1CHQD

Surprising leads for a cholera toxin receptor binding antagonist; crystallographic studies of ctb mutants
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKDEMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Surprising leads for a cholera toxin receptor-binding antagonist: crystallographic studies of CTB mutants.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
molecule keywords CHOLERA TOXIN B PENTAMER
total genus 22
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1995-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1chqD00
3W2DA 1B1ZA 1V1PB 4RHRA 2RDGA 1LO5D 1FNVA 1LLRD 1PRTF 1BCPC 1AW7A 1KLUD 3KLSX 1BCPD 2AQ3B 2Z8LA 3DWAA 3R2IA 1CK1A 1I4HA 1HA5A 1I4QA 1LT5D 4TSSA 4DXGA 1ENFA 2IPKD 2AQ2B 1AN8A 4L63B 1I4PA 1LTSD 1LT3D 3R8BA 1SXTA 4K6LA 1TS3A 2NTTA 1RD9D 1XTCD 3DWPA 3BYTB 1BCPB 1S5BD 1G8ZD 2XRSD 1RF2D 1PTOC 1DYQA 5TSSA 1FD7D 2RDHA 4RFBA 3V05A 5ELCA 2QEJC 1PTOH 2NTSA 1KLGD 2R61A 5ELFA 5ELDA 1I4GA 1S5ED 2XNAC 1PYWD 2J4XA 1V1PA 3OWEB 4RGTA 2O2LD 3MC0B 1EU4A 1JWSD 1BCPF 1UNSA 1D5ZC 2QILA 3R2TA 1ET9A 1JWUD 1PTOB 1S5CD 1CT1D 1I4XA 4RH6A 5ELBA 1T5XD 1QILA 1V1OA 5D3DA 5FKAC 1ESFA 1CHQD 1L0XB 2XRQD 4OHJA 1F77A 1RCVD 1M4VA 2ICIA 2AQ1B 4DXFA 3BYYB 4RGNA 1HTLD 1LTRD 1SJHD 5D3IB 1D5XC 1CHPD 2WV6D 1L0YB 4RCOA 4ZYSA 3EFXD 1FNUA 1LT6D 1JR0D 3URYA 1HQRD 3DWQA 1SJED 1TY2A 1KTKA 1LTID 4L6TB 1SE3A 1D6EC 1HXYD 3BZDB 1SE2A 1S5DD 1LTGD 1LTBD 4BWGB 1EU3A 3BVMA 2G9HD 3TSSA 1FNWA 1PTOF 4C56C 2TSSA 1PRTB 1ET6A 3EA6A 4Z9CB 4UDUC 1LTAD 1RDPD 1JQYD 1DJRD 1XXGA 3BVZA 1STEA 1PTOD 5FK9C 3SEBA 1EWCA 1SE4A 1PZID 1UUPA 3GP7A 1SBBB 1TS2A 1PZJD 4RGMA 5ELEA 3MFGA 1EEID 1MD2D 1JWMD 4RGOS 2CHBD 3BVGA 3O13A 2IJ0A 1I4RA 1CQVA 3CHBD 1BXTA 5I4DA 1LT4D 4O1NA 2XN9C 1LTTD 2SEBD 1B44D 1PZKD 1PRTC 1EEFD 1TS4A 1JCKB 1PRTD 1GOZA 1TS5A 1S5FD 1TY0A 1EFID 1FGBD 4RHSA 1D5MC 1SEBD
chains in the Genus database with same CATH superfamily
1PH3A 1D1IA 2QGQA 3J80i 3J81c 2Z4IA 5IGGA 2A68C 2AHOB 3M3YH 2UXBL 4LNQA 4C1NI 2WAQB 3GTQB 1SYCA 4L63B 1DM0B 3K7AH 1PA6A 4K0KQ 2OT2A 4HJ7A 3CQZB 3HOZG 2NUCA 4YIJA 2CH4A 3AQQA 2AKWB 1DYQA 3W1BA 1VQ9A 4DR7L 4DV4Q 1PTOH 1BQQT 1LUZA 3G6EA 1KABA 4RGTA 2FMMA 4JI5Q 1SYEA 3ULJA 5IP9H 5D65A 3OTOL 1C8CA 1CT1D 4UP9A 2VB2X 2UXCL 5DNFA 3PMFA 3NBIA 1XWEA 4L5TA 1FYCA 1EYCA 1WD0A 2F0OA 1R9TH 4LJZC 4NXMQ 4IALA 1Q81C 3KJPA 3KBXA 1HFNA 3D3RA 3PCOB 4MIUA 4RCOA 2EDGA 2R7ZG 1BBWA 4OO1I 4PZ8A 4J8QA 3H15A 1JMCA 3I56A 2WINB 3DXJC 4NXNQ 1ZXTA 4BY1G 3ICEA 4A3MH 5LMNQ 1SE2A 2CQOA 4HCEA 2Y0SG 5KGUA 1ICWA 2NZ1D 3CMAA 2VZAA 1X65A 1NMGA 5GAEC 2XWBB 4JBJA 2B63G 1WTRA 3NUCA 3I90A 2Z9HA 1Q46A 4JOIA 2XSCA 4A3EH 1TWAB 4K8JA 5T1GA 3OIQA 1J9OA 2F0GA 3TREA 2B2VC 1MHWC 3JAMc 4DR2Q 3SGIA 4BBRB 3PF4A 2CHBD 1H9SB 1PH2A 3OMGA 2JA7G 4JK1C 1MJEA 4LF9L 4WJ3M 3VYUA 3CKIB 4K8IA 2OTLA 4A3GB 2LXJA 2CW0C 1CZGA 1D5MC 2JEBI 4DR1L 1TWFB 2Q2UA 1WCMG 1PRTF 3AYHB 1NBWA 3I4MH 1PH5A 1P8LA 2Z8LA 3R2IA 1STHA 2E2JH 1EZ8A 1JORA 2DNCA 3L9AX 3K5LA 1U5KA 3HOVG 4K5VA 5C4XB 1XNRL 1EY9A 1S4ZA 1Z9FA 3FKIH 4K0KL 5A35A 2HDMA 5NUCA 4G4KA 2GN5A 1FGUA 3BS1A 2OF1A 1HNZQ 1G8ZD 2BDNA 1A63A 3A5ZB 4RFBA 3OYYA 2B8FA 2BDOA 2WACA 1EY6A 3QWNA 2EYFA 3OWEB 1TWCB 1WTHA 2RSNA 3K0XA 3VA5A 3FEWX 2MJ8A 1HR0W 2B63B 2QW7A 1X3FA 1SMYC 2UUBQ 1AE2A 5IT9c 1NE3A 3CCQA 1VQJA 1U0LA 4MTNA 2FMCA 5ELBA 3S24A 1XPRA 2VL6A 4XYQA 3WDNA 4KY6A 2A6ED 4HJ8A 4JG2A 4A3GH 4WJ4A 1KNEA 2CWAA 3VDYA 1TT2A 4OL7A 3I3CA 2DGYA 4KJNA 1HNXQ 1IBML 2KCNA 3Q23A 4DV1Q 1K9MC 2B63H 1TWCH 3GTLH 2HCCA 3DM1A 4DNTB 3QO2A 4N8X1 4FVMA 2XGTA 1ZYRD 3M7NA 1L1OC 1Z47A 1GO3E 4AYBG 4FF4A 5IE8A 4A3EB 1EQTA 1PMRA 2L1BA 1U9RA 5C0XI 4BY7B 4ME5A 1UUPA 1SBBB 2K5QA 1RIPA 5H1SE 3QG1A 2NBFA 3BVGA 1C7YA 5IGBA 3PIO3 3NTKA 3K0YA 3I4MG 3AEVA 3CCMA 2L15A 1BR9A 1SMYD 1PZKD 1EEFD 2EY6A 2WP8J 1R9TB 4XDXA 2M9VA 2KHSA 3HFZB 4ZLTF 1MKHA 1EY7A 2NN6G 4OO1H 4OEMB 4FNFA 2XWJB 3RNUA 3ONAB 5JVG3 3A74A 2QA4A 4JI1L 4KLKA 4POFA 2IWHA 1UE7A 2MUYA 4QIWE 3FPPA 2KHIA 2KCCA 5JJZA 4X62Q 2UUCQ 5CC4A 4A76A 1HZAA 1RD9D 4ZKCB 3S9WA 3S2DB 2R7FA 1O78A 3CQZH 4DK0A 4GKJL 1X32A 2H5XA 3H3VI 4FO2A 1KLGD 4FDBA 5IIFA 4XTCS 3H0GH 3PIOA 2F0QA 5M5YH 4YCVA 1STNA 1HR0L 1UNSA 4KV6A 4QQBX 5EKIA 2K03A 2VS1A 3QJYA 4JV5Q 1G291 1SNDA 3SVMA 2I0QA 1CHQD 1I3QH 3CCRA 3MWYW 5CV8A 3CC2A 1B7YB 2AWNA 4NKLA 1EQRA 2F0JA 5T1IA 2NYZD 3NK9A 4RAUC 3KDFB 3RN5A 1E2WA 4R4QA 4DK1A 3H0GG 4YY3Q 2EZVA 3TDQA 4JI0Q 2L9HA 1QCBD 1YI2A 2B3GA 4DV2Q 4R8IA 2NVQH 1CKNA 3T51B 4IOCA 3STBC 2JP1A 4JI7L 5KIXA 1EIHA 2MP1A 1LTBD 4GLXA 1SYBA 4HIOA 3K6OA 2TSSA 3ERSX 3CRKC 1VQ7A 4X3UA 3K7AB 2Q2IA 1NY4A 2X6GA 2Y0SB 3BVZA 5AJ3L 1KIXA 1E2ZA 1X54A 2R92G 2BH2A 2NN6I 4BXXH 3GP7A 3J7YW 4B3SQ 5EKLA 4K5XA 4BBSG 2G9DA 1IKMA 4PMBA 3JAME 3NWTA 5E1FA 1ICFB 1A2TA 4UHVA 1ILQA 2K04A 4HJ5A 3G7LA 2PMZE 2QDBA 1VQAA 4A3KH 3CCLA 4JV5L 4LF6Q 3PSIA 3X3MA 1AH9A 1W2BA 5M5WB 4A3DH 1QJOA 2NVTB 4IQZA 4BA2I 1B9MA 2F0SA 2Z6KA 4HTHA 1FVIA 4DK3C 3N52A 3Q24A 3AU7A 1IYUA 1UE5A 4DAYB 4DAPA 3F1ZA 1O80A 2IPKD 2HHHL 1ZEQX 3PIPA 3R8BA 5C0XH 1LT3D 2X6LA 3D0FA 4JI2Q 1IL8A 2TMPA 1IYVA 1HZ9A 1VQDA 3F2DA 4RWSC 3NEMA 3EIVA 3TZUA 4Q5VA 3J81L 5IT9E 4GOPB 4AH6A 2IX0A 5IGDA 4CGYB 2PYKA 2K14A 2JA6H 5BR8L 1EYDA 4IUTA 1JOOA 3P1HA 3K57A 4WJWA 2H4OA 2K5VA 5M3MB 4A3FH 4LF8L 1VQCA 4RA8A 2JA5G 1AP0A 1MJCA 5C5MA 4B3TL 1KTKA 5LHY1 2KVMA 3S15B 2WIIB 5C3XA 1OXTA 2VY3A 4ZCKA 2E5LQ 1AEXA 1LTLA 1RHPA 1YIJA 4R4CA 3RR5A 1K0RA 4B3RQ 3S1MH 5JPNC 1SE8A 1VMPA 2V1CC 2YU9H 3CU7A 4CBVA 4A93G 4DAMA 1SE4A 1XMOL 2E76C 2ZXOA 1VQPA 5L37A 1Y1WH 4Q0FA 3CCSA 4QMGA 4R8NA 2JN4A 4LF5L 1MD2D 3NBHB 3NHHA 4DPGA 2B2TC 3CHBD 1QOHA 2CVRA 2WAQE 5JEAJ 5I4DA 2KA7A 4UP8A 3WOEA 3GV3A 2IY5B 1O7LA 1X3QA 2VQFQ 2IX1A 5C0XJ 1B2TA 4LMQD 4MZ9A 3ERQA 3L2PA 1TY0A 3MHBA 2ENBA 4YWLA 2Q2TA 4LUOA 3W2DA 1B1ZA 5FJ8H 4JI6Q 2ATWA 1TQOA 2EJGC 1BCPC 1XMOQ 3KLSA 3S16H 3TS2A 1ASZA 3I55A 3DWAA 4A3KG 3SK6A 2ZJQA 1NR2A 1I4HA 2KUMA 5I6WA 1I4QA 5M9OA 3PO2B 1ML0D 1A6XA 3SK8A 3A8KE 2IW3A 2KJXA 5CV5A 1LTSD 5C4JB 4LUVA 2JQOA 3JAML 5EPKA 4LF4Q 1RF2D 3Q8DA 3HOUH 3BJUA 2NTSA 1JOQA 5ELFA 4CHTB 2J4XA 5EPJA 5C0XG 3Q22A 4H7BA 3FVQA 1QE6A 3T4AC 1IZ6A 3GTOB 4DR1Q 2RHQB 5CV4A 1MSGA 1P16A 1H9SA 1Q12A 3WOFA 1I4XA 4RH6A 2F0DA 3E3XA 3S1NH 1IL2A 3KFUA 1W6KA 4NB3A 2Z1CA 2FJ2A 1SJHD 1K8GA 5D3IB 2OCEA 4DFAA 2XVSA 3I4NH 3HOXG 2C9OA 1J5EL 3PO3H 1KL9A 4I65A 4R4OA 5BN5A 4GN3B 3URYA 4A75A 5GROA 1SE3A 3CCEA 1WTXA 1G91A 3K81C 3NBHA 1ZYRC 1BF4A 1GUOA 3KF6B 1GUWA 1LTGD 4K6DA 3QR8A 2KQ3A 4FF3A 1UAPA 2B2UC 3GD7A 2R93G 2VUMG 4C3HB 2LSSA 2F0IA 1VCIA 3PQIA 4UDUC 2Q8IB 1LV9A 4ZQ3A 1VQHA 1V8QA 1TWHB 1WTOA 1H9KA 1A3TA 1EY4A 4OIJA 4RGMA 3MFGA 1Y1VG 4DR6Q 1CZWA 1K3BC 2RF4A 4PMCA 3V96A 2E2HH 3LWUA 2R92B 1SYFA 5I2XA 1EOVA 3D8GA 1XTDA 4R9WA 2IX3A 4BBSB 1S5FD 2EIFA 4JI4L 1Q90A 4A3LH 2JSOA 4IUQA 5I9PA 1B3AA 1EQQA 1HNWL 1PH7A 1IBLQ 2XTIA 1F2ZA 3ULPA 4PMWA 3OW2A 2EYPA 3GTKH 2PQAA 1HA5A 2L5TA 4X3KA 1LT5D 2R7ZB 2F0FA 1KDCA 5IP9G 3SE0A 3ZJYC 4M8AA 2ZTEA 5IGCA 4QJFA 2ZJPA 5FLXc 5C3EH 1Y14B 4PNYA 4C3JH 4H13C 1WI5A 2UXBQ 1SLJA 1STYA 1HH2P 1FD7D 2D9UA 3KOJA 1VQOA 5ELDA 2VXWA 1PYWD 1HZBA 1V1PA 5IWAQ 5EGTA 1N36L 3MXNA 3HOZH 3D4RA 3K8AA 5C5LA 2R93B 1JWSD 5G3LD 2HT1A 2Z0SA 1EIGA 4DAVA 2EY1A 3CC4A 2M00A 3UE1A 4DV6Q 4QIWB 5FKAC 2A6EC 3RUZA 1Y1VB 1RCVD 1YNNC 2F4VQ 3EBEA 4X3TA 1SNPA 4NMZA 3VR3A 2EY5A 4A3JG 4KN7C 4KHPL 3EFXD 1GJXA 4PQXA 1IBKQ 4DR4L 1CSQA 4X65Q 4GOPC 2BCOA 4TRDA 4EX5A 4O2DA 3NSWA 1MIUA 1WYDA 4IUPA 4EGVA 1WJJA 4L5QA 4DV3L 4BWGB 3BVMA 2PMZB 4C56C 5C4XG 2KHJA 2Q8RE 1EY5A 3MXPA 2HDLA 4MNOA 1YZ6A 1CKMA 3C46A 4IUNA 2OQKA 1KHIA 4G7HC 2NB0A 3A7LA 1PXUA 2VUMH 2K4KA 2CWPA 2B2WA 4KKSA 4R4IA 3D4DA 3K5NA 2C5CA 5J1ZA 2E2DC 3KDFA 4GNXC 2EQSA 3ND9A 4Y7NB 2UXDQ 1A3VA 1S72A 1YITA 4OGQC 3T53B 2ES2A 5HY6A 1QWYA 2AMCB 5FO8B 4BBRG 2I5MX 1VQMA 4XT3B 3S15H 5I2YA 3BDLA 4IO9A 4EQOA 4B3MQ 4TSSA 4C3IG 1ENFA 1OXUA 4QCLA 1CM9A 1PFSA 4JI0L 2F0VA 4K6LA 1KC8C 2E2IB 1K8OA 2N49A 3S17H 1G2TA 1JB3A 1BCPB 1MI2A 5FLXL 3G48A 2ZTCA 2UUAQ 2A6HD 5J22A 1U4PA 2Q8TA 2VQEL 2QEJC 5BN4A 2X69A 3TP6A 2R61A 3TBIB 2HCIA 1IKLA 1X9NA 1Q1EA 4YHHL 3I91A 5EAYA 3CAMA 1BDOA 3MA2B 5I6YA 3EJIA 2RCNA 3NELA 1D5ZC 4H0LC 3A5UA 1QZGA 1SMXA 3A55A 1GHKA 2NVXB 1GUSA 1SNOA 5D3DA 4KI0A 5G3LF 2PZWA 4C3JG 2YV5A 2ICIA 1S40A 2B2TA 3CD6A 2JA8G 3DUZA 1D5XC 4MTKA 1CHPD 2JEAI 1XNRQ 1L0YB 1QNKA 5C4HA 4ABNA 1OO9B 2RBMA 1JR0D 3R3OA 4H44C 3HOYH 1HQRD 3GTKB 4DAYA 3E0JA 3PGZA 4JBKA 3RN2A 4JVZA 1GUTA 3AMUA 1BO0A 3HOXB 1LYLA 3MTSA 3L0OA 5M5WH 4A3DB 5IYDG 1QVCA 5JVH3 1SAPA 3GTPH 4BBSH 1Q1BA 1ET6A 3MEHA 1XJVA 4U673 1Q8IA 1DOKA 1SSOA 4Z9CB 3NQIA 1RTNA 1XXGA 3WWVA 1E1OA 3ITPA 5EBDA 1PZID 2JK8A 3SXHA 2E75C 3J80L 3T1YL 3NENA 4KHZA 1QVFA 1PLFA 3HOWH 4BY1H 3PF5A 1TWHH 1KDAA 4QGUA 3J7A5 1C9OA 1LTTD 2FXQA 2I5HA 1E0BA 2SNMA 3S14H 4QUCA 2K7VA 4CJ0B 3EROA 4LWCA 4GOPA 1N32L 2A19A 3HG9A 5F2DA 2HHHQ 1LO5D 1LLRD 1D1KA 1L1OA 3HZXA 3HEJA 2RQXA 3K7UC 1HNXL 2NVQB 3T16A 1YJWA 1RTOA 3MFYA 2PPBC 3PO3B 4IN3A 3IRBA 1C48A 1E3PA 4UAIA 4DXGA 3I4NB 1RL2A 3NP8A 5J39A 5IODA 3GTJB 1XNQL 1TXYA 4EVOA 3GTMB 1R4QB 1K0SA 1F9QA 1IXRA 1NSNS 2K5DA 4NXML 3S1NB 3D31A 4IZ8A 1RODA 2VQEQ 2ZXRA 5A2QE 2EOTA 5ELCA 4C2MB 2F3WA 4DV0Q 1VMCA 3RZOB 1N9WA 3F2BA 3GTOH 2B2UA 3T1HL 1JJ2A 3W3AA 1H9MA 2MHVA 1G51A 1BCPF 3C1FA 5K36G 1HNZL 1VQ5A 3Q0AA 3HOUB 3UDXA 4DA2A 1IBLL 2UXCQ 1QILA 1V1OA 3KYHC 1WTPA 2CFMA 1UEBA 3I73A 4B3TQ 5C4JH 4JYAQ 3FMCA 3W1GA 4DXFA 4NP5A 5FO7B 3S2DH 1LTRD 5EKKA 3P20A 5C44B 1GM5A 2WV6D 1QUQA 4LFCQ 2A8VA 3T1HQ 1CSPA 3VA7A 3W5OA 1G6ZA 1B70B 1GHJA 5GQOA 2F03A 3MXUA 5IYCG 3Q6SA 4Y52H 3TSSA 1FNWA 2FINB 4DUYL 3DEOA 3KUPA 3MAQA 4TVAB 1STBA 4ME3A 4K14A 2WKDA 3I4NG 4A4IA 1DJRD 2CKZB 1YNXA 3MXGA 4J15A 2DJFC 4HMIA 4P72A 1EY0A 1DCZA 2RA4A 1VDZA 1EWHA 5KRUA 2BH8A 1LT4D 4O1NA 5HGQA 3S1MB 3S1QH 4BY7H 1Q86C 4DR4Q 3ND8A 1O7IA 1SR3A 2EXDA 5C3EG 2D0PA 2QCPX 2GVBA 3BYTB 1Q82C 1VF5C 3FPUB 1EUJA 1UWVA 1V1PB 2A68D 4IPDA 2J7ZA 3KLSX 2OTJA 3BG3A 2F0HA 1IBKL 1I6HB 4CKCA 4IFDG 3HKZE 1C0AA 2F4IA 3SDZA 4AQYQ 1PFBA 5CBEE 3E9HA 1PH9A 4KHVA 1VQBA 4A3FB 5C44G 1WCMH 3G71A 2ZTDA 2L4NA 4J6HA 2ASBA 3QOLA 3A54A 3D4WA 2HIXA 2JA6G 2XRSD 1SFOB 4G7OC 3RZDH 4P2CB 5AJ3Q 1EIYB 2BA0A 3NTHA 4AQYL 2LMCB 2A5HA 2MFIA 1T5XD 4LFCL 1E1TA 2EYJA 4R4TA 3SK4A 2Z6KC 2XRQD 5COYA 4GN4B 2KCTA 5EPLA 4DV2L 1D2BA 1DOLA 4IURA 5J3BA 2PZUA 2I5LX 2B2WC 5LL6X 3CF5A 5LMUL 5KYLA 1WOCA 1XMQQ 3CXCA 3NXWA 3PIP3 1IHZA 4A3IB 1LTID 4ZAIA 2WB1B 5FLMH 1HHVA 3HRZC 3RD4A 4O42A 2L11A 3I4MB 1VQFA 4DV1L 4P71A 1BNZA 1HR0Q 1EL0A 1F9PA 1STGA 3OWFA 4X3SA 1L0WA 4ZK9B 3K5OA 1OXXK 2YYZA 2JA7H 5M5XH 1RDPD 3R93A 2Z4HA 4DU9A 5FK9C 3V2TA 3C3LA 2O5IC 1QB5D 2OQ0A 5E7NA 5ELEA 2QEXA 4BBRH 4A3LG 5I9OA 4X6AH 4X62L 1E24A 1NAPA 2PW5A 5LL6S 4RKBA 4OIKA 3AFPA 3EQLC 3NE5B 1EFID 4JCVE 3TZDA 1N32Q 3HOVH 2PQAB 4XIGS 5LMUQ 4AIMA 3TRZA 1AW7A 1F2LA 3OOCA 4A3MB 1WTWA 1XMQL 4JI1Q 2K52A 2NVYB 4CKEA 4DNRB 3GV6A 3IFDA 3QIAA 3NTIA 1EYAA 4LAAA 2OEOA 1J8IA 2AUKA 1SXTA 3H94A 1TS3A 1I3QB 1NR4A 2DUDA 2DY8A 3OMCA 4FF2A 3NPPA 3U4ZA 1PTOC 4JI8Q 4A3GG 4LF9Q 1X3EA 3U9SA 3GTGB 2H1EA 3PV0A 4B08A 3LGJA 4IFDH 5M5YB 4PZ6A 1SNQA 3H0GB 5JOBA 2QILA 5M3FG 1ET9A 3J81E 2N3SA 1M8AA 1PYSB 1X3PA 3IL8A 3L3OC 4JI2L 3HOVB 2R6GA 4DUZQ 1FR3A 1MSHA 1Z6HA 5FLXE 1GUNA 1VQIA 2UU9Q 4O0AA 4FXDA 2B2YA 3HOUG 1FJGL 4CJ2C 4RCNA 2F3IA 3H09A 3EN2A 4KHPQ 4I7ZC 3VR4A 4L5SA 4ZYSA 3GTQH 2BA1A 1T9HA 5K5PA 1X55A 3DWQA 2F4VL 3M4PA 5JAVA 3GTGH 1F2YA 4IUUA 1S3OA 1J6QA 2EXZA 4ID6A 5JPMC 4JI6L 1HUNA 3TN2A 4CDEC 5IOCA 1A15A 4RG1A 3I7FA 5M5XB 2AUJD 3FRPB 3VR2A 2PI2A 3VYRA 2IHEA 5GAHC 2F0MA 3HKSA 2GVAA 3VR6A 3HKZB 1D8LA 3N6RA 5IGEA 3ULLA 4XXEA 1F9SA 1EFWA 4JI3Q 3PUXA 2EYMA 1PZJD 2WKCA 2NVYH 3E0EA 3G6JB 2A6HC 1K3RA 1PH8A 1V9PA 4HIDA 2XN9C 1XX8A 3TS0A 1VQEA 4YY3L 4YCWA 4B3RL 4RMFA 4HJ9A 4RKLA 1L2FA 1U4RA 3A8IE 1OXVA 1E7ZA 2Y0SE 4A3EG 1PFNA 1QG7A 1DGSA 4E6IA 1BBUA 1Y1WG 1EZ6A 1SYDA 3GTLB 2VNUD 2YTXA 2NZOA 2N88A 4NPSA 3F2CA 1Y8NB 3NWSA 3CPFA 2K5HA 2YTVA 1YBYA 1X56A 3RZDB 1K73C 4LF7Q 1YHBA 1O7YA 1SFOH 2JA7B 5E4WC 1HTPA 5IYBH 4MHEA 4JI4Q 2OXPA 1DZ1A 4GLAC 2K1BA 3DM3A 2BOSA 4JBWA 4OONA 5M3MG 3VYSA 1DXMA 2RDHA 5D14A 1WCMB 2N8NA 4C3IH 3C2PA 5DM73 2F0KA 4A3IH 1SNMA 1BVSA 5CYUA 5KNDA 4J1MA 1CFMA 1TWGB 3BZKA 1MBYA 4DR3L 4XQJA 1K83B 1V1QA 1LABA 5CV9A 1JJGA 2Z6BA 4X66L 4IJLA 1I94L 1ENCA 1ONLA 1YNJC 2AWOA 2SNSA 2ICEC 2K6AA 1XPOA 4CKBA 3FKIB 1VF7A 1SN8A 2EE1A 5C4XH 5A2QL 4G7ZC 4KY7A 3S1QB 3E9IA 3AB9A 4HAEA 4HSPA 3U9OA 2D0OA 1LT6D 1MGSA 4EQ5A 1VQNA 3U58A 2E2JB 4F87A 1L1OB 5KEEA 4OWWB 1TWFH 1FL0A 1Q7YC 4GKKQ 2HD3A 3I4LA 4QUFA 5FO9B 3K59A 4DV5L 2FHTA 3EA6A 5FLMG 4IFDI 1F2MA 2M2LA 2CH4W 4HSVA 2HQEA 4G57A 1B8AA 1VQLA 4V190 1CI3M 4JI5L 1HA6A 1I6HH 2E8GA 4RGOS 2EJFC 1TR5A 2IJ0A 1A0IA 2B2YC 5FOBB 1TWAH 3L7ZC 5C44H 4DR7Q 1B44D 4AYBB 1IYJB 5ISRA 1H9JA 4NDXA 1TS4A 1GOZA 1SYGA 5ELNA 2B8GA 4ODGA 1WVLA 2CQAA 1CTMA 2Q2HA 5CGKA 4U68A 2QKIC 4RHRA 2LXKA 1KDBA 2DNEA 5JEAG 2JE6I 1NUCA 3CP0A 1CA5A 1IW7C 4OX9L 4JI3L 4DR5L 3BZCA 4HEDA 4HIKA 2F3VA 3S2HB 1NTGA 5CBAE 1B4OA 4GLVB 2A1AA 4C2MH 1K8MA 4APVA 1GXDC 3GQBA 2PNHA 2I46A 4F8MA 1I4PA 2K28A 4H02A 3UE0A 2LS01 3DHQA 3BU2A 4LFAL 1V43A 3BDOA 1JICA 4OWXB 1G2SA 3ER0A 3GTMH 3U50C 5TSSA 4GKJQ 3KK7A 4KD3A 4LUZA 3GTJH 4B9XA 4EQPA 2O2LD 3F2UA 4P74A 1M90C 4LF5Q 1EIFA 2WB1E 3R2TA 2A74C 1PTOB 4KY5A 4K2LA 5IYCH 2MPMA 3IFTA 2V4DA 2RHSB 2F0NA 4DUZL 4N8FA 4OHJA 4C3HG 2KEDA 4RGNA 1KAWA 3I72A 4HIMA 2CW0D 1GKHA 2N55A 4LFBQ 1EY8A 4WORA 3M3YB 3GO5A 5JJIA 3FP9A 4DV5Q 1WD1A 2D62A 3RZOH 4F88A 4L6TB 4JI8L 4YWKA 2UXDL 3BZDB 1Q3LA 5CR3A 1C4QA 2G9HD 4QL5A 2VW9A 2MQHA 1QNUA 3SR1A 5BR8Q 4TQUS 3HOYG 3SHLA 3SK5A 1PH4A 3GTPB 1CKOA 1UEAB 2PQEA 3HOXH 1STEA 3SEBA 4OO1G 1YJ9A 2EYOA 3C1EA 4KKTA 1O7ZA 1TS2A 4IPHA 4DNIA 3PUYA 1NJIC 1Y69U 1QVGA 1JWMD 3CW2C 1R4PB 1BXTA 1A8VA 1AZPA 1TVXA 2SEBD 1J5EQ 3I4OA 2F0EA 3MXNB 2B39A 1U4LA 2A69D 4GS3A 3S14B 2P5ZX 4RHSA 1SEBD 2JXMB 1NMFA 2NVXH 2PI2E 4IUVA 4PZ7A 1I94Q 4BY1B 1X3GA 1HQMC 2AQ3B 2KEEA 5IWAL 1N36Q 3HOWB 2K05A 1PHJA 1ILPA 1RKNA 2N78A 1BOSA 5GADC 5E4XA 2ZJRA 3J7AF 1HUMA 1N8RC 2IT1A 3RLNA 1AN8A 3FHWA 5LMNW 1JOKA 2HIVA 4IPGA 4XYOA 4TKOB 2QF7A 3PUZA 1W3SA 3S1RH 1WTQA 3J80E 3H3VH 1A2UA 3OTOQ 3J7AV 2E2IH 3V05A 3UI2A 1HZCA 2EYLA 4A3JB 4LF7L 4IFDJ 2XNAC 3U4VA 3KBGA 4UP7A 4OWTB 3HOYB 2F0WA 3MC0B 2O5JC 1B9NA 2HQLA 3HGBA 1JWUD 1II3A 3GDEA 2R7DA 1BBXC 1ASYA 4A3CH 1GUGA 1GVPA 4DV0L 4CDDC 4Y7NH 2LFNA 1ESFA 5M3FB 1PVOA 4BA1I 1YVCA 1CUKA 1M4VA 2SDFA 4LFAQ 3BYYB 1HTLD 4DV7L 2HUGA 5EBCA 1KRTA 4HN7A 4X64Q 1QUQB 2K32A 3J80c 3J81i 5EJWA 3JAMi 4BXXG 2K75A 2A73B 3X3NA 4S3SA 1SJED 3QOJA 1TY2A 3M4OH 4LK1C 5GAGC 4JPBW 1N33L 3M9BA 4A3CG 1S5DD 1FJGQ 1AFPA 1EU3A 1AE3A 1PTOF 3HOWG 1JJCB 3S17B 4R1JA 3OHXC 3J81j 1PV4A 3TMEA 5ELOA 4LW1A 1EWCA 1XPUA 1EQVA 4FP5D 1EOTA 3IKJA 4DR2L 1UE1A 2DY7A 2SOBA 2JA5B 4OXPA 4CDCC 1I4RA 1CQVA 2ZXPA 3H3VC 2A69C 2LKVA 3KLRA 4KN4C 5LMNL 1VQ6A 1PRTC 4DKAC 2L55A 4ZRZA 2K50A 3IAYA 2JA9A 3KF8A 4QY7A 1HCZA 1Y1VH 1YNND 3OSOA 4KMUC 5DAUA 1EYGA 4N9TA 5DEHA 4A93B 4GKKL 2VUMB 2L12A 1RJTA 1BCPD 1I5FA 3PUVA 4FYDA 4ULLA 3M4OB 4A3BG 1CK1A 1BKBA 3HOZB 5KNCA 4QB4A 2K5WA 1SRUA 2E74C 4BY7G 4A3IG 4B3SL 1PFMA 4QF4A 4DUYQ 1G6PA 4C3JB 1X6OA 4L5RC 3DWPA 4WFN3 5C3EB 1S5BD 2CCZA 2RDFA 2IHFA 4ZUIA 1S5ED 2JA8B 2R7ZH 1DONA 2BE5C 2PZTA 3M4YA 4GN5A 1EU4A 3CMEA 4UPAA 5E3FA 4DN4M 2G5DA 4KKUA 4A3FG 4LF4L 1HNWQ 1K8AC 4A3JH 3D6WA 3FDTA 2PNRC 4GZYC 2J0TD 2F0PA 3KF8B 5C6AA 2D5DA 1TU2B 2WFWA 2O4XA 3CCUA 4GNXB 1NNXA 2F0UA 3RMHA 4ALPA 2PO4A 1N33Q 3LNNA 4JBMA 2R92H 3K80C 4OX9Q 2E2HB 3RLOA 3G4SA 3B6YA 2R93H 1VQ4A 4BS9A 2I07B 2MO0A 2F52A 2RVLA 4L8JA 1OXSC 3A8JE 4KJOA 1D6EC 3A0JA 4PV1C 2MNAA 4DV7Q 1QZHA 2NZHA 1HRJA 2MO1A 4KD4A 4C3HH 4YWMA 4NW2A 2IL8A 4A3BB 3H6MA 5CV7A 1LTAD 1VS0A 1KD1C 1A3UA 3P75A 1PTOD 3KJOA 1PDQA 3TEHB 1STAA 4WRDA 1I50B 1I50H 5KNBA 3I70A 3RLFA 2WB1G 3QB3A 5AFWA 4HJAA 4EQNA 1KNAA 4JC0A 1SDFA 2ALYB 3OIPA 4FXKC 1TKWB 3EVQA 1TS5A 4A3BH 5IYBG 4HMJA 4IJHA 1Z7TA 5DLQE 4DK6C 1VQ8A 5C3WA 1YHAA 1JE4A 5IT9L 4LF8Q 1SNCA 2WAQG 1FNVA 3OPOA 1Y8OB 3T1YQ 3K58A 3HS0C 4M1UB 1LM0A 3VYTA 5KYIA 2KECA 1H95A 1KXLA 2AQ2B 3E5SA 4DV3Q 4POGA 4MN3A 3TP8A 4B9WA 2RKSA 3M4QA 1N34L 1PH1A 1XNQQ 1XTCD 5DM63 4X65L 2KOLA 2NN6H 1W6JA 1UE6A 5IP7H 2RSOA 5CV6A 4CJ1B 4DV6L 2LY7A 2UUCL 3HKZG 3OW7A 4N9PA 1VQGA 2UU9L 4K2KA 2JA8H 4DR3Q 1S5CD 5CORA 3KLWA 1GD7A 1IBMQ 1WTVA 1YJNA 1XYIA 1CA6A 1BUVT 3T13A 1F77A 2XIWA 1PYBA 2ID0A 5IP7G 1JE5A 4X66Q 3J7ZC 1DD2A 4P75A 1ENAA 4DF7A 1LACA 1N34Q 4HCSA 1Y8PB 1FNUA 2K33A 3S2HH 4UY8C 4LF6L 3CRLC 4F7XA 1ESRA 5BN3A 5EQ0A 3CPWA 1TIID 2GA4B 4XQNA 2R3ZA 1WFQA 3I8ZA 1IW7D 3DLLA 4DV4L 1Y1WB 4A93H 1T5EA 4PG3A 3H91A 1D7QA 2YU9B 1F9RA 4ZKBB 1DOMA 2K01A 3TQYA 2FFKB 3HP3A 4B3ML 1JQYD 2PW7A 3PO2H 2E5LL 4FF1A 3K5MA 3E6ZX 4AYBE 2OWOA 2F0TA 3A56A 2JA5H 3UDGA 5IYDH 2YTYA 3AFQA 3PUWA 3O13A 5FJ8G 1JC7A 4YCUA 3S16B 1AZQA 1HFGA 2KCMA 4DGZA 4FXGC 4ILWA 2QDLA 1ZKOA 3BDCA 4JYAL 3KF6A 2JA6B 4DR6L 1K28A 2F1MA 3JC66 3CCJA 2B29A 4V0BA 1SROA 2RDGA 1CKNB 1CQFA 1KLUD 3FKIG 4YHHQ 3ZYYX 2EYHA 3STBD 1U4MA 2EJMA 3TP5A 4CDFC 2UUBL 2PCFB 4IOAA 4K5WA 3MVVA 2K5NA 5CMDA 2DJGC 2NTTA 1Q8KA 3I2ZA 3P7JA 4DR5Q 1A62A 5M3FH 3D6CA 5K36H 5HGTA 1KQSA 4I7AA 3UDIA 3DMUA 5JEAH 3TP7A 2ZT9C 1KAAA 2ZM6Q 1I4GA 4KTAA 2D2CC 1K83H 2MGSA 1TWGH 1JB7A 4JOIC 3NQTA 1YEZA 4GNXA 2BE5D 3CCVA 1HJPA 5M3MH 4C3IB 3PO3G 2B2VA 4HR7B 3A7AB 1B3QA 2NVTH 1L0XB 5HURA 3UDFA 1EWIA 1OTCA 3S1RB 1PH6A 2AQ1B 5JJLA 4A3KB 3DEPA 4P73A 1B50A 2NWGA 5IY0A 2EPBA 3PO2G 2VB3X 3MZ5A 4OELB 1E2VA 2F0LA 1HPCA 2KENA 2DN8A 2L0CA 5JJKA 1KRSA 1HXYD 4LFBL 2C35B 3VR5A 4ZUJA 1YHQA 3MEFA 4XQQA 4JW0A 3CC7A 1PRTB 1I6VC 4KK7A 5C4ZA 1M1KC 4C1NK 4XT1B 1B53A 2EVBA 2RCFA 2ZM6L 4JI7Q 2VQFL 3T56B 1H9RA 1E22A 1EEID 1JT8A 5IGFA 4IPCA 4NXNL 4A3MG 4A3DG 1YNJD 2JJQA 2JYOA 2UUAL 3M7GA 4X64L 1NCVA 3M85A 2KBNA 3F8TA 1JCKB 1PRTD 3LX0A 3LWEA 1VQKA 1FGBD 2EY2A
chains in the Genus database with same CATH topology
1D1IA 2Z4IA 5IGGA 2A68C 4C1NI 2WAQB 3GTQB 1SYCA 4L63B 1DM0B 2OT2A 3CQZB 2NUCA 4YIJA 1DYQA 1PTOH 1BQQT 1KABA 4RGTA 2FMMA 1SYEA 5D65A 1C8CA 1CT1D 2VB2X 5DNFA 3PMFA 3NBIA 1XWEA 1FYCA 1EYCA 1WD0A 2F0OA 4LJZC 4IALA 3KBXA 1HFNA 3D3RA 4MIUA 4RCOA 2EDGA 4OO1I 4J8QA 2WINB 3DXJC 1ZXTA 1SE2A 4HCEA 5KGUA 1ICWA 2NZ1D 2XWBB 1WTRA 3NUCA 3I90A 2XSCA 1TWAB 4K8JA 5T1GA 3OIQA 1J9OA 2F0GA 2B2VC 4BBRB 2CHBD 1H9SB 3OMGA 4JK1C 3VYUA 3CKIB 4K8IA 4A3GB 2CW0C 1CZGA 1D5MC 2JEBI 1TWFB 1PRTF 2Z8LA 3R2IA 1STHA 1EZ8A 1JORA 2DNCA 3L9AX 3K5LA 4K5VA 5C4XB 1EY9A 1S4ZA 5A35A 2HDMA 5NUCA 4G4KA 3BS1A 2OF1A 1G8ZD 2BDNA 4RFBA 2B8FA 2BDOA 2WACA 1EY6A 3QWNA 2EYFA 3OWEB 1TWCB 2RSNA 3VA5A 3FEWX 2MJ8A 2B63B 1SMYC 2FMCA 5ELBA 4XYQA 3WDNA 4KY6A 2A6ED 1KNEA 1TT2A 4OL7A 3I3CA 4KJNA 2KCNA 3Q23A 2HCCA 3DM1A 4DNTB 3QO2A 4FVMA 1ZYRD 3M7NA 1Z47A 4FF4A 4A3EB 1EQTA 1PMRA 2L1BA 1U9RA 5C0XI 4BY7B 4ME5A 1UUPA 1SBBB 2K5QA 3QG1A 2NBFA 3BVGA 5IGBA 3PIO3 3NTKA 3K0YA 1BR9A 1SMYD 1PZKD 1EEFD 2EY6A 2WP8J 1R9TB 4XDXA 2M9VA 2KHSA 4ZLTF 1EY7A 2NN6G 4OO1H 4FNFA 2XWJB 3ONAB 5JVG3 2IWHA 2MUYA 3FPPA 2KCCA 5JJZA 5CC4A 1RD9D 4ZKCB 3S9WA 3S2DB 1O78A 4DK0A 1X32A 4FO2A 1KLGD 5IIFA 4XTCS 2F0QA 1STNA 1UNSA 4KV6A 5EKIA 2K03A 3QJYA 1G291 1SNDA 3SVMA 1CHQD 3MWYW 5CV8A 2AWNA 4NKLA 2F0JA 5T1IA 2NYZD 3NK9A 4RAUC 1E2WA 4DK1A 2EZVA 3TDQA 2L9HA 1QCBD 4R8IA 3T51B 2JP1A 5KIXA 1EIHA 2MP1A 1LTBD 1SYBA 3K6OA 2TSSA 3CRKC 4X3UA 3K7AB 2X6GA 2Y0SB 3BVZA 1E2ZA 2NN6I 3GP7A 3J7YW 5EKLA 4K5XA 2G9DA 1IKMA 4PMBA 3JAME 3NWTA 5E1FA 1A2TA 1ILQA 2K04A 3G7LA 2QDBA 3X3MA 2NVTB 5M5WB 1QJOA 4IQZA 4BA2I 1B9MA 2F0SA 4HTHA 3N52A 3Q24A 3AU7A 1IYUA 4DAPA 1O80A 2IPKD 1ZEQX 3R8BA 5C0XH 1LT3D 2X6LA 1IL8A 2TMPA 1IYVA 4RWSC 3TZUA 4Q5VA 3J81L 5IT9E 2IX0A 5IGDA 4CGYB 2PYKA 1EYDA 4IUTA 1JOOA 3P1HA 3K57A 4WJWA 2H4OA 5M3MB 4RA8A 1AP0A 5C5MA 3S15B 1KTKA 5LHY1 2KVMA 2WIIB 5C3XA 1OXTA 1AEXA 1RHPA 5JPNC 1VMPA 3CU7A 4CBVA 1SE4A 2E76C 2ZXOA 4Q0FA 4QMGA 4R8NA 1MD2D 3NHHA 2B2TC 1QOHA 2CVRA 3CHBD 5JEAJ 5I4DA 2KA7A 3WOEA 3GV3A 1O7LA 1X3QA 2IX1A 5C0XJ 1B2TA 4LMQD 3ERQA 1TY0A 3MHBA 2ENBA 3W2DA 1B1ZA 1TQOA 2EJGC 1BCPC 3KLSA 3DWAA 3SK6A 1NR2A 1I4HA 2KUMA 5I6WA 1I4QA 5M9OA 3PO2B 1ML0D 1A6XA 3SK8A 3A8KE 2IW3A 2KJXA 5CV5A 1LTSD 5C4JB 3JAML 5EPKA 1RF2D 2NTSA 1JOQA 5ELFA 4CHTB 2J4XA 5EPJA 5C0XG 3Q22A 4H7BA 3FVQA 1QE6A 3T4AC 3GTOB 5CV4A 1MSGA 1H9SA 1Q12A 3WOFA 1I4XA 4RH6A 2F0DA 1W6KA 2Z1CA 2FJ2A 1SJHD 5D3IB 4DFAA 2XVSA 2C9OA 4I65A 5BN5A 3URYA 1SE3A 1WTXA 1G91A 3NBHA 1ZYRC 1BF4A 1GUOA 1GUWA 1LTGD 4K6DA 2KQ3A 4FF3A 1UAPA 2B2UC 3GD7A 4C3HB 2F0IA 1VCIA 4UDUC 2Q8IB 1LV9A 4ZQ3A 1V8QA 1TWHB 1WTOA 1H9KA 1A3TA 1EY4A 4OIJA 4RGMA 3MFGA 1CZWA 4PMCA 3V96A 3LWUA 2R92B 1SYFA 5I2XA 3D8GA 4R9WA 2IX3A 4BBSB 1S5FD 1Q90A 2JSOA 4IUQA 5I9PA 1B3AA 1F2ZA 4PMWA 2EYPA 1HA5A 2L5TA 4X3KA 1LT5D 2R7ZB 2F0FA 1KDCA 3SE0A 4M8AA 5IGCA 4PNYA 4H13C 1STYA 1FD7D 2D9UA 5ELDA 2VXWA 1PYWD 1V1PA 5EGTA 3MXNA 3D4RA 5C5LA 2R93B 1JWSD 5G3LD 1EIGA 4DAVA 2EY1A 2M00A 4QIWB 5FKAC 2A6EC 3RUZA 1Y1VB 1RCVD 1YNNC 4X3TA 1SNPA 4NMZA 3VR3A 2EY5A 4KN7C 1GJXA 3EFXD 4PQXA 2BCOA 4TRDA 3NSWA 4IUPA 4EGVA 4BWGB 3BVMA 2PMZB 4C56C 2Q8RE 1EY5A 3MXPA 2HDLA 3C46A 4IUNA 4G7HC 2NB0A 3A7LA 1PXUA 2B2WA 4KKSA 3D4DA 3K5NA 2C5CA 5J1ZA 2E2DC 3ND9A 4Y7NB 1A3VA 4OGQC 3T53B 1QWYA 5FO8B 4XT3B 5I2YA 3BDLA 4EQOA 4TSSA 4C3IG 1ENFA 1OXUA 4QCLA 1CM9A 1K8OA 2F0VA 4K6LA 2E2IB 1G2TA 1JB3A 1BCPB 1MI2A 5FLXL 2A6HD 5J22A 1U4PA 2Q8TA 2QEJC 5BN4A 2X69A 3TP6A 2R61A 3TBIB 2HCIA 1IKLA 1Q1EA 3I91A 1BDOA 3MA2B 5I6YA 3EJIA 1D5ZC 4H0LC 3A55A 1GHKA 2NVXB 1GUSA 1SNOA 5D3DA 4KI0A 5G3LF 2PZWA 4C3JG 2ICIA 2B2TA 3DUZA 1D5XC 1CHPD 2JEAI 1L0YB 5C4HA 1QNKA 4ABNA 1OO9B 2RBMA 1JR0D 3R3OA 4H44C 3GTKB 1HQRD 4DAYA 3E0JA 1GUTA 3AMUA 1BO0A 3HOXB 3MTSA 4A3DB 5JVH3 1SAPA 1Q1BA 1ET6A 3MEHA 4U673 1Q8IA 1DOKA 1SSOA 4Z9CB 3NQIA 1RTNA 1XXGA 3ITPA 5EBDA 1PZID 3SXHA 2E75C 3J80L 4KHZA 1PLFA 1KDAA 1LTTD 1E0BA 2SNMA 4QUCA 2K7VA 4CJ0B 3EROA 3HG9A 5F2DA 1LO5D 1LLRD 1D1KA 3HZXA 3HEJA 2RQXA 2NVQB 3T16A 1RTOA 3MFYA 2PPBC 3PO3B 4IN3A 1C48A 4UAIA 4DXGA 3I4NB 3NP8A 5J39A 5IODA 3GTJB 4EVOA 3GTMB 1R4QB 1F9QA 2K5DA 1NSNS 3S1NB 3D31A 4IZ8A 1RODA 2ZXRA 5A2QE 2EOTA 5ELCA 4C2MB 2F3WA 1VMCA 3RZOB 2B2UA 3W3AA 1H9MA 2MHVA 1BCPF 3C1FA 5K36G 3Q0AA 3HOUB 4DA2A 1QILA 1V1OA 1WTPA 3I73A 3FMCA 4DXFA 4NP5A 5FO7B 1LTRD 5EKKA 3P20A 5C44B 2WV6D 3VA7A 1G6ZA 1GHJA 2F03A 3MXUA 3Q6SA 3TSSA 1FNWA 2FINB 3DEOA 3KUPA 3MAQA 1STBA 4K14A 2WKDA 1DJRD 3MXGA 4HMIA 1EY0A 1DCZA 2RA4A 1VDZA 1EWHA 5KRUA 1LT4D 4O1NA 3S1MB 3ND8A 2QCPX 3BYTB 1VF5C 3FPUB 1V1PB 2A68D 2J7ZA 3KLSX 3BG3A 2F0HA 1I6HB 4CKCA 4IFDG 2F4IA 3SDZA 1PFBA 5CBEE 4KHVA 4A3FB 2L4NA 4J6HA 3QOLA 3A54A 3D4WA 2XRSD 1SFOB 4G7OC 4P2CB 2BA0A 3NTHA 2LMCB 2A5HA 1T5XD 2EYJA 3SK4A 2XRQD 5COYA 5EPLA 1D2BA 1DOLA 4IURA 2PZUA 2B2WC 5LL6X 5KYLA 3NXWA 3PIP3 1IHZA 4A3IB 1LTID 4ZAIA 2WB1B 1HHVA 3HRZC 3RD4A 4O42A 2L11A 3I4MB 1BNZA 1EL0A 1F9PA 1STGA 3OWFA 4X3SA 4ZK9B 3K5OA 1OXXK 2YYZA 1RDPD 3R93A 2Z4HA 4DU9A 5FK9C 3V2TA 3C3LA 2O5IC 1QB5D 5ELEA 5I9OA 1NAPA 2PW5A 5LL6S 4RKBA 4OIKA 3EQLC 3NE5B 1EFID 3TZDA 4XIGS 1AW7A 1F2LA 3OOCA 4A3MB 1WTWA 2NVYB 4CKEA 4DNRB 3GV6A 3IFDA 3QIAA 3NTIA 1EYAA 4LAAA 2OEOA 1J8IA 2AUKA 1SXTA 3H94A 1TS3A 1I3QB 1NR4A 2DY8A 3OMCA 4FF2A 3NPPA 1PTOC 3U9SA 3GTGB 2H1EA 3PV0A 4B08A 4IFDH 5M5YB 1SNQA 3H0GB 5JOBA 2QILA 1ET9A 3J81E 1M8AA 1X3PA 3IL8A 3L3OC 3HOVB 2R6GA 1FR3A 1MSHA 1Z6HA 5FLXE 1GUNA 4FXDA 2B2YA 4CJ2C 4RCNA 3H09A 4I7ZC 3VR4A 4ZYSA 2BA1A 5K5PA 3DWQA 5JAVA 1F2YA 2EXZA 4ID6A 4IUUA 5JPMC 1HUNA 3TN2A 5IOCA 1A15A 5M5XB 2AUJD 3FRPB 3VR2A 3VYRA 2F0MA 3VR6A 3HKZB 3N6RA 5IGEA 4XXEA 1F9SA 3PUXA 2EYMA 1PZJD 2WKCA 3G6JB 2A6HC 2XN9C 1XX8A 4RKLA 1U4RA 3A8IE 1OXVA 1PFNA 1QG7A 4E6IA 1EZ6A 1SYDA 3GTLB 2VNUD 2N88A 1Y8NB 3NWSA 3RZDB 1O7YA 2JA7B 5E4WC 1HTPA 4MHEA 2OXPA 1DZ1A 2K1BA 2BOSA 4JBWA 3VYSA 1DXMA 2RDHA 5D14A 1WCMB 3C2PA 5DM73 2F0KA 1SNMA 5CYUA 5KNDA 4J1MA 1TWGB 1CFMA 1MBYA 4XQJA 1K83B 1LABA 5CV9A 1ENCA 1ONLA 1YNJC 2AWOA 2SNSA 2ICEC 2K6AA 4CKBA 3FKIB 1VF7A 2EE1A 3S1QB 5A2QL 4G7ZC 4KY7A 3AB9A 4HAEA 4HSPA 3U9OA 1LT6D 1MGSA 2E2JB 4F87A 5KEEA 3I4LA 4QUFA 5FO9B 3K59A 2FHTA 3EA6A 4IFDI 1F2MA 2M2LA 2HQEA 4HSVA 4G57A 4V190 1CI3M 1HA6A 4RGOS 2EJFC 1TR5A 2IJ0A 2B2YC 5FOBB 3L7ZC 1B44D 4AYBB 5ISRA 1H9JA 4NDXA 1TS4A 1GOZA 1SYGA 2B8GA 4ODGA 1WVLA 2CQAA 1CTMA 5CGKA 4U68A 2QKIC 4RHRA 1KDBA 2DNEA 5JEAG 2JE6I 1NUCA 1CA5A 1IW7C 4HEDA 2F3VA 3S2HB 5CBAE 1B4OA 1K8MA 1GXDC 3GQBA 2I46A 4F8MA 1I4PA 2K28A 2LS01 3DHQA 1V43A 3BDOA 1JICA 1G2SA 5TSSA 3KK7A 4KD3A 4B9XA 4EQPA 2O2LD 3F2UA 3R2TA 2A74C 1PTOB 4KY5A 4K2LA 2MPMA 3IFTA 2V4DA 2F0NA 4OHJA 4C3HG 2KEDA 4RGNA 3I72A 2CW0D 2N55A 1EY8A 4WORA 3M3YB 3GO5A 1WD1A 2D62A 4F88A 4L6TB 3BZDB 1Q3LA 5CR3A 1C4QA 2G9HD 1QNUA 3SR1A 4TQUS 3SHLA 3SK5A 3GTPB 1UEAB 2PQEA 4OO1G 1STEA 3SEBA 2EYOA 3C1EA 4KKTA 1O7ZA 1TS2A 3PUYA 1Y69U 1JWMD 1R4PB 1BXTA 1AZPA 1TVXA 2SEBD 2F0EA 2B39A 1U4LA 2A69D 3S14B 4RHSA 1SEBD 2JXMB 4IUVA 4BY1B 1HQMC 2AQ3B 2KEEA 3HOWB 2K05A 1ILPA 1RKNA 1BOSA 5E4XA 3J7AF 1HUMA 2IT1A 1AN8A 1JOKA 4XYOA 4TKOB 2QF7A 3PUZA 1WTQA 3J80E 1A2UA 3J7AV 3V05A 3UI2A 2EYLA 4A3JB 4IFDJ 2XNAC 3KBGA 3HOYB 2F0WA 3MC0B 2O5JC 1B9NA 3HGBA 1JWUD 1II3A 1BBXC 1GUGA 2LFNA 1ESFA 5M3FB 4BA1I 1M4VA 2SDFA 3BYYB 1HTLD 2HUGA 5EBCA 4HN7A 2K32A 5EJWA 2A73B 3X3NA 4S3SA 1SJED 3QOJA 1TY2A 4LK1C 1S5DD 1AFPA 1EU3A 1PTOF 3S17B 3OHXC 3TMEA 1EWCA 1EQVA 4FP5D 1EOTA 3IKJA 2DY7A 2SOBA 2JA5B 1I4RA 1CQVA 2ZXPA 3H3VC 2A69C 2LKVA 3KLRA 4KN4C 1PRTC 2L55A 4ZRZA 3IAYA 3KF8A 1HCZA 1YNND 3OSOA 4KMUC 5DAUA 4N9TA 5DEHA 4A93B 2VUMB 2L12A 1RJTA 1BCPD 3PUVA 4FYDA 4ULLA 3M4OB 1CK1A 3HOZB 5KNCA 4QB4A 2K5WA 2E74C 1PFMA 4QF4A 4C3JB 3DWPA 4WFN3 5C3EB 1S5BD 2RDFA 4ZUIA 1S5ED 2JA8B 1DONA 2BE5C 2PZTA 3M4YA 1EU4A 5E3FA 4DN4M 4KKUA 3D6WA 3FDTA 2PNRC 4GZYC 2J0TD 2F0PA 5C6AA 2D5DA 1TU2B 2O4XA 2F0UA 3RMHA 2PO4A 3LNNA 2E2HB 4BS9A 2I07B 2RVLA 4L8JA 1OXSC 3A8JE 4PV1C 1D6EC 4KJOA 1HRJA 4KD4A 4NW2A 2IL8A 4A3BB 3H6MA 5CV7A 1LTAD 1A3UA 3P75A 1PTOD 1PDQA 1STAA 4WRDA 1I50B 5KNBA 3I70A 3RLFA 3QB3A 5AFWA 4EQNA 1KNAA 1SDFA 3OIPA 4FXKC 1TKWB 3EVQA 1TS5A 4HMJA 1Z7TA 5C3WA 5IT9L 1JE4A 1SNCA 1FNVA 3OPOA 1Y8OB 3K58A 3HS0C 4M1UB 5KYIA 3VYTA 2KECA 2AQ2B 3E5SA 4MN3A 3TP8A 4B9WA 2RKSA 1XTCD 5DM63 2KOLA 2NN6H 1W6JA 2RSOA 5CV6A 4CJ1B 2LY7A 3OW7A 4N9PA 4K2KA 1S5CD 5CORA 1WTVA 1XYIA 1CA6A 1BUVT 3T13A 1F77A 2XIWA 2ID0A 1DD2A 1ENAA 4DF7A 1LACA 4HCSA 1Y8PB 1FNUA 2K33A 3CRLC 4F7XA 1ESRA 5BN3A 5EQ0A 1TIID 2GA4B 4XQNA 2R3ZA 3I8ZA 1Y1WB 1IW7D 1T5EA 3H91A 2YU9B 1F9RA 4ZKBB 1DOMA 2K01A 2FFKB 3HP3A 1JQYD 2PW7A 4FF1A 3K5MA 3E6ZX 2F0TA 3A56A 3PUWA 3O13A 1JC7A 3S16B 1AZQA 1HFGA 4DGZA 4FXGC 4ILWA 1ZKOA 3BDCA 2JA6B 2F1MA 4V0BA 2RDGA 1CQFA 1KLUD 3ZYYX 2EYHA 1U4MA 2EJMA 3TP5A 2PCFB 4K5WA 3MVVA 5CMDA 2NTTA 3P7JA 3D6CA 5K36H 5HGTA 3DMUA 5JEAH 3TP7A 2ZT9C 1KAAA 1I4GA 4KTAA 2D2CC 2MGSA 3NQTA 2BE5D 4C3IB 2B2VA 4HR7B 3A7AB 1L0XB 5HURA 3S1RB 2AQ1B 4A3KB 3DEPA 1B50A 2NWGA 2EPBA 2VB3X 3MZ5A 1E2VA 2F0LA 1HPCA 2DN8A 2L0CA 1HXYD 3VR5A 4ZUJA 4XQQA 1PRTB 1I6VC 4KK7A 5C4ZA 4C1NK 4XT1B 1B53A 2EVBA 3T56B 1H9RA 1EEID 5IGFA 1YNJD 2JYOA 3M7GA 1NCVA 3M85A 1JCKB 1PRTD 3LX0A 3LWEA 1FGBD 2EY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W2D A;  1B1Z A;  1V1P B;  4RHR A;  2RDG A;  1LO5 D;  1FNV A;  1LLR D;  1PRT F;  1BCP C;  1AW7 A;  1KLU D;  3KLS X;  1BCP D;  2AQ3 B;  2Z8L A;  3DWA A;  3R2I A;  1CK1 A;  1I4H A;  1HA5 A;  1I4Q A;  1LT5 D;  4TSS A;  4DXG A;  1ENF A;  2IPK D;  2AQ2 B;  1AN8 A;  4L63 B;  1I4P A;  1LTS D;  1LT3 D;  3R8B A;  1SXT A;  4K6L A;  1TS3 A;  2NTT A;  1RD9 D;  1XTC D;  3DWP A;  3BYT B;  1BCP B;  1S5B D;  1G8Z D;  2XRS D;  1RF2 D;  1PTO C;  1DYQ A;  5TSS A;  1FD7 D;  2RDH A;  4RFB A;  3V05 A;  5ELC A;  2QEJ C;  1PTO H;  2NTS A;  1KLG D;  2R61 A;  5ELF A;  5ELD A;  1I4G A;  1S5E D;  2XNA C;  1PYW D;  2J4X A;  1V1P A;  3OWE B;  4RGT A;  2O2L D;  3MC0 B;  1EU4 A;  1JWS D;  1BCP F;  1UNS A;  1D5Z C;  2QIL A;  3R2T A;  1ET9 A;  1JWU D;  1PTO B;  1S5C D;  1CT1 D;  1I4X A;  4RH6 A;  5ELB A;  1T5X D;  1QIL A;  1V1O A;  5D3D A;  5FKA C;  1ESF A;  1CHQ D;  1L0X B;  2XRQ D;  4OHJ A;  1F77 A;  1RCV D;  1M4V A;  2ICI A;  2AQ1 B;  4DXF A;  3BYY B;  4RGN A;  1HTL D;  1LTR D;  1SJH D;  5D3I B;  1D5X C;  1CHP D;  2WV6 D;  1L0Y B;  4RCO A;  4ZYS A;  3EFX D;  1FNU A;  1LT6 D;  1JR0 D;  3URY A;  1HQR D;  3DWQ A;  1SJE D;  1TY2 A;  1KTK A;  1LTI D;  4L6T B;  1SE3 A;  1D6E C;  1HXY D;  3BZD B;  1SE2 A;  1S5D D;  1LTG D;  1LTB D;  4BWG B;  1EU3 A;  3BVM A;  2G9H D;  3TSS A;  1FNW A;  1PTO F;  4C56 C;  2TSS A;  1PRT B;  1ET6 A;  3EA6 A;  4Z9C B;  4UDU C;  1LTA D;  1RDP D;  1JQY D;  1DJR D;  1XXG A;  3BVZ A;  1STE A;  1PTO D;  5FK9 C;  3SEB A;  1EWC A;  1SE4 A;  1PZI D;  1UUP A;  3GP7 A;  1SBB B;  1TS2 A;  1PZJ D;  4RGM A;  5ELE A;  3MFG A;  1EEI D;  1MD2 D;  1JWM D;  4RGO S;  2CHB D;  3BVG A;  3O13 A;  2IJ0 A;  1I4R A;  1CQV A;  3CHB D;  1BXT A;  5I4D A;  1LT4 D;  4O1N A;  2XN9 C;  1LTT D;  2SEB D;  1B44 D;  1PZK D;  1PRT C;  1EEF D;  1TS4 A;  1JCK B;  1PRT D;  1GOZ A;  1TS5 A;  1S5F D;  1TY0 A;  1EFI D;  1FGB D;  4RHS A;  1D5M C;  1SEB D; 
#chains in the Genus database with same CATH topology
 1PH3 A;  1D1I A;  2QGQ A;  3J80 i;  3J81 c;  2Z4I A;  5IGG A;  2A68 C;  2AHO B;  3M3Y H;  2UXB L;  4LNQ A;  4C1N I;  2WAQ B;  3GTQ B;  1SYC A;  4L63 B;  1DM0 B;  3K7A H;  1PA6 A;  4K0K Q;  2OT2 A;  4HJ7 A;  3CQZ B;  3HOZ G;  2NUC A;  4YIJ A;  2CH4 A;  3AQQ A;  2AKW B;  1DYQ A;  3W1B A;  1VQ9 A;  4DR7 L;  4DV4 Q;  1PTO H;  1BQQ T;  1LUZ A;  3G6E A;  1KAB A;  4RGT A;  2FMM A;  4JI5 Q;  1SYE A;  3ULJ A;  5IP9 H;  5D65 A;  3OTO L;  1C8C A;  1CT1 D;  4UP9 A;  2VB2 X;  2UXC L;  5DNF A;  3PMF A;  3NBI A;  1XWE A;  4L5T A;  1FYC A;  1EYC A;  1WD0 A;  2F0O A;  1R9T H;  4LJZ C;  4NXM Q;  4IAL A;  1Q81 C;  3KJP A;  3KBX A;  1HFN A;  3D3R A;  3PCO B;  4MIU A;  4RCO A;  2EDG A;  2R7Z G;  1BBW A;  4OO1 I;  4PZ8 A;  4J8Q A;  3H15 A;  1JMC A;  3I56 A;  2WIN B;  3DXJ C;  4NXN Q;  1ZXT A;  4BY1 G;  3ICE A;  4A3M H;  5LMN Q;  1SE2 A;  2CQO A;  4HCE A;  2Y0S G;  5KGU A;  1ICW A;  2NZ1 D;  3CMA A;  2VZA A;  1X65 A;  1NMG A;  5GAE C;  2XWB B;  4JBJ A;  2B63 G;  1WTR A;  3NUC A;  3I90 A;  2Z9H A;  1Q46 A;  4JOI A;  2XSC A;  4A3E H;  1TWA B;  4K8J A;  5T1G A;  3OIQ A;  1J9O A;  2F0G A;  3TRE A;  2B2V C;  1MHW C;  3JAM c;  4DR2 Q;  3SGI A;  4BBR B;  3PF4 A;  2CHB D;  1H9S B;  1PH2 A;  3OMG A;  2JA7 G;  4JK1 C;  1MJE A;  4LF9 L;  4WJ3 M;  3VYU A;  3CKI B;  4K8I A;  2OTL A;  4A3G B;  2LXJ A;  2CW0 C;  1CZG A;  1D5M C;  2JEB I;  4DR1 L;  1TWF B;  2Q2U A;  1WCM G;  1PRT F;  3AYH B;  1NBW A;  3I4M H;  1PH5 A;  1P8L A;  2Z8L A;  3R2I A;  1STH A;  2E2J H;  1EZ8 A;  1JOR A;  2DNC A;  3L9A X;  3K5L A;  1U5K A;  3HOV G;  4K5V A;  5C4X B;  1XNR L;  1EY9 A;  1S4Z A;  1Z9F A;  3FKI H;  4K0K L;  5A35 A;  2HDM A;  5NUC A;  4G4K A;  2GN5 A;  1FGU A;  3BS1 A;  2OF1 A;  1HNZ Q;  1G8Z D;  2BDN A;  1A63 A;  3A5Z B;  4RFB A;  3OYY A;  2B8F A;  2BDO A;  2WAC A;  1EY6 A;  3QWN A;  2EYF A;  3OWE B;  1TWC B;  1WTH A;  2RSN A;  3K0X A;  3VA5 A;  3FEW X;  2MJ8 A;  1HR0 W;  2B63 B;  2QW7 A;  1X3F A;  1SMY C;  2UUB Q;  1AE2 A;  5IT9 c;  1NE3 A;  3CCQ A;  1VQJ A;  1U0L A;  4MTN A;  2FMC A;  5ELB A;  3S24 A;  1XPR A;  2VL6 A;  4XYQ A;  3WDN A;  4KY6 A;  2A6E D;  4HJ8 A;  4JG2 A;  4A3G H;  4WJ4 A;  1KNE A;  2CWA A;  3VDY A;  1TT2 A;  4OL7 A;  3I3C A;  2DGY A;  4KJN A;  1HNX Q;  1IBM L;  2KCN A;  3Q23 A;  4DV1 Q;  1K9M C;  2B63 H;  1TWC H;  3GTL H;  2HCC A;  3DM1 A;  4DNT B;  3QO2 A;  4N8X 1;  4FVM A;  2XGT A;  1ZYR D;  3M7N A;  1L1O C;  1Z47 A;  1GO3 E;  4AYB G;  4FF4 A;  5IE8 A;  4A3E B;  1EQT A;  1PMR A;  2L1B A;  1U9R A;  5C0X I;  4BY7 B;  4ME5 A;  1UUP A;  1SBB B;  2K5Q A;  1RIP A;  5H1S E;  3QG1 A;  2NBF A;  3BVG A;  1C7Y A;  5IGB A;  3PIO 3;  3NTK A;  3K0Y A;  3I4M G;  3AEV A;  3CCM A;  2L15 A;  1BR9 A;  1SMY D;  1PZK D;  1EEF D;  2EY6 A;  2WP8 J;  1R9T B;  4XDX A;  2M9V A;  2KHS A;  3HFZ B;  4ZLT F;  1MKH A;  1EY7 A;  2NN6 G;  4OO1 H;  4OEM B;  4FNF A;  2XWJ B;  3RNU A;  3ONA B;  5JVG 3;  3A74 A;  2QA4 A;  4JI1 L;  4KLK A;  4POF A;  2IWH A;  1UE7 A;  2MUY A;  4QIW E;  3FPP A;  2KHI A;  2KCC A;  5JJZ A;  4X62 Q;  2UUC Q;  5CC4 A;  4A76 A;  1HZA A;  1RD9 D;  4ZKC B;  3S9W A;  3S2D B;  2R7F A;  1O78 A;  3CQZ H;  4DK0 A;  4GKJ L;  1X32 A;  2H5X A;  3H3V I;  4FO2 A;  1KLG D;  4FDB A;  5IIF A;  4XTC S;  3H0G H;  3PIO A;  2F0Q A;  5M5Y H;  4YCV A;  1STN A;  1HR0 L;  1UNS A;  4KV6 A;  4QQB X;  5EKI A;  2K03 A;  2VS1 A;  3QJY A;  4JV5 Q;  1G29 1;  1SND A;  3SVM A;  2I0Q A;  1CHQ D;  1I3Q H;  3CCR A;  3MWY W;  5CV8 A;  3CC2 A;  1B7Y B;  2AWN A;  4NKL A;  1EQR A;  2F0J A;  5T1I A;  2NYZ D;  3NK9 A;  4RAU C;  3KDF B;  3RN5 A;  1E2W A;  4R4Q A;  4DK1 A;  3H0G G;  4YY3 Q;  2EZV A;  3TDQ A;  4JI0 Q;  2L9H A;  1QCB D;  1YI2 A;  2B3G A;  4DV2 Q;  4R8I A;  2NVQ H;  1CKN A;  3T51 B;  4IOC A;  3STB C;  2JP1 A;  4JI7 L;  5KIX A;  1EIH A;  2MP1 A;  1LTB D;  4GLX A;  1SYB A;  4HIO A;  3K6O A;  2TSS A;  3ERS X;  3CRK C;  1VQ7 A;  4X3U A;  3K7A B;  2Q2I A;  1NY4 A;  2X6G A;  2Y0S B;  3BVZ A;  5AJ3 L;  1KIX A;  1E2Z A;  1X54 A;  2R92 G;  2BH2 A;  2NN6 I;  4BXX H;  3GP7 A;  3J7Y W;  4B3S Q;  5EKL A;  4K5X A;  4BBS G;  2G9D A;  1IKM A;  4PMB A;  3JAM E;  3NWT A;  5E1F A;  1ICF B;  1A2T A;  4UHV A;  1ILQ A;  2K04 A;  4HJ5 A;  3G7L A;  2PMZ E;  2QDB A;  1VQA A;  4A3K H;  3CCL A;  4JV5 L;  4LF6 Q;  3PSI A;  3X3M A;  1AH9 A;  1W2B A;  5M5W B;  4A3D H;  1QJO A;  2NVT B;  4IQZ A;  4BA2 I;  1B9M A;  2F0S A;  2Z6K A;  4HTH A;  1FVI A;  4DK3 C;  3N52 A;  3Q24 A;  3AU7 A;  1IYU A;  1UE5 A;  4DAY B;  4DAP A;  3F1Z A;  1O80 A;  2IPK D;  2HHH L;  1ZEQ X;  3PIP A;  3R8B A;  5C0X H;  1LT3 D;  2X6L A;  3D0F A;  4JI2 Q;  1IL8 A;  2TMP A;  1IYV A;  1HZ9 A;  1VQD A;  3F2D A;  4RWS C;  3NEM A;  3EIV A;  3TZU A;  4Q5V A;  3J81 L;  5IT9 E;  4GOP B;  4AH6 A;  2IX0 A;  5IGD A;  4CGY B;  2PYK A;  2K14 A;  2JA6 H;  5BR8 L;  1EYD A;  4IUT A;  1JOO A;  3P1H A;  3K57 A;  4WJW A;  2H4O A;  2K5V A;  5M3M B;  4A3F H;  4LF8 L;  1VQC A;  4RA8 A;  2JA5 G;  1AP0 A;  1MJC A;  5C5M A;  4B3T L;  1KTK A;  5LHY 1;  2KVM A;  3S15 B;  2WII B;  5C3X A;  1OXT A;  2VY3 A;  4ZCK A;  2E5L Q;  1AEX A;  1LTL A;  1RHP A;  1YIJ A;  4R4C A;  3RR5 A;  1K0R A;  4B3R Q;  3S1M H;  5JPN C;  1SE8 A;  1VMP A;  2V1C C;  2YU9 H;  3CU7 A;  4CBV A;  4A93 G;  4DAM A;  1SE4 A;  1XMO L;  2E76 C;  2ZXO A;  1VQP A;  5L37 A;  1Y1W H;  4Q0F A;  3CCS A;  4QMG A;  4R8N A;  2JN4 A;  4LF5 L;  1MD2 D;  3NBH B;  3NHH A;  4DPG A;  2B2T C;  3CHB D;  1QOH A;  2CVR A;  2WAQ E;  5JEA J;  5I4D A;  2KA7 A;  4UP8 A;  3WOE A;  3GV3 A;  2IY5 B;  1O7L A;  1X3Q A;  2VQF Q;  2IX1 A;  5C0X J;  1B2T A;  4LMQ D;  4MZ9 A;  3ERQ A;  3L2P A;  1TY0 A;  3MHB A;  2ENB A;  4YWL A;  2Q2T A;  4LUO A;  3W2D A;  1B1Z A;  5FJ8 H;  4JI6 Q;  2ATW A;  1TQO A;  2EJG C;  1BCP C;  1XMO Q;  3KLS A;  3S16 H;  3TS2 A;  1ASZ A;  3I55 A;  3DWA A;  4A3K G;  3SK6 A;  2ZJQ A;  1NR2 A;  1I4H A;  2KUM A;  5I6W A;  1I4Q A;  5M9O A;  3PO2 B;  1ML0 D;  1A6X A;  3SK8 A;  3A8K E;  2IW3 A;  2KJX A;  5CV5 A;  1LTS D;  5C4J B;  4LUV A;  2JQO A;  3JAM L;  5EPK A;  4LF4 Q;  1RF2 D;  3Q8D A;  3HOU H;  3BJU A;  2NTS A;  1JOQ A;  5ELF A;  4CHT B;  2J4X A;  5EPJ A;  5C0X G;  3Q22 A;  4H7B A;  3FVQ A;  1QE6 A;  3T4A C;  1IZ6 A;  3GTO B;  4DR1 Q;  2RHQ B;  5CV4 A;  1MSG A;  1P16 A;  1H9S A;  1Q12 A;  3WOF A;  1I4X A;  4RH6 A;  2F0D A;  3E3X A;  3S1N H;  1IL2 A;  3KFU A;  1W6K A;  4NB3 A;  2Z1C A;  2FJ2 A;  1SJH D;  1K8G A;  5D3I B;  2OCE A;  4DFA A;  2XVS A;  3I4N H;  3HOX G;  2C9O A;  1J5E L;  3PO3 H;  1KL9 A;  4I65 A;  4R4O A;  5BN5 A;  4GN3 B;  3URY A;  4A75 A;  5GRO A;  1SE3 A;  3CCE A;  1WTX A;  1G91 A;  3K81 C;  3NBH A;  1ZYR C;  1BF4 A;  1GUO A;  3KF6 B;  1GUW A;  1LTG D;  4K6D A;  3QR8 A;  2KQ3 A;  4FF3 A;  1UAP A;  2B2U C;  3GD7 A;  2R93 G;  2VUM G;  4C3H B;  2LSS A;  2F0I A;  1VCI A;  3PQI A;  4UDU C;  2Q8I B;  1LV9 A;  4ZQ3 A;  1VQH A;  1V8Q A;  1TWH B;  1WTO A;  1H9K A;  1A3T A;  1EY4 A;  4OIJ A;  4RGM A;  3MFG A;  1Y1V G;  4DR6 Q;  1CZW A;  1K3B C;  2RF4 A;  4PMC A;  3V96 A;  2E2H H;  3LWU A;  2R92 B;  1SYF A;  5I2X A;  1EOV A;  3D8G A;  1XTD A;  4R9W A;  2IX3 A;  4BBS B;  1S5F D;  2EIF A;  4JI4 L;  1Q90 A;  4A3L H;  2JSO A;  4IUQ A;  5I9P A;  1B3A A;  1EQQ A;  1HNW L;  1PH7 A;  1IBL Q;  2XTI A;  1F2Z A;  3ULP A;  4PMW A;  3OW2 A;  2EYP A;  3GTK H;  2PQA A;  1HA5 A;  2L5T A;  4X3K A;  1LT5 D;  2R7Z B;  2F0F A;  1KDC A;  5IP9 G;  3SE0 A;  3ZJY C;  4M8A A;  2ZTE A;  5IGC A;  4QJF A;  2ZJP A;  5FLX c;  5C3E H;  1Y14 B;  4PNY A;  4C3J H;  4H13 C;  1WI5 A;  2UXB Q;  1SLJ A;  1STY A;  1HH2 P;  1FD7 D;  2D9U A;  3KOJ A;  1VQO A;  5ELD A;  2VXW A;  1PYW D;  1HZB A;  1V1P A;  5IWA Q;  5EGT A;  1N36 L;  3MXN A;  3HOZ H;  3D4R A;  3K8A A;  5C5L A;  2R93 B;  1JWS D;  5G3L D;  2HT1 A;  2Z0S A;  1EIG A;  4DAV A;  2EY1 A;  3CC4 A;  2M00 A;  3UE1 A;  4DV6 Q;  4QIW B;  5FKA C;  2A6E C;  3RUZ A;  1Y1V B;  1RCV D;  1YNN C;  2F4V Q;  3EBE A;  4X3T A;  1SNP A;  4NMZ A;  3VR3 A;  2EY5 A;  4A3J G;  4KN7 C;  4KHP L;  3EFX D;  1GJX A;  4PQX A;  1IBK Q;  4DR4 L;  1CSQ A;  4X65 Q;  4GOP C;  2BCO A;  4TRD A;  4EX5 A;  4O2D A;  3NSW A;  1MIU A;  1WYD A;  4IUP A;  4EGV A;  1WJJ A;  4L5Q A;  4DV3 L;  4BWG B;  3BVM A;  2PMZ B;  4C56 C;  5C4X G;  2KHJ A;  2Q8R E;  1EY5 A;  3MXP A;  2HDL A;  4MNO A;  1YZ6 A;  1CKM A;  3C46 A;  4IUN A;  2OQK A;  1KHI A;  4G7H C;  2NB0 A;  3A7L A;  1PXU A;  2VUM H;  2K4K A;  2CWP A;  2B2W A;  4KKS A;  4R4I A;  3D4D A;  3K5N A;  2C5C A;  5J1Z A;  2E2D C;  3KDF A;  4GNX C;  2EQS A;  3ND9 A;  4Y7N B;  2UXD Q;  1A3V A;  1S72 A;  1YIT A;  4OGQ C;  3T53 B;  2ES2 A;  5HY6 A;  1QWY A;  2AMC B;  5FO8 B;  4BBR G;  2I5M X;  1VQM A;  4XT3 B;  3S15 H;  5I2Y A;  3BDL A;  4IO9 A;  4EQO A;  4B3M Q;  4TSS A;  4C3I G;  1ENF A;  1OXU A;  4QCL A;  1CM9 A;  1PFS A;  4JI0 L;  2F0V A;  4K6L A;  1KC8 C;  2E2I B;  1K8O A;  2N49 A;  3S17 H;  1G2T A;  1JB3 A;  1BCP B;  1MI2 A;  5FLX L;  3G48 A;  2ZTC A;  2UUA Q;  2A6H D;  5J22 A;  1U4P A;  2Q8T A;  2VQE L;  2QEJ C;  5BN4 A;  2X69 A;  3TP6 A;  2R61 A;  3TBI B;  2HCI A;  1IKL A;  1X9N A;  1Q1E A;  4YHH L;  3I91 A;  5EAY A;  3CAM A;  1BDO A;  3MA2 B;  5I6Y A;  3EJI A;  2RCN A;  3NEL A;  1D5Z C;  4H0L C;  3A5U A;  1QZG A;  1SMX A;  3A55 A;  1GHK A;  2NVX B;  1GUS A;  1SNO A;  5D3D A;  4KI0 A;  5G3L F;  2PZW A;  4C3J G;  2YV5 A;  2ICI A;  1S40 A;  2B2T A;  3CD6 A;  2JA8 G;  3DUZ A;  1D5X C;  4MTK A;  1CHP D;  2JEA I;  1XNR Q;  1L0Y B;  1QNK A;  5C4H A;  4ABN A;  1OO9 B;  2RBM A;  1JR0 D;  3R3O A;  4H44 C;  3HOY H;  1HQR D;  3GTK B;  4DAY A;  3E0J A;  3PGZ A;  4JBK A;  3RN2 A;  4JVZ A;  1GUT A;  3AMU A;  1BO0 A;  3HOX B;  1LYL A;  3MTS A;  3L0O A;  5M5W H;  4A3D B;  5IYD G;  1QVC A;  5JVH 3;  1SAP A;  3GTP H;  4BBS H;  1Q1B A;  1ET6 A;  3MEH A;  1XJV A;  4U67 3;  1Q8I A;  1DOK A;  1SSO A;  4Z9C B;  3NQI A;  1RTN A;  1XXG A;  3WWV A;  1E1O A;  3ITP A;  5EBD A;  1PZI D;  2JK8 A;  3SXH A;  2E75 C;  3J80 L;  3T1Y L;  3NEN A;  4KHZ A;  1QVF A;  1PLF A;  3HOW H;  4BY1 H;  3PF5 A;  1TWH H;  1KDA A;  4QGU A;  3J7A 5;  1C9O A;  1LTT D;  2FXQ A;  2I5H A;  1E0B A;  2SNM A;  3S14 H;  4QUC A;  2K7V A;  4CJ0 B;  3ERO A;  4LWC A;  4GOP A;  1N32 L;  2A19 A;  3HG9 A;  5F2D A;  2HHH Q;  1LO5 D;  1LLR D;  1D1K A;  1L1O A;  3HZX A;  3HEJ A;  2RQX A;  3K7U C;  1HNX L;  2NVQ B;  3T16 A;  1YJW A;  1RTO A;  3MFY A;  2PPB C;  3PO3 B;  4IN3 A;  3IRB A;  1C48 A;  1E3P A;  4UAI A;  4DXG A;  3I4N B;  1RL2 A;  3NP8 A;  5J39 A;  5IOD A;  3GTJ B;  1XNQ L;  1TXY A;  4EVO A;  3GTM B;  1R4Q B;  1K0S A;  1F9Q A;  1IXR A;  1NSN S;  2K5D A;  4NXM L;  3S1N B;  3D31 A;  4IZ8 A;  1ROD A;  2VQE Q;  2ZXR A;  5A2Q E;  2EOT A;  5ELC A;  4C2M B;  2F3W A;  4DV0 Q;  1VMC A;  3RZO B;  1N9W A;  3F2B A;  3GTO H;  2B2U A;  3T1H L;  1JJ2 A;  3W3A A;  1H9M A;  2MHV A;  1G51 A;  1BCP F;  3C1F A;  5K36 G;  1HNZ L;  1VQ5 A;  3Q0A A;  3HOU B;  3UDX A;  4DA2 A;  1IBL L;  2UXC Q;  1QIL A;  1V1O A;  3KYH C;  1WTP A;  2CFM A;  1UEB A;  3I73 A;  4B3T Q;  5C4J H;  4JYA Q;  3FMC A;  3W1G A;  4DXF A;  4NP5 A;  5FO7 B;  3S2D H;  1LTR D;  5EKK A;  3P20 A;  5C44 B;  1GM5 A;  2WV6 D;  1QUQ A;  4LFC Q;  2A8V A;  3T1H Q;  1CSP A;  3VA7 A;  3W5O A;  1G6Z A;  1B70 B;  1GHJ A;  5GQO A;  2F03 A;  3MXU A;  5IYC G;  3Q6S A;  4Y52 H;  3TSS A;  1FNW A;  2FIN B;  4DUY L;  3DEO A;  3KUP A;  3MAQ A;  4TVA B;  1STB A;  4ME3 A;  4K14 A;  2WKD A;  3I4N G;  4A4I A;  1DJR D;  2CKZ B;  1YNX A;  3MXG A;  4J15 A;  2DJF C;  4HMI A;  4P72 A;  1EY0 A;  1DCZ A;  2RA4 A;  1VDZ A;  1EWH A;  5KRU A;  2BH8 A;  1LT4 D;  4O1N A;  5HGQ A;  3S1M B;  3S1Q H;  4BY7 H;  1Q86 C;  4DR4 Q;  3ND8 A;  1O7I A;  1SR3 A;  2EXD A;  5C3E G;  2D0P A;  2QCP X;  2GVB A;  3BYT B;  1Q82 C;  1VF5 C;  3FPU B;  1EUJ A;  1UWV A;  1V1P B;  2A68 D;  4IPD A;  2J7Z A;  3KLS X;  2OTJ A;  3BG3 A;  2F0H A;  1IBK L;  1I6H B;  4CKC A;  4IFD G;  3HKZ E;  1C0A A;  2F4I A;  3SDZ A;  4AQY Q;  1PFB A;  5CBE E;  3E9H A;  1PH9 A;  4KHV A;  1VQB A;  4A3F B;  5C44 G;  1WCM H;  3G71 A;  2ZTD A;  2L4N A;  4J6H A;  2ASB A;  3QOL A;  3A54 A;  3D4W A;  2HIX A;  2JA6 G;  2XRS D;  1SFO B;  4G7O C;  3RZD H;  4P2C B;  5AJ3 Q;  1EIY B;  2BA0 A;  3NTH A;  4AQY L;  2LMC B;  2A5H A;  2MFI A;  1T5X D;  4LFC L;  1E1T A;  2EYJ A;  4R4T A;  3SK4 A;  2Z6K C;  2XRQ D;  5COY A;  4GN4 B;  2KCT A;  5EPL A;  4DV2 L;  1D2B A;  1DOL A;  4IUR A;  5J3B A;  2PZU A;  2I5L X;  2B2W C;  5LL6 X;  3CF5 A;  5LMU L;  5KYL A;  1WOC A;  1XMQ Q;  3CXC A;  3NXW A;  3PIP 3;  1IHZ A;  4A3I B;  1LTI D;  4ZAI A;  2WB1 B;  5FLM H;  1HHV A;  3HRZ C;  3RD4 A;  4O42 A;  2L11 A;  3I4M B;  1VQF A;  4DV1 L;  4P71 A;  1BNZ A;  1HR0 Q;  1EL0 A;  1F9P A;  1STG A;  3OWF A;  4X3S A;  1L0W A;  4ZK9 B;  3K5O A;  1OXX K;  2YYZ A;  2JA7 H;  5M5X H;  1RDP D;  3R93 A;  2Z4H A;  4DU9 A;  5FK9 C;  3V2T A;  3C3L A;  2O5I C;  1QB5 D;  2OQ0 A;  5E7N A;  5ELE A;  2QEX A;  4BBR H;  4A3L G;  5I9O A;  4X6A H;  4X62 L;  1E24 A;  1NAP A;  2PW5 A;  5LL6 S;  4RKB A;  4OIK A;  3AFP A;  3EQL C;  3NE5 B;  1EFI D;  4JCV E;  3TZD A;  1N32 Q;  3HOV H;  2PQA B;  4XIG S;  5LMU Q;  4AIM A;  3TRZ A;  1AW7 A;  1F2L A;  3OOC A;  4A3M B;  1WTW A;  1XMQ L;  4JI1 Q;  2K52 A;  2NVY B;  4CKE A;  4DNR B;  3GV6 A;  3IFD A;  3QIA A;  3NTI A;  1EYA A;  4LAA A;  2OEO A;  1J8I A;  2AUK A;  1SXT A;  3H94 A;  1TS3 A;  1I3Q B;  1NR4 A;  2DUD A;  2DY8 A;  3OMC A;  4FF2 A;  3NPP A;  3U4Z A;  1PTO C;  4JI8 Q;  4A3G G;  4LF9 Q;  1X3E A;  3U9S A;  3GTG B;  2H1E A;  3PV0 A;  4B08 A;  3LGJ A;  4IFD H;  5M5Y B;  4PZ6 A;  1SNQ A;  3H0G B;  5JOB A;  2QIL A;  5M3F G;  1ET9 A;  3J81 E;  2N3S A;  1M8A A;  1PYS B;  1X3P A;  3IL8 A;  3L3O C;  4JI2 L;  3HOV B;  2R6G A;  4DUZ Q;  1FR3 A;  1MSH A;  1Z6H A;  5FLX E;  1GUN A;  1VQI A;  2UU9 Q;  4O0A A;  4FXD A;  2B2Y A;  3HOU G;  1FJG L;  4CJ2 C;  4RCN A;  2F3I A;  3H09 A;  3EN2 A;  4KHP Q;  4I7Z C;  3VR4 A;  4L5S A;  4ZYS A;  3GTQ H;  2BA1 A;  1T9H A;  5K5P A;  1X55 A;  3DWQ A;  2F4V L;  3M4P A;  5JAV A;  3GTG H;  1F2Y A;  4IUU A;  1S3O A;  1J6Q A;  2EXZ A;  4ID6 A;  5JPM C;  4JI6 L;  1HUN A;  3TN2 A;  4CDE C;  5IOC A;  1A15 A;  4RG1 A;  3I7F A;  5M5X B;  2AUJ D;  3FRP B;  3VR2 A;  2PI2 A;  3VYR A;  2IHE A;  5GAH C;  2F0M A;  3HKS A;  2GVA A;  3VR6 A;  3HKZ B;  1D8L A;  3N6R A;  5IGE A;  3ULL A;  4XXE A;  1F9S A;  1EFW A;  4JI3 Q;  3PUX A;  2EYM A;  1PZJ D;  2WKC A;  2NVY H;  3E0E A;  3G6J B;  2A6H C;  1K3R A;  1PH8 A;  1V9P A;  4HID A;  2XN9 C;  1XX8 A;  3TS0 A;  1VQE A;  4YY3 L;  4YCW A;  4B3R L;  4RMF A;  4HJ9 A;  4RKL A;  1L2F A;  1U4R A;  3A8I E;  1OXV A;  1E7Z A;  2Y0S E;  4A3E G;  1PFN A;  1QG7 A;  1DGS A;  4E6I A;  1BBU A;  1Y1W G;  1EZ6 A;  1SYD A;  3GTL B;  2VNU D;  2YTX A;  2NZO A;  2N88 A;  4NPS A;  3F2C A;  1Y8N B;  3NWS A;  3CPF A;  2K5H A;  2YTV A;  1YBY A;  1X56 A;  3RZD B;  1K73 C;  4LF7 Q;  1YHB A;  1O7Y A;  1SFO H;  2JA7 B;  5E4W C;  1HTP A;  5IYB H;  4MHE A;  4JI4 Q;  2OXP A;  1DZ1 A;  4GLA C;  2K1B A;  3DM3 A;  2BOS A;  4JBW A;  4OON A;  5M3M G;  3VYS A;  1DXM A;  2RDH A;  5D14 A;  1WCM B;  2N8N A;  4C3I H;  3C2P A;  5DM7 3;  2F0K A;  4A3I H;  1SNM A;  1BVS A;  5CYU A;  5KND A;  4J1M A;  1CFM A;  1TWG B;  3BZK A;  1MBY A;  4DR3 L;  4XQJ A;  1K83 B;  1V1Q A;  1LAB A;  5CV9 A;  1JJG A;  2Z6B A;  4X66 L;  4IJL A;  1I94 L;  1ENC A;  1ONL A;  1YNJ C;  2AWO A;  2SNS A;  2ICE C;  2K6A A;  1XPO A;  4CKB A;  3FKI B;  1VF7 A;  1SN8 A;  2EE1 A;  5C4X H;  5A2Q L;  4G7Z C;  4KY7 A;  3S1Q B;  3E9I A;  3AB9 A;  4HAE A;  4HSP A;  3U9O A;  2D0O A;  1LT6 D;  1MGS A;  4EQ5 A;  1VQN A;  3U58 A;  2E2J B;  4F87 A;  1L1O B;  5KEE A;  4OWW B;  1TWF H;  1FL0 A;  1Q7Y C;  4GKK Q;  2HD3 A;  3I4L A;  4QUF A;  5FO9 B;  3K59 A;  4DV5 L;  2FHT A;  3EA6 A;  5FLM G;  4IFD I;  1F2M A;  2M2L A;  2CH4 W;  4HSV A;  2HQE A;  4G57 A;  1B8A A;  1VQL A;  4V19 0;  1CI3 M;  4JI5 L;  1HA6 A;  1I6H H;  2E8G A;  4RGO S;  2EJF C;  1TR5 A;  2IJ0 A;  1A0I A;  2B2Y C;  5FOB B;  1TWA H;  3L7Z C;  5C44 H;  4DR7 Q;  1B44 D;  4AYB B;  1IYJ B;  5ISR A;  1H9J A;  4NDX A;  1TS4 A;  1GOZ A;  1SYG A;  5ELN A;  2B8G A;  4ODG A;  1WVL A;  2CQA A;  1CTM A;  2Q2H A;  5CGK A;  4U68 A;  2QKI C;  4RHR A;  2LXK A;  1KDB A;  2DNE A;  5JEA G;  2JE6 I;  1NUC A;  3CP0 A;  1CA5 A;  1IW7 C;  4OX9 L;  4JI3 L;  4DR5 L;  3BZC A;  4HED A;  4HIK A;  2F3V A;  3S2H B;  1NTG A;  5CBA E;  1B4O A;  4GLV B;  2A1A A;  4C2M H;  1K8M A;  4APV A;  1GXD C;  3GQB A;  2PNH A;  2I46 A;  4F8M A;  1I4P A;  2K28 A;  4H02 A;  3UE0 A;  2LS0 1;  3DHQ A;  3BU2 A;  4LFA L;  1V43 A;  3BDO A;  1JIC A;  4OWX B;  1G2S A;  3ER0 A;  3GTM H;  3U50 C;  5TSS A;  4GKJ Q;  3KK7 A;  4KD3 A;  4LUZ A;  3GTJ H;  4B9X A;  4EQP A;  2O2L D;  3F2U A;  4P74 A;  1M90 C;  4LF5 Q;  1EIF A;  2WB1 E;  3R2T A;  2A74 C;  1PTO B;  4KY5 A;  4K2L A;  5IYC H;  2MPM A;  3IFT A;  2V4D A;  2RHS B;  2F0N A;  4DUZ L;  4N8F A;  4OHJ A;  4C3H G;  2KED A;  4RGN A;  1KAW A;  3I72 A;  4HIM A;  2CW0 D;  1GKH A;  2N55 A;  4LFB Q;  1EY8 A;  4WOR A;  3M3Y B;  3GO5 A;  5JJI A;  3FP9 A;  4DV5 Q;  1WD1 A;  2D62 A;  3RZO H;  4F88 A;  4L6T B;  4JI8 L;  4YWK A;  2UXD L;  3BZD B;  1Q3L A;  5CR3 A;  1C4Q A;  2G9H D;  4QL5 A;  2VW9 A;  2MQH A;  1QNU A;  3SR1 A;  5BR8 Q;  4TQU S;  3HOY G;  3SHL A;  3SK5 A;  1PH4 A;  3GTP B;  1CKO A;  1UEA B;  2PQE A;  3HOX H;  1STE A;  3SEB A;  4OO1 G;  1YJ9 A;  2EYO A;  3C1E A;  4KKT A;  1O7Z A;  1TS2 A;  4IPH A;  4DNI A;  3PUY A;  1NJI C;  1Y69 U;  1QVG A;  1JWM D;  3CW2 C;  1R4P B;  1BXT A;  1A8V A;  1AZP A;  1TVX A;  2SEB D;  1J5E Q;  3I4O A;  2F0E A;  3MXN B;  2B39 A;  1U4L A;  2A69 D;  4GS3 A;  3S14 B;  2P5Z X;  4RHS A;  1SEB D;  2JXM B;  1NMF A;  2NVX H;  2PI2 E;  4IUV A;  4PZ7 A;  1I94 Q;  4BY1 B;  1X3G A;  1HQM C;  2AQ3 B;  2KEE A;  5IWA L;  1N36 Q;  3HOW B;  2K05 A;  1PHJ A;  1ILP A;  1RKN A;  2N78 A;  1BOS A;  5GAD C;  5E4X A;  2ZJR A;  3J7A F;  1HUM A;  1N8R C;  2IT1 A;  3RLN A;  1AN8 A;  3FHW A;  5LMN W;  1JOK A;  2HIV A;  4IPG A;  4XYO A;  4TKO B;  2QF7 A;  3PUZ A;  1W3S A;  3S1R H;  1WTQ A;  3J80 E;  3H3V H;  1A2U A;  3OTO Q;  3J7A V;  2E2I H;  3V05 A;  3UI2 A;  1HZC A;  2EYL A;  4A3J B;  4LF7 L;  4IFD J;  2XNA C;  3U4V A;  3KBG A;  4UP7 A;  4OWT B;  3HOY B;  2F0W A;  3MC0 B;  2O5J C;  1B9N A;  2HQL A;  3HGB A;  1JWU D;  1II3 A;  3GDE A;  2R7D A;  1BBX C;  1ASY A;  4A3C H;  1GUG A;  1GVP A;  4DV0 L;  4CDD C;  4Y7N H;  2LFN A;  1ESF A;  5M3F B;  1PVO A;  4BA1 I;  1YVC A;  1CUK A;  1M4V A;  2SDF A;  4LFA Q;  3BYY B;  1HTL D;  4DV7 L;  2HUG A;  5EBC A;  1KRT A;  4HN7 A;  4X64 Q;  1QUQ B;  2K32 A;  3J80 c;  3J81 i;  5EJW A;  3JAM i;  4BXX G;  2K75 A;  2A73 B;  3X3N A;  4S3S A;  1SJE D;  3QOJ A;  1TY2 A;  3M4O H;  4LK1 C;  5GAG C;  4JPB W;  1N33 L;  3M9B A;  4A3C G;  1S5D D;  1FJG Q;  1AFP A;  1EU3 A;  1AE3 A;  1PTO F;  3HOW G;  1JJC B;  3S17 B;  4R1J A;  3OHX C;  3J81 j;  1PV4 A;  3TME A;  5ELO A;  4LW1 A;  1EWC A;  1XPU A;  1EQV A;  4FP5 D;  1EOT A;  3IKJ A;  4DR2 L;  1UE1 A;  2DY7 A;  2SOB A;  2JA5 B;  4OXP A;  4CDC C;  1I4R A;  1CQV A;  2ZXP A;  3H3V C;  2A69 C;  2LKV A;  3KLR A;  4KN4 C;  5LMN L;  1VQ6 A;  1PRT C;  4DKA C;  2L55 A;  4ZRZ A;  2K50 A;  3IAY A;  2JA9 A;  3KF8 A;  4QY7 A;  1HCZ A;  1Y1V H;  1YNN D;  3OSO A;  4KMU C;  5DAU A;  1EYG A;  4N9T A;  5DEH A;  4A93 B;  4GKK L;  2VUM B;  2L12 A;  1RJT A;  1BCP D;  1I5F A;  3PUV A;  4FYD A;  4ULL A;  3M4O B;  4A3B G;  1CK1 A;  1BKB A;  3HOZ B;  5KNC A;  4QB4 A;  2K5W A;  1SRU A;  2E74 C;  4BY7 G;  4A3I G;  4B3S L;  1PFM A;  4QF4 A;  4DUY Q;  1G6P A;  4C3J B;  1X6O A;  4L5R C;  3DWP A;  4WFN 3;  5C3E B;  1S5B D;  2CCZ A;  2RDF A;  2IHF A;  4ZUI A;  1S5E D;  2JA8 B;  2R7Z H;  1DON A;  2BE5 C;  2PZT A;  3M4Y A;  4GN5 A;  1EU4 A;  3CME A;  4UPA A;  5E3F A;  4DN4 M;  2G5D A;  4KKU A;  4A3F G;  4LF4 L;  1HNW Q;  1K8A C;  4A3J H;  3D6W A;  3FDT A;  2PNR C;  4GZY C;  2J0T D;  2F0P A;  3KF8 B;  5C6A A;  2D5D A;  1TU2 B;  2WFW A;  2O4X A;  3CCU A;  4GNX B;  1NNX A;  2F0U A;  3RMH A;  4ALP A;  2PO4 A;  1N33 Q;  3LNN A;  4JBM A;  2R92 H;  3K80 C;  4OX9 Q;  2E2H B;  3RLO A;  3G4S A;  3B6Y A;  2R93 H;  1VQ4 A;  4BS9 A;  2I07 B;  2MO0 A;  2F52 A;  2RVL A;  4L8J A;  1OXS C;  3A8J E;  4KJO A;  1D6E C;  3A0J A;  4PV1 C;  2MNA A;  4DV7 Q;  1QZH A;  2NZH A;  1HRJ A;  2MO1 A;  4KD4 A;  4C3H H;  4YWM A;  4NW2 A;  2IL8 A;  4A3B B;  3H6M A;  5CV7 A;  1LTA D;  1VS0 A;  1KD1 C;  1A3U A;  3P75 A;  1PTO D;  3KJO A;  1PDQ A;  3TEH B;  1STA A;  4WRD A;  1I50 B;  1I50 H;  5KNB A;  3I70 A;  3RLF A;  2WB1 G;  3QB3 A;  5AFW A;  4HJA A;  4EQN A;  1KNA A;  4JC0 A;  1SDF A;  2ALY B;  3OIP A;  4FXK C;  1TKW B;  3EVQ A;  1TS5 A;  4A3B H;  5IYB G;  4HMJ A;  4IJH A;  1Z7T A;  5DLQ E;  4DK6 C;  1VQ8 A;  5C3W A;  1YHA A;  1JE4 A;  5IT9 L;  4LF8 Q;  1SNC A;  2WAQ G;  1FNV A;  3OPO A;  1Y8O B;  3T1Y Q;  3K58 A;  3HS0 C;  4M1U B;  1LM0 A;  3VYT A;  5KYI A;  2KEC A;  1H95 A;  1KXL A;  2AQ2 B;  3E5S A;  4DV3 Q;  4POG A;  4MN3 A;  3TP8 A;  4B9W A;  2RKS A;  3M4Q A;  1N34 L;  1PH1 A;  1XNQ Q;  1XTC D;  5DM6 3;  4X65 L;  2KOL A;  2NN6 H;  1W6J A;  1UE6 A;  5IP7 H;  2RSO A;  5CV6 A;  4CJ1 B;  4DV6 L;  2LY7 A;  2UUC L;  3HKZ G;  3OW7 A;  4N9P A;  1VQG A;  2UU9 L;  4K2K A;  2JA8 H;  4DR3 Q;  1S5C D;  5COR A;  3KLW A;  1GD7 A;  1IBM Q;  1WTV A;  1YJN A;  1XYI A;  1CA6 A;  1BUV T;  3T13 A;  1F77 A;  2XIW A;  1PYB A;  2ID0 A;  5IP7 G;  1JE5 A;  4X66 Q;  3J7Z C;  1DD2 A;  4P75 A;  1ENA A;  4DF7 A;  1LAC A;  1N34 Q;  4HCS A;  1Y8P B;  1FNU A;  2K33 A;  3S2H H;  4UY8 C;  4LF6 L;  3CRL C;  4F7X A;  1ESR A;  5BN3 A;  5EQ0 A;  3CPW A;  1TII D;  2GA4 B;  4XQN A;  2R3Z A;  1WFQ A;  3I8Z A;  1IW7 D;  3DLL A;  4DV4 L;  1Y1W B;  4A93 H;  1T5E A;  4PG3 A;  3H91 A;  1D7Q A;  2YU9 B;  1F9R A;  4ZKB B;  1DOM A;  2K01 A;  3TQY A;  2FFK B;  3HP3 A;  4B3M L;  1JQY D;  2PW7 A;  3PO2 H;  2E5L L;  4FF1 A;  3K5M A;  3E6Z X;  4AYB E;  2OWO A;  2F0T A;  3A56 A;  2JA5 H;  3UDG A;  5IYD H;  2YTY A;  3AFQ A;  3PUW A;  3O13 A;  5FJ8 G;  1JC7 A;  4YCU A;  3S16 B;  1AZQ A;  1HFG A;  2KCM A;  4DGZ A;  4FXG C;  4ILW A;  2QDL A;  1ZKO A;  3BDC A;  4JYA L;  3KF6 A;  2JA6 B;  4DR6 L;  1K28 A;  2F1M A;  3JC6 6;  3CCJ A;  2B29 A;  4V0B A;  1SRO A;  2RDG A;  1CKN B;  1CQF A;  1KLU D;  3FKI G;  4YHH Q;  3ZYY X;  2EYH A;  3STB D;  1U4M A;  2EJM A;  3TP5 A;  4CDF C;  2UUB L;  2PCF B;  4IOA A;  4K5W A;  3MVV A;  2K5N A;  5CMD A;  2DJG C;  2NTT A;  1Q8K A;  3I2Z A;  3P7J A;  4DR5 Q;  1A62 A;  5M3F H;  3D6C A;  5K36 H;  5HGT A;  1KQS A;  4I7A A;  3UDI A;  3DMU A;  5JEA H;  3TP7 A;  2ZT9 C;  1KAA A;  2ZM6 Q;  1I4G A;  4KTA A;  2D2C C;  1K83 H;  2MGS A;  1TWG H;  1JB7 A;  4JOI C;  3NQT A;  1YEZ A;  4GNX A;  2BE5 D;  3CCV A;  1HJP A;  5M3M H;  4C3I B;  3PO3 G;  2B2V A;  4HR7 B;  3A7A B;  1B3Q A;  2NVT H;  1L0X B;  5HUR A;  3UDF A;  1EWI A;  1OTC A;  3S1R B;  1PH6 A;  2AQ1 B;  5JJL A;  4A3K B;  3DEP A;  4P73 A;  1B50 A;  2NWG A;  5IY0 A;  2EPB A;  3PO2 G;  2VB3 X;  3MZ5 A;  4OEL B;  1E2V A;  2F0L A;  1HPC A;  2KEN A;  2DN8 A;  2L0C A;  5JJK A;  1KRS A;  1HXY D;  4LFB L;  2C35 B;  3VR5 A;  4ZUJ A;  1YHQ A;  3MEF A;  4XQQ A;  4JW0 A;  3CC7 A;  1PRT B;  1I6V C;  4KK7 A;  5C4Z A;  1M1K C;  4C1N K;  4XT1 B;  1B53 A;  2EVB A;  2RCF A;  2ZM6 L;  4JI7 Q;  2VQF L;  3T56 B;  1H9R A;  1E22 A;  1EEI D;  1JT8 A;  5IGF A;  4IPC A;  4NXN L;  4A3M G;  4A3D G;  1YNJ D;  2JJQ A;  2JYO A;  2UUA L;  3M7G A;  4X64 L;  1NCV A;  3M85 A;  2KBN A;  3F8T A;  1JCK B;  1PRT D;  3LX0 A;  3LWE A;  1VQK A;  1FGB D;  2EY2 A; 
#chains in the Genus database with same CATH homology
 1D1I A;  2Z4I A;  5IGG A;  2A68 C;  4C1N I;  2WAQ B;  3GTQ B;  1SYC A;  4L63 B;  1DM0 B;  2OT2 A;  3CQZ B;  2NUC A;  4YIJ A;  1DYQ A;  1PTO H;  1BQQ T;  1KAB A;  4RGT A;  2FMM A;  1SYE A;  5D65 A;  1C8C A;  1CT1 D;  2VB2 X;  5DNF A;  3PMF A;  3NBI A;  1XWE A;  1FYC A;  1EYC A;  1WD0 A;  2F0O A;  4LJZ C;  4IAL A;  3KBX A;  1HFN A;  3D3R A;  4MIU A;  4RCO A;  2EDG A;  4OO1 I;  4J8Q A;  2WIN B;  3DXJ C;  1ZXT A;  1SE2 A;  4HCE A;  5KGU A;  1ICW A;  2NZ1 D;  2XWB B;  1WTR A;  3NUC A;  3I90 A;  2XSC A;  1TWA B;  4K8J A;  5T1G A;  3OIQ A;  1J9O A;  2F0G A;  2B2V C;  4BBR B;  2CHB D;  1H9S B;  3OMG A;  4JK1 C;  3VYU A;  3CKI B;  4K8I A;  4A3G B;  2CW0 C;  1CZG A;  1D5M C;  2JEB I;  1TWF B;  1PRT F;  2Z8L A;  3R2I A;  1STH A;  1EZ8 A;  1JOR A;  2DNC A;  3L9A X;  3K5L A;  4K5V A;  5C4X B;  1EY9 A;  1S4Z A;  5A35 A;  2HDM A;  5NUC A;  4G4K A;  3BS1 A;  2OF1 A;  1G8Z D;  2BDN A;  4RFB A;  2B8F A;  2BDO A;  2WAC A;  1EY6 A;  3QWN A;  2EYF A;  3OWE B;  1TWC B;  2RSN A;  3VA5 A;  3FEW X;  2MJ8 A;  2B63 B;  1SMY C;  2FMC A;  5ELB A;  4XYQ A;  3WDN A;  4KY6 A;  2A6E D;  1KNE A;  1TT2 A;  4OL7 A;  3I3C A;  4KJN A;  2KCN A;  3Q23 A;  2HCC A;  3DM1 A;  4DNT B;  3QO2 A;  4FVM A;  1ZYR D;  3M7N A;  1Z47 A;  4FF4 A;  4A3E B;  1EQT A;  1PMR A;  2L1B A;  1U9R A;  5C0X I;  4BY7 B;  4ME5 A;  1UUP A;  1SBB B;  2K5Q A;  3QG1 A;  2NBF A;  3BVG A;  5IGB A;  3PIO 3;  3NTK A;  3K0Y A;  1BR9 A;  1SMY D;  1PZK D;  1EEF D;  2EY6 A;  2WP8 J;  1R9T B;  4XDX A;  2M9V A;  2KHS A;  4ZLT F;  1EY7 A;  2NN6 G;  4OO1 H;  4FNF A;  2XWJ B;  3ONA B;  5JVG 3;  2IWH A;  2MUY A;  3FPP A;  2KCC A;  5JJZ A;  5CC4 A;  1RD9 D;  4ZKC B;  3S9W A;  3S2D B;  1O78 A;  4DK0 A;  1X32 A;  4FO2 A;  1KLG D;  5IIF A;  4XTC S;  2F0Q A;  1STN A;  1UNS A;  4KV6 A;  5EKI A;  2K03 A;  3QJY A;  1G29 1;  1SND A;  3SVM A;  1CHQ D;  3MWY W;  5CV8 A;  2AWN A;  4NKL A;  2F0J A;  5T1I A;  2NYZ D;  3NK9 A;  4RAU C;  1E2W A;  4DK1 A;  2EZV A;  3TDQ A;  2L9H A;  1QCB D;  4R8I A;  3T51 B;  2JP1 A;  5KIX A;  1EIH A;  2MP1 A;  1LTB D;  1SYB A;  3K6O A;  2TSS A;  3CRK C;  4X3U A;  3K7A B;  2X6G A;  2Y0S B;  3BVZ A;  1E2Z A;  2NN6 I;  3GP7 A;  3J7Y W;  5EKL A;  4K5X A;  2G9D A;  1IKM A;  4PMB A;  3JAM E;  3NWT A;  5E1F A;  1A2T A;  1ILQ A;  2K04 A;  3G7L A;  2QDB A;  3X3M A;  2NVT B;  5M5W B;  1QJO A;  4IQZ A;  4BA2 I;  1B9M A;  2F0S A;  4HTH A;  3N52 A;  3Q24 A;  3AU7 A;  1IYU A;  4DAP A;  1O80 A;  2IPK D;  1ZEQ X;  3R8B A;  5C0X H;  1LT3 D;  2X6L A;  1IL8 A;  2TMP A;  1IYV A;  4RWS C;  3TZU A;  4Q5V A;  3J81 L;  5IT9 E;  2IX0 A;  5IGD A;  4CGY B;  2PYK A;  1EYD A;  4IUT A;  1JOO A;  3P1H A;  3K57 A;  4WJW A;  2H4O A;  5M3M B;  4RA8 A;  1AP0 A;  5C5M A;  3S15 B;  1KTK A;  5LHY 1;  2KVM A;  2WII B;  5C3X A;  1OXT A;  1AEX A;  1RHP A;  5JPN C;  1VMP A;  3CU7 A;  4CBV A;  1SE4 A;  2E76 C;  2ZXO A;  4Q0F A;  4QMG A;  4R8N A;  1MD2 D;  3NHH A;  2B2T C;  1QOH A;  2CVR A;  3CHB D;  5JEA J;  5I4D A;  2KA7 A;  3WOE A;  3GV3 A;  1O7L A;  1X3Q A;  2IX1 A;  5C0X J;  1B2T A;  4LMQ D;  3ERQ A;  1TY0 A;  3MHB A;  2ENB A;  3W2D A;  1B1Z A;  1TQO A;  2EJG C;  1BCP C;  3KLS A;  3DWA A;  3SK6 A;  1NR2 A;  1I4H A;  2KUM A;  5I6W A;  1I4Q A;  5M9O A;  3PO2 B;  1ML0 D;  1A6X A;  3SK8 A;  3A8K E;  2IW3 A;  2KJX A;  5CV5 A;  1LTS D;  5C4J B;  3JAM L;  5EPK A;  1RF2 D;  2NTS A;  1JOQ A;  5ELF A;  4CHT B;  2J4X A;  5EPJ A;  5C0X G;  3Q22 A;  4H7B A;  3FVQ A;  1QE6 A;  3T4A C;  3GTO B;  5CV4 A;  1MSG A;  1H9S A;  1Q12 A;  3WOF A;  1I4X A;  4RH6 A;  2F0D A;  1W6K A;  2Z1C A;  2FJ2 A;  1SJH D;  5D3I B;  4DFA A;  2XVS A;  2C9O A;  4I65 A;  5BN5 A;  3URY A;  1SE3 A;  1WTX A;  1G91 A;  3NBH A;  1ZYR C;  1BF4 A;  1GUO A;  1GUW A;  1LTG D;  4K6D A;  2KQ3 A;  4FF3 A;  1UAP A;  2B2U C;  3GD7 A;  4C3H B;  2F0I A;  1VCI A;  4UDU C;  2Q8I B;  1LV9 A;  4ZQ3 A;  1V8Q A;  1TWH B;  1WTO A;  1H9K A;  1A3T A;  1EY4 A;  4OIJ A;  4RGM A;  3MFG A;  1CZW A;  4PMC A;  3V96 A;  3LWU A;  2R92 B;  1SYF A;  5I2X A;  3D8G A;  4R9W A;  2IX3 A;  4BBS B;  1S5F D;  1Q90 A;  2JSO A;  4IUQ A;  5I9P A;  1B3A A;  1F2Z A;  4PMW A;  2EYP A;  1HA5 A;  2L5T A;  4X3K A;  1LT5 D;  2R7Z B;  2F0F A;  1KDC A;  3SE0 A;  4M8A A;  5IGC A;  4PNY A;  4H13 C;  1STY A;  1FD7 D;  2D9U A;  5ELD A;  2VXW A;  1PYW D;  1V1P A;  5EGT A;  3MXN A;  3D4R A;  5C5L A;  2R93 B;  1JWS D;  5G3L D;  1EIG A;  4DAV A;  2EY1 A;  2M00 A;  4QIW B;  5FKA C;  2A6E C;  3RUZ A;  1Y1V B;  1RCV D;  1YNN C;  4X3T A;  1SNP A;  4NMZ A;  3VR3 A;  2EY5 A;  4KN7 C;  1GJX A;  3EFX D;  4PQX A;  2BCO A;  4TRD A;  3NSW A;  4IUP A;  4EGV A;  4BWG B;  3BVM A;  2PMZ B;  4C56 C;  2Q8R E;  1EY5 A;  3MXP A;  2HDL A;  3C46 A;  4IUN A;  4G7H C;  2NB0 A;  3A7L A;  1PXU A;  2B2W A;  4KKS A;  3D4D A;  3K5N A;  2C5C A;  5J1Z A;  2E2D C;  3ND9 A;  4Y7N B;  1A3V A;  4OGQ C;  3T53 B;  1QWY A;  5FO8 B;  4XT3 B;  5I2Y A;  3BDL A;  4EQO A;  4TSS A;  4C3I G;  1ENF A;  1OXU A;  4QCL A;  1CM9 A;  1K8O A;  2F0V A;  4K6L A;  2E2I B;  1G2T A;  1JB3 A;  1BCP B;  1MI2 A;  5FLX L;  2A6H D;  5J22 A;  1U4P A;  2Q8T A;  2QEJ C;  5BN4 A;  2X69 A;  3TP6 A;  2R61 A;  3TBI B;  2HCI A;  1IKL A;  1Q1E A;  3I91 A;  1BDO A;  3MA2 B;  5I6Y A;  3EJI A;  1D5Z C;  4H0L C;  3A55 A;  1GHK A;  2NVX B;  1GUS A;  1SNO A;  5D3D A;  4KI0 A;  5G3L F;  2PZW A;  4C3J G;  2ICI A;  2B2T A;  3DUZ A;  1D5X C;  1CHP D;  2JEA I;  1L0Y B;  5C4H A;  1QNK A;  4ABN A;  1OO9 B;  2RBM A;  1JR0 D;  3R3O A;  4H44 C;  3GTK B;  1HQR D;  4DAY A;  3E0J A;  1GUT A;  3AMU A;  1BO0 A;  3HOX B;  3MTS A;  4A3D B;  5JVH 3;  1SAP A;  1Q1B A;  1ET6 A;  3MEH A;  4U67 3;  1Q8I A;  1DOK A;  1SSO A;  4Z9C B;  3NQI A;  1RTN A;  1XXG A;  3ITP A;  5EBD A;  1PZI D;  3SXH A;  2E75 C;  3J80 L;  4KHZ A;  1PLF A;  1KDA A;  1LTT D;  1E0B A;  2SNM A;  4QUC A;  2K7V A;  4CJ0 B;  3ERO A;  3HG9 A;  5F2D A;  1LO5 D;  1LLR D;  1D1K A;  3HZX A;  3HEJ A;  2RQX A;  2NVQ B;  3T16 A;  1RTO A;  3MFY A;  2PPB C;  3PO3 B;  4IN3 A;  1C48 A;  4UAI A;  4DXG A;  3I4N B;  3NP8 A;  5J39 A;  5IOD A;  3GTJ B;  4EVO A;  3GTM B;  1R4Q B;  1F9Q A;  2K5D A;  1NSN S;  3S1N B;  3D31 A;  4IZ8 A;  1ROD A;  2ZXR A;  5A2Q E;  2EOT A;  5ELC A;  4C2M B;  2F3W A;  1VMC A;  3RZO B;  2B2U A;  3W3A A;  1H9M A;  2MHV A;  1BCP F;  3C1F A;  5K36 G;  3Q0A A;  3HOU B;  4DA2 A;  1QIL A;  1V1O A;  1WTP A;  3I73 A;  3FMC A;  4DXF A;  4NP5 A;  5FO7 B;  1LTR D;  5EKK A;  3P20 A;  5C44 B;  2WV6 D;  3VA7 A;  1G6Z A;  1GHJ A;  2F03 A;  3MXU A;  3Q6S A;  3TSS A;  1FNW A;  2FIN B;  3DEO A;  3KUP A;  3MAQ A;  1STB A;  4K14 A;  2WKD A;  1DJR D;  3MXG A;  4HMI A;  1EY0 A;  1DCZ A;  2RA4 A;  1VDZ A;  1EWH A;  5KRU A;  1LT4 D;  4O1N A;  3S1M B;  3ND8 A;  2QCP X;  3BYT B;  1VF5 C;  3FPU B;  1V1P B;  2A68 D;  2J7Z A;  3KLS X;  3BG3 A;  2F0H A;  1I6H B;  4CKC A;  4IFD G;  2F4I A;  3SDZ A;  1PFB A;  5CBE E;  4KHV A;  4A3F B;  2L4N A;  4J6H A;  3QOL A;  3A54 A;  3D4W A;  2XRS D;  1SFO B;  4G7O C;  4P2C B;  2BA0 A;  3NTH A;  2LMC B;  2A5H A;  1T5X D;  2EYJ A;  3SK4 A;  2XRQ D;  5COY A;  5EPL A;  1D2B A;  1DOL A;  4IUR A;  2PZU A;  2B2W C;  5LL6 X;  5KYL A;  3NXW A;  3PIP 3;  1IHZ A;  4A3I B;  1LTI D;  4ZAI A;  2WB1 B;  1HHV A;  3HRZ C;  3RD4 A;  4O42 A;  2L11 A;  3I4M B;  1BNZ A;  1EL0 A;  1F9P A;  1STG A;  3OWF A;  4X3S A;  4ZK9 B;  3K5O A;  1OXX K;  2YYZ A;  1RDP D;  3R93 A;  2Z4H A;  4DU9 A;  5FK9 C;  3V2T A;  3C3L A;  2O5I C;  1QB5 D;  5ELE A;  5I9O A;  1NAP A;  2PW5 A;  5LL6 S;  4RKB A;  4OIK A;  3EQL C;  3NE5 B;  1EFI D;  3TZD A;  4XIG S;  1AW7 A;  1F2L A;  3OOC A;  4A3M B;  1WTW A;  2NVY B;  4CKE A;  4DNR B;  3GV6 A;  3IFD A;  3QIA A;  3NTI A;  1EYA A;  4LAA A;  2OEO A;  1J8I A;  2AUK A;  1SXT A;  3H94 A;  1TS3 A;  1I3Q B;  1NR4 A;  2DY8 A;  3OMC A;  4FF2 A;  3NPP A;  1PTO C;  3U9S A;  3GTG B;  2H1E A;  3PV0 A;  4B08 A;  4IFD H;  5M5Y B;  1SNQ A;  3H0G B;  5JOB A;  2QIL A;  1ET9 A;  3J81 E;  1M8A A;  1X3P A;  3IL8 A;  3L3O C;  3HOV B;  2R6G A;  1FR3 A;  1MSH A;  1Z6H A;  5FLX E;  1GUN A;  4FXD A;  2B2Y A;  4CJ2 C;  4RCN A;  3H09 A;  4I7Z C;  3VR4 A;  4ZYS A;  2BA1 A;  5K5P A;  3DWQ A;  5JAV A;  1F2Y A;  2EXZ A;  4ID6 A;  4IUU A;  5JPM C;  1HUN A;  3TN2 A;  5IOC A;  1A15 A;  5M5X B;  2AUJ D;  3FRP B;  3VR2 A;  3VYR A;  2F0M A;  3VR6 A;  3HKZ B;  3N6R A;  5IGE A;  4XXE A;  1F9S A;  3PUX A;  2EYM A;  1PZJ D;  2WKC A;  3G6J B;  2A6H C;  2XN9 C;  1XX8 A;  4RKL A;  1U4R A;  3A8I E;  1OXV A;  1PFN A;  1QG7 A;  4E6I A;  1EZ6 A;  1SYD A;  3GTL B;  2VNU D;  2N88 A;  1Y8N B;  3NWS A;  3RZD B;  1O7Y A;  2JA7 B;  5E4W C;  1HTP A;  4MHE A;  2OXP A;  1DZ1 A;  2K1B A;  2BOS A;  4JBW A;  3VYS A;  1DXM A;  2RDH A;  5D14 A;  1WCM B;  3C2P A;  5DM7 3;  2F0K A;  1SNM A;  5CYU A;  5KND A;  4J1M A;  1TWG B;  1CFM A;  1MBY A;  4XQJ A;  1K83 B;  1LAB A;  5CV9 A;  1ENC A;  1ONL A;  1YNJ C;  2AWO A;  2SNS A;  2ICE C;  2K6A A;  4CKB A;  3FKI B;  1VF7 A;  2EE1 A;  3S1Q B;  5A2Q L;  4G7Z C;  4KY7 A;  3AB9 A;  4HAE A;  4HSP A;  3U9O A;  1LT6 D;  1MGS A;  2E2J B;  4F87 A;  5KEE A;  3I4L A;  4QUF A;  5FO9 B;  3K59 A;  2FHT A;  3EA6 A;  4IFD I;  1F2M A;  2M2L A;  2HQE A;  4HSV A;  4G57 A;  4V19 0;  1CI3 M;  1HA6 A;  4RGO S;  2EJF C;  1TR5 A;  2IJ0 A;  2B2Y C;  5FOB B;  3L7Z C;  1B44 D;  4AYB B;  5ISR A;  1H9J A;  4NDX A;  1TS4 A;  1GOZ A;  1SYG A;  2B8G A;  4ODG A;  1WVL A;  2CQA A;  1CTM A;  5CGK A;  4U68 A;  2QKI C;  4RHR A;  1KDB A;  2DNE A;  5JEA G;  2JE6 I;  1NUC A;  1CA5 A;  1IW7 C;  4HED A;  2F3V A;  3S2H B;  5CBA E;  1B4O A;  1K8M A;  1GXD C;  3GQB A;  2I46 A;  4F8M A;  1I4P A;  2K28 A;  2LS0 1;  3DHQ A;  1V43 A;  3BDO A;  1JIC A;  1G2S A;  5TSS A;  3KK7 A;  4KD3 A;  4B9X A;  4EQP A;  2O2L D;  3F2U A;  3R2T A;  2A74 C;  1PTO B;  4KY5 A;  4K2L A;  2MPM A;  3IFT A;  2V4D A;  2F0N A;  4OHJ A;  4C3H G;  2KED A;  4RGN A;  3I72 A;  2CW0 D;  2N55 A;  1EY8 A;  4WOR A;  3M3Y B;  3GO5 A;  1WD1 A;  2D62 A;  4F88 A;  4L6T B;  3BZD B;  1Q3L A;  5CR3 A;  1C4Q A;  2G9H D;  1QNU A;  3SR1 A;  4TQU S;  3SHL A;  3SK5 A;  3GTP B;  1UEA B;  2PQE A;  4OO1 G;  1STE A;  3SEB A;  2EYO A;  3C1E A;  4KKT A;  1O7Z A;  1TS2 A;  3PUY A;  1Y69 U;  1JWM D;  1R4P B;  1BXT A;  1AZP A;  1TVX A;  2SEB D;  2F0E A;  2B39 A;  1U4L A;  2A69 D;  3S14 B;  4RHS A;  1SEB D;  2JXM B;  4IUV A;  4BY1 B;  1HQM C;  2AQ3 B;  2KEE A;  3HOW B;  2K05 A;  1ILP A;  1RKN A;  1BOS A;  5E4X A;  3J7A F;  1HUM A;  2IT1 A;  1AN8 A;  1JOK A;  4XYO A;  4TKO B;  2QF7 A;  3PUZ A;  1WTQ A;  3J80 E;  1A2U A;  3J7A V;  3V05 A;  3UI2 A;  2EYL A;  4A3J B;  4IFD J;  2XNA C;  3KBG A;  3HOY B;  2F0W A;  3MC0 B;  2O5J C;  1B9N A;  3HGB A;  1JWU D;  1II3 A;  1BBX C;  1GUG A;  2LFN A;  1ESF A;  5M3F B;  4BA1 I;  1M4V A;  2SDF A;  3BYY B;  1HTL D;  2HUG A;  5EBC A;  4HN7 A;  2K32 A;  5EJW A;  2A73 B;  3X3N A;  4S3S A;  1SJE D;  3QOJ A;  1TY2 A;  4LK1 C;  1S5D D;  1AFP A;  1EU3 A;  1PTO F;  3S17 B;  3OHX C;  3TME A;  1EWC A;  1EQV A;  4FP5 D;  1EOT A;  3IKJ A;  2DY7 A;  2SOB A;  2JA5 B;  1I4R A;  1CQV A;  2ZXP A;  3H3V C;  2A69 C;  2LKV A;  3KLR A;  4KN4 C;  1PRT C;  2L55 A;  4ZRZ A;  3IAY A;  3KF8 A;  1HCZ A;  1YNN D;  3OSO A;  4KMU C;  5DAU A;  4N9T A;  5DEH A;  4A93 B;  2VUM B;  2L12 A;  1RJT A;  1BCP D;  3PUV A;  4FYD A;  4ULL A;  3M4O B;  1CK1 A;  3HOZ B;  5KNC A;  4QB4 A;  2K5W A;  2E74 C;  1PFM A;  4QF4 A;  4C3J B;  3DWP A;  4WFN 3;  5C3E B;  1S5B D;  2RDF A;  4ZUI A;  1S5E D;  2JA8 B;  1DON A;  2BE5 C;  2PZT A;  3M4Y A;  1EU4 A;  5E3F A;  4DN4 M;  4KKU A;  3D6W A;  3FDT A;  2PNR C;  4GZY C;  2J0T D;  2F0P A;  5C6A A;  2D5D A;  1TU2 B;  2O4X A;  2F0U A;  3RMH A;  2PO4 A;  3LNN A;  2E2H B;  4BS9 A;  2I07 B;  2RVL A;  4L8J A;  1OXS C;  3A8J E;  4PV1 C;  1D6E C;  4KJO A;  1HRJ A;  4KD4 A;  4NW2 A;  2IL8 A;  4A3B B;  3H6M A;  5CV7 A;  1LTA D;  1A3U A;  3P75 A;  1PTO D;  1PDQ A;  1STA A;  4WRD A;  1I50 B;  5KNB A;  3I70 A;  3RLF A;  3QB3 A;  5AFW A;  4EQN A;  1KNA A;  1SDF A;  3OIP A;  4FXK C;  1TKW B;  3EVQ A;  1TS5 A;  4HMJ A;  1Z7T A;  5C3W A;  5IT9 L;  1JE4 A;  1SNC A;  1FNV A;  3OPO A;  1Y8O B;  3K58 A;  3HS0 C;  4M1U B;  5KYI A;  3VYT A;  2KEC A;  2AQ2 B;  3E5S A;  4MN3 A;  3TP8 A;  4B9W A;  2RKS A;  1XTC D;  5DM6 3;  2KOL A;  2NN6 H;  1W6J A;  2RSO A;  5CV6 A;  4CJ1 B;  2LY7 A;  3OW7 A;  4N9P A;  4K2K A;  1S5C D;  5COR A;  1WTV A;  1XYI A;  1CA6 A;  1BUV T;  3T13 A;  1F77 A;  2XIW A;  2ID0 A;  1DD2 A;  1ENA A;  4DF7 A;  1LAC A;  4HCS A;  1Y8P B;  1FNU A;  2K33 A;  3CRL C;  4F7X A;  1ESR A;  5BN3 A;  5EQ0 A;  1TII D;  2GA4 B;  4XQN A;  2R3Z A;  3I8Z A;  1Y1W B;  1IW7 D;  1T5E A;  3H91 A;  2YU9 B;  1F9R A;  4ZKB B;  1DOM A;  2K01 A;  2FFK B;  3HP3 A;  1JQY D;  2PW7 A;  4FF1 A;  3K5M A;  3E6Z X;  2F0T A;  3A56 A;  3PUW A;  3O13 A;  1JC7 A;  3S16 B;  1AZQ A;  1HFG A;  4DGZ A;  4FXG C;  4ILW A;  1ZKO A;  3BDC A;  2JA6 B;  2F1M A;  4V0B A;  2RDG A;  1CQF A;  1KLU D;  3ZYY X;  2EYH A;  1U4M A;  2EJM A;  3TP5 A;  2PCF B;  4K5W A;  3MVV A;  5CMD A;  2NTT A;  3P7J A;  3D6C A;  5K36 H;  5HGT A;  3DMU A;  5JEA H;  3TP7 A;  2ZT9 C;  1KAA A;  1I4G A;  4KTA A;  2D2C C;  2MGS A;  3NQT A;  2BE5 D;  4C3I B;  2B2V A;  4HR7 B;  3A7A B;  1L0X B;  5HUR A;  3S1R B;  2AQ1 B;  4A3K B;  3DEP A;  1B50 A;  2NWG A;  2EPB A;  2VB3 X;  3MZ5 A;  1E2V A;  2F0L A;  1HPC A;  2DN8 A;  2L0C A;  1HXY D;  3VR5 A;  4ZUJ A;  4XQQ A;  1PRT B;  1I6V C;  4KK7 A;  5C4Z A;  4C1N K;  4XT1 B;  1B53 A;  2EVB A;  3T56 B;  1H9R A;  1EEI D;  5IGF A;  1YNJ D;  2JYO A;  3M7G A;  1NCV A;  3M85 A;  1JCK B;  1PRT D;  3LX0 A;  3LWE A;  1FGB D;  2EY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...