1CHPD

Surprising leads for a cholera toxin receptor binding antagonist; crystallographic studies of ctb mutants
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLADKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHOLERA TOXIN B PENTAMER
publication title Surprising leads for a cholera toxin receptor-binding antagonist: crystallographic studies of CTB mutants.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 22
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1995-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1chpD00
1D5XC 1TY0A 1RF2D 1TS3A 1XTCD 2XNAC 1KLUD 3BZDB 4DXGA 1CK1A 5ELEA 1BCPD 1T5XD 4L6TB 3SEBA 1PRTC 1D5MC 1HA5A 1I4RA 4RGMA 1LT4D 3MC0B 1CT1D 2AQ2B 1GOZA 5ELBA 1PZJD 1LTGD 1EWCA 1KTKA 1LLRD 1LTTD 1ESFA 2R61A 2XRQD 1JQYD 1PTOH 1V1PB 2NTSA 3TSSA 1I4HA 3V05A 2J4XA 5D3IB 1CHQD 1LTID 2XN9C 1PYWD 1V1OA 4RCOA 1PTOC 1S5BD 2Z8LA 1FNUA 4RGTA 4UDUC 4O1NA 3W2DA 4OHJA 1B1ZA 1ENFA 3O13A 1TS5A 3DWPA 2IJ0A 2WV6D 1PZKD 5I4DA 1I4GA 1HXYD 1BCPB 2ICIA 3CHBD 5FKAC 1TY2A 1SJED 1JWSD 1EFID 5TSSA 1FGBD 1RDPD 1UNSA 1FNWA 1EU3A 1LTRD 1LT5D 2XRSD 1FNVA 5D3DA 4DXFA 1XXGA 4ZYSA 3R2IA 1MD2D 1TS2A 3DWQA 1CHPD 1SE3A 1PRTF 4BWGB 4RGNA 1KLGD 4RHRA 5ELFA 1PRTD 1BCPC 1JWUD 2SEBD 1STEA 4RFBA 3R2TA 1SE4A 2AQ3B 1LTAD 5ELDA 1EEID 2O2LD 1F77A 1CQVA 2IPKD 2TSSA 1AW7A 4L63B 3BYYB 1SBBB 2RDHA 3EFXD 1D6EC 1PTOF 4RHSA 4K6LA 5ELCA 3KLSX 3R8BA 1PTOD 2RDGA 1DJRD 3OWEB 1SJHD 3BVMA 1EEFD 1RD9D 3GP7A 5FK9C 3BYTB 4C56C 3URYA 1DYQA 1L0YB 1L0XB 2NTTA 1S5DD 1PZID 1PRTB 1LT6D 1SE2A 4RH6A 1D5ZC 1SEBD 2G9HD 2QEJC 4Z9CB 1TS4A 1JR0D 1HQRD 1UUPA 2AQ1B 1RCVD 3MFGA 1V1PA 4RGOS 1S5CD 3BVGA 1B44D 1I4QA 1SXTA 1LTSD 1AN8A 1ET9A 1I4XA 1LO5D 1I4PA 1HTLD 3EA6A 3BVZA 1M4VA 1JCKB 1EU4A 3DWAA 1FD7D 1ET6A 1G8ZD 1S5ED 1LT3D 1S5FD 4TSSA 1BXTA 1PTOB 1QILA 2QILA 1LTBD 2CHBD 1JWMD 1BCPF
chains in the Genus database with same CATH superfamily
1QZGA 2AWOA 3AYHB 3HOWH 1QB5D 4N9TA 1TWCH 4B3TL 5HURA 2IX1A 5C6AA 1YNJD 3CQZB 1CKNB 2M2LA 2B2TC 3PSIA 4O42A 2RF4A 5DM73 1H95A 3MC0B 2Q2UA 1AZQA 4KI0A 3L7ZC 1LTTD 3S17B 3HOZH 1R9TB 3GV3A 4KHVA 1I4HA 3K80C 1GD7A 1IBKL 2WAQB 3EBEA 1K8MA 1X3QA 5C4JB 4C1NK 2XSCA 2K7VA 2DY8A 2KOLA 4X3UA 4CHTB 1VQOA 2JK8A 1MBYA 4UDUC 1B70B 1S72A 3E3XA 4DAVA 5JPMC 2RCFA 4B9WA 4JYAQ 5C0XJ 2BOSA 4ZLTF 1XPUA 5EBDA 5T1GA 4Q0FA 2BH2A 3A55A 4UAIA 1JWSD 2FJ2A 1CUKA 1VQ6A 3K57A 5CGKA 1U4RA 1KD1C 2XRSD 4ID6A 1NSNS 1WOCA 1TS2A 1B53A 5IT9c 4DR3Q 4YHHL 3PGZA 3NTHA 3MVVA 2DY7A 3VYRA 2UUBQ 2CCZA 1J8IA 1CSPA 4DU9A 4HSPA 3K7AB 5IGFA 5CBAE 4B3TQ 5KGUA 2NZHA 4K6LA 1G291 4A3LH 4DV6L 4DNIA 1HQMC 2YTYA 3OMGA 4OELB 1BOSA 3HOYG 3Q22A 4FXDA 1WCMH 1W6JA 1YVCA 1PZID 2BE5C 1IBKQ 3K5MA 1FVIA 4A3JB 2EE1A 1VQFA 2R3ZA 2IT1A 4DFAA 3J81i 1GUSA 2VUMH 2R92B 1Q1EA 1RKNA 1E3PA 5GAHC 1EWIA 2J7ZA 1FYCA 3I4OA 2F0IA 1EYGA 3J81E 3NK9A 4UP7A 1M4VA 3NQIA 1RL2A 1FD7D 1G8ZD 2JA8G 1SDFA 2SDFA 1F2ZA 1QILA 3FKIG 1N36L 3DLLA 5BN5A 4HIOA 1TY0A 5C4HA 5M5XH 3J81j 1CA5A 1T5XD 2Z6KC 3V96A 4QF4A 3OW7A 1F2YA 5M5YB 3OSOA 3L2PA 4C3JG 2JA5H 2MNAA 1WJJA 1TVXA 2ZTDA 3F2UA 3RD4A 1G2TA 1EYDA 2B8FA 3NBIA 3NBHA 2WKCA 2ENBA 2R6GA 2ID0A 1VQNA 1PTOC 3X3MA 3D31A 1C4QA 1ENAA 2CKZB 4OHJA 1H9SB 2F0OA 4A93H 1RTNA 4A3FG 3MXNA 4GKKQ 1TS5A 3P7JA 1I4GA 3SVMA 4R9WA 5A2QE 4X62L 3S15B 3M9BA 1H9KA 2KEDA 3VR3A 4DV6Q 1SJED 1PH8A 2ZM6Q 1YITA 1RDPD 3AQQA 1JOKA 1RHPA 5E7NA 1SNCA 2JN4A 2PQAB 3TP5A 2AMCB 1FNVA 2BCOA 3PO2B 4A3EG 4IOCA 4S3SA 4DNRB 5FLMG 2MO1A 1PA6A 1V8QA 3GO5A 4GNXA 5I6WA 5CORA 3RUZA 2F0QA 2BH8A 4H7BA 1WD0A 1STEA 1MSHA 1HNWQ 4A3GG 1EEID 4A3IG 1VQIA 4EQ5A 3KLRA 2SNMA 1CA6A 4NB3A 3D3RA 1N36Q 4GN3B 4QIWB 3BJUA 4IURA 2OXPA 1Q81C 2IX0A 2N78A 5EPKA 3KFUA 1ZEQX 3TDQA 1PH1A 4BBSH 2N55A 1L0WA 1HFGA 1K28A 2JA6G 2R93G 2F0JA 1SMXA 3HG9A 4JV5L 1AE3A 2X6LA 4K2LA 4YCWA 1YJWA 2RKSA 3OHXC 2D62A 4IUTA 2B2WA 4JOIA 5CV4A 1WTQA 2KJXA 1XX8A 1SE2A 2L55A 4HJ9A 2Q8IB 5M3FG 4LFCL 5FJ8G 2K14A 2F52A 3GTKH 2FFKB 4H02A 1I4XA 1VQHA 3EA6A 5C4ZA 2UU9L 4OONA 1M8AA 2EJFC 3MAQA 3KBXA 1VQKA 3S16H 4C3HH 2K5NA 1LT3D 5EKKA 5T1IA 4HJAA 5KEEA 3S24A 3VR2A 1D5XC 4BY1B 2A6ED 3CMEA 3EIVA 3GTQH 4A3KG 4QJFA 4B3RL 1X3EA 1EL0A 4CDEC 4DN4M 2HDLA 4A3CH 3F2DA 2E2HH 4LJZC 4NDXA 3PF4A 3NENA 1VQ8A 1VQBA 2EY5A 1D8LA 1SMYD 3E9IA 3GTMH 2JE6I 2K5WA 1B3QA 3K7UC 3Q8DA 2XGTA 2NVYH 2L15A 4AYBE 1LUZA 2Z8LA 3GTLB 2SOBA 5ELOA 1EZ8A 4J8QA 3NTIA 4DV7L 1ML0D 2IJ0A 3CRLC 5IGGA 2EJMA 1Q8IA 4XQJA 2NVTH 5G3LD 1RODA 1IXRA 1WTOA 5FKAC 3CD6A 1TXYA 2JSOA 5GADC 1EFID 3L9AX 4POGA 4DAPA 2OTJA 2UXDL 2A8VA 1H9JA 4JV5Q 1UNSA 2B2YC 4IQZA 3P75A 3D0FA 2V4DA 1X55A 2FMMA 4Y52H 5JVH3 5JJLA 3S1RB 4DUZL 1O7IA 1B9NA 2E2IB 1CM9A 2NN6I 1PH9A 1S3OA 2GVBA 1DXMA 2I0QA 2CVRA 2IY5B 3J7AF 3GD7A 4DV2L 5IYBH 2OCEA 2K5DA 4XIGS 2EOTA 1GO3E 2N49A 1WTRA 2RQXA 4MHEA 1Q86C 4HN7A 3OMCA 4L5TA 2HQEA 1VQDA 4B3RQ 1Y8PB 1SSOA 5LMNW 1B9MA 4ZKCB 4KY5A 1SROA 1PDQA 4A3MG 1EY7A 2CWAA 1CKNA 3HKZB 3H0GH 4OGQC 4Y7NH 4ZRZA 4EVOA 2G9HD 5FO8B 3HOWB 4BA1I 1TWCB 2K03A 1B7YB 3BVGA 4KD3A 5JEAG 1PFMA 3FP9A 2F0KA 4DV7Q 3MA2B 1G2SA 5EKIA 1QVCA 2K52A 1FJGL 4C1NI 3HOZB 1QNKA 3HOVG 4RGMA 2B63H 1TS3A 3PCOB 1L2FA 1WTHA 3QOJA 5JJKA 1I4RA 4I7AA 2AQ2B 4JI8L 2EZVA 4PNYA 1PZJD 5FO7B 3CU7A 1PTOH 1V1PB 4B3SL 1DCZA 3OOCA 2K28A 2JP1A 2NZOA 5HY6A 1S5BD 4DV2Q 2JJQA 3WOFA 4R4QA 2WAQG 1AFPA 2Z6KA 1HXYD 5C5MA 2HIXA 2CW0D 5C44H 4DR5L 3H3VH 3BDCA 2F0VA 2EXZA 4MTKA 1ZYRD 5LL6S 2K32A 1DOKA 2PO4A 3DEPA 5KNDA 1V43A 4DXFA 1O7YA 3BZKA 1Q46A 3HKSA 3CPFA 1V1QA 1EZ6A 1PRTF 2O5JC 1A8VA 3K0XA 3SHLA 5IT9E 1YNND 1N34Q 2I5LX 1GHJA 1Y1VH 1SE4A 1VQLA 1A15A 1LTAD 1NMGA 5EPLA 1TKWB 4GLAC 2PPBC 1WCMB 3KBGA 3K5LA 4FNFA 2GVAA 2EVBA 3G6EA 2RDHA 1DGSA 4K8IA 3MXGA 1SN8A 4L5RC 2ZJRA 2VUMB 3R8BA 3H91A 4JI4L 5IYDH 1RD9D 4C56C 3KF6A 1OXUA 4AIMA 2N8NA 4B3SQ 4QL5A 4RAUC 3QO2A 4IPHA 5CC4A 3D4WA 5FOBB 2PYKA 4DK0A 1SEBD 2EQSA 2HIVA 1BQQT 5EBCA 2TMPA 5M5XB 3H3VI 4WJ4A 5K36G 4X64L 2A73B 2LXJA 2L1BA 1X54A 3I73A 3NHHA 4B3ML 4A3JG 1N33Q 2YV5A 2R92G 2F0SA 2JA5B 2QDLA 4P2CB 4JI6L 1Q1BA 1BXTA 5LHY1 1HA6A 4LNQA 3A8KE 1H9SA 4XQNA 4L5QA 1RF2D 4YY3Q 1BCPD 1A2TA 3W5OA 1QNUA 1MIUA 2OQKA 1XWEA 2CW0C 5NUCA 3CRKC 3NELA 1MSGA 1KABA 4A93B 3K8AA 5C4XB 2B8GA 3T56B 4GLXA 5J22A 1MHWC 1JE4A 1STBA 5IIFA 2PI2A 4K6DA 1I50H 5E3FA 1OO9B 4ME5A 4ME3A 2OEOA 4RCOA 2R7ZB 1BDOA 5CV6A 4IPDA 4QMGA 1HTPA 5M3MH 3I70A 3KDFB 2F0NA 3SK6A 3VR4A 3S1QH 1EWHA 3I55A 2L11A 1YNNC 1VF5C 1BCPB 3EVQA 3CHBD 4CBVA 4V0BA 4JI4Q 1A3UA 4A3DH 2WB1B 3J80E 5L37A 1XMOL 4NP5A 3RLFA 4XXEA 1TWGH 1CZWA 4IJLA 1IYJB 3PO2G 5F2DA 4X64Q 1N32L 4BBSB 2SEBD 5C0XH 1EIYB 3UE1A 4CDDC 4LF8Q 2G5DA 4JI6Q 2IPKD 2TSSA 1H9RA 2IX3A 3HS0C 1W3SA 4ODGA 5A35A 4LUOA 1CI3M 2G9DA 1SYBA 4RHSA 4G7OC 1EY5A 4YCVA 4KY7A 3NQTA 1X32A 4GOPB 3ERQA 1HHVA 2PZWA 1PFSA 4ILWA 4EGVA 3GTKB 1XPOA 2VL6A 3AFPA 4R4CA 4XQQA 3S14H 4BA2I 3S16B 4C3HB 5JAVA 1HR0W 3KJPA 1CZGA 1BBUA 4CJ1B 3WOEA 1PV4A 1JR0D 1Q8KA 1UUPA 1NJIC 4DV1Q 4O0AA 4RGOS 3GTQB 4XT3B 2EXDA 1HNXL 1SYCA 2GN5A 1LO5D 2RCNA 4C2MH 4LF9L 5AFWA 4ZAIA 3PIP3 2E2HB 1ET6A 4IFDG 1RTOA 1VQEA 3GTMB 1NY4A 1KLUD 4PV1C 2NVYB 2KENA 3L3OC 3MXUA 1R4PB 1Z47A 3M7NA 4HIDA 4P71A 2L12A 4N8X1 3FVQA 4KHZA 1LLRD 2R61A 1I5FA 2K33A 2LFNA 4H13C 2UUBL 4DK6C 2NVTB 1N32Q 2KEEA 5C3WA 3GTOH 2K01A 1A0IA 1I6HH 5IOCA 3HOUH 4OEMB 1DM0B 5J3BA 2BE5D 1QE6A 3V2TA 2NVQH 4JBKA 2KCTA 1QVFA 4K5XA 4HAEA 1I6VC 4LUZA 4P73A 1CKMA 4KMUC 1BNZA 2F0EA 4LF5L 1ONLA 4EX5A 1OXVA 1ICWA 1K9MC 1LTRD 5IP9G 2WACA 3NPPA 4ZYSA 5I9OA 3R2IA 2DGYA 5E4WC 1O7ZA 5IYCG 1AH9A 4ULLA 2XIWA 1AE2A 3SK5A 3ITPA 3NTKA 3DXJC 1JICA 3PF5A 4BWGB 4RGNA 1F2MA 2WINB 3TMEA 1U5KA 3BU2A 3MWYW 2WAQE 1HNXQ 2RHQB 3S1MH 4LF9Q 1A3TA 2Y0SB 1O78A 4OWTB 2YTVA 2Z0SA 2IHEA 1EUJA 1Y14B 5E1FA 1AW7A 4IN3A 3S1NH 2UUAQ 4FF4A 3H0GB 4HCSA 4Y7NB 1K0SA 5IP7H 1D6EC 4CJ2C 3FDTA 1K3RA 1PTOD 3M4PA 1IW7C 4APVA 1EEFD 4HIKA 2VZAA 4DK3C 1CFMA 3EROA 2JA8H 4BY7H 1L0XB 1NE3A 3QR8A 1WD1A 5BN3A 1ASYA 4KJNA 2B63B 5FO9B 1RCVD 2Q8TA 1V1PA 3HKZG 3PIO3 1I4QA 1SXTA 4GKKL 1S4ZA 4JI5Q 2KHJA 3IFTA 2MFIA 3HOWG 3VA5A 1PTOB 1BKBA 4NMZA 3MEFA 3T1YQ 1GOZA 2CHBD 2D5DA 2ZM6L 4BXXH 1XTCD 3EN2A 4LF5Q 1CK1A 3MTSA 2GA4B 3LX0A 3HOZG 1EY4A 2JXMB 1MJCA 4F88A 4BS9A 2AKWB 4JW0A 1A2UA 1VQ9A 1BBWA 2CH4A 1TR5A 5H1SE 2ZXRA 1JQYD 4KJOA 4R4OA 1SFOH 5C44B 5IGEA 3VYUA 3ERSX 1HNWL 4G7HC 3M4QA 3C2PA 2CQAA 4JC0A 3PUVA 4OIJA 1GUNA 1SNMA 2OT2A 5JJIA 1KAWA 1U4LA 3KF6B 1AP0A 5ELNA 5I2XA 2OF1A 1VQGA 1HFNA 2QF7A 1KNEA 4HJ5A 1EU3A 3U4ZA 4A3IH 1Y1VB 2O5IC 4JI1Q 3CCSA 3G71A 2PMZB 4ZUJA 1CTMA 3DWQA 3Q23A 1U0LA 4DR1L 3C46A 5FLXE 4X6AH 1YNXA 1V9PA 4G4KA 3PO3G 2JQOA 5C4XH 2ASBA 2NZ1D 1Y1WH 3BG3A 2E8GA 1Q3LA 3DM1A 1K83H 1F77A 4A3LG 1XNQQ 2E74C 2R7ZH 2K75A 2C9OA 3KOJA 3N6RA 1HPCA 1T9HA 2F4IA 2B39A 5BN4A 5GQOA 3H3VC 1YJNA 1KRTA 2RDGA 1WCMG 4U673 3OWEB 2ZJQA 2F4VQ 3BVMA 4YWKA 1IBLL 3RLNA 1IYUA 3D6CA 2KBNA 4V190 2VUMG 2E76C 4OXPA 1S5DD 4IALA 2IHFA 3H94A 4K8JA 1LT6D 2A6HC 2EYLA 3I2ZA 4LW1A 2DUDA 1PXUA 2EYMA 2F0UA 4CKBA 1JOOA 2FXQA 3GQBA 2EIFA 4IUNA 3D6WA 2F0DA 2HCCA 3BVZA 2JA7H 2WFWA 1EQTA 1S5FD 3OPOA 2KHSA 3KDFA 1I50B 4QIWE 3A5UA 3VR6A 2B2UA 5HGTA 4FVMA 5IGDA 1O80A 2L9HA 1GUTA 5KNCA 1Z7TA 5M3MB 2F0HA 5CR3A 1TWFB 5AJ3L 2DNCA 3M85A 1ESRA 2A69C 5E4XA 3S1QB 1LTGD 1F2LA 1KTKA 2AUKA 2WIIB 4DR1Q 4N9PA 4A93G 1J5EQ 3MEHA 2CWPA 3PUWA 4LAAA 2ZJPA 5EAYA 3I4NH 2H1EA 4A3DB 4QQBX 1YHBA 2L4NA 2M00A 2XWJB 3K0YA 2OTLA 2EJGC 2ZXOA 1TWGB 2NN6H 2JEAI 4C3IB 3GTPH 2I5HA 4OO1H 1J9OA 4O2DA 1EIHA 2YU9H 2QGQA 1IBLQ 3E5SA 4J15A 4RCNA 1Z6HA 3J7ZC 4YWMA 4GOPA 4FF2A 1U4MA 3SGIA 5JPNC 1HZ9A 4DGZA 2WB1G 2ZTCA 3SR1A 1JE5A 5LMNQ 3A56A 4TRDA 3FRPB 2B2TA 1A63A 4I65A 3VA7A 3S14B 2CFMA 2I46A 4BBSG 4XDXA 3BYYB 5IGBA 2KCMA 3QIAA 3U4VA 3I56A 1WYDA 4MZ9A 1BF4A 3KLSX 2DNEA 1UE7A 2F0WA 3GP7A 4K0KL 3P20A 5AJ3Q 4R8IA 4C2MB 3J7A5 1DONA 2JEBI 4QCLA 1F9PA 2E5LL 1EY0A 3SK4A 2QEJC 2OQ0A 1JJCB 5CMDA 2MQHA 4OO1I 3MFGA 1PH4A 4MNOA 1X56A 1LTSD 1HTLD 4JG2A 1GVPA 1RJTA 2PCFB 2Z1CA 3CCEA 4LF6Q 1HZBA 4TKOB 3TZDA 1EY8A 3HEJA 1TWAH 5KYIA 2HD3A 4DAYB 4A3CG 5CV8A 5EQ0A 1EOVA 5GAEC 4LF7Q 5ELEA 3GTOB 3DM3A 2F3IA 4XT1B 1HA5A 3M3YH 1IZ6A 4HCEA 1I6HB 3HOUB 4OWWB 1B50A 1EYCA 4KN4C 3M7GA 3I4MH 2D0OA 4IUVA 3HKZE 4GZYC 2NVQB 1N34L 1O7LA 5C3EH 5IY0A 3NWTA 2Q2TA 1XTDA 4RG1A 1UEAB 1OXTA 4H0LC 3A7AB 5DM63 2NWGA 4ZQ3A 1WVLA 2NB0A 3MXPA 1ICFB 3DWPA 4DR4L 1NNXA 3X3NA 1YZ6A 2M9VA 3E9HA 3CF5A 4K0KQ 3S1MB 4IO9A 4FF1A 3ER0A 5D3DA 2MJ8A 5M9OA 3ZJYC 4IUQA 3C1FA 1M1KC 2E5LQ 1PVOA 3S1NB 1Q90A 1CHPD 4X3SA 4IJHA 3TEHB 4A4IA 5IYBG 1STNA 3WDNA 4UP8A 5ELFA 1Y8NB 1N33L 3UE0A 2K6AA 2NYZD 4K5WA 1LTLA 5CV5A 2I5MX 2P5ZX 4UY8C 4WJWA 5ELDA 3EQLC 5KYLA 1AZPA 3PV0A 1VQ4A 2JA8B 5IGCA 4BY7B 4JBJA 4OX9L 1KDAA 1E1TA 4YY3L 1SBBB 1HJPA 2Y0SG 3ND9A 4IUUA 5JEAJ 1STHA 1Q7YC 2LY7A 3GTJH 4FF3A 5K5PA 3TBIB 3T1HQ 3F2BA 1K0RA 3H0GG 4JVZA 1JJGA 3URYA 1AEXA 2H5XA 3M4YA 2MPMA 1HZCA 4CKCA 3EJIA 4BBRH 1SE8A 4EQOA 5EPJA 2Z6BA 1TS4A 2I07B 2PNRC 1VQCA 1NUCA 2F03A 3KK7A 4EQNA 2H4OA 1P16A 2EY6A 1UE5A 5J1ZA 2B63G 2D9UA 1EU4A 1SNOA 3DWAA 4DR4Q 3C1EA 4WFN3 1HR0L 3QWNA 1EYAA 1FR3A 1G51A 4DUYL 1SFOB 2K05A 3IAYA 1JWMD 4CDCC 1BCPF 4IPCA 2ZTEA 2BDNA 4POFA 3FHWA 4DR7L 5BR8Q 4L6TB 1W6KA 2PZUA 1UAPA 2BDOA 2ICEC 2VXWA 3NXWA 1HUNA 4KY6A 3HOXH 1CT1D 4TQUS 1MKHA 1JC7A 1EWCA 1HH2P 3K5NA 1ESFA 4K5VA 2Q2IA 1VQAA 4E6IA 3CCMA 3D8GA 1EQRA 1KNAA 1VQPA 4OWXB 3CKIB 2LS01 4GN4B 1VMPA 2KECA 4YCUA 2N88A 4LF8L 2AHOB 2HCIA 5C44G 4A3IB 2J0TD 1SR3A 2UUCQ 4OX9Q 3O13A 5I4DA 4DV0Q 2E2DC 2Q2HA 3CCQA 4NXNQ 1EQQA 1PYBA 2RDFA 2VW9A 1KDCA 1TY2A 4JI0L 1IL2A 4J6HA 1Y1WB 3S2HH 1BO0A 5C5LA 4RKLA 3RZOH 1K83B 2E2JB 1T5EA 4JBMA 1E1OA 4GN5A 3PIPA 1Y1VG 4CGYB 4DV1L 1SE3A 1I3QH 2IL8A 1W2BA 1TWFH 2LKVA 4RHRA 4DK1A 1JB3A 4IOAA 5LMUL 4FO2A 4WORA 1WTXA 2QDBA 3BDOA 1PLFA 4RFBA 1ASZA 3PUXA 2EDGA 1XNRL 3DUZA 3VR5A 1VQMA 1HR0Q 4YIJA 1DOMA 4DUYQ 5IODA 3OWFA 4NKLA 5IYDG 4ALPA 4ZUIA 3EFXD 1FGUA 4A3BH 3IFDA 4DR7Q 2VY3A 1SAPA 1IYVA 2DN8A 3I7FA 4ZK9B 4C3IH 4P72A 2XTIA 1OTCA 1MGSA 2WB1E 2RHSB 3OTOQ 1VF7A 2JA7B 3T13A 3U9OA 3JC66 4DKAC 4KLKA 3CMAA 4DV3L 4X66L 2UXCQ 4KKUA 5DLQE 3IKJA 2FMCA 1LACA 1FL0A 2F3WA 3QG1A 1F9SA 1GHKA 2B2YA 3HRZC 3SDZA 2ES2A 1XYIA 2DJGC 1Y8OB 2VQFL 5IWAL 1STAA 1SYGA 1HNZQ 2YTXA 4GNXC 1X3GA 4JI0Q 3G6JB 1Z9FA 4LFAQ 1YIJA 1PRTC 3I4NB 1D5MC 4ZKBB 3BZCA 1K8AC 1X3PA 4PZ8A 4F87A 3UDIA 2XRQD 1GJXA 4A75A 4JI3L 3GTPB 3DEOA 3STBC 3TREA 1LTID 4LUVA 5M3MG 4WRDA 4LMQD 5LMUQ 5EKLA 1CKOA 1IW7D 2YU9B 2F3VA 3W2DA 3I72A 4P74A 2UUAL 3W3AA 1GKHA 1S40A 4IFDI 3ONAB 2WV6D 4DAMA 4A3DG 1EFWA 4KKTA 2WP8J 1IKLA 2LMCB 4QY7A 4LK1C 4BY1G 4KV6A 3U50C 2EPBA 2E75C 1NR2A 4IZ8A 4LF4L 2OWOA 3PIOA 1XMQL 3VYTA 4DV3Q 1ZKOA 4CDFC 1VMCA 2R7FA 4X66Q 3CCJA 4UP9A 5C0XG 5ISRA 3JAML 4JI5L 3UDGA 2ZT9C 5HGQA 3U9SA 5GAGC 2KCCA 3AU7A 2VQFQ 2CQOA 3TRZA 1KC8C 5IWAQ 4RA8A 3JAMi 3T1YL 1IKMA 1B2TA 3ULPA 1VS0A 4YWLA 1CSQA 1PTOF 1DOLA 4QB4A 3CPWA 1SJHD 4AH6A 1HUMA 4DAYA 4KD4A 5CV7A 4IFDJ 2MHVA 5D14A 1K73C 3DMUA 1YEZA 2NTTA 4JI3Q 3G48A 3OIQA 1TWAB 4RH6A 3HOYH 2A19A 4KK7A 1WI5A 1PH5A 1HQRD 2Z4HA 2A68C 1B44D 2XWBB 3VDYA 3Q0AA 3M3YB 2HT1A 1EY9A 3TP7A 4GS3A 3CCUA 3KJOA 1JT8A 1JCKB 3TN2A 2Y0SE 1S5ED 1HRJA 3FPPA 5KRUA 3I4MB 2QILA 1LTBD 4HR7B 3RN2A 3A8IE 3CCLA 2RVLA 2XNAC 3BZDB 5C3EB 2O4XA 4JI1L 4LF4Q 1A3VA 4RKBA 3FKIH 1XMQQ 1SLJA 1LT4D 1YJ9A 4G57A 2JA9A 3CP0A 4JI2Q 5M5WH 2J4XA 3HOUG 3HFZB 4C3JH 1VDZA 4DF7A 2XN9C 1L1OB 4DR2Q 1PYWD 3CCVA 3DHQA 4OL7A 3C3LA 2KVMA 2N3SA 2B2VC 1XNQL 2QW7A 1SYEA 4B9XA 2EYPA 2A6HD 3CXCA 4R1JA 4G7ZC 3QB3A 3SK8A 2F4VL 4A3FH 3PO3H 1PHJA 5D65A 3L0OA 5TSSA 4M1UB 1FNWA 2EYHA 4PMWA 4HMIA 1LT5D 2B29A 2MP1A 2C35B 2VS1A 4DNTB 1JMCA 3J81L 4JK1C 4A3EH 1KLGD 3F1ZA 5FLMH 1N8RC 1YNJC 3S9WA 3GTJB 2MO0A 3LWUA 2L5TA 5IP7G 2A69D 1CQVA 1M90C 2X69A 2KA7A 4BBRB 3HP3A 4A3GH 1UEBA 1UWVA 2F0LA 1L1OC 3IRBA 4BY7G 3MFYA 3BS1A 1KDBA 2PW5A 1G6ZA 3A0JA 3GTGH 1DYQA 3FMCA 1YHAA 4U68A 3AMUA 1SNDA 1Q12A 4FP5D 1J5EL 1EY6A 2PMZE 3MZ5A 4HEDA 2JA6H 2R93H 1DD2A 5KIXA 5FLXL 5DAUA 2VB3X 3KF8B 4YHHQ 1C7YA 2E2JH 3LWEA 5JVG3 1C9OA 5A2QL 2F1MA 2A1AA 4PZ7A 4HMJA 1IL8A 3T53B 4BXXG 5M3FH 3HOXB 1BBXC 3AB9A 5FJ8H 4TSSA 5I2YA 3Q24A 4R4IA 1YHQA 2RSNA 2IW3A 2NUCA 2SNSA 4DXGA 3T4AC 4PQXA 2PI2E 1QUQB 4LFBL 2Q8RE 2JYOA 3J80c 5ELBA 4PMCA 5EGTA 4A3KH 5LMNL 3WWVA 2Z9HA 3S2DH 4Q5VA 4RMFA 2WKDA 1EIGA 1V1OA 5DEHA 3ULLA 5JOBA 4RGTA 4N8FA 1HZAA 4ZCKA 4O1NA 3RZDB 3S2HB 3LNNA 1TWHH 3RZOB 2BA0A 2JA5G 1I94L 3E0EA 3J7AV 1N9WA 3UI2A 3KLWA 3SXHA 3OW2A 1I3QB 3HGBA 3M4OH 1K8OA 3SE0A 3T16A 1SYFA 4IUPA 4DV5L 2HUGA 4JPBW 3GV6A 3RNUA 1XXGA 1CQFA 4EQPA 5C4XG 3NUCA 1Y1WG 4DA2A 4A3BB 4R8NA 3FEWX 2BA1A 3A74A 3NP8A 2KUMA 5G3LF 2R7ZG 4LF6L 1NCVA 3ULJA 3K58A 1BR9A 4UPAA 2Z4IA 1TQOA 1PH6A 2K5HA 4LF7L 1ENCA 1QWYA 2DJFC 4X62Q 2XVSA 2NVXB 4LFBQ 4DV4L 3BYTB 1EIFA 1DZ1A 1D1KA 3A8JE 1UE6A 2F0TA 2IWHA 4HJ7A 2R7DA 4A3MH 4AYBB 3G7LA 5EJWA 5JJZA 2JA7G 1QVGA 1E2ZA 2RA4A 1S5CD 3JAMc 1X9NA 3HZXA 1A62A 3T51B 1ET9A 4KHPL 1C8CA 1EQVA 2NBFA 1I94Q 1VQ7A 2MGSA 1C0AA 5JEAH 1Y69U 2QEXA 1BUVT 3GDEA 1D7QA 3SEBA 4DV5Q 3HOVH 1PH3A 3RN5A 3KYHC 2QCPX 2VQEL 2K4KA 1LV9A 1U9RA 3I4NG 4R4TA 3NEMA 4C3HG 2FHTA 3PMFA 1B8AA 3V05A 1WTPA 3W1GA 1PMRA 3W1BA 4NW2A 1II3A 1X3FA 3R93A 3CQZH 2K04A 3NWSA 1FNUA 2NN6G 4NPSA 4LFCQ 1UE1A 1B1ZA 1ENFA 1J6QA 4RWSC 4DR6L 3S17H 4OO1G 4QGUA 1R9TH 2UU9Q 3N52A 4AQYL 1B3AA 1WFQA 4MTNA 5C4JH 3T1HL 3ICEA 1MJEA 1E0BA 4DV4Q 2QA4A 2ZXPA 3U58A 1X6OA 4KTAA 4LWCA 3CC7A 2B2VA 1XPRA 3OIPA 2A6EC 2L0CA 3TS2A 1WTWA 1SNQA 4XTCS 4FYDA 4IPGA 4KHPQ 4JCVE 5COYA 3RMHA 1TT2A 3UDXA 2EYOA 1SMYC 5BR8L 1HCZA 3TZUA 3HOYB 4GKJL 1PYSB 5ELCA 2D0PA 4JBWA 3I8ZA 2X6GA 1KQSA 4NXML 3TQYA 5CBEE 3K81C 4ABNA 1Q82C 4JI7L 1GXDC 1ZXTA 3LGJA 2PNHA 5I6YA 2VQEQ 2ATWA 2UXDQ 3J7YW 3H6MA 1R4QB 3K7AH 1TIID 2UXBL 3CC2A 1PFNA 3CC4A 3J81c 1SYDA 1LABA 3K5OA 4DUZQ 2UUCL 2LSSA 1QCBD 3FKIB 4DV0L 3MHBA 4DR6Q 3AFQA 1L1OA 1JB7A 1G6PA 1QJOA 5K36H 3K6OA 4AQYQ 4NXNL 2EYFA 1SNPA 3AEVA 4A3JH 3G4SA 5M5WB 4B08A 4C3JB 3NSWA 5CV9A 2R92H 2C5CA 2F0MA 1GUOA 2PZTA 2LXKA 3A54A 3I4MG 3QOLA 2F0GA 2ALYB 1E2VA 5IT9L 5C3EG 3RLOA 3TSSA 1CHQD 3PO3B 4A3FB 1VCIA 1E7ZA 1JORA 5FLXc 1U4PA 2A5HA 4L8JA 3RR5A 4PZ6A 5M5YH 1LYLA 1IHZA 4J1MA 1JJ2A 1VQ5A 1PZKD 1D2BA 4H44C 4GKJQ 4CKEA 5GROA 3A5ZB 5C3XA 1FJGQ 4P75A 3PQIA 4A3EB 1G91A 4NXMQ 1NMFA 4GLVB 1K3BC 1FGBD 3P1HA 3Q6SA 4JI7Q 3OTOL 1XNRQ 2B3GA 2K5QA 2UXBQ 2VNUD 3ZYYX 3NBHB 1NAPA 1VQJA 2UXCL 1PH7A 4JI8Q 3S15H 1PFBA 4A3GB 5I9PA 2YYZA 2EYJA 2K1BA 2QKIC 2RBMA 3MXNB 1PRTD 1EOTA 3I4LA 2D2CC 1E22A 3R2TA 2HDMA 2AQ3B 3QJYA 3TS0A 3PO2H 3VYSA 3GTGB 4DPGA 1OXXK 3KF8A 4QUCA 3E0JA 4F7XA 1HNZL 1GM5A 1MI2A 1ILQA 1GUWA 4L63B 5CYUA 2JA6B 2R93B 4LFAL 3PUYA 3STBD 2PQEA 3RZDH 3H09A 2AWNA 4FDBA 2PW7A 4XYQA 4DR5Q 1DJRD 3KLSA 4BBRG 4OIKA 1STGA 5FK9C 1BVSA 1H9MA 2HHHL 1L0YB 2K50A 1D1IA 4TVAB 4X3KA 5M3FB 4GNXB 3PUZA 1QUQA 4FXKC 1F9QA 2K5VA 1PRTB 3BDLA 1D5ZC 4PMBA 3CW2C 3NE5B 1TU2B 4Z9CB 1KAAA 1XJVA 2EY2A 2PQAA 1ZYRC 2A74C 4X65L 3E6ZX 2KHIA 1AN8A 1P8LA 3I90A 4A76A 3I91A 4QUFA 4A3KB 3CCRA 1X65A 4PG3A 4CJ0B 3J80L 3S2DB 3HOXG 4X3TA 4IFDH 2EY1A 3A7LA 4HIMA 1WTVA 3J80i 1TWHB 4KN7C 3CAMA 2NVXH 1QOHA 2VB2X 2NTSA 3I3CA 5D3IB 2CH4W 4BY1H 4WJ3M 1A6XA 4UHVA 1KXLA 3M4OB 4XYOA 5DNFA 1YI2A 3OYYA 1ILPA 2AUJD 4K14A 1STYA 1NR4A 3TP8A 1B4OA 1IBML 4B3MQ 5LL6X 4K2KA 1RIPA 4M8AA 2ICIA 5J39A 2A68D 4I7ZC 3GTLH 2HHHQ 4F8MA 5IE8A 1E24A 1C48A 3F2CA 3B6YA 2FINB 1PH2A 1MD2D 3IL8A 4FXGC 3R3OA 4HJ8A 5IP9H 2KCNA 1KL9A 4X65Q 5IYCH 1E2WA 2B2UC 3ND8A 1BCPC 2B2WC 1JWUD 4JOIC 2KQ3A 1NTGA 4HTHA 3H15A 1YBYA 4A3BG 2O2LD 1KHIA 1NBWA 4JYAL 3F8TA 3KUPA 3FPUB 3S1RH 4C3IG 5KNBA 1LM0A 4A3MB 3UDFA 2E2IH 2MUYA 1OXSC 1SRUA 2F0FA 4MN3A 3TP6A 3K59A 4HSVA 1KRSA 4KKSA 4JI2L 2HQLA 3D4RA 1F9RA 1K8GA 1QG7A 1XMOQ 5C0XI 4DR2L 4DR3L 4L5SA 2RSOA 1JOQA 2AQ1B 2V1CC 3D4DA 4MIUA 3HOVB 1I4PA 1KIXA 1QZHA 1IBMQ 2F0PA 4AYBG 4GOPC 1GUGA 3JAME
chains in the Genus database with same CATH topology
2AWOA 1QB5D 4N9TA 5HURA 2IX1A 5C6AA 1YNJD 3CQZB 2M2LA 2B2TC 4O42A 5DM73 3MC0B 1AZQA 4KI0A 3L7ZC 1LTTD 3S17B 1R9TB 3GV3A 4KHVA 1I4HA 2WAQB 5C4JB 1K8MA 1X3QA 4C1NK 2XSCA 2K7VA 2DY8A 2KOLA 4X3UA 4CHTB 1MBYA 4UDUC 4DAVA 5JPMC 4B9WA 5C0XJ 2BOSA 4ZLTF 5EBDA 5T1GA 4Q0FA 3A55A 4UAIA 1JWSD 2FJ2A 3K57A 5CGKA 1U4RA 2XRSD 4ID6A 1NSNS 1TS2A 1B53A 3NTHA 3MVVA 2DY7A 3VYRA 1J8IA 4DU9A 4HSPA 3K7AB 5IGFA 5CBAE 5KGUA 4K6LA 1G291 1HQMC 3OMGA 1BOSA 3Q22A 4FXDA 1W6JA 1PZID 2BE5C 3K5MA 4A3JB 2EE1A 2R3ZA 2IT1A 4DFAA 1GUSA 2R92B 1Q1EA 1RKNA 2J7ZA 1FYCA 2F0IA 3J81E 3NK9A 1M4VA 3NQIA 1FD7D 1G8ZD 1SDFA 2SDFA 1F2ZA 1QILA 5BN5A 1TY0A 5C4HA 1CA5A 1T5XD 3V96A 4QF4A 3OW7A 1F2YA 5M5YB 3OSOA 4C3JG 1TVXA 3F2UA 3RD4A 1G2TA 1EYDA 2B8FA 3NBIA 3NBHA 2WKCA 2ENBA 2R6GA 2ID0A 1PTOC 3X3MA 3D31A 1C4QA 1ENAA 4OHJA 1H9SB 2F0OA 1RTNA 3MXNA 1TS5A 3P7JA 1I4GA 3SVMA 4R9WA 5A2QE 3S15B 1H9KA 2KEDA 3VR3A 1SJED 1RDPD 1JOKA 1RHPA 1SNCA 3TP5A 1FNVA 2BCOA 3PO2B 4S3SA 4DNRB 1V8QA 3GO5A 5I6WA 5CORA 3RUZA 2F0QA 4H7BA 1WD0A 1STEA 1MSHA 1EEID 3KLRA 2SNMA 1CA6A 3D3RA 4QIWB 4IURA 2OXPA 2IX0A 5EPKA 1ZEQX 3TDQA 2N55A 1HFGA 2F0JA 3HG9A 2X6LA 4K2LA 2RKSA 3OHXC 2D62A 4IUTA 2B2WA 5CV4A 1WTQA 2KJXA 1XX8A 1SE2A 2L55A 2Q8IB 2FFKB 1I4XA 3EA6A 5C4ZA 1M8AA 2EJFC 3MAQA 3KBXA 1LT3D 5EKKA 5T1IA 5KEEA 3VR2A 1D5XC 4BY1B 2A6ED 1EL0A 4DN4M 2HDLA 4LJZC 4NDXA 2EY5A 1SMYD 2JE6I 2K5WA 2Z8LA 3GTLB 2SOBA 1EZ8A 4J8QA 3NTIA 1ML0D 2IJ0A 3CRLC 5IGGA 2EJMA 1Q8IA 4XQJA 5G3LD 1RODA 1WTOA 5FKAC 2JSOA 1EFID 3L9AX 4DAPA 1H9JA 1UNSA 2B2YC 4IQZA 3P75A 2V4DA 2FMMA 5JVH3 3S1RB 1B9NA 2E2IB 1CM9A 2NN6I 1DXMA 2CVRA 3J7AF 3GD7A 2K5DA 4XIGS 2EOTA 1WTRA 2RQXA 4MHEA 4HN7A 3OMCA 2HQEA 1Y8PB 1SSOA 1B9MA 4ZKCB 4KY5A 1PDQA 1EY7A 3HKZB 4OGQC 4ZRZA 4EVOA 2G9HD 5FO8B 3HOWB 4BA1I 1TWCB 2K03A 3BVGA 4KD3A 5JEAG 1PFMA 2F0KA 3MA2B 1G2SA 5EKIA 4C1NI 3HOZB 1QNKA 4RGMA 1TS3A 3QOJA 1I4RA 2AQ2B 2EZVA 4PNYA 1PZJD 5FO7B 3CU7A 1PTOH 1V1PB 1DCZA 3OOCA 2K28A 2JP1A 1S5BD 3WOFA 1AFPA 1HXYD 5C5MA 2CW0D 3BDCA 2F0VA 2EXZA 1ZYRD 5LL6S 2K32A 1DOKA 2PO4A 3DEPA 5KNDA 1V43A 4DXFA 1O7YA 1EZ6A 1PRTF 2O5JC 3SHLA 5IT9E 1YNND 1GHJA 1SE4A 1A15A 1LTAD 5EPLA 1TKWB 2PPBC 1WCMB 3KBGA 3K5LA 4FNFA 2EVBA 2RDHA 4K8IA 3MXGA 2VUMB 3R8BA 3H91A 1RD9D 4C56C 1OXUA 4RAUC 3QO2A 5CC4A 3D4WA 5FOBB 2PYKA 4DK0A 1SEBD 1BQQT 5EBCA 2TMPA 5M5XB 5K36G 2A73B 2L1BA 3I73A 3NHHA 2F0SA 2JA5B 4P2CB 1Q1BA 1BXTA 5LHY1 1HA6A 3A8KE 1H9SA 4XQNA 1RF2D 1BCPD 1A2TA 1QNUA 1XWEA 2CW0C 5NUCA 3CRKC 4A93B 1MSGA 1KABA 5C4XB 2B8GA 3T56B 5J22A 1JE4A 1STBA 5IIFA 4K6DA 5E3FA 1OO9B 4ME5A 2OEOA 4RCOA 2R7ZB 1BDOA 5CV6A 4QMGA 1HTPA 3I70A 2F0NA 3SK6A 3VR4A 1EWHA 2L11A 1YNNC 1VF5C 1BCPB 3EVQA 3CHBD 4CBVA 4V0BA 1A3UA 2WB1B 3J80E 4NP5A 3RLFA 4XXEA 1CZWA 5F2DA 4BBSB 2SEBD 5C0XH 2IPKD 2TSSA 1H9RA 2IX3A 3HS0C 4ODGA 5A35A 1CI3M 2G9DA 1SYBA 4RHSA 4G7OC 1EY5A 4KY7A 3NQTA 1X32A 3ERQA 1HHVA 2PZWA 4ILWA 4EGVA 3GTKB 4XQQA 4BA2I 3S16B 4C3HB 5JAVA 1CZGA 4CJ1B 3WOEA 1JR0D 1UUPA 4RGOS 3GTQB 4XT3B 1SYCA 1LO5D 5AFWA 4ZAIA 3PIP3 2E2HB 1ET6A 4IFDG 1RTOA 3GTMB 1KLUD 4PV1C 2NVYB 3L3OC 3MXUA 1R4PB 1Z47A 3M7NA 2L12A 3FVQA 4KHZA 1LLRD 2R61A 2K33A 2LFNA 4H13C 2NVTB 2KEEA 5C3WA 2K01A 5IOCA 1DM0B 2BE5D 1QE6A 3V2TA 4K5XA 4HAEA 1I6VC 4KMUC 1BNZA 2F0EA 1ONLA 1OXVA 1ICWA 1LTRD 2WACA 3NPPA 4ZYSA 5I9OA 3R2IA 5E4WC 1O7ZA 4ULLA 2XIWA 3SK5A 3ITPA 3NTKA 3DXJC 1JICA 4BWGB 4RGNA 1F2MA 2WINB 3TMEA 3MWYW 1A3TA 2Y0SB 1O78A 5E1FA 1AW7A 4IN3A 4FF4A 3H0GB 4HCSA 4Y7NB 1D6EC 4CJ2C 3FDTA 1PTOD 1IW7C 1EEFD 1CFMA 3EROA 1L0XB 1WD1A 5BN3A 4KJNA 2B63B 5FO9B 1RCVD 2Q8TA 1V1PA 3PIO3 1I4QA 1SXTA 1S4ZA 3IFTA 3VA5A 1PTOB 4NMZA 1GOZA 2CHBD 2D5DA 1XTCD 1CK1A 3MTSA 2GA4B 3LX0A 1EY4A 2JXMB 4F88A 4BS9A 1A2UA 1TR5A 2ZXRA 1JQYD 4KJOA 5C44B 5IGEA 3VYUA 4G7HC 3C2PA 2CQAA 3PUVA 4OIJA 1GUNA 1SNMA 2OT2A 1U4LA 1AP0A 5I2XA 2OF1A 1HFNA 2QF7A 1KNEA 1EU3A 1Y1VB 2O5IC 2PMZB 4ZUJA 1CTMA 3DWQA 3Q23A 3C46A 5FLXE 4G4KA 2NZ1D 3BG3A 1Q3LA 3DM1A 1F77A 2E74C 2C9OA 3N6RA 1HPCA 2F4IA 2B39A 5BN4A 3H3VC 2RDGA 4U673 3OWEB 3BVMA 1IYUA 3D6CA 4V190 2E76C 1S5DD 4IALA 3H94A 4K8JA 1LT6D 2A6HC 2EYLA 2EYMA 1PXUA 2F0UA 4CKBA 1JOOA 3GQBA 4IUNA 3D6WA 2F0DA 2HCCA 3BVZA 1EQTA 1S5FD 3OPOA 2KHSA 1I50B 3VR6A 2B2UA 5HGTA 4FVMA 5IGDA 1O80A 2L9HA 1GUTA 5KNCA 1Z7TA 5M3MB 2F0HA 5CR3A 1TWFB 3M85A 2DNCA 1ESRA 2A69C 5E4XA 3S1QB 1LTGD 1F2LA 1KTKA 2AUKA 2WIIB 4N9PA 3MEHA 3PUWA 4LAAA 2H1EA 4A3DB 2L4NA 2M00A 2XWJB 3K0YA 2EJGC 2ZXOA 1TWGB 2NN6H 2JEAI 4C3IB 4OO1H 1J9OA 1EIHA 3E5SA 4RCNA 1Z6HA 4FF2A 1U4MA 5JPNC 4DGZA 3SR1A 3A56A 4TRDA 3FRPB 2B2TA 4I65A 3VA7A 3S14B 2I46A 4XDXA 3BYYB 5IGBA 3QIAA 1BF4A 3KLSX 2DNEA 3GP7A 2F0WA 3P20A 4R8IA 4C2MB 1DONA 2JEBI 4QCLA 1F9PA 1EY0A 3SK4A 2QEJC 5CMDA 4OO1I 3MFGA 1LTSD 1HTLD 1RJTA 2PCFB 2Z1CA 4TKOB 3TZDA 1EY8A 3HEJA 5KYIA 5CV8A 5EQ0A 5ELEA 3GTOB 4XT1B 1HA5A 4HCEA 1I6HB 3HOUB 1B50A 1EYCA 4KN4C 3M7GA 4IUVA 4GZYC 2NVQB 1O7LA 3NWTA 1UEAB 1OXTA 4H0LC 3A7AB 5DM63 2NWGA 4ZQ3A 1WVLA 2NB0A 3MXPA 3DWPA 3X3NA 2M9VA 3S1MB 4FF1A 5D3DA 2MJ8A 5M9OA 4IUQA 3C1FA 3S1NB 1Q90A 1CHPD 4X3SA 1STNA 3WDNA 5ELFA 1Y8NB 2K6AA 2NYZD 4K5WA 5CV5A 4WJWA 5ELDA 3EQLC 5KYLA 1AZPA 3PV0A 2JA8B 5IGCA 4BY7B 1KDAA 1SBBB 3ND9A 4IUUA 5JEAJ 1STHA 2LY7A 4FF3A 5K5PA 3TBIB 3URYA 1AEXA 3M4YA 2MPMA 4CKCA 3EJIA 4EQOA 5EPJA 1TS4A 2I07B 2PNRC 1NUCA 2F03A 3KK7A 4EQNA 2H4OA 2EY6A 5J1ZA 2D9UA 1EU4A 1SNOA 3DWAA 3C1EA 4WFN3 3QWNA 1EYAA 1FR3A 1SFOB 2K05A 3IAYA 1JWMD 1BCPF 2BDNA 4L6TB 1W6KA 2PZUA 1UAPA 2BDOA 2ICEC 2VXWA 3NXWA 1HUNA 4KY6A 1CT1D 4TQUS 1JC7A 1EWCA 3K5NA 1ESFA 4K5VA 4E6IA 3D8GA 1KNAA 3CKIB 2LS01 1VMPA 2KECA 2N88A 2HCIA 4A3IB 2J0TD 3O13A 5I4DA 2E2DC 2RDFA 1KDCA 1TY2A 4J6HA 1Y1WB 1BO0A 5C5LA 4RKLA 1K83B 2E2JB 1T5EA 4CGYB 1SE3A 2IL8A 2LKVA 4RHRA 4DK1A 1JB3A 4FO2A 4WORA 1WTXA 2QDBA 3BDOA 1PLFA 4RFBA 3PUXA 2EDGA 3DUZA 3VR5A 4YIJA 1DOMA 5IODA 3OWFA 4NKLA 4ZUIA 3EFXD 3IFDA 1SAPA 1IYVA 2DN8A 4ZK9B 1MGSA 1VF7A 2JA7B 3T13A 3U9OA 4KKUA 3IKJA 2FMCA 1LACA 2F3WA 3QG1A 1F9SA 1GHKA 2B2YA 3HRZC 3SDZA 1XYIA 1Y8OB 1STAA 1SYGA 3G6JB 1PRTC 3I4NB 1D5MC 4ZKBB 1X3PA 4F87A 2XRQD 1GJXA 3GTPB 3DEOA 1LTID 4WRDA 4LMQD 5EKLA 1IW7D 2YU9B 2F3VA 3W2DA 3I72A 3W3AA 4IFDI 3ONAB 2WV6D 4KKTA 2WP8J 1IKLA 2LMCB 4LK1C 4KV6A 2EPBA 2E75C 1NR2A 4IZ8A 3VYTA 1ZKOA 1VMCA 5C0XG 5ISRA 3JAML 2ZT9C 3U9SA 2KCCA 3AU7A 4RA8A 1IKMA 1B2TA 1PTOF 1DOLA 4QB4A 1SJHD 1HUMA 4DAYA 4KD4A 5CV7A 4IFDJ 2MHVA 5D14A 3DMUA 2NTTA 3OIQA 1TWAB 4RH6A 4KK7A 1HQRD 2Z4HA 2A68C 1B44D 2XWBB 3Q0AA 3M3YB 1EY9A 3TP7A 1JCKB 3TN2A 1S5ED 1HRJA 3FPPA 5KRUA 3I4MB 2QILA 1LTBD 4HR7B 3A8IE 2RVLA 2XNAC 3BZDB 5C3EB 2O4XA 1A3VA 4RKBA 1LT4D 4G57A 2J4XA 1VDZA 4DF7A 2XN9C 1PYWD 3DHQA 4OL7A 3C3LA 2KVMA 2B2VC 1SYEA 4B9XA 2EYPA 2A6HD 4G7ZC 3QB3A 3SK8A 5D65A 5TSSA 4M1UB 1FNWA 2EYHA 4PMWA 4HMIA 1LT5D 2MP1A 4DNTB 3J81L 4JK1C 1KLGD 1YNJC 3S9WA 3GTJB 3LWUA 2L5TA 2A69D 1CQVA 2X69A 2KA7A 4BBRB 3HP3A 2F0LA 3MFYA 3BS1A 1KDBA 2PW5A 1G6ZA 1DYQA 3FMCA 4U68A 3AMUA 1SNDA 1Q12A 4FP5D 1EY6A 3MZ5A 4HEDA 1DD2A 5KIXA 5FLXL 5DAUA 2VB3X 3LWEA 5JVG3 5A2QL 2F1MA 4HMJA 1IL8A 3T53B 3HOXB 1BBXC 3AB9A 4TSSA 5I2YA 3Q24A 2RSNA 2IW3A 2NUCA 2SNSA 4DXGA 3T4AC 4PQXA 2Q8RE 2JYOA 5ELBA 4PMCA 5EGTA 4Q5VA 2WKDA 1EIGA 1V1OA 5DEHA 5JOBA 4RGTA 3RZDB 4O1NA 3S2HB 3LNNA 3RZOB 2BA0A 3J7AV 3UI2A 3SXHA 1I3QB 3HGBA 1K8OA 3SE0A 3T16A 1SYFA 4IUPA 2HUGA 3GV6A 1XXGA 1CQFA 4EQPA 3NUCA 4DA2A 4A3BB 4R8NA 3FEWX 2BA1A 3NP8A 2KUMA 5G3LF 1NCVA 3K58A 1BR9A 2Z4IA 1TQOA 1ENCA 1QWYA 2XVSA 2NVXB 3BYTB 1DZ1A 1D1KA 3A8JE 2F0TA 2IWHA 4AYBB 3G7LA 5EJWA 5JJZA 1E2ZA 2RA4A 1S5CD 3HZXA 3T51B 1ET9A 1C8CA 1EQVA 2NBFA 2MGSA 5JEAH 1Y69U 1BUVT 3SEBA 2QCPX 1LV9A 1U9RA 4C3HG 2FHTA 3PMFA 3V05A 1WTPA 1PMRA 4NW2A 1II3A 3R93A 2K04A 3NWSA 1FNUA 2NN6G 1B1ZA 1ENFA 4RWSC 4OO1G 3N52A 1B3AA 1E0BA 2ZXPA 4KTAA 2B2VA 2A6EC 3OIPA 2L0CA 1WTWA 1SNQA 4XTCS 4FYDA 5COYA 3RMHA 1TT2A 2EYOA 1SMYC 1HCZA 3TZUA 3HOYB 5ELCA 4JBWA 3I8ZA 2X6GA 5CBEE 4ABNA 1GXDC 1ZXTA 5I6YA 3J7YW 3H6MA 1R4QB 1TIID 1PFNA 1SYDA 1LABA 3K5OA 1QCBD 3FKIB 3MHBA 1QJOA 5K36H 3K6OA 2EYFA 1SNPA 5M5WB 4B08A 4C3JB 3NSWA 5CV9A 2C5CA 2F0MA 1GUOA 2PZTA 3A54A 3QOLA 2F0GA 1E2VA 5IT9L 3TSSA 1CHQD 3PO3B 4A3FB 1VCIA 1JORA 1U4PA 2A5HA 4L8JA 1IHZA 4J1MA 1PZKD 1D2BA 4H44C 4CKEA 5C3XA 4A3EB 1G91A 1FGBD 3P1HA 3Q6SA 2K5QA 2VNUD 3ZYYX 1NAPA 1PFBA 4A3GB 5I9PA 2YYZA 2EYJA 2K1BA 2QKIC 2RBMA 1PRTD 1EOTA 3I4LA 2D2CC 3R2TA 2HDMA 2AQ3B 3QJYA 3VYSA 3GTGB 1OXXK 3KF8A 4QUCA 3E0JA 4F7XA 1MI2A 1ILQA 1GUWA 4L63B 5CYUA 2JA6B 2R93B 3PUYA 2PQEA 3H09A 2AWNA 2PW7A 4XYQA 1DJRD 3KLSA 4OIKA 1STGA 5FK9C 1H9MA 1L0YB 1D1IA 4X3KA 5M3FB 3PUZA 4FXKC 1F9QA 1PRTB 3BDLA 1D5ZC 4PMBA 3NE5B 1TU2B 4Z9CB 1KAAA 2EY2A 1ZYRC 2A74C 3E6ZX 1AN8A 3I90A 3I91A 4QUFA 4A3KB 4CJ0B 3J80L 3S2DB 4X3TA 4IFDH 2EY1A 3A7LA 1WTVA 1TWHB 4KN7C 1QOHA 2VB2X 2NTSA 3I3CA 5D3IB 1A6XA 3M4OB 4XYOA 5DNFA 1ILPA 2AUJD 4K14A 1STYA 1NR4A 3TP8A 1B4OA 5LL6X 4K2KA 4M8AA 2ICIA 5J39A 2A68D 4I7ZC 4F8MA 1C48A 2FINB 1MD2D 3IL8A 4FXGC 3R3OA 2KCNA 1E2WA 2B2UC 3ND8A 1BCPC 2B2WC 1JWUD 2KQ3A 4HTHA 2O2LD 3KUPA 3FPUB 4C3IG 5KNBA 4A3MB 2MUYA 1OXSC 2F0FA 4MN3A 3TP6A 3K59A 4HSVA 4KKSA 3D4RA 1F9RA 1QG7A 5C0XI 2RSOA 1JOQA 2AQ1B 4MIUA 3D4DA 3HOVB 1I4PA 2F0PA 1GUGA 3JAME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D5X C;  1TY0 A;  1RF2 D;  1TS3 A;  1XTC D;  2XNA C;  1KLU D;  3BZD B;  4DXG A;  1CK1 A;  5ELE A;  1BCP D;  1T5X D;  4L6T B;  3SEB A;  1PRT C;  1D5M C;  1HA5 A;  1I4R A;  4RGM A;  1LT4 D;  3MC0 B;  1CT1 D;  2AQ2 B;  1GOZ A;  5ELB A;  1PZJ D;  1LTG D;  1EWC A;  1KTK A;  1LLR D;  1LTT D;  1ESF A;  2R61 A;  2XRQ D;  1JQY D;  1PTO H;  1V1P B;  2NTS A;  3TSS A;  1I4H A;  3V05 A;  2J4X A;  5D3I B;  1CHQ D;  1LTI D;  2XN9 C;  1PYW D;  1V1O A;  4RCO A;  1PTO C;  1S5B D;  2Z8L A;  1FNU A;  4RGT A;  4UDU C;  4O1N A;  3W2D A;  4OHJ A;  1B1Z A;  1ENF A;  3O13 A;  1TS5 A;  3DWP A;  2IJ0 A;  2WV6 D;  1PZK D;  5I4D A;  1I4G A;  1HXY D;  1BCP B;  2ICI A;  3CHB D;  5FKA C;  1TY2 A;  1SJE D;  1JWS D;  1EFI D;  5TSS A;  1FGB D;  1RDP D;  1UNS A;  1FNW A;  1EU3 A;  1LTR D;  1LT5 D;  2XRS D;  1FNV A;  5D3D A;  4DXF A;  1XXG A;  4ZYS A;  3R2I A;  1MD2 D;  1TS2 A;  3DWQ A;  1CHP D;  1SE3 A;  1PRT F;  4BWG B;  4RGN A;  1KLG D;  4RHR A;  5ELF A;  1PRT D;  1BCP C;  1JWU D;  2SEB D;  1STE A;  4RFB A;  3R2T A;  1SE4 A;  2AQ3 B;  1LTA D;  5ELD A;  1EEI D;  2O2L D;  1F77 A;  1CQV A;  2IPK D;  2TSS A;  1AW7 A;  4L63 B;  3BYY B;  1SBB B;  2RDH A;  3EFX D;  1D6E C;  1PTO F;  4RHS A;  4K6L A;  5ELC A;  3KLS X;  3R8B A;  1PTO D;  2RDG A;  1DJR D;  3OWE B;  1SJH D;  3BVM A;  1EEF D;  1RD9 D;  3GP7 A;  5FK9 C;  3BYT B;  4C56 C;  3URY A;  1DYQ A;  1L0Y B;  1L0X B;  2NTT A;  1S5D D;  1PZI D;  1PRT B;  1LT6 D;  1SE2 A;  4RH6 A;  1D5Z C;  1SEB D;  2G9H D;  2QEJ C;  4Z9C B;  1TS4 A;  1JR0 D;  1HQR D;  1UUP A;  2AQ1 B;  1RCV D;  3MFG A;  1V1P A;  4RGO S;  1S5C D;  3BVG A;  1B44 D;  1I4Q A;  1SXT A;  1LTS D;  1AN8 A;  1ET9 A;  1I4X A;  1LO5 D;  1I4P A;  1HTL D;  3EA6 A;  3BVZ A;  1M4V A;  1JCK B;  1EU4 A;  3DWA A;  1FD7 D;  1ET6 A;  1G8Z D;  1S5E D;  1LT3 D;  1S5F D;  4TSS A;  1BXT A;  1PTO B;  1QIL A;  2QIL A;  1LTB D;  2CHB D;  1JWM D;  1BCP F; 
#chains in the Genus database with same CATH topology
 1QZG A;  2AWO A;  3AYH B;  3HOW H;  1QB5 D;  4N9T A;  1TWC H;  4B3T L;  5HUR A;  2IX1 A;  5C6A A;  1YNJ D;  3CQZ B;  1CKN B;  2M2L A;  2B2T C;  3PSI A;  4O42 A;  2RF4 A;  5DM7 3;  1H95 A;  3MC0 B;  2Q2U A;  1AZQ A;  4KI0 A;  3L7Z C;  1LTT D;  3S17 B;  3HOZ H;  1R9T B;  3GV3 A;  4KHV A;  1I4H A;  3K80 C;  1GD7 A;  1IBK L;  2WAQ B;  3EBE A;  1K8M A;  1X3Q A;  5C4J B;  4C1N K;  2XSC A;  2K7V A;  2DY8 A;  2KOL A;  4X3U A;  4CHT B;  1VQO A;  2JK8 A;  1MBY A;  4UDU C;  1B70 B;  1S72 A;  3E3X A;  4DAV A;  5JPM C;  2RCF A;  4B9W A;  4JYA Q;  5C0X J;  2BOS A;  4ZLT F;  1XPU A;  5EBD A;  5T1G A;  4Q0F A;  2BH2 A;  3A55 A;  4UAI A;  1JWS D;  2FJ2 A;  1CUK A;  1VQ6 A;  3K57 A;  5CGK A;  1U4R A;  1KD1 C;  2XRS D;  4ID6 A;  1NSN S;  1WOC A;  1TS2 A;  1B53 A;  5IT9 c;  4DR3 Q;  4YHH L;  3PGZ A;  3NTH A;  3MVV A;  2DY7 A;  3VYR A;  2UUB Q;  2CCZ A;  1J8I A;  1CSP A;  4DU9 A;  4HSP A;  3K7A B;  5IGF A;  5CBA E;  4B3T Q;  5KGU A;  2NZH A;  4K6L A;  1G29 1;  4A3L H;  4DV6 L;  4DNI A;  1HQM C;  2YTY A;  3OMG A;  4OEL B;  1BOS A;  3HOY G;  3Q22 A;  4FXD A;  1WCM H;  1W6J A;  1YVC A;  1PZI D;  2BE5 C;  1IBK Q;  3K5M A;  1FVI A;  4A3J B;  2EE1 A;  1VQF A;  2R3Z A;  2IT1 A;  4DFA A;  3J81 i;  1GUS A;  2VUM H;  2R92 B;  1Q1E A;  1RKN A;  1E3P A;  5GAH C;  1EWI A;  2J7Z A;  1FYC A;  3I4O A;  2F0I A;  1EYG A;  3J81 E;  3NK9 A;  4UP7 A;  1M4V A;  3NQI A;  1RL2 A;  1FD7 D;  1G8Z D;  2JA8 G;  1SDF A;  2SDF A;  1F2Z A;  1QIL A;  3FKI G;  1N36 L;  3DLL A;  5BN5 A;  4HIO A;  1TY0 A;  5C4H A;  5M5X H;  3J81 j;  1CA5 A;  1T5X D;  2Z6K C;  3V96 A;  4QF4 A;  3OW7 A;  1F2Y A;  5M5Y B;  3OSO A;  3L2P A;  4C3J G;  2JA5 H;  2MNA A;  1WJJ A;  1TVX A;  2ZTD A;  3F2U A;  3RD4 A;  1G2T A;  1EYD A;  2B8F A;  3NBI A;  3NBH A;  2WKC A;  2ENB A;  2R6G A;  2ID0 A;  1VQN A;  1PTO C;  3X3M A;  3D31 A;  1C4Q A;  1ENA A;  2CKZ B;  4OHJ A;  1H9S B;  2F0O A;  4A93 H;  1RTN A;  4A3F G;  3MXN A;  4GKK Q;  1TS5 A;  3P7J A;  1I4G A;  3SVM A;  4R9W A;  5A2Q E;  4X62 L;  3S15 B;  3M9B A;  1H9K A;  2KED A;  3VR3 A;  4DV6 Q;  1SJE D;  1PH8 A;  2ZM6 Q;  1YIT A;  1RDP D;  3AQQ A;  1JOK A;  1RHP A;  5E7N A;  1SNC A;  2JN4 A;  2PQA B;  3TP5 A;  2AMC B;  1FNV A;  2BCO A;  3PO2 B;  4A3E G;  4IOC A;  4S3S A;  4DNR B;  5FLM G;  2MO1 A;  1PA6 A;  1V8Q A;  3GO5 A;  4GNX A;  5I6W A;  5COR A;  3RUZ A;  2F0Q A;  2BH8 A;  4H7B A;  1WD0 A;  1STE A;  1MSH A;  1HNW Q;  4A3G G;  1EEI D;  4A3I G;  1VQI A;  4EQ5 A;  3KLR A;  2SNM A;  1CA6 A;  4NB3 A;  3D3R A;  1N36 Q;  4GN3 B;  4QIW B;  3BJU A;  4IUR A;  2OXP A;  1Q81 C;  2IX0 A;  2N78 A;  5EPK A;  3KFU A;  1ZEQ X;  3TDQ A;  1PH1 A;  4BBS H;  2N55 A;  1L0W A;  1HFG A;  1K28 A;  2JA6 G;  2R93 G;  2F0J A;  1SMX A;  3HG9 A;  4JV5 L;  1AE3 A;  2X6L A;  4K2L A;  4YCW A;  1YJW A;  2RKS A;  3OHX C;  2D62 A;  4IUT A;  2B2W A;  4JOI A;  5CV4 A;  1WTQ A;  2KJX A;  1XX8 A;  1SE2 A;  2L55 A;  4HJ9 A;  2Q8I B;  5M3F G;  4LFC L;  5FJ8 G;  2K14 A;  2F52 A;  3GTK H;  2FFK B;  4H02 A;  1I4X A;  1VQH A;  3EA6 A;  5C4Z A;  2UU9 L;  4OON A;  1M8A A;  2EJF C;  3MAQ A;  3KBX A;  1VQK A;  3S16 H;  4C3H H;  2K5N A;  1LT3 D;  5EKK A;  5T1I A;  4HJA A;  5KEE A;  3S24 A;  3VR2 A;  1D5X C;  4BY1 B;  2A6E D;  3CME A;  3EIV A;  3GTQ H;  4A3K G;  4QJF A;  4B3R L;  1X3E A;  1EL0 A;  4CDE C;  4DN4 M;  2HDL A;  4A3C H;  3F2D A;  2E2H H;  4LJZ C;  4NDX A;  3PF4 A;  3NEN A;  1VQ8 A;  1VQB A;  2EY5 A;  1D8L A;  1SMY D;  3E9I A;  3GTM H;  2JE6 I;  2K5W A;  1B3Q A;  3K7U C;  3Q8D A;  2XGT A;  2NVY H;  2L15 A;  4AYB E;  1LUZ A;  2Z8L A;  3GTL B;  2SOB A;  5ELO A;  1EZ8 A;  4J8Q A;  3NTI A;  4DV7 L;  1ML0 D;  2IJ0 A;  3CRL C;  5IGG A;  2EJM A;  1Q8I A;  4XQJ A;  2NVT H;  5G3L D;  1ROD A;  1IXR A;  1WTO A;  5FKA C;  3CD6 A;  1TXY A;  2JSO A;  5GAD C;  1EFI D;  3L9A X;  4POG A;  4DAP A;  2OTJ A;  2UXD L;  2A8V A;  1H9J A;  4JV5 Q;  1UNS A;  2B2Y C;  4IQZ A;  3P75 A;  3D0F A;  2V4D A;  1X55 A;  2FMM A;  4Y52 H;  5JVH 3;  5JJL A;  3S1R B;  4DUZ L;  1O7I A;  1B9N A;  2E2I B;  1CM9 A;  2NN6 I;  1PH9 A;  1S3O A;  2GVB A;  1DXM A;  2I0Q A;  2CVR A;  2IY5 B;  3J7A F;  3GD7 A;  4DV2 L;  5IYB H;  2OCE A;  2K5D A;  4XIG S;  2EOT A;  1GO3 E;  2N49 A;  1WTR A;  2RQX A;  4MHE A;  1Q86 C;  4HN7 A;  3OMC A;  4L5T A;  2HQE A;  1VQD A;  4B3R Q;  1Y8P B;  1SSO A;  5LMN W;  1B9M A;  4ZKC B;  4KY5 A;  1SRO A;  1PDQ A;  4A3M G;  1EY7 A;  2CWA A;  1CKN A;  3HKZ B;  3H0G H;  4OGQ C;  4Y7N H;  4ZRZ A;  4EVO A;  2G9H D;  5FO8 B;  3HOW B;  4BA1 I;  1TWC B;  2K03 A;  1B7Y B;  3BVG A;  4KD3 A;  5JEA G;  1PFM A;  3FP9 A;  2F0K A;  4DV7 Q;  3MA2 B;  1G2S A;  5EKI A;  1QVC A;  2K52 A;  1FJG L;  4C1N I;  3HOZ B;  1QNK A;  3HOV G;  4RGM A;  2B63 H;  1TS3 A;  3PCO B;  1L2F A;  1WTH A;  3QOJ A;  5JJK A;  1I4R A;  4I7A A;  2AQ2 B;  4JI8 L;  2EZV A;  4PNY A;  1PZJ D;  5FO7 B;  3CU7 A;  1PTO H;  1V1P B;  4B3S L;  1DCZ A;  3OOC A;  2K28 A;  2JP1 A;  2NZO A;  5HY6 A;  1S5B D;  4DV2 Q;  2JJQ A;  3WOF A;  4R4Q A;  2WAQ G;  1AFP A;  2Z6K A;  1HXY D;  5C5M A;  2HIX A;  2CW0 D;  5C44 H;  4DR5 L;  3H3V H;  3BDC A;  2F0V A;  2EXZ A;  4MTK A;  1ZYR D;  5LL6 S;  2K32 A;  1DOK A;  2PO4 A;  3DEP A;  5KND A;  1V43 A;  4DXF A;  1O7Y A;  3BZK A;  1Q46 A;  3HKS A;  3CPF A;  1V1Q A;  1EZ6 A;  1PRT F;  2O5J C;  1A8V A;  3K0X A;  3SHL A;  5IT9 E;  1YNN D;  1N34 Q;  2I5L X;  1GHJ A;  1Y1V H;  1SE4 A;  1VQL A;  1A15 A;  1LTA D;  1NMG A;  5EPL A;  1TKW B;  4GLA C;  2PPB C;  1WCM B;  3KBG A;  3K5L A;  4FNF A;  2GVA A;  2EVB A;  3G6E A;  2RDH A;  1DGS A;  4K8I A;  3MXG A;  1SN8 A;  4L5R C;  2ZJR A;  2VUM B;  3R8B A;  3H91 A;  4JI4 L;  5IYD H;  1RD9 D;  4C56 C;  3KF6 A;  1OXU A;  4AIM A;  2N8N A;  4B3S Q;  4QL5 A;  4RAU C;  3QO2 A;  4IPH A;  5CC4 A;  3D4W A;  5FOB B;  2PYK A;  4DK0 A;  1SEB D;  2EQS A;  2HIV A;  1BQQ T;  5EBC A;  2TMP A;  5M5X B;  3H3V I;  4WJ4 A;  5K36 G;  4X64 L;  2A73 B;  2LXJ A;  2L1B A;  1X54 A;  3I73 A;  3NHH A;  4B3M L;  4A3J G;  1N33 Q;  2YV5 A;  2R92 G;  2F0S A;  2JA5 B;  2QDL A;  4P2C B;  4JI6 L;  1Q1B A;  1BXT A;  5LHY 1;  1HA6 A;  4LNQ A;  3A8K E;  1H9S A;  4XQN A;  4L5Q A;  1RF2 D;  4YY3 Q;  1BCP D;  1A2T A;  3W5O A;  1QNU A;  1MIU A;  2OQK A;  1XWE A;  2CW0 C;  5NUC A;  3CRK C;  3NEL A;  1MSG A;  1KAB A;  4A93 B;  3K8A A;  5C4X B;  2B8G A;  3T56 B;  4GLX A;  5J22 A;  1MHW C;  1JE4 A;  1STB A;  5IIF A;  2PI2 A;  4K6D A;  1I50 H;  5E3F A;  1OO9 B;  4ME5 A;  4ME3 A;  2OEO A;  4RCO A;  2R7Z B;  1BDO A;  5CV6 A;  4IPD A;  4QMG A;  1HTP A;  5M3M H;  3I70 A;  3KDF B;  2F0N A;  3SK6 A;  3VR4 A;  3S1Q H;  1EWH A;  3I55 A;  2L11 A;  1YNN C;  1VF5 C;  1BCP B;  3EVQ A;  3CHB D;  4CBV A;  4V0B A;  4JI4 Q;  1A3U A;  4A3D H;  2WB1 B;  3J80 E;  5L37 A;  1XMO L;  4NP5 A;  3RLF A;  4XXE A;  1TWG H;  1CZW A;  4IJL A;  1IYJ B;  3PO2 G;  5F2D A;  4X64 Q;  1N32 L;  4BBS B;  2SEB D;  5C0X H;  1EIY B;  3UE1 A;  4CDD C;  4LF8 Q;  2G5D A;  4JI6 Q;  2IPK D;  2TSS A;  1H9R A;  2IX3 A;  3HS0 C;  1W3S A;  4ODG A;  5A35 A;  4LUO A;  1CI3 M;  2G9D A;  1SYB A;  4RHS A;  4G7O C;  1EY5 A;  4YCV A;  4KY7 A;  3NQT A;  1X32 A;  4GOP B;  3ERQ A;  1HHV A;  2PZW A;  1PFS A;  4ILW A;  4EGV A;  3GTK B;  1XPO A;  2VL6 A;  3AFP A;  4R4C A;  4XQQ A;  3S14 H;  4BA2 I;  3S16 B;  4C3H B;  5JAV A;  1HR0 W;  3KJP A;  1CZG A;  1BBU A;  4CJ1 B;  3WOE A;  1PV4 A;  1JR0 D;  1Q8K A;  1UUP A;  1NJI C;  4DV1 Q;  4O0A A;  4RGO S;  3GTQ B;  4XT3 B;  2EXD A;  1HNX L;  1SYC A;  2GN5 A;  1LO5 D;  2RCN A;  4C2M H;  4LF9 L;  5AFW A;  4ZAI A;  3PIP 3;  2E2H B;  1ET6 A;  4IFD G;  1RTO A;  1VQE A;  3GTM B;  1NY4 A;  1KLU D;  4PV1 C;  2NVY B;  2KEN A;  3L3O C;  3MXU A;  1R4P B;  1Z47 A;  3M7N A;  4HID A;  4P71 A;  2L12 A;  4N8X 1;  3FVQ A;  4KHZ A;  1LLR D;  2R61 A;  1I5F A;  2K33 A;  2LFN A;  4H13 C;  2UUB L;  4DK6 C;  2NVT B;  1N32 Q;  2KEE A;  5C3W A;  3GTO H;  2K01 A;  1A0I A;  1I6H H;  5IOC A;  3HOU H;  4OEM B;  1DM0 B;  5J3B A;  2BE5 D;  1QE6 A;  3V2T A;  2NVQ H;  4JBK A;  2KCT A;  1QVF A;  4K5X A;  4HAE A;  1I6V C;  4LUZ A;  4P73 A;  1CKM A;  4KMU C;  1BNZ A;  2F0E A;  4LF5 L;  1ONL A;  4EX5 A;  1OXV A;  1ICW A;  1K9M C;  1LTR D;  5IP9 G;  2WAC A;  3NPP A;  4ZYS A;  5I9O A;  3R2I A;  2DGY A;  5E4W C;  1O7Z A;  5IYC G;  1AH9 A;  4ULL A;  2XIW A;  1AE2 A;  3SK5 A;  3ITP A;  3NTK A;  3DXJ C;  1JIC A;  3PF5 A;  4BWG B;  4RGN A;  1F2M A;  2WIN B;  3TME A;  1U5K A;  3BU2 A;  3MWY W;  2WAQ E;  1HNX Q;  2RHQ B;  3S1M H;  4LF9 Q;  1A3T A;  2Y0S B;  1O78 A;  4OWT B;  2YTV A;  2Z0S A;  2IHE A;  1EUJ A;  1Y14 B;  5E1F A;  1AW7 A;  4IN3 A;  3S1N H;  2UUA Q;  4FF4 A;  3H0G B;  4HCS A;  4Y7N B;  1K0S A;  5IP7 H;  1D6E C;  4CJ2 C;  3FDT A;  1K3R A;  1PTO D;  3M4P A;  1IW7 C;  4APV A;  1EEF D;  4HIK A;  2VZA A;  4DK3 C;  1CFM A;  3ERO A;  2JA8 H;  4BY7 H;  1L0X B;  1NE3 A;  3QR8 A;  1WD1 A;  5BN3 A;  1ASY A;  4KJN A;  2B63 B;  5FO9 B;  1RCV D;  2Q8T A;  1V1P A;  3HKZ G;  3PIO 3;  1I4Q A;  1SXT A;  4GKK L;  1S4Z A;  4JI5 Q;  2KHJ A;  3IFT A;  2MFI A;  3HOW G;  3VA5 A;  1PTO B;  1BKB A;  4NMZ A;  3MEF A;  3T1Y Q;  1GOZ A;  2CHB D;  2D5D A;  2ZM6 L;  4BXX H;  1XTC D;  3EN2 A;  4LF5 Q;  1CK1 A;  3MTS A;  2GA4 B;  3LX0 A;  3HOZ G;  1EY4 A;  2JXM B;  1MJC A;  4F88 A;  4BS9 A;  2AKW B;  4JW0 A;  1A2U A;  1VQ9 A;  1BBW A;  2CH4 A;  1TR5 A;  5H1S E;  2ZXR A;  1JQY D;  4KJO A;  4R4O A;  1SFO H;  5C44 B;  5IGE A;  3VYU A;  3ERS X;  1HNW L;  4G7H C;  3M4Q A;  3C2P A;  2CQA A;  4JC0 A;  3PUV A;  4OIJ A;  1GUN A;  1SNM A;  2OT2 A;  5JJI A;  1KAW A;  1U4L A;  3KF6 B;  1AP0 A;  5ELN A;  5I2X A;  2OF1 A;  1VQG A;  1HFN A;  2QF7 A;  1KNE A;  4HJ5 A;  1EU3 A;  3U4Z A;  4A3I H;  1Y1V B;  2O5I C;  4JI1 Q;  3CCS A;  3G71 A;  2PMZ B;  4ZUJ A;  1CTM A;  3DWQ A;  3Q23 A;  1U0L A;  4DR1 L;  3C46 A;  5FLX E;  4X6A H;  1YNX A;  1V9P A;  4G4K A;  3PO3 G;  2JQO A;  5C4X H;  2ASB A;  2NZ1 D;  1Y1W H;  3BG3 A;  2E8G A;  1Q3L A;  3DM1 A;  1K83 H;  1F77 A;  4A3L G;  1XNQ Q;  2E74 C;  2R7Z H;  2K75 A;  2C9O A;  3KOJ A;  3N6R A;  1HPC A;  1T9H A;  2F4I A;  2B39 A;  5BN4 A;  5GQO A;  3H3V C;  1YJN A;  1KRT A;  2RDG A;  1WCM G;  4U67 3;  3OWE B;  2ZJQ A;  2F4V Q;  3BVM A;  4YWK A;  1IBL L;  3RLN A;  1IYU A;  3D6C A;  2KBN A;  4V19 0;  2VUM G;  2E76 C;  4OXP A;  1S5D D;  4IAL A;  2IHF A;  3H94 A;  4K8J A;  1LT6 D;  2A6H C;  2EYL A;  3I2Z A;  4LW1 A;  2DUD A;  1PXU A;  2EYM A;  2F0U A;  4CKB A;  1JOO A;  2FXQ A;  3GQB A;  2EIF A;  4IUN A;  3D6W A;  2F0D A;  2HCC A;  3BVZ A;  2JA7 H;  2WFW A;  1EQT A;  1S5F D;  3OPO A;  2KHS A;  3KDF A;  1I50 B;  4QIW E;  3A5U A;  3VR6 A;  2B2U A;  5HGT A;  4FVM A;  5IGD A;  1O80 A;  2L9H A;  1GUT A;  5KNC A;  1Z7T A;  5M3M B;  2F0H A;  5CR3 A;  1TWF B;  5AJ3 L;  2DNC A;  3M85 A;  1ESR A;  2A69 C;  5E4X A;  3S1Q B;  1LTG D;  1F2L A;  1KTK A;  2AUK A;  2WII B;  4DR1 Q;  4N9P A;  4A93 G;  1J5E Q;  3MEH A;  2CWP A;  3PUW A;  4LAA A;  2ZJP A;  5EAY A;  3I4N H;  2H1E A;  4A3D B;  4QQB X;  1YHB A;  2L4N A;  2M00 A;  2XWJ B;  3K0Y A;  2OTL A;  2EJG C;  2ZXO A;  1TWG B;  2NN6 H;  2JEA I;  4C3I B;  3GTP H;  2I5H A;  4OO1 H;  1J9O A;  4O2D A;  1EIH A;  2YU9 H;  2QGQ A;  1IBL Q;  3E5S A;  4J15 A;  4RCN A;  1Z6H A;  3J7Z C;  4YWM A;  4GOP A;  4FF2 A;  1U4M A;  3SGI A;  5JPN C;  1HZ9 A;  4DGZ A;  2WB1 G;  2ZTC A;  3SR1 A;  1JE5 A;  5LMN Q;  3A56 A;  4TRD A;  3FRP B;  2B2T A;  1A63 A;  4I65 A;  3VA7 A;  3S14 B;  2CFM A;  2I46 A;  4BBS G;  4XDX A;  3BYY B;  5IGB A;  2KCM A;  3QIA A;  3U4V A;  3I56 A;  1WYD A;  4MZ9 A;  1BF4 A;  3KLS X;  2DNE A;  1UE7 A;  2F0W A;  3GP7 A;  4K0K L;  3P20 A;  5AJ3 Q;  4R8I A;  4C2M B;  3J7A 5;  1DON A;  2JEB I;  4QCL A;  1F9P A;  2E5L L;  1EY0 A;  3SK4 A;  2QEJ C;  2OQ0 A;  1JJC B;  5CMD A;  2MQH A;  4OO1 I;  3MFG A;  1PH4 A;  4MNO A;  1X56 A;  1LTS D;  1HTL D;  4JG2 A;  1GVP A;  1RJT A;  2PCF B;  2Z1C A;  3CCE A;  4LF6 Q;  1HZB A;  4TKO B;  3TZD A;  1EY8 A;  3HEJ A;  1TWA H;  5KYI A;  2HD3 A;  4DAY B;  4A3C G;  5CV8 A;  5EQ0 A;  1EOV A;  5GAE C;  4LF7 Q;  5ELE A;  3GTO B;  3DM3 A;  2F3I A;  4XT1 B;  1HA5 A;  3M3Y H;  1IZ6 A;  4HCE A;  1I6H B;  3HOU B;  4OWW B;  1B50 A;  1EYC A;  4KN4 C;  3M7G A;  3I4M H;  2D0O A;  4IUV A;  3HKZ E;  4GZY C;  2NVQ B;  1N34 L;  1O7L A;  5C3E H;  5IY0 A;  3NWT A;  2Q2T A;  1XTD A;  4RG1 A;  1UEA B;  1OXT A;  4H0L C;  3A7A B;  5DM6 3;  2NWG A;  4ZQ3 A;  1WVL A;  2NB0 A;  3MXP A;  1ICF B;  3DWP A;  4DR4 L;  1NNX A;  3X3N A;  1YZ6 A;  2M9V A;  3E9H A;  3CF5 A;  4K0K Q;  3S1M B;  4IO9 A;  4FF1 A;  3ER0 A;  5D3D A;  2MJ8 A;  5M9O A;  3ZJY C;  4IUQ A;  3C1F A;  1M1K C;  2E5L Q;  1PVO A;  3S1N B;  1Q90 A;  1CHP D;  4X3S A;  4IJH A;  3TEH B;  4A4I A;  5IYB G;  1STN A;  3WDN A;  4UP8 A;  5ELF A;  1Y8N B;  1N33 L;  3UE0 A;  2K6A A;  2NYZ D;  4K5W A;  1LTL A;  5CV5 A;  2I5M X;  2P5Z X;  4UY8 C;  4WJW A;  5ELD A;  3EQL C;  5KYL A;  1AZP A;  3PV0 A;  1VQ4 A;  2JA8 B;  5IGC A;  4BY7 B;  4JBJ A;  4OX9 L;  1KDA A;  1E1T A;  4YY3 L;  1SBB B;  1HJP A;  2Y0S G;  3ND9 A;  4IUU A;  5JEA J;  1STH A;  1Q7Y C;  2LY7 A;  3GTJ H;  4FF3 A;  5K5P A;  3TBI B;  3T1H Q;  3F2B A;  1K0R A;  3H0G G;  4JVZ A;  1JJG A;  3URY A;  1AEX A;  2H5X A;  3M4Y A;  2MPM A;  1HZC A;  4CKC A;  3EJI A;  4BBR H;  1SE8 A;  4EQO A;  5EPJ A;  2Z6B A;  1TS4 A;  2I07 B;  2PNR C;  1VQC A;  1NUC A;  2F03 A;  3KK7 A;  4EQN A;  2H4O A;  1P16 A;  2EY6 A;  1UE5 A;  5J1Z A;  2B63 G;  2D9U A;  1EU4 A;  1SNO A;  3DWA A;  4DR4 Q;  3C1E A;  4WFN 3;  1HR0 L;  3QWN A;  1EYA A;  1FR3 A;  1G51 A;  4DUY L;  1SFO B;  2K05 A;  3IAY A;  1JWM D;  4CDC C;  1BCP F;  4IPC A;  2ZTE A;  2BDN A;  4POF A;  3FHW A;  4DR7 L;  5BR8 Q;  4L6T B;  1W6K A;  2PZU A;  1UAP A;  2BDO A;  2ICE C;  2VXW A;  3NXW A;  1HUN A;  4KY6 A;  3HOX H;  1CT1 D;  4TQU S;  1MKH A;  1JC7 A;  1EWC A;  1HH2 P;  3K5N A;  1ESF A;  4K5V A;  2Q2I A;  1VQA A;  4E6I A;  3CCM A;  3D8G A;  1EQR A;  1KNA A;  1VQP A;  4OWX B;  3CKI B;  2LS0 1;  4GN4 B;  1VMP A;  2KEC A;  4YCU A;  2N88 A;  4LF8 L;  2AHO B;  2HCI A;  5C44 G;  4A3I B;  2J0T D;  1SR3 A;  2UUC Q;  4OX9 Q;  3O13 A;  5I4D A;  4DV0 Q;  2E2D C;  2Q2H A;  3CCQ A;  4NXN Q;  1EQQ A;  1PYB A;  2RDF A;  2VW9 A;  1KDC A;  1TY2 A;  4JI0 L;  1IL2 A;  4J6H A;  1Y1W B;  3S2H H;  1BO0 A;  5C5L A;  4RKL A;  3RZO H;  1K83 B;  2E2J B;  1T5E A;  4JBM A;  1E1O A;  4GN5 A;  3PIP A;  1Y1V G;  4CGY B;  4DV1 L;  1SE3 A;  1I3Q H;  2IL8 A;  1W2B A;  1TWF H;  2LKV A;  4RHR A;  4DK1 A;  1JB3 A;  4IOA A;  5LMU L;  4FO2 A;  4WOR A;  1WTX A;  2QDB A;  3BDO A;  1PLF A;  4RFB A;  1ASZ A;  3PUX A;  2EDG A;  1XNR L;  3DUZ A;  3VR5 A;  1VQM A;  1HR0 Q;  4YIJ A;  1DOM A;  4DUY Q;  5IOD A;  3OWF A;  4NKL A;  5IYD G;  4ALP A;  4ZUI A;  3EFX D;  1FGU A;  4A3B H;  3IFD A;  4DR7 Q;  2VY3 A;  1SAP A;  1IYV A;  2DN8 A;  3I7F A;  4ZK9 B;  4C3I H;  4P72 A;  2XTI A;  1OTC A;  1MGS A;  2WB1 E;  2RHS B;  3OTO Q;  1VF7 A;  2JA7 B;  3T13 A;  3U9O A;  3JC6 6;  4DKA C;  4KLK A;  3CMA A;  4DV3 L;  4X66 L;  2UXC Q;  4KKU A;  5DLQ E;  3IKJ A;  2FMC A;  1LAC A;  1FL0 A;  2F3W A;  3QG1 A;  1F9S A;  1GHK A;  2B2Y A;  3HRZ C;  3SDZ A;  2ES2 A;  1XYI A;  2DJG C;  1Y8O B;  2VQF L;  5IWA L;  1STA A;  1SYG A;  1HNZ Q;  2YTX A;  4GNX C;  1X3G A;  4JI0 Q;  3G6J B;  1Z9F A;  4LFA Q;  1YIJ A;  1PRT C;  3I4N B;  1D5M C;  4ZKB B;  3BZC A;  1K8A C;  1X3P A;  4PZ8 A;  4F87 A;  3UDI A;  2XRQ D;  1GJX A;  4A75 A;  4JI3 L;  3GTP B;  3DEO A;  3STB C;  3TRE A;  1LTI D;  4LUV A;  5M3M G;  4WRD A;  4LMQ D;  5LMU Q;  5EKL A;  1CKO A;  1IW7 D;  2YU9 B;  2F3V A;  3W2D A;  3I72 A;  4P74 A;  2UUA L;  3W3A A;  1GKH A;  1S40 A;  4IFD I;  3ONA B;  2WV6 D;  4DAM A;  4A3D G;  1EFW A;  4KKT A;  2WP8 J;  1IKL A;  2LMC B;  4QY7 A;  4LK1 C;  4BY1 G;  4KV6 A;  3U50 C;  2EPB A;  2E75 C;  1NR2 A;  4IZ8 A;  4LF4 L;  2OWO A;  3PIO A;  1XMQ L;  3VYT A;  4DV3 Q;  1ZKO A;  4CDF C;  1VMC A;  2R7F A;  4X66 Q;  3CCJ A;  4UP9 A;  5C0X G;  5ISR A;  3JAM L;  4JI5 L;  3UDG A;  2ZT9 C;  5HGQ A;  3U9S A;  5GAG C;  2KCC A;  3AU7 A;  2VQF Q;  2CQO A;  3TRZ A;  1KC8 C;  5IWA Q;  4RA8 A;  3JAM i;  3T1Y L;  1IKM A;  1B2T A;  3ULP A;  1VS0 A;  4YWL A;  1CSQ A;  1PTO F;  1DOL A;  4QB4 A;  3CPW A;  1SJH D;  4AH6 A;  1HUM A;  4DAY A;  4KD4 A;  5CV7 A;  4IFD J;  2MHV A;  5D14 A;  1K73 C;  3DMU A;  1YEZ A;  2NTT A;  4JI3 Q;  3G48 A;  3OIQ A;  1TWA B;  4RH6 A;  3HOY H;  2A19 A;  4KK7 A;  1WI5 A;  1PH5 A;  1HQR D;  2Z4H A;  2A68 C;  1B44 D;  2XWB B;  3VDY A;  3Q0A A;  3M3Y B;  2HT1 A;  1EY9 A;  3TP7 A;  4GS3 A;  3CCU A;  3KJO A;  1JT8 A;  1JCK B;  3TN2 A;  2Y0S E;  1S5E D;  1HRJ A;  3FPP A;  5KRU A;  3I4M B;  2QIL A;  1LTB D;  4HR7 B;  3RN2 A;  3A8I E;  3CCL A;  2RVL A;  2XNA C;  3BZD B;  5C3E B;  2O4X A;  4JI1 L;  4LF4 Q;  1A3V A;  4RKB A;  3FKI H;  1XMQ Q;  1SLJ A;  1LT4 D;  1YJ9 A;  4G57 A;  2JA9 A;  3CP0 A;  4JI2 Q;  5M5W H;  2J4X A;  3HOU G;  3HFZ B;  4C3J H;  1VDZ A;  4DF7 A;  2XN9 C;  1L1O B;  4DR2 Q;  1PYW D;  3CCV A;  3DHQ A;  4OL7 A;  3C3L A;  2KVM A;  2N3S A;  2B2V C;  1XNQ L;  2QW7 A;  1SYE A;  4B9X A;  2EYP A;  2A6H D;  3CXC A;  4R1J A;  4G7Z C;  3QB3 A;  3SK8 A;  2F4V L;  4A3F H;  3PO3 H;  1PHJ A;  5D65 A;  3L0O A;  5TSS A;  4M1U B;  1FNW A;  2EYH A;  4PMW A;  4HMI A;  1LT5 D;  2B29 A;  2MP1 A;  2C35 B;  2VS1 A;  4DNT B;  1JMC A;  3J81 L;  4JK1 C;  4A3E H;  1KLG D;  3F1Z A;  5FLM H;  1N8R C;  1YNJ C;  3S9W A;  3GTJ B;  2MO0 A;  3LWU A;  2L5T A;  5IP7 G;  2A69 D;  1CQV A;  1M90 C;  2X69 A;  2KA7 A;  4BBR B;  3HP3 A;  4A3G H;  1UEB A;  1UWV A;  2F0L A;  1L1O C;  3IRB A;  4BY7 G;  3MFY A;  3BS1 A;  1KDB A;  2PW5 A;  1G6Z A;  3A0J A;  3GTG H;  1DYQ A;  3FMC A;  1YHA A;  4U68 A;  3AMU A;  1SND A;  1Q12 A;  4FP5 D;  1J5E L;  1EY6 A;  2PMZ E;  3MZ5 A;  4HED A;  2JA6 H;  2R93 H;  1DD2 A;  5KIX A;  5FLX L;  5DAU A;  2VB3 X;  3KF8 B;  4YHH Q;  1C7Y A;  2E2J H;  3LWE A;  5JVG 3;  1C9O A;  5A2Q L;  2F1M A;  2A1A A;  4PZ7 A;  4HMJ A;  1IL8 A;  3T53 B;  4BXX G;  5M3F H;  3HOX B;  1BBX C;  3AB9 A;  5FJ8 H;  4TSS A;  5I2Y A;  3Q24 A;  4R4I A;  1YHQ A;  2RSN A;  2IW3 A;  2NUC A;  2SNS A;  4DXG A;  3T4A C;  4PQX A;  2PI2 E;  1QUQ B;  4LFB L;  2Q8R E;  2JYO A;  3J80 c;  5ELB A;  4PMC A;  5EGT A;  4A3K H;  5LMN L;  3WWV A;  2Z9H A;  3S2D H;  4Q5V A;  4RMF A;  2WKD A;  1EIG A;  1V1O A;  5DEH A;  3ULL A;  5JOB A;  4RGT A;  4N8F A;  1HZA A;  4ZCK A;  4O1N A;  3RZD B;  3S2H B;  3LNN A;  1TWH H;  3RZO B;  2BA0 A;  2JA5 G;  1I94 L;  3E0E A;  3J7A V;  1N9W A;  3UI2 A;  3KLW A;  3SXH A;  3OW2 A;  1I3Q B;  3HGB A;  3M4O H;  1K8O A;  3SE0 A;  3T16 A;  1SYF A;  4IUP A;  4DV5 L;  2HUG A;  4JPB W;  3GV6 A;  3RNU A;  1XXG A;  1CQF A;  4EQP A;  5C4X G;  3NUC A;  1Y1W G;  4DA2 A;  4A3B B;  4R8N A;  3FEW X;  2BA1 A;  3A74 A;  3NP8 A;  2KUM A;  5G3L F;  2R7Z G;  4LF6 L;  1NCV A;  3ULJ A;  3K58 A;  1BR9 A;  4UPA A;  2Z4I A;  1TQO A;  1PH6 A;  2K5H A;  4LF7 L;  1ENC A;  1QWY A;  2DJF C;  4X62 Q;  2XVS A;  2NVX B;  4LFB Q;  4DV4 L;  3BYT B;  1EIF A;  1DZ1 A;  1D1K A;  3A8J E;  1UE6 A;  2F0T A;  2IWH A;  4HJ7 A;  2R7D A;  4A3M H;  4AYB B;  3G7L A;  5EJW A;  5JJZ A;  2JA7 G;  1QVG A;  1E2Z A;  2RA4 A;  1S5C D;  3JAM c;  1X9N A;  3HZX A;  1A62 A;  3T51 B;  1ET9 A;  4KHP L;  1C8C A;  1EQV A;  2NBF A;  1I94 Q;  1VQ7 A;  2MGS A;  1C0A A;  5JEA H;  1Y69 U;  2QEX A;  1BUV T;  3GDE A;  1D7Q A;  3SEB A;  4DV5 Q;  3HOV H;  1PH3 A;  3RN5 A;  3KYH C;  2QCP X;  2VQE L;  2K4K A;  1LV9 A;  1U9R A;  3I4N G;  4R4T A;  3NEM A;  4C3H G;  2FHT A;  3PMF A;  1B8A A;  3V05 A;  1WTP A;  3W1G A;  1PMR A;  3W1B A;  4NW2 A;  1II3 A;  1X3F A;  3R93 A;  3CQZ H;  2K04 A;  3NWS A;  1FNU A;  2NN6 G;  4NPS A;  4LFC Q;  1UE1 A;  1B1Z A;  1ENF A;  1J6Q A;  4RWS C;  4DR6 L;  3S17 H;  4OO1 G;  4QGU A;  1R9T H;  2UU9 Q;  3N52 A;  4AQY L;  1B3A A;  1WFQ A;  4MTN A;  5C4J H;  3T1H L;  3ICE A;  1MJE A;  1E0B A;  4DV4 Q;  2QA4 A;  2ZXP A;  3U58 A;  1X6O A;  4KTA A;  4LWC A;  3CC7 A;  2B2V A;  1XPR A;  3OIP A;  2A6E C;  2L0C A;  3TS2 A;  1WTW A;  1SNQ A;  4XTC S;  4FYD A;  4IPG A;  4KHP Q;  4JCV E;  5COY A;  3RMH A;  1TT2 A;  3UDX A;  2EYO A;  1SMY C;  5BR8 L;  1HCZ A;  3TZU A;  3HOY B;  4GKJ L;  1PYS B;  5ELC A;  2D0P A;  4JBW A;  3I8Z A;  2X6G A;  1KQS A;  4NXM L;  3TQY A;  5CBE E;  3K81 C;  4ABN A;  1Q82 C;  4JI7 L;  1GXD C;  1ZXT A;  3LGJ A;  2PNH A;  5I6Y A;  2VQE Q;  2ATW A;  2UXD Q;  3J7Y W;  3H6M A;  1R4Q B;  3K7A H;  1TII D;  2UXB L;  3CC2 A;  1PFN A;  3CC4 A;  3J81 c;  1SYD A;  1LAB A;  3K5O A;  4DUZ Q;  2UUC L;  2LSS A;  1QCB D;  3FKI B;  4DV0 L;  3MHB A;  4DR6 Q;  3AFQ A;  1L1O A;  1JB7 A;  1G6P A;  1QJO A;  5K36 H;  3K6O A;  4AQY Q;  4NXN L;  2EYF A;  1SNP A;  3AEV A;  4A3J H;  3G4S A;  5M5W B;  4B08 A;  4C3J B;  3NSW A;  5CV9 A;  2R92 H;  2C5C A;  2F0M A;  1GUO A;  2PZT A;  2LXK A;  3A54 A;  3I4M G;  3QOL A;  2F0G A;  2ALY B;  1E2V A;  5IT9 L;  5C3E G;  3RLO A;  3TSS A;  1CHQ D;  3PO3 B;  4A3F B;  1VCI A;  1E7Z A;  1JOR A;  5FLX c;  1U4P A;  2A5H A;  4L8J A;  3RR5 A;  4PZ6 A;  5M5Y H;  1LYL A;  1IHZ A;  4J1M A;  1JJ2 A;  1VQ5 A;  1PZK D;  1D2B A;  4H44 C;  4GKJ Q;  4CKE A;  5GRO A;  3A5Z B;  5C3X A;  1FJG Q;  4P75 A;  3PQI A;  4A3E B;  1G91 A;  4NXM Q;  1NMF A;  4GLV B;  1K3B C;  1FGB D;  3P1H A;  3Q6S A;  4JI7 Q;  3OTO L;  1XNR Q;  2B3G A;  2K5Q A;  2UXB Q;  2VNU D;  3ZYY X;  3NBH B;  1NAP A;  1VQJ A;  2UXC L;  1PH7 A;  4JI8 Q;  3S15 H;  1PFB A;  4A3G B;  5I9P A;  2YYZ A;  2EYJ A;  2K1B A;  2QKI C;  2RBM A;  3MXN B;  1PRT D;  1EOT A;  3I4L A;  2D2C C;  1E22 A;  3R2T A;  2HDM A;  2AQ3 B;  3QJY A;  3TS0 A;  3PO2 H;  3VYS A;  3GTG B;  4DPG A;  1OXX K;  3KF8 A;  4QUC A;  3E0J A;  4F7X A;  1HNZ L;  1GM5 A;  1MI2 A;  1ILQ A;  1GUW A;  4L63 B;  5CYU A;  2JA6 B;  2R93 B;  4LFA L;  3PUY A;  3STB D;  2PQE A;  3RZD H;  3H09 A;  2AWN A;  4FDB A;  2PW7 A;  4XYQ A;  4DR5 Q;  1DJR D;  3KLS A;  4BBR G;  4OIK A;  1STG A;  5FK9 C;  1BVS A;  1H9M A;  2HHH L;  1L0Y B;  2K50 A;  1D1I A;  4TVA B;  4X3K A;  5M3F B;  4GNX B;  3PUZ A;  1QUQ A;  4FXK C;  1F9Q A;  2K5V A;  1PRT B;  3BDL A;  1D5Z C;  4PMB A;  3CW2 C;  3NE5 B;  1TU2 B;  4Z9C B;  1KAA A;  1XJV A;  2EY2 A;  2PQA A;  1ZYR C;  2A74 C;  4X65 L;  3E6Z X;  2KHI A;  1AN8 A;  1P8L A;  3I90 A;  4A76 A;  3I91 A;  4QUF A;  4A3K B;  3CCR A;  1X65 A;  4PG3 A;  4CJ0 B;  3J80 L;  3S2D B;  3HOX G;  4X3T A;  4IFD H;  2EY1 A;  3A7L A;  4HIM A;  1WTV A;  3J80 i;  1TWH B;  4KN7 C;  3CAM A;  2NVX H;  1QOH A;  2VB2 X;  2NTS A;  3I3C A;  5D3I B;  2CH4 W;  4BY1 H;  4WJ3 M;  1A6X A;  4UHV A;  1KXL A;  3M4O B;  4XYO A;  5DNF A;  1YI2 A;  3OYY A;  1ILP A;  2AUJ D;  4K14 A;  1STY A;  1NR4 A;  3TP8 A;  1B4O A;  1IBM L;  4B3M Q;  5LL6 X;  4K2K A;  1RIP A;  4M8A A;  2ICI A;  5J39 A;  2A68 D;  4I7Z C;  3GTL H;  2HHH Q;  4F8M A;  5IE8 A;  1E24 A;  1C48 A;  3F2C A;  3B6Y A;  2FIN B;  1PH2 A;  1MD2 D;  3IL8 A;  4FXG C;  3R3O A;  4HJ8 A;  5IP9 H;  2KCN A;  1KL9 A;  4X65 Q;  5IYC H;  1E2W A;  2B2U C;  3ND8 A;  1BCP C;  2B2W C;  1JWU D;  4JOI C;  2KQ3 A;  1NTG A;  4HTH A;  3H15 A;  1YBY A;  4A3B G;  2O2L D;  1KHI A;  1NBW A;  4JYA L;  3F8T A;  3KUP A;  3FPU B;  3S1R H;  4C3I G;  5KNB A;  1LM0 A;  4A3M B;  3UDF A;  2E2I H;  2MUY A;  1OXS C;  1SRU A;  2F0F A;  4MN3 A;  3TP6 A;  3K59 A;  4HSV A;  1KRS A;  4KKS A;  4JI2 L;  2HQL A;  3D4R A;  1F9R A;  1K8G A;  1QG7 A;  1XMO Q;  5C0X I;  4DR2 L;  4DR3 L;  4L5S A;  2RSO A;  1JOQ A;  2AQ1 B;  2V1C C;  3D4D A;  4MIU A;  3HOV B;  1I4P A;  1KIX A;  1QZH A;  1IBM Q;  2F0P A;  4AYB G;  4GOP C;  1GUG A;  3JAM E; 
#chains in the Genus database with same CATH homology
 2AWO A;  1QB5 D;  4N9T A;  5HUR A;  2IX1 A;  5C6A A;  1YNJ D;  3CQZ B;  2M2L A;  2B2T C;  4O42 A;  5DM7 3;  3MC0 B;  1AZQ A;  4KI0 A;  3L7Z C;  1LTT D;  3S17 B;  1R9T B;  3GV3 A;  4KHV A;  1I4H A;  2WAQ B;  5C4J B;  1K8M A;  1X3Q A;  4C1N K;  2XSC A;  2K7V A;  2DY8 A;  2KOL A;  4X3U A;  4CHT B;  1MBY A;  4UDU C;  4DAV A;  5JPM C;  4B9W A;  5C0X J;  2BOS A;  4ZLT F;  5EBD A;  5T1G A;  4Q0F A;  3A55 A;  4UAI A;  1JWS D;  2FJ2 A;  3K57 A;  5CGK A;  1U4R A;  2XRS D;  4ID6 A;  1NSN S;  1TS2 A;  1B53 A;  3NTH A;  3MVV A;  2DY7 A;  3VYR A;  1J8I A;  4DU9 A;  4HSP A;  3K7A B;  5IGF A;  5CBA E;  5KGU A;  4K6L A;  1G29 1;  1HQM C;  3OMG A;  1BOS A;  3Q22 A;  4FXD A;  1W6J A;  1PZI D;  2BE5 C;  3K5M A;  4A3J B;  2EE1 A;  2R3Z A;  2IT1 A;  4DFA A;  1GUS A;  2R92 B;  1Q1E A;  1RKN A;  2J7Z A;  1FYC A;  2F0I A;  3J81 E;  3NK9 A;  1M4V A;  3NQI A;  1FD7 D;  1G8Z D;  1SDF A;  2SDF A;  1F2Z A;  1QIL A;  5BN5 A;  1TY0 A;  5C4H A;  1CA5 A;  1T5X D;  3V96 A;  4QF4 A;  3OW7 A;  1F2Y A;  5M5Y B;  3OSO A;  4C3J G;  1TVX A;  3F2U A;  3RD4 A;  1G2T A;  1EYD A;  2B8F A;  3NBI A;  3NBH A;  2WKC A;  2ENB A;  2R6G A;  2ID0 A;  1PTO C;  3X3M A;  3D31 A;  1C4Q A;  1ENA A;  4OHJ A;  1H9S B;  2F0O A;  1RTN A;  3MXN A;  1TS5 A;  3P7J A;  1I4G A;  3SVM A;  4R9W A;  5A2Q E;  3S15 B;  1H9K A;  2KED A;  3VR3 A;  1SJE D;  1RDP D;  1JOK A;  1RHP A;  1SNC A;  3TP5 A;  1FNV A;  2BCO A;  3PO2 B;  4S3S A;  4DNR B;  1V8Q A;  3GO5 A;  5I6W A;  5COR A;  3RUZ A;  2F0Q A;  4H7B A;  1WD0 A;  1STE A;  1MSH A;  1EEI D;  3KLR A;  2SNM A;  1CA6 A;  3D3R A;  4QIW B;  4IUR A;  2OXP A;  2IX0 A;  5EPK A;  1ZEQ X;  3TDQ A;  2N55 A;  1HFG A;  2F0J A;  3HG9 A;  2X6L A;  4K2L A;  2RKS A;  3OHX C;  2D62 A;  4IUT A;  2B2W A;  5CV4 A;  1WTQ A;  2KJX A;  1XX8 A;  1SE2 A;  2L55 A;  2Q8I B;  2FFK B;  1I4X A;  3EA6 A;  5C4Z A;  1M8A A;  2EJF C;  3MAQ A;  3KBX A;  1LT3 D;  5EKK A;  5T1I A;  5KEE A;  3VR2 A;  1D5X C;  4BY1 B;  2A6E D;  1EL0 A;  4DN4 M;  2HDL A;  4LJZ C;  4NDX A;  2EY5 A;  1SMY D;  2JE6 I;  2K5W A;  2Z8L A;  3GTL B;  2SOB A;  1EZ8 A;  4J8Q A;  3NTI A;  1ML0 D;  2IJ0 A;  3CRL C;  5IGG A;  2EJM A;  1Q8I A;  4XQJ A;  5G3L D;  1ROD A;  1WTO A;  5FKA C;  2JSO A;  1EFI D;  3L9A X;  4DAP A;  1H9J A;  1UNS A;  2B2Y C;  4IQZ A;  3P75 A;  2V4D A;  2FMM A;  5JVH 3;  3S1R B;  1B9N A;  2E2I B;  1CM9 A;  2NN6 I;  1DXM A;  2CVR A;  3J7A F;  3GD7 A;  2K5D A;  4XIG S;  2EOT A;  1WTR A;  2RQX A;  4MHE A;  4HN7 A;  3OMC A;  2HQE A;  1Y8P B;  1SSO A;  1B9M A;  4ZKC B;  4KY5 A;  1PDQ A;  1EY7 A;  3HKZ B;  4OGQ C;  4ZRZ A;  4EVO A;  2G9H D;  5FO8 B;  3HOW B;  4BA1 I;  1TWC B;  2K03 A;  3BVG A;  4KD3 A;  5JEA G;  1PFM A;  2F0K A;  3MA2 B;  1G2S A;  5EKI A;  4C1N I;  3HOZ B;  1QNK A;  4RGM A;  1TS3 A;  3QOJ A;  1I4R A;  2AQ2 B;  2EZV A;  4PNY A;  1PZJ D;  5FO7 B;  3CU7 A;  1PTO H;  1V1P B;  1DCZ A;  3OOC A;  2K28 A;  2JP1 A;  1S5B D;  3WOF A;  1AFP A;  1HXY D;  5C5M A;  2CW0 D;  3BDC A;  2F0V A;  2EXZ A;  1ZYR D;  5LL6 S;  2K32 A;  1DOK A;  2PO4 A;  3DEP A;  5KND A;  1V43 A;  4DXF A;  1O7Y A;  1EZ6 A;  1PRT F;  2O5J C;  3SHL A;  5IT9 E;  1YNN D;  1GHJ A;  1SE4 A;  1A15 A;  1LTA D;  5EPL A;  1TKW B;  2PPB C;  1WCM B;  3KBG A;  3K5L A;  4FNF A;  2EVB A;  2RDH A;  4K8I A;  3MXG A;  2VUM B;  3R8B A;  3H91 A;  1RD9 D;  4C56 C;  1OXU A;  4RAU C;  3QO2 A;  5CC4 A;  3D4W A;  5FOB B;  2PYK A;  4DK0 A;  1SEB D;  1BQQ T;  5EBC A;  2TMP A;  5M5X B;  5K36 G;  2A73 B;  2L1B A;  3I73 A;  3NHH A;  2F0S A;  2JA5 B;  4P2C B;  1Q1B A;  1BXT A;  5LHY 1;  1HA6 A;  3A8K E;  1H9S A;  4XQN A;  1RF2 D;  1BCP D;  1A2T A;  1QNU A;  1XWE A;  2CW0 C;  5NUC A;  3CRK C;  4A93 B;  1MSG A;  1KAB A;  5C4X B;  2B8G A;  3T56 B;  5J22 A;  1JE4 A;  1STB A;  5IIF A;  4K6D A;  5E3F A;  1OO9 B;  4ME5 A;  2OEO A;  4RCO A;  2R7Z B;  1BDO A;  5CV6 A;  4QMG A;  1HTP A;  3I70 A;  2F0N A;  3SK6 A;  3VR4 A;  1EWH A;  2L11 A;  1YNN C;  1VF5 C;  1BCP B;  3EVQ A;  3CHB D;  4CBV A;  4V0B A;  1A3U A;  2WB1 B;  3J80 E;  4NP5 A;  3RLF A;  4XXE A;  1CZW A;  5F2D A;  4BBS B;  2SEB D;  5C0X H;  2IPK D;  2TSS A;  1H9R A;  2IX3 A;  3HS0 C;  4ODG A;  5A35 A;  1CI3 M;  2G9D A;  1SYB A;  4RHS A;  4G7O C;  1EY5 A;  4KY7 A;  3NQT A;  1X32 A;  3ERQ A;  1HHV A;  2PZW A;  4ILW A;  4EGV A;  3GTK B;  4XQQ A;  4BA2 I;  3S16 B;  4C3H B;  5JAV A;  1CZG A;  4CJ1 B;  3WOE A;  1JR0 D;  1UUP A;  4RGO S;  3GTQ B;  4XT3 B;  1SYC A;  1LO5 D;  5AFW A;  4ZAI A;  3PIP 3;  2E2H B;  1ET6 A;  4IFD G;  1RTO A;  3GTM B;  1KLU D;  4PV1 C;  2NVY B;  3L3O C;  3MXU A;  1R4P B;  1Z47 A;  3M7N A;  2L12 A;  3FVQ A;  4KHZ A;  1LLR D;  2R61 A;  2K33 A;  2LFN A;  4H13 C;  2NVT B;  2KEE A;  5C3W A;  2K01 A;  5IOC A;  1DM0 B;  2BE5 D;  1QE6 A;  3V2T A;  4K5X A;  4HAE A;  1I6V C;  4KMU C;  1BNZ A;  2F0E A;  1ONL A;  1OXV A;  1ICW A;  1LTR D;  2WAC A;  3NPP A;  4ZYS A;  5I9O A;  3R2I A;  5E4W C;  1O7Z A;  4ULL A;  2XIW A;  3SK5 A;  3ITP A;  3NTK A;  3DXJ C;  1JIC A;  4BWG B;  4RGN A;  1F2M A;  2WIN B;  3TME A;  3MWY W;  1A3T A;  2Y0S B;  1O78 A;  5E1F A;  1AW7 A;  4IN3 A;  4FF4 A;  3H0G B;  4HCS A;  4Y7N B;  1D6E C;  4CJ2 C;  3FDT A;  1PTO D;  1IW7 C;  1EEF D;  1CFM A;  3ERO A;  1L0X B;  1WD1 A;  5BN3 A;  4KJN A;  2B63 B;  5FO9 B;  1RCV D;  2Q8T A;  1V1P A;  3PIO 3;  1I4Q A;  1SXT A;  1S4Z A;  3IFT A;  3VA5 A;  1PTO B;  4NMZ A;  1GOZ A;  2CHB D;  2D5D A;  1XTC D;  1CK1 A;  3MTS A;  2GA4 B;  3LX0 A;  1EY4 A;  2JXM B;  4F88 A;  4BS9 A;  1A2U A;  1TR5 A;  2ZXR A;  1JQY D;  4KJO A;  5C44 B;  5IGE A;  3VYU A;  4G7H C;  3C2P A;  2CQA A;  3PUV A;  4OIJ A;  1GUN A;  1SNM A;  2OT2 A;  1U4L A;  1AP0 A;  5I2X A;  2OF1 A;  1HFN A;  2QF7 A;  1KNE A;  1EU3 A;  1Y1V B;  2O5I C;  2PMZ B;  4ZUJ A;  1CTM A;  3DWQ A;  3Q23 A;  3C46 A;  5FLX E;  4G4K A;  2NZ1 D;  3BG3 A;  1Q3L A;  3DM1 A;  1F77 A;  2E74 C;  2C9O A;  3N6R A;  1HPC A;  2F4I A;  2B39 A;  5BN4 A;  3H3V C;  2RDG A;  4U67 3;  3OWE B;  3BVM A;  1IYU A;  3D6C A;  4V19 0;  2E76 C;  1S5D D;  4IAL A;  3H94 A;  4K8J A;  1LT6 D;  2A6H C;  2EYL A;  2EYM A;  1PXU A;  2F0U A;  4CKB A;  1JOO A;  3GQB A;  4IUN A;  3D6W A;  2F0D A;  2HCC A;  3BVZ A;  1EQT A;  1S5F D;  3OPO A;  2KHS A;  1I50 B;  3VR6 A;  2B2U A;  5HGT A;  4FVM A;  5IGD A;  1O80 A;  2L9H A;  1GUT A;  5KNC A;  1Z7T A;  5M3M B;  2F0H A;  5CR3 A;  1TWF B;  3M85 A;  2DNC A;  1ESR A;  2A69 C;  5E4X A;  3S1Q B;  1LTG D;  1F2L A;  1KTK A;  2AUK A;  2WII B;  4N9P A;  3MEH A;  3PUW A;  4LAA A;  2H1E A;  4A3D B;  2L4N A;  2M00 A;  2XWJ B;  3K0Y A;  2EJG C;  2ZXO A;  1TWG B;  2NN6 H;  2JEA I;  4C3I B;  4OO1 H;  1J9O A;  1EIH A;  3E5S A;  4RCN A;  1Z6H A;  4FF2 A;  1U4M A;  5JPN C;  4DGZ A;  3SR1 A;  3A56 A;  4TRD A;  3FRP B;  2B2T A;  4I65 A;  3VA7 A;  3S14 B;  2I46 A;  4XDX A;  3BYY B;  5IGB A;  3QIA A;  1BF4 A;  3KLS X;  2DNE A;  3GP7 A;  2F0W A;  3P20 A;  4R8I A;  4C2M B;  1DON A;  2JEB I;  4QCL A;  1F9P A;  1EY0 A;  3SK4 A;  2QEJ C;  5CMD A;  4OO1 I;  3MFG A;  1LTS D;  1HTL D;  1RJT A;  2PCF B;  2Z1C A;  4TKO B;  3TZD A;  1EY8 A;  3HEJ A;  5KYI A;  5CV8 A;  5EQ0 A;  5ELE A;  3GTO B;  4XT1 B;  1HA5 A;  4HCE A;  1I6H B;  3HOU B;  1B50 A;  1EYC A;  4KN4 C;  3M7G A;  4IUV A;  4GZY C;  2NVQ B;  1O7L A;  3NWT A;  1UEA B;  1OXT A;  4H0L C;  3A7A B;  5DM6 3;  2NWG A;  4ZQ3 A;  1WVL A;  2NB0 A;  3MXP A;  3DWP A;  3X3N A;  2M9V A;  3S1M B;  4FF1 A;  5D3D A;  2MJ8 A;  5M9O A;  4IUQ A;  3C1F A;  3S1N B;  1Q90 A;  1CHP D;  4X3S A;  1STN A;  3WDN A;  5ELF A;  1Y8N B;  2K6A A;  2NYZ D;  4K5W A;  5CV5 A;  4WJW A;  5ELD A;  3EQL C;  5KYL A;  1AZP A;  3PV0 A;  2JA8 B;  5IGC A;  4BY7 B;  1KDA A;  1SBB B;  3ND9 A;  4IUU A;  5JEA J;  1STH A;  2LY7 A;  4FF3 A;  5K5P A;  3TBI B;  3URY A;  1AEX A;  3M4Y A;  2MPM A;  4CKC A;  3EJI A;  4EQO A;  5EPJ A;  1TS4 A;  2I07 B;  2PNR C;  1NUC A;  2F03 A;  3KK7 A;  4EQN A;  2H4O A;  2EY6 A;  5J1Z A;  2D9U A;  1EU4 A;  1SNO A;  3DWA A;  3C1E A;  4WFN 3;  3QWN A;  1EYA A;  1FR3 A;  1SFO B;  2K05 A;  3IAY A;  1JWM D;  1BCP F;  2BDN A;  4L6T B;  1W6K A;  2PZU A;  1UAP A;  2BDO A;  2ICE C;  2VXW A;  3NXW A;  1HUN A;  4KY6 A;  1CT1 D;  4TQU S;  1JC7 A;  1EWC A;  3K5N A;  1ESF A;  4K5V A;  4E6I A;  3D8G A;  1KNA A;  3CKI B;  2LS0 1;  1VMP A;  2KEC A;  2N88 A;  2HCI A;  4A3I B;  2J0T D;  3O13 A;  5I4D A;  2E2D C;  2RDF A;  1KDC A;  1TY2 A;  4J6H A;  1Y1W B;  1BO0 A;  5C5L A;  4RKL A;  1K83 B;  2E2J B;  1T5E A;  4CGY B;  1SE3 A;  2IL8 A;  2LKV A;  4RHR A;  4DK1 A;  1JB3 A;  4FO2 A;  4WOR A;  1WTX A;  2QDB A;  3BDO A;  1PLF A;  4RFB A;  3PUX A;  2EDG A;  3DUZ A;  3VR5 A;  4YIJ A;  1DOM A;  5IOD A;  3OWF A;  4NKL A;  4ZUI A;  3EFX D;  3IFD A;  1SAP A;  1IYV A;  2DN8 A;  4ZK9 B;  1MGS A;  1VF7 A;  2JA7 B;  3T13 A;  3U9O A;  4KKU A;  3IKJ A;  2FMC A;  1LAC A;  2F3W A;  3QG1 A;  1F9S A;  1GHK A;  2B2Y A;  3HRZ C;  3SDZ A;  1XYI A;  1Y8O B;  1STA A;  1SYG A;  3G6J B;  1PRT C;  3I4N B;  1D5M C;  4ZKB B;  1X3P A;  4F87 A;  2XRQ D;  1GJX A;  3GTP B;  3DEO A;  1LTI D;  4WRD A;  4LMQ D;  5EKL A;  1IW7 D;  2YU9 B;  2F3V A;  3W2D A;  3I72 A;  3W3A A;  4IFD I;  3ONA B;  2WV6 D;  4KKT A;  2WP8 J;  1IKL A;  2LMC B;  4LK1 C;  4KV6 A;  2EPB A;  2E75 C;  1NR2 A;  4IZ8 A;  3VYT A;  1ZKO A;  1VMC A;  5C0X G;  5ISR A;  3JAM L;  2ZT9 C;  3U9S A;  2KCC A;  3AU7 A;  4RA8 A;  1IKM A;  1B2T A;  1PTO F;  1DOL A;  4QB4 A;  1SJH D;  1HUM A;  4DAY A;  4KD4 A;  5CV7 A;  4IFD J;  2MHV A;  5D14 A;  3DMU A;  2NTT A;  3OIQ A;  1TWA B;  4RH6 A;  4KK7 A;  1HQR D;  2Z4H A;  2A68 C;  1B44 D;  2XWB B;  3Q0A A;  3M3Y B;  1EY9 A;  3TP7 A;  1JCK B;  3TN2 A;  1S5E D;  1HRJ A;  3FPP A;  5KRU A;  3I4M B;  2QIL A;  1LTB D;  4HR7 B;  3A8I E;  2RVL A;  2XNA C;  3BZD B;  5C3E B;  2O4X A;  1A3V A;  4RKB A;  1LT4 D;  4G57 A;  2J4X A;  1VDZ A;  4DF7 A;  2XN9 C;  1PYW D;  3DHQ A;  4OL7 A;  3C3L A;  2KVM A;  2B2V C;  1SYE A;  4B9X A;  2EYP A;  2A6H D;  4G7Z C;  3QB3 A;  3SK8 A;  5D65 A;  5TSS A;  4M1U B;  1FNW A;  2EYH A;  4PMW A;  4HMI A;  1LT5 D;  2MP1 A;  4DNT B;  3J81 L;  4JK1 C;  1KLG D;  1YNJ C;  3S9W A;  3GTJ B;  3LWU A;  2L5T A;  2A69 D;  1CQV A;  2X69 A;  2KA7 A;  4BBR B;  3HP3 A;  2F0L A;  3MFY A;  3BS1 A;  1KDB A;  2PW5 A;  1G6Z A;  1DYQ A;  3FMC A;  4U68 A;  3AMU A;  1SND A;  1Q12 A;  4FP5 D;  1EY6 A;  3MZ5 A;  4HED A;  1DD2 A;  5KIX A;  5FLX L;  5DAU A;  2VB3 X;  3LWE A;  5JVG 3;  5A2Q L;  2F1M A;  4HMJ A;  1IL8 A;  3T53 B;  3HOX B;  1BBX C;  3AB9 A;  4TSS A;  5I2Y A;  3Q24 A;  2RSN A;  2IW3 A;  2NUC A;  2SNS A;  4DXG A;  3T4A C;  4PQX A;  2Q8R E;  2JYO A;  5ELB A;  4PMC A;  5EGT A;  4Q5V A;  2WKD A;  1EIG A;  1V1O A;  5DEH A;  5JOB A;  4RGT A;  3RZD B;  4O1N A;  3S2H B;  3LNN A;  3RZO B;  2BA0 A;  3J7A V;  3UI2 A;  3SXH A;  1I3Q B;  3HGB A;  1K8O A;  3SE0 A;  3T16 A;  1SYF A;  4IUP A;  2HUG A;  3GV6 A;  1XXG A;  1CQF A;  4EQP A;  3NUC A;  4DA2 A;  4A3B B;  4R8N A;  3FEW X;  2BA1 A;  3NP8 A;  2KUM A;  5G3L F;  1NCV A;  3K58 A;  1BR9 A;  2Z4I A;  1TQO A;  1ENC A;  1QWY A;  2XVS A;  2NVX B;  3BYT B;  1DZ1 A;  1D1K A;  3A8J E;  2F0T A;  2IWH A;  4AYB B;  3G7L A;  5EJW A;  5JJZ A;  1E2Z A;  2RA4 A;  1S5C D;  3HZX A;  3T51 B;  1ET9 A;  1C8C A;  1EQV A;  2NBF A;  2MGS A;  5JEA H;  1Y69 U;  1BUV T;  3SEB A;  2QCP X;  1LV9 A;  1U9R A;  4C3H G;  2FHT A;  3PMF A;  3V05 A;  1WTP A;  1PMR A;  4NW2 A;  1II3 A;  3R93 A;  2K04 A;  3NWS A;  1FNU A;  2NN6 G;  1B1Z A;  1ENF A;  4RWS C;  4OO1 G;  3N52 A;  1B3A A;  1E0B A;  2ZXP A;  4KTA A;  2B2V A;  2A6E C;  3OIP A;  2L0C A;  1WTW A;  1SNQ A;  4XTC S;  4FYD A;  5COY A;  3RMH A;  1TT2 A;  2EYO A;  1SMY C;  1HCZ A;  3TZU A;  3HOY B;  5ELC A;  4JBW A;  3I8Z A;  2X6G A;  5CBE E;  4ABN A;  1GXD C;  1ZXT A;  5I6Y A;  3J7Y W;  3H6M A;  1R4Q B;  1TII D;  1PFN A;  1SYD A;  1LAB A;  3K5O A;  1QCB D;  3FKI B;  3MHB A;  1QJO A;  5K36 H;  3K6O A;  2EYF A;  1SNP A;  5M5W B;  4B08 A;  4C3J B;  3NSW A;  5CV9 A;  2C5C A;  2F0M A;  1GUO A;  2PZT A;  3A54 A;  3QOL A;  2F0G A;  1E2V A;  5IT9 L;  3TSS A;  1CHQ D;  3PO3 B;  4A3F B;  1VCI A;  1JOR A;  1U4P A;  2A5H A;  4L8J A;  1IHZ A;  4J1M A;  1PZK D;  1D2B A;  4H44 C;  4CKE A;  5C3X A;  4A3E B;  1G91 A;  1FGB D;  3P1H A;  3Q6S A;  2K5Q A;  2VNU D;  3ZYY X;  1NAP A;  1PFB A;  4A3G B;  5I9P A;  2YYZ A;  2EYJ A;  2K1B A;  2QKI C;  2RBM A;  1PRT D;  1EOT A;  3I4L A;  2D2C C;  3R2T A;  2HDM A;  2AQ3 B;  3QJY A;  3VYS A;  3GTG B;  1OXX K;  3KF8 A;  4QUC A;  3E0J A;  4F7X A;  1MI2 A;  1ILQ A;  1GUW A;  4L63 B;  5CYU A;  2JA6 B;  2R93 B;  3PUY A;  2PQE A;  3H09 A;  2AWN A;  2PW7 A;  4XYQ A;  1DJR D;  3KLS A;  4OIK A;  1STG A;  5FK9 C;  1H9M A;  1L0Y B;  1D1I A;  4X3K A;  5M3F B;  3PUZ A;  4FXK C;  1F9Q A;  1PRT B;  3BDL A;  1D5Z C;  4PMB A;  3NE5 B;  1TU2 B;  4Z9C B;  1KAA A;  2EY2 A;  1ZYR C;  2A74 C;  3E6Z X;  1AN8 A;  3I90 A;  3I91 A;  4QUF A;  4A3K B;  4CJ0 B;  3J80 L;  3S2D B;  4X3T A;  4IFD H;  2EY1 A;  3A7L A;  1WTV A;  1TWH B;  4KN7 C;  1QOH A;  2VB2 X;  2NTS A;  3I3C A;  5D3I B;  1A6X A;  3M4O B;  4XYO A;  5DNF A;  1ILP A;  2AUJ D;  4K14 A;  1STY A;  1NR4 A;  3TP8 A;  1B4O A;  5LL6 X;  4K2K A;  4M8A A;  2ICI A;  5J39 A;  2A68 D;  4I7Z C;  4F8M A;  1C48 A;  2FIN B;  1MD2 D;  3IL8 A;  4FXG C;  3R3O A;  2KCN A;  1E2W A;  2B2U C;  3ND8 A;  1BCP C;  2B2W C;  1JWU D;  2KQ3 A;  4HTH A;  2O2L D;  3KUP A;  3FPU B;  4C3I G;  5KNB A;  4A3M B;  2MUY A;  1OXS C;  2F0F A;  4MN3 A;  3TP6 A;  3K59 A;  4HSV A;  4KKS A;  3D4R A;  1F9R A;  1QG7 A;  5C0X I;  2RSO A;  1JOQ A;  2AQ1 B;  4MIU A;  3D4D A;  3HOV B;  1I4P A;  2F0P A;  1GUG A;  3JAM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...