;  2CQA A;  4DV5 L;  3S1R H;  5I2Y A;  1E3P A;  2VQE Q;  1XX8 A;  4BY1 B;  2KA7 A;  2ZXR A;  4HIK A;  2VUM B;  1D7Q A;  2AQ2 B;  3FKI G;  5LMU L;  2JQO A;  3QOJ A;  2XSC A;  3KJP A;  4DR4 Q;  5M3F G;  4F88 A;  4BBS H;  1PZJ D;  4DGZ A;  1LV9 A;  1CZG A;  1H9S A;  2SNS A;  2CH4 W;  3BYY B;  2CWP A;  4JI1 Q;  1D5X C;  1IBM L;  3J81 c;  1XMO Q;  4GN4 B;  3OW7 A;  4XDX A;  3SK8 A;  1N34 Q;  2QW7 A;  2AUK A;  3M7N A;  1S5D D;  1XMQ L;  1HNX L;  1VQ9 A;  3OTO Q;  1YHB A;  4PMW A;  2K5Q A;  1ML0 D;  3GDE A;  5JEA J;  1M90 C;  3L7Z C;  1BXT A;  4PG3 A;  4JYA Q;  2FMC A;  4DAP A;  4G57 A;  1B8A A;  2F03 A;  4N8X 1;  1X32 A;  3KF6 A;  2GVB A;  4ME5 A;  3STB C;  1SRU A;  4B3R Q;  3SK4 A;  4EGV A;  4X6A H;  2OCE A;  1TS3 A;  4P75 A;  2PCF B;  5LMN L;  5C5M A;  1XJV A;  1CUK A;  3KYH C;  5HY6 A;  2RA4 A;  1A3U A;  1CSP A;  2F4I A;  2K5D A;  5C4X H;  2N49 A;  4CHT B;  3BZD B;  5IGF A;  4QUF A;  1AFP A;  2MUY A;  3VA5 A;  1J8I A;  4RMF A;  4A3I G;  3Q23 A;  1A6X A;  2K03 A;  2B29 A;  2UXC Q;  3QR8 A;  3KBX A;  5C4J B;  1SNP A;  2E2J H;  1CKM A;  1HFN A;  4JBJ A;  2EZV A;  4RG1 A;  3HEJ A;  5FK9 C;  1IBM Q;  1UNS A;  3RZD H;  4GKJ L;  4UP9 A;  3I3C A;  1PTO H;  2G9D A;  1ILP A;  1N34 L;  3H0G H;  5ELE A;  3BU2 A;  1Q3L A;  2A68 C;  3OTO L;  2O2L D;  1PZI D;  5A35 A;  4JI3 Q;  4BXX H;  4C3I B;  2BDO A;  3I91 A;  1LTT D;  3J7A V;  1QNU A;  3IFD A;  1BR9 A;  2F0E A;  5T1I A;  3T1H Q;  4H0L C;  3OMG A;  5KYI A;  5EPJ A;  2ZJQ A;  3H0G B;  3S15 B;  2F0K A;  2HQE A;  3JAM c;  2Z4I A;  4DU9 A;  5M3F B;  2N78 A;  1XNQ Q;  1KXL A;  1TWF B;  4LUZ A;  3TP7 A;  3CKI B;  3GTG H;  1CFM A;  2M00 A;  1F2Z A;  5ELB A;  4ZLT F;  4DV7 L;  1PYB A;  2WB1 G;  1D8L A;  4R4Q A;  1ZXT A;  1BDO A;  5IGG A;  1LUZ A;  1E7Z A;  3AEV A;  3VA7 A;  4E6I A;  1VQI A;  4A3G B;  2Q2T A;  1GUT A;  2IHE A;  5C4X B;  5M5Y B;  3HOY H;  3S9W A;  4LF5 L;  5DM6 3;  2XRQ D;  2UXB L;  2OXP A;  1QJO A;  2K04 A;  1QUQ B;  2PZT A;  4GLX A;  4ZKB B;  1CKO A;  1AH9 A;  3GTQ H;  2BH2 A;  4UPA A;  2A6H C;  1TWH B;  4RGO S;  1TWA H;  2KUM A;  1Q7Y C;  3S14 B;  1TWG H;  2D0O A;  1EOV A;  4HAE A;  1WTW A;  4JI5 Q;  4BBR H;  4J15 A;  1A0I A;  1HHV A;  3RZO H;  3NP8 A;  5EBC A;  4H02 A;  4QF4 A;  4EQN A;  3AFQ A;  1JB3 A;  4DXG A;  2EE1 A;  3T1H L;  1JOK A;  2F0F A;  2NVX H;  2V1C C;  4DK6 C;  4IFD H;  3TME A;  1EQT A;  4QIW B;  1K3R A;  4LF6 Q;  1IBL L;  4NPS A;  3Q0A A;  1YNN D;  1RHP A;  5J22 A;  1V43 A;  4JI4 L;  5A2Q E;  2K05 A;  3L0O A;  3H91 A;  4RGN A;  1FVI A;  4A3L G;  2WAC A;  1RKN A;  4DNR B;  5I6Y A;  3DUZ A;  3HOX G;  2F4V L;  3K7A B;  2O4X A;  2MHV A;  3F8T A;  1MSH A;  1B53 A;  4DR5 Q;  2EY5 A;  2K7V A;  4JI7 L;  2ZJP A;  3KLW A;  4F7X A;  3PSI A;  2VQF Q;  1SDF A;  2A6E D;  4DV1 L;  5J39 A;  3DLL A;  1JC7 A;  3K80 C;  1EYG A;  2YYZ A;  4XIG S;  2MNA A;  2MPM A;  1VQH A;  1SE8 A;  1BCP F;  1JMC A;  5FJ8 H;  5IYB G;  3Q24 A;  1A3T A;  1KC8 C;  4K0K L;  1Z9F A;  2MGS A;  1U4R A;  2F0L A;  5JOB A;  1PH6 A;  1E2W A;  3GTQ B;  1LO5 D;  3RMH A;  3NK9 A;  1AW7 A;  4OO1 I;  1QE6 A;  2CH4 A;  4LNQ A;  3CP0 A;  4N8F A;  3EA6 A;  2M2L A;  4JVZ A;  2UUA L;  4QJF A;  2NN6 H;  5GAE C;  4H44 C;  1V1P A;  1YBY A;  4A3I B;  2RKS A;  1J6Q A;  2A6H D;  1KHI A;  4C3I H;  5IOC A;  4A3M B;  5C3E B;  1IBL Q;  4KD4 A;  5C5L A;  1LTL A;  2AMC B;  1SNM A;  5KEE A;  3RZO B;  2PNH A;  5D65 A;  2IX1 A;  2R92 H;  2K75 A;  1Q1E A;  5C0X J;  3S2H H;  3CQZ H;  2JA6 H;  1W6K A;  3S17 B;  2Q8T A;  3CQZ B;  4LFA Q;  3CHB D;  1KRT A;  1CQF A;  3J80 c;  1YJW A;  1GJX A;  4IJH A;  4MHE A;  2NYZ D;  4AYB E;  1I4P A;  4CKC A;  3I4N B;  2JA8 H;  1WVL A;  3HG9 A;  2D0P A;  1PRT B;  4J6H A;  4KKT A;  2R7D A;  4CDF C;  4DNI A;  1SRO A;  2X6G A;  1FJG Q;  3TRE A;  4JI0 L;  3HOZ G;  3E9I A;  1PFB A;  4A3G H;  3MAQ A;  5CV6 A;  1JJ2 A;  3OW2 A;  2R7Z H;  5H1S E;  3S1Q B;  4LUV A;  1EU4 A;  3I4N H;  4K0K Q;  1NJI C;  2NZ1 D;  1I6H B;  1IL2 A;  1EEI D;  2RBM A;  3K5N A;  1IKL A;  2PYK A;  2YV5 A;  5AFW A;  1L1O C;  5M3F H;  2AHO B;  2EJG C;  4C3J G;  4HJ9 A;  3H3V C;  4BBS G;  3QO2 A;  1X6O A;  4ILW A;  3CCU A;  2F0O A;  4KV6 A;  2H1E A;  2JP1 A;  2K01 A;  5FO9 B;  5C44 B;  4K2L A;  1ROD A;  2WB1 B;  4BA2 I;  4R8N A;  1EIH A;  1JOQ A;  2KHJ A;  1WTQ A;  3H15 A;  1GXD C;  3CCL A;  3MXN A;  1VQ5 A;  3NSW A;  4DAY B;  5C4X G;  2LKV A;  2CQO A;  3I4O A;  4JYA L;  1NR2 A;  1OXS C;  2F0N A;  3A8J E;  5JEA H;  3E5S A;  3PIO 3;  4C3H G;  4N9P A;  3DM3 A;  1JB7 A;  1JR0 D;  4B3R L;  1E0B A;  3S17 H;  4X62 Q;  2NB0 A;  1MI2 A;  1H9R A;  4XXE A;  2F3V A;  3QIA A;  2PQA B;  1YJ9 A;  5KYL A;  2ZTD A;  1H9S B;  1W6J A;  1JIC A;  2RHQ B;  5DEH A;  2JEB I;  2JA5 G;  1STN A;  1QOH A;  2DJG C;  4I7A A;  2BE5 C;  4A3M G;  1XTD A;  4ID6 A;  3RR5 A;  3J81 i;  2JA6 G;  1TT2 A;  1E1O A;  2LSS A;  1EL0 A;  3DWA A;  2F3W A;  3HOX H;  4K5X A;  1QVF A;  2K5V A;  3HOX B;  1CI3 M;  1KIX A;  4TQU S;  1X3P A;  1NAP A;  1FGU A;  3MXU A;  4CDD C;  1STH A;  2QDB A;  2B2V C;  1D2B A;  3FKI H;  4KY5 A;  4IUN A;  3CC4 A;  4DUZ Q;  2JA7 G;  1RJT A;  3JC6 6;  4IUP A;  1A3V A;  4O42 A;  1ZYR D;  2G5D A;  2E5L Q;  3FP9 A;  4A3K B;  5COR A;  1PLF A;  4DAV A;  5E7N A;  4LFB L;  4UAI A;  5EKK A;  4ZQ3 A;  1SR3 A;  4LMQ D;  4ZUI A;  1SEB D;  3F1Z A;  5KIX A;  2VUM G;  2JEA I;  1VQF A;  3J7A F;  5C4Z A;  4LFC Q;  4X62 L;  2HIV A;  1KL9 A;  1B1Z A;  4OWT B;  2EPB A;  1K73 C;  1PYW D;  1S5C D;  1ENF A;  4X64 L;  1D6E C;  3HKZ B;  1E24 A;  4DR6 Q;  1R4P B;  3K0X A;  5GAD C;  1YI2 A;  3F2D A;  4KHV A;  2MP1 A;  1WTO A;  3NEL A;  4KD3 A;  2EDG A;  3NQI A;  5FLM H;  2E2I H;  1Y1W G;  3M4Y A;  3NQT A;  2BA0 A;  4QCL A;  1TKW B;  2A69 C;  1Y14 B;  1PYS B;  5CGK A;  1WD0 A;  1DCZ A;  3FHW A;  1M4V A;  3OIP A;  4CJ2 C;  4GOP A;  2N8N A;  1X3Q A;  3IAY A;  1I94 L;  3FPU B;  2VB3 X;  5C4H A;  5CV8 A;  3T1Y L;  4IFD G;  3I4M H;  1X65 A;  1EIG A;  1CA5 A;  1V1P B;  4G7Z C;  1FR3 A;  4FNF A;  2JE6 I;  3PO3 B;  5IGE A;  4K6L A;  3M4O H;  1SYG A;  4WJW A;  1C48 A;  5KND A;  2E5L L;  2B2Y C;  4B08 A;  1T5E A;  4R9W A;  4OO1 H;  3GTM B;  5G3L D;  4DK1 A;  5D3D A;  1S5E D;  4MTK A;  2NVY B;  4RHS A;  4LFB Q;  2ZTE A;  2BCO A;  3HOV G;  1RDP D;  1EYC A;  2RCF A;  4C3J H;  1UE1 A;  4OXP A;  3SK5 A;  4X64 Q;  1VF5 C;  4DR7 L;  3HGB A;  1DXM A;  1ZYR C;  3KLR A;  4IPD A;  2A68 D;  3CCV A;  3K58 A;  4A3L H;  5C44 G;  1V8Q A;  2BA1 A;  3E6Z X;  1JCK B;  3KF8 A;  3G7L A;  3ND9 A;  4C3J B;  2NZO A;  5D14 A;  4IFD J;  5A2Q L;  4QMG A;  4GLV B;  1ET6 A;  1NMF A;  2ZXO A;  4YHH L;  3GTK B;  4JCV E;  4A3I H;  2VQF L;  3TZD A;  3AMU A;  2KED A;  4EQ5 A;  5JJK A;  4H13 C;  2ZXP A;  1ZEQ X;  1A2U A;  1WTR A;  3GV6 A;  2F0V A;  1EY5 A;  5E4X A;  1S72 A;  2Z6B A;  2F0P A;  3FPP A;  1YNJ D;  3I56 A;  3EQL C;  4LWC A;  3UDI A;  2F0M A;  1SE3 A;  1EZ6 A;  3U50 C;  1YVC A;  4DFA A;  1O7Z A;  4BWG B;  3S1R B;  4JBM A;  1BKB A;  5TSS A;  5LMN W;  4GKK L;  1SJH D;  2Y0S B;  1E1T A;  4JI1 L;  1Y1W B;  2WAQ B;  2EJM A;  5JVH 3;  3A7L A;  1QNK A;  3GTL H;  3I70 A;  4DV6 Q;  5IT9 c;  1YNX A;  1PRT F;  3UE1 A;  1U5K A;  2JXM B;  2DNE A;  1T5X D;  5NUC A;  4LFA L;  4J8Q A;  1V9P A;  2PQE A;  1SYF A;  1QCB D;  2UUB L;  2R6G A;  4S3S A;  3RN5 A;  2X6L A;  1LT4 D;  2E2D C;  2NBF A;  2PMZ B;  3R3O A;  2NZH A;  3MXG A;  1UWV A;  2L12 A;  3Q6S A;  5LL6 X;  3D3R A;  2XGT A;  5D3I B;  5ELD A;  4R8I A;  1ET9 A;  2LMC B;  5T1G A;  4HIO A;  2TSS A;  4BY7 B;  4ODG A;  3BDL A;  3J80 E;  2WKC A;  3W5O A;  1G51 A;  3ERS X;  5CR3 A;  3R2I A;  2EYL A;  4PV1 C;  4XT3 B;  3A55 A;  3FMC A;  4LJZ C;  4BY7 H;  5EKI A;  1HFG A;  1Z6H A;  1MJE A;  3EBE A;  1P8L A;  4DR3 L;  2HQL A;  3HOU B;  1F9R A;  2DGY A;  4GKJ Q;  1ESF A;  1CKN B;  2YU9 H;  3NWT A; 
#chains in the Genus database with same CATH homology
 1VDZ A;  2EYF A;  1TII D;  4HED A;  1S4Z A;  5JVG 3;  1DOL A;  5E3F A;  5E4W C;  1LLR D;  4RAU C;  1ONL A;  4FF3 A;  1HQR D;  1PZK D;  2B2W A;  2RDF A;  3SVM A;  2WKD A;  1TY0 A;  1STG A;  4FF1 A;  1BNZ A;  3QWN A;  3MA2 B;  1BCP C;  4KJN A;  1Y8P B;  2NVT B;  4TKO B;  3T56 B;  4KMU C;  1KLG D;  3HP3 A;  3S2D B;  2EY2 A;  4CKB A;  1JWU D;  4Q0F A;  4CGY B;  2BDN A;  3O13 A;  1YNN C;  4KHZ A;  1KNE A;  3EJI A;  3S16 B;  1F9S A;  5DM7 3;  2HDL A;  1EY6 A;  4LAA A;  1PRT D;  5F2D A;  1U4M A;  3I4M B;  3G6J B;  1G8Z D;  2N88 A;  3SR1 A;  3T4A C;  2ZT9 C;  1GHJ A;  2J4X A;  3SE0 A;  3RZD B;  3OOC A;  1GUO A;  4DN4 M;  3HS0 C;  1HUN A;  3SXH A;  2Z4H A;  5FLX L;  2PZU A;  3NWS A;  3T51 B;  5C6A A;  5CMD A;  4GZY C;  5JPN C;  1XTC D;  3MXP A;  3K0Y A;  4X3T A;  4ZAI A;  4MIU A;  1PTO C;  2Z8L A;  2F0J A;  5FOB B;  4C3H B;  4DA2 A;  2K1B A;  5I4D A;  1DON A;  1GOZ A;  1QWY A;  5EJW A;  3BDC A;  4XTC S;  3MZ5 A;  2OF1 A;  4DNT B;  2PW5 A;  4DF7 A;  1G6Z A;  4EQP A;  3OWF A;  3S1M B;  5M9O A;  2NN6 I;  1BF4 A;  2JA5 B;  3TP6 A;  4V0B A;  4HSP A;  3J81 L;  4TSS A;  3D6W A;  1MBY A;  4G4K A;  4RCN A;  2VXW A;  4X3U A;  4V19 0;  3GTL B;  2L1B A;  5I9O A;  1PMR A;  2XIW A;  3VYS A;  4BBS B;  5EPL A;  2NTS A;  3QB3 A;  1M8A A;  4FVM A;  4FYD A;  2MJ8 A;  1U4L A;  2O5J C;  2EY6 A;  1II3 A;  5BN5 A;  4FF4 A;  4OHJ A;  1FD7 D;  2EJF C;  5KGU A;  4QUC A;  4OGQ C;  4C3I G;  1NCV A;  2Z1C A;  4HCS A;  5IT9 L;  1ZKO A;  1C4Q A;  2K5W A;  3PUZ A;  2LS0 1;  2SNM A;  3ZYY X;  1QB5 D;  4IAL A;  3K5M A;  2K33 A;  1SMY D;  1IYV A;  3M7G A;  4KKU A;  3OIQ A;  3N52 A;  1VMP A;  2L4N A;  1NUC A;  1PFM A;  1B2T A;  2B2U C;  4RGT A;  1WCM B;  1OXT A;  3PIP 3;  1EYA A;  3BVM A;  1PXU A;  2J0T D;  2HDM A;  5IT9 E;  4A3F B;  4K8J A;  2F0T A;  5I6W A;  4F8M A;  5JAV A;  3L3O C;  1U9R A;  3WOE A;  1XWE A;  1AZP A;  2EYJ A;  3CRL C;  4IUQ A;  1D1K A;  3GD7 A;  1LTS D;  1SYB A;  1BBX C;  2A73 B;  1G2S A;  2J7Z A;  3CU7 A;  1PDQ A;  1C8C A;  3X3M A;  2F0I A;  4A3B B;  2WV6 D;  5CV7 A;  2QEJ C;  2NWG A;  1SNO A;  3PUY A;  1LTI D;  1TU2 B;  1D5M C;  5BN3 A;  1LTG D;  3NBI A;  5K36 G;  4G7O C;  3MC0 B;  2H4O A;  3TZU A;  4WRD A;  1UEA B;  4K14 A;  1L0X B;  1I3Q B;  5JEA G;  2R61 A;  4XQJ A;  1JQY D;  3NTK A;  4A3J B;  1SYE A;  4OIJ A;  3KBG A;  5EBD A;  4RH6 A;  1LTA D;  1Y8O B;  1AP0 A;  3VR3 A;  2F1M A;  3MTS A;  5IGC A;  5ISR A;  4I7Z C;  3A8I E;  5ELF A;  5FLX E;  3HRZ C;  4U68 A;  3TSS A;  3VR2 A;  2L55 A;  2EYO A;  1LT6 D;  4NP5 A;  2F0Q A;  2XN9 C;  2E75 C;  1RF2 D;  4KI0 A;  5J1Z A;  4CKE A;  2B2T C;  2TMP A;  3D4W A;  1B44 D;  3KLS X;  4TRD A;  2L9H A;  3R93 A;  5HUR A;  1I4G A;  3BVG A;  1B50 A;  3NPP A;  5EQ0 A;  1STA A;  3X3N A;  1RTN A;  5IIF A;  3JAM E;  2IT1 A;  2AUJ D;  4Q5V A;  2EYM A;  2OT2 A;  2NVQ B;  3H6M A;  4MN3 A;  2EYH A;  3P1H A;  3QG1 A;  4FF2 A;  1AEX A;  3HOZ B;  3NE5 B;  3BG3 A;  3TDQ A;  3MWY W;  2IPK D;  3BYT B;  4K8I A;  3T53 B;  1ICW A;  2KEE A;  5CBE E;  1HCZ A;  3VYT A;  4CJ0 B;  2B8F A;  3I4L A;  1F2L A;  1I4Q A;  3T16 A;  1F9Q A;  3DHQ A;  1OXX K;  3RUZ A;  4EQO A;  1L0Y B;  3FDT A;  1H9M A;  2A6E C;  1Y8N B;  3WDN A;  1GUW A;  1NSN S;  2RQX A;  1TS2 A;  2R92 B;  2B2V A;  3DXJ C;  4RHR A;  4RGM A;  2VNU D;  1F9P A;  5G3L F;  3J80 L;  3C3L A;  4B9W A;  4C2M B;  3J7Y W;  2QIL A;  1SE4 A;  4K2K A;  1SBB B;  4KN4 C;  3K5L A;  3KK7 A;  3P75 A;  1GUG A;  1JOO A;  1BCP D;  1Y69 U;  1NR4 A;  5CV5 A;  1E2Z A;  4OIK A;  3GTO B;  2IWH A;  5I9P A;  5DAU A;  4F87 A;  2C9O A;  4PQX A;  1EZ8 A;  1SAP A;  1IHZ A;  3BDO A;  4P2C B;  1PRT C;  1EEF D;  1H9K A;  3U9S A;  3FEW X;  1STY A;  3KLS A;  3HOV B;  1B4O A;  1JWM D;  1RD9 D;  3N6R A;  5IGB A;  2F0S A;  5CBA E;  1HQM C;  4IN3 A;  1IKM A;  1HXY D;  4BBR B;  3U9O A;  2B2U A;  3H09 A;  5M5X B;  1GUS A;  2KOL A;  2EVB A;  1EWC A;  3WOF A;  1Z47 A;  4A3E B;  1CHP D;  3VR4 A;  5K36 H;  4IQZ A;  4PMC A;  2IX3 A;  1HA6 A;  1STE A;  3IKJ A;  1FNW A;  1PTO D;  4FO2 A;  1EU3 A;  3GO5 A;  5E1F A;  1DD2 A;  1B9M A;  1TWA B;  1F2Y A;  2IW3 A;  3MEH A;  3KUP A;  1IW7 D;  1F2M A;  2EYP A;  5FO7 B;  3S1N B;  4HSV A;  4NW2 A;  1B3A A;  3W2D A;  3OHX C;  4NDX A;  3IL8 A;  1LAC A;  3M4O B;  4HMI A;  3V2T A;  4CJ1 B;  1GHK A;  5IGD A;  2ID0 A;  1LTR D;  3OPO A;  4IUR A;  4WFN 3;  2A5H A;  1E2V A;  1LAB A;  5LL6 S;  4JK1 C;  3ITP A;  4XYQ A;  3MFG A;  3CRK C;  1EWH A;  1BO0 A;  2XWB B;  4JBW A;  4RKB A;  2XWJ B;  3A56 A;  2O5I C;  1AZQ A;  3ND8 A;  3FRP B;  2RDH A;  5C0X I;  2PW7 A;  1WTX A;  1O78 A;  2Q8R E;  1LT3 D;  2PNR C;  2EY1 A;  1D5Z C;  2F0H A;  2IJ0 A;  3VR6 A;  4AYB B;  1MSG A;  2FMM A;  1RCV D;  5CYU A;  2ICI A;  3C46 A;  2JA8 B;  5FKA C;  1ESR A;  2ENB A;  1TWC B;  2F0U A;  1DZ1 A;  1RTO A;  1JE4 A;  4HCE A;  4L8J A;  1K83 B;  2FHT A;  1HTL D;  1FGB D;  3VYR A;  4UDU C;  3Q22 A;  1G2T A;  2KVM A;  1CK1 A;  1JWS D;  2K6A A;  1EFI D;  1CT1 D;  2OEO A;  1EY8 A;  3SHL A;  2DN8 A;  4PNY A;  1KNA A;  1O7Y A;  4HMJ A;  5C0X H;  1ENC A;  1FYC A;  1KAA A;  3H94 A;  1SNQ A;  3RD4 A;  1A15 A;  3JAM L;  1KTK A;  2WII B;  1CA6 A;  2FFK B;  3DWQ A;  4A93 B;  1KDB A;  4WOR A;  4IUT A;  2SDF A;  1EY9 A;  1EOT A;  1PTO F;  2NN6 G;  4ZK9 B;  3OSO A;  3P20 A;  3PO2 B;  1HUM A;  5M5W B;  3D31 A;  4HTH A;  1VMC A;  1VCI A;  4DXF A;  2F0G A;  2BOS A;  4A3D B;  4IFD I;  2WP8 J;  4I65 A;  2CVR A;  1Q8I A;  1PTO B;  3GTG B;  2B2T A;  1I4H A;  3EFX D;  3FVQ A;  2ICE C;  3AB9 A;  3PUX A;  4QB4 A;  3GTJ B;  1STB A;  2JA7 B;  3W3A A;  2G9H D;  3VYU A;  1Z7T A;  1SFO B;  3UI2 A;  1A2T A;  4ULL A;  2DY8 A;  3F2U A;  4HR7 B;  3HOY B;  1Q90 A;  2B2W C;  2AWN A;  3D8G A;  4ZUJ A;  1G91 A;  2HUG A;  1PFN A;  3I72 A;  1TS4 A;  1LTB D;  3NHH A;  2YU9 B;  3J81 E;  4XQQ A;  1IL8 A;  1GUN A;  3S2H B;  2E76 C;  5HGT A;  4KN7 C;  3NXW A;  2CW0 C;  1UAP A;  1XXG A;  1CZW A;  2JYO A;  3LWU A;  4X3K A;  1K8M A;  1TY2 A;  4X3S A;  3PMF A;  1SND A;  4XYO A;  3LNN A;  5K5P A;  2C5C A;  1MGS A;  1TR5 A;  1EQV A;  4KTA A;  1MD2 D;  4RWS C;  4C1N I;  2JA6 B;  4CBV A;  1ILQ A;  3QJY A;  1FNU A;  2RSN A;  2K28 A;  1Q12 A;  2AQ3 B;  3ERO A;  4M1U B;  3C1E A;  3RLF A;  1UUP A;  2AQ1 B;  4KKS A;  1J9O A;  3GV3 A;  4L6T B;  5C0X G;  1TS5 A;  2XNA C;  3NUC A;  3D6C A;  3TP8 A;  2E74 C;  2IX0 A;  3ERQ A;  4YIJ A;  2PZW A;  3DWP A;  5CV4 A;  4C1N K;  1R9T B;  1TVX A;  2B39 A;  2L11 A;  1DJR D;  1BUV T;  2L0C A;  4ZRZ A;  1YNJ C;  3R2T A;  2PO4 A;  4C56 C;  1BOS A;  3A54 A;  3P7J A;  2EOT A;  2M9V A;  1SSO A;  1HRJ A;  2R3Z A;  3C2P A;  1KDA A;  3LX0 A;  4RCO A;  2IL8 A;  4XT1 B;  2B63 B;  3DEO A;  2EXZ A;  3K57 A;  2D5D A;  2DY7 A;  2V4D A;  4RFB A;  1I6V C;  1O7L A;  1BQQ T;  3DMU A;  3MFY A;  1KAB A;  4K5V A;  1JOR A;  3URY A;  5CC4 A;  3T13 A;  2LFN A;  3TBI B;  2WIN B;  1SJE D;  1XYI A;  1HTP A;  4BS9 A;  4NKL A;  5DNF A;  2L5T A;  3I90 A;  4KY7 A;  4G7H C;  2A69 D;  3DM1 A;  1S5B D;  2QCP X;  3NTH A;  1OXU A;  4ABN A;  2KCC A;  1R4Q B;  4OO1 G;  5LHY 1;  5KNC A;  2F0D A;  4DK0 A;  4OL7 A;  2SOB A;  4L63 B;  3BVZ A;  3D4R A;  1S5F D;  2D2C C;  2FJ2 A;  3L9A X;  4IUV A;  3I8Z A;  5EGT A;  4Y7N B;  2D9U A;  1D1I A;  2HCI A;  2RDG A;  2R7Z B;  3K6O A;  2SEB D;  1SE2 A;  1KLU D;  2XRS D;  4BA1 I;  5ELC A;  1V1O A;  1SMY C;  3TN2 A;  2R93 B;  1EY0 A;  1WD1 A;  1LT5 D;  2E2H B;  4LK1 C;  2KCN A;  1SXT A;  2BE5 D;  2A74 C;  1IYU A;  1I4X A;  1O80 A;  1WTV A;  1B9N A;  1Q1B A;  3MVV A;  4HN7 A;  3SDZ A;  4K6D A;  1EYD A;  3C1F A;  3AU7 A;  2QKI C;  4IUU A;  2Q8I B;  3TP5 A;  2KJX A;  1OO9 B;  3V96 A;  1EY4 A;  4XQN A;  3M85 A;  4EVO A;  3M3Y B;  2X69 A;  4DAY A;  3FKI B;  4FXD A;  3K59 A;  3MHB A;  1Y1V B;  3BS1 A;  1FNV A;  2NVX B;  3I73 A;  1CTM A;  4KK7 A;  5EPK A;  2K32 A;  2KEC A;  1WTP A;  3SEB A;  3PV0 A;  1TWG B;  1U4P A;  5M3M B;  2I46 A;  5KNB A;  3K5O A;  2KHS A;  4RKL A;  3GP7 A;  2RVL A;  3NBH A;  1H9J A;  4O1N A;  1ENA A;  5EKL A;  1HA5 A;  4B9X A;  2VB2 X;  2LY7 A;  2D62 A;  3OMC A;  2GA4 B;  2I07 B;  4M8A A;  5IOD A;  2CHB D;  1KDC A;  4FXK C;  5JPM C;  4U67 3;  1SYD A;  1OXV A;  3PUW A;  2XVS A;  1DYQ A;  3HOW B;  1I4R A;  1CQV A;  4J1M A;  3EVQ A;  1DOK A;  5CV9 A;  4FXG C;  3GTP B;  2NUC A;  3SK6 A;  3A7A B;  3IFT A;  3NTI A;  4ZKC B;  5C3W A;  5BN4 A;  4FP5 D;  1K8O A;  1SYC A;  3QOL A;  2B8G A;  2AWO A;  2NTT A;  1DOM A;  3GQB A;  1CHQ D;  1QG7 A;  1DM0 B;  1F77 A;  4IZ8 A;  2PPB C;  2KQ3 A;  4KJO A;  1I50 B;  1BCP B;  2F0W A;  4ZYS A;  1IW7 C;  3HZX A;  4N9T A;  1AN8 A;  5C3X A;  1QIL A;  4PMB A;  2N55 A;  1HPC A;  2E2I B;  4KY6 A;  3E0J A;  2CW0 D;  4RA8 A;  3VR5 A;  5FO8 B;  5KRU A;  2RSO A;  2JSO A;  4Z9C B;  2E2J B;  2B2Y A;  1EY7 A;  3ONA B;  4NMZ A;  2DNC A;  1G29 1;  1VF7 A;  3D4D A;  5COY A;  5JJZ A;  3R8B A;  1SNC A;  3A8K E;  1TQO A;  3LWE A;  3PUV A;  4H7B A;  4K5W A;  3DEP A;  3OWE B;  5I2X A;  1CM9 A;  3V05 A;  2FIN B;  2HCC A;  2QF7 A;  2CQA A;  5I2Y A;  1XX8 A;  4BY1 B;  2KA7 A;  2ZXR A;  2VUM B;  2AQ2 B;  3QOJ A;  2XSC A;  4F88 A;  1PZJ D;  4DGZ A;  1LV9 A;  1CZG A;  1H9S A;  2SNS A;  3BYY B;  1D5X C;  3OW7 A;  4XDX A;  3SK8 A;  2AUK A;  3M7N A;  1S5D D;  4PMW A;  2K5Q A;  1ML0 D;  5JEA J;  3L7Z C;  1BXT A;  2FMC A;  4DAP A;  4G57 A;  2F03 A;  1X32 A;  4ME5 A;  3SK4 A;  4EGV A;  1TS3 A;  2PCF B;  5C5M A;  2RA4 A;  1A3U A;  2F4I A;  2K5D A;  4CHT B;  3BZD B;  5IGF A;  4QUF A;  1AFP A;  2MUY A;  3VA5 A;  1J8I A;  3Q23 A;  1A6X A;  2K03 A;  3KBX A;  5C4J B;  1SNP A;  1HFN A;  2EZV A;  3HEJ A;  5FK9 C;  1UNS A;  3I3C A;  1PTO H;  2G9D A;  1ILP A;  5ELE A;  1Q3L A;  2A68 C;  2O2L D;  1PZI D;  5A35 A;  4C3I B;  2BDO A;  3I91 A;  1LTT D;  3J7A V;  1QNU A;  3IFD A;  1BR9 A;  2F0E A;  5T1I A;  4H0L C;  3OMG A;  5KYI A;  5EPJ A;  3H0G B;  3S15 B;  2F0K A;  2HQE A;  2Z4I A;  4DU9 A;  5M3F B;  1TWF B;  3TP7 A;  3CKI B;  1CFM A;  2M00 A;  1F2Z A;  5ELB A;  4ZLT F;  1ZXT A;  1BDO A;  5IGG A;  3VA7 A;  4E6I A;  4A3G B;  1GUT A;  5C4X B;  5M5Y B;  3S9W A;  5DM6 3;  2XRQ D;  2OXP A;  1QJO A;  2K04 A;  2PZT A;  4ZKB B;  2A6H C;  1TWH B;  4RGO S;  2KUM A;  3S14 B;  4HAE A;  1WTW A;  1HHV A;  3NP8 A;  5EBC A;  4QF4 A;  4EQN A;  1JB3 A;  4DXG A;  2EE1 A;  1JOK A;  2F0F A;  4IFD H;  3TME A;  1EQT A;  4QIW B;  3Q0A A;  1YNN D;  1RHP A;  5J22 A;  1V43 A;  5A2Q E;  2K05 A;  3H91 A;  4RGN A;  2WAC A;  1RKN A;  4DNR B;  5I6Y A;  3DUZ A;  3K7A B;  2O4X A;  2MHV A;  1MSH A;  1B53 A;  2EY5 A;  2K7V A;  4F7X A;  1SDF A;  2A6E D;  5J39 A;  1JC7 A;  2YYZ A;  4XIG S;  2MPM A;  1BCP F;  3Q24 A;  1A3T A;  2MGS A;  1U4R A;  2F0L A;  5JOB A;  1E2W A;  3GTQ B;  1LO5 D;  3RMH A;  3NK9 A;  1AW7 A;  4OO1 I;  1QE6 A;  3EA6 A;  2M2L A;  2NN6 H;  4H44 C;  1V1P A;  4A3I B;  2RKS A;  2A6H D;  5IOC A;  4A3M B;  5C3E B;  4KD4 A;  5C5L A;  1SNM A;  5KEE A;  3RZO B;  5D65 A;  2IX1 A;  1Q1E A;  5C0X J;  1W6K A;  3S17 B;  2Q8T A;  3CQZ B;  3CHB D;  1CQF A;  1GJX A;  4MHE A;  2NYZ D;  4CKC A;  1I4P A;  3I4N B;  1WVL A;  3HG9 A;  4J6H A;  1PRT B;  4KKT A;  2X6G A;  1PFB A;  3MAQ A;  5CV6 A;  3S1Q B;  1EU4 A;  2NZ1 D;  1I6H B;  1EEI D;  2RBM A;  3K5N A;  1IKL A;  2PYK A;  5AFW A;  4C3J G;  2EJG C;  3H3V C;  3QO2 A;  4ILW A;  2F0O A;  4KV6 A;  2H1E A;  2JP1 A;  2K01 A;  5FO9 B;  5C44 B;  4K2L A;  1ROD A;  2WB1 B;  4BA2 I;  4R8N A;  1EIH A;  1JOQ A;  1WTQ A;  1GXD C;  3MXN A;  3NSW A;  2LKV A;  1NR2 A;  1OXS C;  2F0N A;  3A8J E;  5JEA H;  3E5S A;  3PIO 3;  4C3H G;  4N9P A;  1JR0 D;  1E0B A;  2NB0 A;  1MI2 A;  1H9R A;  4XXE A;  2F3V A;  3QIA A;  5KYL A;  1H9S B;  1W6J A;  1JIC A;  5DEH A;  2JEB I;  1STN A;  1QOH A;  2BE5 C;  4ID6 A;  1TT2 A;  1EL0 A;  3DWA A;  2F3W A;  4K5X A;  3HOX B;  1CI3 M;  4TQU S;  1X3P A;  1NAP A;  3MXU A;  1STH A;  2QDB A;  2B2V C;  1D2B A;  4KY5 A;  4IUN A;  1RJT A;  4IUP A;  1A3V A;  4O42 A;  1ZYR D;  4A3K B;  5COR A;  1PLF A;  4DAV A;  4UAI A;  5EKK A;  4ZQ3 A;  4LMQ D;  4ZUI A;  1SEB D;  5KIX A;  2JEA I;  3J7A F;  5C4Z A;  1B1Z A;  2EPB A;  1PYW D;  1S5C D;  1ENF A;  1D6E C;  3HKZ B;  1R4P B;  1WTO A;  2MP1 A;  4KHV A;  4KD3 A;  2EDG A;  3NQI A;  3M4Y A;  3NQT A;  2BA0 A;  4QCL A;  1TKW B;  2A69 C;  5CGK A;  1WD0 A;  1DCZ A;  3OIP A;  1M4V A;  4CJ2 C;  1X3Q A;  3IAY A;  3FPU B;  2VB3 X;  5C4H A;  5CV8 A;  4IFD G;  1EIG A;  1CA5 A;  1V1P B;  4G7Z C;  1FR3 A;  4FNF A;  2JE6 I;  3PO3 B;  5IGE A;  4K6L A;  1SYG A;  4WJW A;  1C48 A;  5KND A;  2B2Y C;  4B08 A;  1T5E A;  4R9W A;  4OO1 H;  3GTM B;  5G3L D;  4DK1 A;  5D3D A;  1S5E D;  2NVY B;  4RHS A;  2BCO A;  1RDP D;  1EYC A;  3SK5 A;  1VF5 C;  3HGB A;  1DXM A;  1ZYR C;  3KLR A;  2A68 D;  3K58 A;  4C3J B;  1V8Q A;  2BA1 A;  3E6Z X;  1JCK B;  3G7L A;  3KF8 A;  3ND9 A;  5D14 A;  4IFD J;  5A2Q L;  4QMG A;  1ET6 A;  2ZXO A;  3GTK B;  3TZD A;  3AMU A;  2KED A;  4H13 C;  2ZXP A;  1ZEQ X;  1A2U A;  1WTR A;  3GV6 A;  2F0V A;  1EY5 A;  5E4X A;  3FPP A;  2F0P A;  1YNJ D;  3EQL C;  2F0M A;  1SE3 A;  1EZ6 A;  4DFA A;  1O7Z A;  4BWG B;  3S1R B;  5TSS A;  1SJH D;  2Y0S B;  1Y1W B;  2WAQ B;  2EJM A;  5JVH 3;  3A7L A;  1QNK A;  3I70 A;  1PRT F;  2JXM B;  2DNE A;  1T5X D;  5NUC A;  4J8Q A;  2PQE A;  1SYF A;  1QCB D;  2R6G A;  4S3S A;  2X6L A;  1LT4 D;  2E2D C;  2NBF A;  2PMZ B;  3R3O A;  3MXG A;  2L12 A;  3Q6S A;  5LL6 X;  3D3R A;  5ELD A;  5D3I B;  4R8I A;  1ET9 A;  2LMC B;  5T1G A;  2TSS A;  4BY7 B;  4ODG A;  3BDL A;  3J80 E;  2WKC A;  5CR3 A;  3R2I A;  2EYL A;  4PV1 C;  4XT3 B;  3A55 A;  3FMC A;  4LJZ C;  5EKI A;  1HFG A;  1Z6H A;  3HOU B;  1F9R A;  1ESF A;  3NWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...