1CHQD

Surprising leads for a cholera toxin receptor binding antagonist; crystallographic studies of ctb mutants
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKDEMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHOLERA TOXIN B PENTAMER
publication title Surprising leads for a cholera toxin receptor-binding antagonist: crystallographic studies of CTB mutants.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 22
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1995-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1chqD00
3OWEB 1XTCD 5ELFA 2AQ1B 1JWSD 1CHQD 1HXYD 2J4XA 3MFGA 4TSSA 4BWGB 1SXTA 3O13A 4RGTA 1ESFA 2XNAC 1EU3A 2CHBD 1PTOH 4RHRA 1CT1D 2TSSA 3DWPA 5ELBA 1B1ZA 1D5ZC 1PRTF 1JWMD 4O1NA 1PRTC 1F77A 1S5FD 5FK9C 3BYTB 1V1OA 1LTGD 3EFXD 1M4VA 1FNVA 4UDUC 1STEA 3SEBA 5ELDA 3BVZA 1PTOC 1QILA 1TS4A 1HQRD 1I4HA 1TY0A 4C56C 1SE2A 1I4XA 2IPKD 1HTLD 1TS5A 1LT4D 1JWUD 2QILA 4OHJA 1TS2A 3BVGA 3BZDB 1SE4A 1JCKB 1PTOD 1AN8A 1I4RA 1LTRD 5D3IB 1FD7D 2XRQD 1B44D 3R2TA 1JQYD 1KLGD 2WV6D 1EEID 1EEFD 1SE3A 3TSSA 1SJED 1RCVD 1PTOF 4K6LA 2R61A 4RGOS 5ELCA 1BCPF 3W2DA 2AQ2B 1BCPC 3MC0B 1CHPD 5TSSA 1BXTA 1LTID 1LTTD 1PZID 2RDGA 3KLSX 2NTSA 1PZKD 2G9HD 1AW7A 5ELEA 1JR0D 1FNUA 3BVMA 3GP7A 5D3DA 2XN9C 5FKAC 3R2IA 1DYQA 2O2LD 1SBBB 1PRTB 2NTTA 1FGBD 1RDPD 1ET9A 4L6TB 1BCPD 1DJRD 2AQ3B 1G8ZD 1EWCA 1MD2D 1KTKA 1LTSD 1CK1A 1GOZA 3BYYB 1ET6A 4RFBA 4RHSA 1PYWD 1I4GA 3URYA 4DXGA 1LO5D 3V05A 3CHBD 4ZYSA 1I4PA 1I4QA 1CQVA 1S5CD 1RF2D 3R8BA 4RH6A 1D5MC 1T5XD 1S5BD 1TY2A 1L0YB 1SJHD 4RCOA 1TS3A 1LTBD 1D5XC 1V1PB 1SEBD 1RD9D 1S5ED 4L63B 2ICIA 1LLRD 2RDHA 3DWAA 1HA5A 3DWQA 3EA6A 1UUPA 1FNWA 2QEJC 4DXFA 1S5DD 1EU4A 1L0XB 1XXGA 2SEBD 1D6EC 4RGNA 4RGMA 1LT6D 1ENFA 4Z9CB 1PTOB 1BCPB 1KLUD 2Z8LA 1PZJD 1V1PA 2XRSD 1LT3D 1LTAD 2IJ0A 1EFID 1PRTD 1UNSA 5I4DA 1LT5D
chains in the Genus database with same CATH superfamily
4FP5D 3UDXA 2JA5G 2CQOA 3V96A 1MKHA 2NVTB 2HIXA 4DR5L 2DY7A 3R3OA 1CT1D 3S14B 3VYTA 1ENAA 4MTKA 4HJ9A 1JWMD 4JI0L 4KKSA 1VQ5A 4RKLA 4FO2A 4P2CB 4XT1B 4OX9L 4OO1I 1PYBA 4HSVA 5C44B 1CQFA 1U0LA 1VQDA 3PCOB 3S17H 4IUQA 2ZJPA 3A5UA 4BBRH 1A0IA 4DR2L 2K5VA 1DGSA 2VQEL 2JA7G 3GTLB 2EYPA 1X3FA 3T56B 1YJNA 2Q2HA 4LFCL 3ICEA 3RD4A 3M7GA 1SE4A 2A6EC 2A74C 1WTPA 3RZDH 2UUBL 3BU2A 1PYSB 1HUMA 2LKVA 1SJED 2UXBQ 4X3UA 4MIUA 2MO0A 3MC0B 2A69C 1UAPA 1U9RA 1C4QA 2HCIA 3CPFA 2Z6KC 2A6HD 5FKAC 1PH4A 1DXMA 3I8ZA 4K5VA 3EJIA 4JI5Q 1VQNA 3J7AF 1YVCA 2MP1A 3C1EA 1IBKL 3BYYB 3NBHA 4X66L 3I7FA 1VMPA 3JAML 1RF2D 2JYOA 4LNQA 1PH1A 2A73B 1GHJA 2F0IA 4C2MB 1EZ6A 3QO2A 4DUYL 3GTPH 4JV5L 4QJFA 5IODA 1QZGA 4LUZA 4DV2Q 3NXWA 3D4WA 2F0EA 1VQGA 2QEJC 1X3QA 5AJ3Q 1G51A 3L9AX 2R7FA 3PV0A 1G2SA 1E22A 5T1GA 4KY6A 3RLFA 4BBRG 5I9OA 2A19A 1YJWA 1PZJD 3GQBA 5T1IA 2PZTA 4GN4B 1O7IA 2PMZE 5GQOA 1X9NA 4KK7A 3IAYA 3FHWA 1W2BA 4A3DB 2J4XA 4TSSA 3A56A 1N33L 1VQ4A 2K6AA 2XNAC 4N8X1 2FMMA 1GKHA 4RKBA 5CV6A 4PZ8A 2Z9HA 2UUAL 4NXNL 3IKJA 3BYTB 5J22A 1GD7A 2Z1CA 2NZ1D 1I6HB 1CSPA 1CKMA 2ZJRA 4QY7A 4FF2A 1HQRD 4QUCA 5D65A 5LL6X 4HIKA 3J7YW 2KENA 1Q12A 2YTYA 1H9MA 1TS5A 1SYGA 4DU9A 1LUZA 1QZHA 5LMNQ 2HDMA 1SNPA 2IX3A 2QW7A 2K5NA 5CBAE 2MJ8A 4NW2A 4WRDA 3T1YL 4CJ1B 3K58A 1HZ9A 3K7AB 4A3EB 1HNWL 4DR3Q 1SAPA 3GTKB 1O7LA 1CTMA 1P8LA 1SNQA 2L5TA 4GKJQ 1JE5A 4KLKA 3E9HA 2B2TA 2Y0SG 3CPWA 3KF8A 3E3XA 4JI8Q 4OWTB 1LV9A 2IHEA 3H91A 5IGFA 2I5LX 2NVXB 1DYQA 1SBBB 1WOCA 1UE1A 1STBA 5LMUQ 5BN4A 1WCMB 3SGIA 4R4IA 4F87A 2QF7A 1NJIC 1VMCA 1BBXC 2F3IA 1KHIA 2WKDA 3GTJB 1RHPA 2K32A 3H09A 4IPDA 2QGQA 5M5XH 3ERQA 2R92B 1B9MA 2E2HH 2KHIA 5C6AA 1V43A 4BBSB 2OWOA 2VQFL 2NZOA 4K6DA 2BDNA 1FGUA 2ICIA 4K5WA 3DWAA 3M9BA 2N55A 4PNYA 1DZ1A 1AE2A 3J80L 4RGMA 3PUYA 3M4OB 1JJ2A 2UXDQ 2RCNA 5IE8A 4WJ4A 2B39A 1K3RA 3DEPA 2JA6H 3O13A 3ULJA 3BG3A 3HG9A 3GDEA 4YIJA 1S4ZA 1M8AA 1J5EQ 4O1NA 1S5FD 3D3RA 2BH8A 1LTGD 3NELA 2FMCA 2M00A 3QR8A 1STAA 3VR3A 1R9TH 4ILWA 1F9PA 1STNA 2XWBB 3KK7A 4ZUIA 4ZK9B 1TS4A 2EYMA 3L3OC 4L8JA 5C0XI 3SXHA 1YHQA 3KLSA 3R93A 4JYAL 1TWGB 4LFAL 2DNCA 1NMFA 4AYBB 1F2MA 3CP0A 3A8IE 2PW5A 1Z47A 2RF4A 3W5OA 1A62A 1EY8A 3FKIH 3TREA 4B08A 2A68C 1B53A 3R2TA 4IZ8A 2EXZA 3MXNB 1KLGD 4HMIA 1Z9FA 3K59A 1EEFD 4IPGA 1G91A 5IGEA 2CQAA 3VR2A 4YCUA 1JOKA 4ZKCB 3TMEA 2L11A 2GVBA 3RLNA 2Q8TA 3HOWH 1MJEA 1KABA 4CDCC 2ZTDA 1YNJD 2B2TC 4NDXA 1FGBD 1C8CA 2WACA 5DM63 5H1SE 1DJRD 1SYDA 1MHWC 1PHJA 2EXDA 5ISRA 2I5MX 3GV3A 2ZXRA 3ZYYX 3I4OA 1Q81C 2JA6G 1I4QA 1W6JA 2WP8J 1VCIA 1EY5A 1S5CD 4Y7NH 4KHZA 1Y1WB 3E9IA 3NWSA 2ATWA 2NVQH 3PIO3 3OW7A 2VW9A 4AQYQ 1PA6A 2KEEA 3Q23A 2K75A 2XSCA 1YITA 4QCLA 5L37A 1L1OA 1PVOA 2R93H 2ZM6Q 1Y1VH 3K5LA 2HHHL 3AFQA 4JI6L 5IP9H 5EKKA 1XYIA 2WAQG 1EU4A 4PMWA 5M3MH 4LF9L 2CW0D 3M3YH 2OQKA 2MGSA 3CU7A 1ENFA 4J8QA 1I94L 4IO9A 1PRTD 1UNSA 1LT5D 1HZBA 3QB3A 1SNDA 4A3MB 1XTCD 3QG1A 3TP6A 4DR5Q 4DAYB 3RMHA 2E5LL 1SXTA 3FKIG 2NN6I 4JI0Q 1EU3A 1J6QA 2CHBD 3MTSA 3CCSA 1GVPA 3DWPA 3TRZA 1JT8A 4OX9Q 3J7AV 3BDOA 5A35A 4HIDA 1MIUA 1UE6A 2WAQE 3HGBA 3G7LA 2B29A 4DR2Q 1O7YA 4KN4C 1W6KA 2VQEQ 4C3JB 5FLXE 2GN5A 1EY9A 3HOWG 3HKZG 4LFCQ 4DV1L 1YHBA 4PMBA 2SDFA 2F4IA 4DK3C 4P72A 5F2DA 3F2UA 2LSSA 3GTGH 3P75A 2G9DA 5LL6S 5C3EH 2A1AA 2UUBQ 2VB2X 4UPAA 3TBIB 4HEDA 3S1RH 2AMCB 1AH9A 3AEVA 3QWNA 4GN5A 2JE6I 4J1MA 3CF5A 2EY6A 4DV3L 2ENBA 1VQAA 2AQ2B 1MGSA 3DHQA 5CV9A 1BXTA 2B8FA 4DPGA 4BY7B 1PZID 2MO1A 2RHSB 4KTAA 4OONA 5ELEA 4DAMA 2PNRC 4RA8A 3HKZE 2E2DC 2R93G 4XQNA 3S2DB 1Y1VG 4ALPA 1PRTB 1YNND 5IP9G 4ZCKA 3P1HA 5M3MG 1SFOH 1IBKQ 2L9HA 3CQZH 1NUCA 4KHVA 1ASZA 1XNRL 5C4XH 3OHXC 4JBJA 2YU9H 1Z6HA 2EY1A 3T53B 4X66Q 1QCBD 2IWHA 5K36H 1H9RA 1I4PA 2OXPA 5IGGA 2HT1A 3I3CA 4DUYQ 4JV5Q 1EYDA 1TIID 1VQMA 2FFKB 3F2BA 2F0OA 4B3ML 2BE5D 2K04A 3HOXB 4A3IH 3GTMH 2RDHA 1KIXA 1D1IA 4DV4L 1G2TA 5A2QL 2PYKA 2R6GA 4LFBL 4A3JH 1VQ7A 1N32L 4HCSA 4JI3L 1V1PA 1AZQA 1SNMA 3FEWX 3ITPA 4GOPB 1L1OC 3OWFA 1IKMA 2F0VA 3D0FA 1N33Q 1NCVA 3SDZA 3NTHA 3Q6SA 4A3LH 1VQCA 1X65A 5FO9B 1F2LA 1A3VA 5C3EG 1SYFA 1HZAA 1ESFA 3G6JB 2UUAQ 1IBLL 4NXNQ 4YY3L 1B9NA 4OWXB 5JJZA 1RTOA 3UE1A 1PRTF 1D5ZC 1TWCH 2EVBA 2JP1A 5FK9C 3S1MH 4DNTB 5FOBB 1Q86C 3I90A 3H3VC 4EX5A 4OGQC 3FDTA 4B3TL 2IPKD 5C4JB 3WOFA 2JK8A 4TQUS 2X6GA 4U673 2NBFA 4QQBX 1X3GA 3T1YQ 1PTOD 1XMQL 1HNWQ 5C4XG 3HOVB 4A3BH 2XGTA 2JEBI 3N6RA 5JPNC 2RHQB 5K36G 3PIOA 4IUPA 1EIFA 1VQOA 5IIFA 1QJOA 1XX8A 1Q8IA 5GAGC 2G9HD 2J0TD 3DLLA 4A3IG 4Y52H 1UWVA 2PQEA 1QUQA 3R2IA 2NTTA 2RDFA 3J81j 3C46A 1FJGL 4A3JG 3OW2A 1ET9A 1TWFH 5EBDA 5HY6A 1EWCA 3NHHA 1TWAB 4R4QA 5JVH3 2SNMA 1K83H 2K1BA 4J15A 3S1NH 4EVOA 5M5WB 3KF6B 5IWAL 4GLAC 1I5FA 4RG1A 4A3LG 2WINB 1XNQL 1U4MA 4LMQD 2VQFQ 1IBML 5M5YH 2NVYB 1DOLA 1FL0A 1SE8A 2WB1B 4BA2I 1PH3A 1E1OA 4K0KL 4R4TA 4JBKA 1S5ED 4QL5A 2F0UA 2KCTA 3X3NA 1BNZA 1B2TA 4A3FB 1LT6D 1PTOB 4JI7L 1Y8PB 1V9PA 3D6CA 5EPLA 4R4OA 4LF6L 2D62A 1X32A 1JWSD 2AWNA 3RN2A 4G4KA 1U4PA 1HPCA 2ZT9C 4A3BG 1P16A 1HA6A 2F0KA 4DF7A 3NEMA 4DR7L 3NWTA 4JYAQ 1UE7A 4LFAQ 1ML0D 1TKWB 1EIGA 2F0MA 4CJ2C 3I91A 3NUCA 2BOSA 4QIWB 4A3EH 1RIPA 1JMCA 3M4PA 3HOUB 5J39A 3KLRA 1ZKOA 3S1QH 4C3IH 5CORA 5J3BA 3BVGA 5JJLA 1NR2A 1LTRD 2EY2A 2XRQD 4ODGA 4R9WA 2KVMA 3UDIA 3CCVA 1PFSA 4G57A 3GTQH 1IL2A 1E0BA 3K81C 3PO2B 1LACA 4DR1L 1PTOF 3OOCA 3PUXA 2F0NA 3AQQA 4LAAA 1IYUA 4BY1H 1CHPD 3N52A 2GVAA 1PZKD 1WTXA 1QVCA 4HJ8A 3I4NB 1K8GA 1I3QH 4F8MA 1Q1EA 4X65L 1MSHA 4RCNA 3CCMA 1CFMA 1MBYA 3RUZA 4MN3A 4X3TA 4DNRB 2EJFC 3C1FA 2F03A 5IT9L 2L55A 1NTGA 2D9UA 3HOYB 4X3SA 1PH8A 4JW0A 1WTWA 4C3HB 4H0LC 4KN7C 4UP8A 2PZUA 2D2CC 1ASYA 4RCOA 1FVIA 2NUCA 4L63B 1YBYA 2HHHQ 1AFPA 4JI6Q 3WWVA 3GTOB 3GV6A 3HS0C 4LF9Q 2K01A 2N3SA 3AYHB 1XJVA 1I94Q 2LXKA 4A3EG 1Q3LA 3OMGA 5M3FH 4GNXB 2B63H 2IJ0A 3ULPA 2EZVA 3I2ZA 4XXEA 2E5LQ 2D0PA 1Y69U 4C3IG 1E2ZA 1OTCA 2B2VC 4JI2L 1HXYD 1HQMC 3T51B 2PNHA 1IHZA 2VB3X 1Y8NB 1TWHB 5KGUA 5DAUA 1B1ZA 1EQRA 1WYDA 3DM1A 2CWAA 3RZOH 1BDOA 2NYZD 2F3WA 2P5ZX 1I6VC 4BY1G 1K73C 5ELDA 2JQOA 5CYUA 3J81L 2JA5B 2R7ZH 4X3KA 4DV1Q 1CUKA 2F52A 5ELNA 2E2IH 1IW7C 1GUNA 3Q8DA 1A63A 5G3LF 2UUCL 3FPUB 4QB4A 4FXDA 3E0EA 3T1HL 1GUTA 3VYSA 1UEBA 2KCCA 1SR3A 1FD7D 4A3CH 4RAUC 1V8QA 2C9OA 1XPUA 4DV3Q 3S15B 2JA7B 3TSSA 2N78A 4NXML 4K6LA 2F0GA 4H02A 1B7YB 1YZ6A 1BCPC 2V1CC 5KNDA 4R4CA 3HOZH 2QCPX 2N8NA 3SHLA 3MXUA 2RDGA 3MZ5A 2NTSA 5IGCA 3GP7A 4LF7L 3CAMA 4MZ9A 1MSGA 4KY7A 2E8GA 2I07B 3DMUA 3W1BA 1XNRQ 3H0GH 4K8IA 2LY7A 4HJAA 1G8ZD 3X3MA 2AKWB 1EUJA 2B63G 5IYCH 2KHJA 5M3FG 3PMFA 4ZLTF 1BO0A 2WKCA 5IOCA 4LF5L 3CCUA 5CV8A 4DXGA 1M1KC 2K50A 4UP9A 1SYBA 1VQ6A 1SMYD 1HJPA 4B3MQ 1IYJB 4OIKA 3STBD 3J80E 3F2CA 3H15A 1SNOA 4DA2A 2C5CA 4DV4Q 4LF4L 1X55A 3EVQA 4MHEA 5E1FA 1F9RA 4LFBQ 4EQNA 5BR8L 1IL8A 1N32Q 3IFDA 4F7XA 4JI3Q 2R7ZG 1S40A 1KDBA 4JBWA 3EIVA 4EQOA 3Q22A 4I7AA 1B8AA 1VS0A 1T5EA 4YCWA 1IBLQ 4YY3Q 5GAEC 2MNAA 2Q8RE 1H9JA 3H3VH 4B9WA 4F88A 5FLXc 1PMRA 1RL2A 3S17B 4A3CG 2BDOA 1WVLA 3I70A 3AMUA 4BBRB 4I7ZC 4H13C 5IP7H 1SN8A 4DNIA 4B9XA 3EFXD 3PQIA 2NN6H 2RVLA 4YWKA 3S2HB 1FNVA 3HOZG 5CV5A 3MA2B 4B3TQ 1TY0A 4UY8C 1QVFA 3I4MH 1ZYRD 3QIAA 1VF7A 1MI2A 3CRLC 3RZDB 4DGZA 5CMDA 4ABNA 1CKOA 3SE0A 5EBCA 1LT4D 1XMQQ 3H0GG 4APVA 1RODA 3KJOA 4LWCA 5EPJA 3VYRA 5IYCG 3U50C 2A6HC 4GLVB 2F0WA 3A5ZB 3LWEA 5ELCA 3W3AA 4JG2A 5C3WA 1KRTA 3CC4A 1HNZL 1LTID 2PI2A 1GXDC 3MXNA 4HAEA 2XN9C 3UI2A 1FJGQ 4YCVA 3PF4A 2CFMA 4M1UB 3JAMi 3AFPA 2VUMH 2F0LA 2B2WA 2L15A 2K14A 2C35B 1SNCA 2Y0SB 4K2LA 5IWAQ 3GTPB 4NPSA 1XNQQ 2RA4A 2OF1A 1VQ9A 4CDFC 4DFAA 1IBMQ 5AFWA 2AUJD 3CW2C 4K0KQ 4RH6A 1Q7YC 1R4PB 1SJHD 1TS3A 2YTXA 2EYJA 1RD9D 5IP7G 1H9SB 1LLRD 2EJGC 1CZGA 2NN6G 5EKIA 3CC7A 1F9SA 4JI7Q 1XXGA 3I4MG 1D6EC 2Z8LA 5HURA 4LF6Q 2XRSD 3CXCA 1Q82C 1C7YA 3H94A 3S16H 3PO3H 1CKNB 4YWLA 2E2JH 1G6PA 1QVGA 4O42A 1LABA 1EWHA 1KDAA 1RJTA 3F1ZA 4DR7Q 4AH6A 1GUSA 2UXCL 2B8GA 3HKSA 4DAYA 1E7ZA 4UDUC 1QILA 3ND8A 1EOTA 1F2YA 4FYDA 4HJ7A 2LFNA 2F0FA 4IFDH 1HCZA 1DOMA 2VUMG 5CBEE 1HNXL 2LS01 1K28A 3IRBA 2YV5A 3MEHA 5E3FA 4R1JA 2CCZA 2OTJA 2FHTA 2JA8H 4X64L 4DR1Q 4FXKC 4NKLA 1A2UA 1SYEA 5CC4A 5I2YA 1TT2A 1X3PA 5K5PA 3FPPA 3MVVA 1YEZA 2R7DA 4C1NI 3L0OA 4Q0FA 3B6YA 2PW7A 4G7ZC 4LF8L 3K5NA 3GO5A 4WJ3M 3ERSX 2F0HA 2EE1A 2NZHA 4P74A 4X65Q 1B4OA 4GN3B 2ICEC 4FDBA 3MHBA 3TS2A 2EYLA 4JPBW 4LK1C 5M5XB 1A6XA 2PO4A 2AQ3B 4R8IA 5FJ8H 2E2HB 1JJGA 3A55A 3T16A 1SYCA 1GOZA 2AUKA 3P20A 3PIP3 2H4OA 3Q0AA 2F0DA 3UDGA 1I4GA 3URYA 4A3KH 3PO3G 3E0JA 3J7A5 2B2WC 3J80i 3H6MA 1VQFA 1VDZA 1I50H 4DR6L 4A3GH 3L7ZC 1SEBD 2K4KA 4ZAIA 2EYHA 3VR6A 4IUVA 1CI3M 2PPBC 2JA6B 1WD0A 1ESRA 1JOQA 4Z9CB 4A93H 1K0RA 1H9KA 5IGBA 3TQYA 5EPKA 2RSNA 4JI2Q 3U9SA 3K0YA 1HUNA 4IFDG 2R3ZA 1IZ6A 4FVMA 3BDCA 3BZCA 4N8FA 4RMFA 4A4IA 4BWGB 1BOSA 1NAPA 3BS1A 1R9TB 2WAQB 5FLXL 2JA8G 5HGTA 3TZDA 4GOPA 1F77A 4WJWA 1XPOA 4B3RL 3K8AA 1M4VA 5EQ0A 1SROA 2EOTA 1QWYA 4IUNA 2NVTH 4IFDJ 3S14H 1I4HA 1II3A 1KQSA 4JVZA 4POGA 3FKIB 5C4ZA 4LJZC 3GD7A 2K05A 2LMCB 2VXWA 1XTDA 3G48A 2UUCQ 2DJFC 3T1HQ 1OXSC 2K7VA 1JB3A 3TDQA 2QILA 4OHJA 5C44H 1EQQA 2O5JC 1ONLA 5FJ8G 1N36L 1U4RA 2WB1G 2ZJQA 3GTLH 4AIMA 3VR5A 4NXMQ 1JQYD 3DUZA 1G6ZA 2WV6D 3HOWB 1O80A 3BZKA 2MUYA 2KJXA 4A3KG 1D7QA 3HKZB 1YNJC 4OWWB 2ZXPA 4LUOA 2OEOA 4K14A 1PH2A 2M2LA 3IFTA 4LF7Q 4A3GG 2A6ED 1PFBA 5BN3A 3KLSX 4J6HA 3D6WA 2LXJA 1JR0D 1CSQA 1EYAA 4HCEA 1EIYB 4OO1H 2F4VL 1OXVA 4DV7L 1N34L 5CR3A 1PLFA 2F0SA 2B2UA 3VDYA 1OO9B 1XMOL 2KCMA 4B3SL 4FF1A 1QNUA 3I72A 4A93G 4Y7NB 2A69D 2WB1E 4GZYC 3SK5A 4CDDC 4LF5Q 2NVQB 4RFBA 2TMPA 4JI1L 1O78A 1VQ8A 1PYWD 3GTOH 1LO5D 1KAWA 2R93B 1RKNA 3C2PA 1CQVA 1Y1VB 3NTIA 1WTQA 2CW0C 1T5XD 4LF4Q 2FINB 1TY2A 3CKIB 3ZJYC 5M3MB 5GADC 1C48A 5FO7B 3M3YB 4H7BA 5BR8Q 1EYCA 3KF6A 2EIFA 5KRUA 3RN5A 2EY5A 3NTKA 3DWQA 1DOKA 1NNXA 3NQTA 3PUWA 4PG3A 4C2MH 4KJOA 3VA7A 1TWHH 4FXGC 3I55A 3F2DA 1KL9A 2DUDA 2AHOB 1WTOA 1JB7A 2DGYA 2PQAB 1PV4A 4BS9A 1YNXA 5C44G 1VQIA 1ENCA 1ILQA 4CKCA 2XVSA 3SK8A 3CCJA 1U4LA 1Q8KA 3D4DA 4QIWE 5GAHC 3I4NG 2ZTEA 3LGJA 1V1OA 3D8GA 4A3DH 1TQOA 2IX1A 3GTGB 1STEA 3HP3A 4XYOA 4HIOA 5C3EB 2L0CA 3AB9A 2E74C 5KYLA 4GOPC 4OO1G 3S1RB 3T4AC 2AWOA 3CMEA 3I73A 3PIPA 1I6HH 2K03A 1PH5A 3FP9A 4DK0A 3TEHB 1JCKB 5KNCA 2K5WA 1KXLA 1B44D 4XDXA 2K28A 4N9PA 2A5HA 3DM3A 4IJLA 5KEEA 1HFNA 2A8VA 1YNNC 5G3LD 1HNZQ 1DCZA 2DY8A 2L4NA 2R61A 3NP8A 5E4WC 2Q2TA 2CH4W 4OIJA 1SFOB 3CQZB 2XWJB 4K8JA 4ZKBB 2YTVA 3K7AH 5C4XB 1TR5A 5IT9E 1EY0A 4NMZA 1FNUA 3GTKH 2YU9B 5JEAH 1A15A 2QDBA 4XTCS 3KUPA 1J8IA 4G7HC 2ID0A 1JJCB 2DNEA 3TP8A 3J80c 1E1TA 4HMJA 1CK1A 3NE5B 4CGYB 2BE5C 4KHPL 4JI4L 2NVXH 2OTLA 4A3IB 2B2UC 1KC8C 3GTMB 4IUUA 1WCMH 3KDFB 2QEXA 2KOLA 5JPMC 1D5MC 4A3JB 1WI5A 1B3AA 1JC7A 2K33A 3G4SA 2JXMB 1NR4A 1A2TA 1ICFB 3GTJH 4DR4L 4CKEA 1GUGA 1VF5C 4L5QA 4A3DG 3OTOL 2MHVA 2R92H 4DV0L 1S72A 3JAME 2KQ3A 4ME3A 2UU9L 4BBSH 2KBNA 1V1QA 4DAVA 1DONA 1BCPB 2N49A 1LT3D 1NY4A 1EFID 4PMCA 1TWCB 2VL6A 2IX0A 3S1MB 2F0QA 3S2HH 4CBVA 3U4VA 5CV4A 5CV7A 1PDQA 3M4OH 4CDEC 3J81E 2UXCQ 1NMGA 4GNXA 2WIIB 2I46A 4P73A 1Q46A 4A76A 2CKZB 4U68A 1EZ8A 1QB5D 2H1EA 2B3GA 1PTOC 2Z4IA 2O5IC 4KI0A 4UP7A 1GM5A 3LNNA 4UAIA 5JEAG 4A3BB 1E2VA 4P71A 4RWSC 4C1NK 1HNXQ 5C5MA 1LM0A 4V0BA 2KHSA 2BA0A 4ZRZA 1EOVA 5I6WA 1SDFA 4X64Q 1TWGH 5D3IB 3KBGA 3U58A 3MWYW 4ME5A 2EPBA 4LF8Q 1BQQT 1VQHA 1SE3A 3SK6A 1WCMG 5JEAJ 2HUGA 1DD2A 3HZXA 1PH7A 2ES2A 1BCPF 4OXPA 1TWFB 3K5OA 2EDGA 2A68D 2OT2A 1EQTA 3BVMA 4CHTB 1K83B 3S1NB 5C0XH 4BXXH 3NBHB 5EAYA 4GKKL 2R92G 2O2LD 2HD3A 2QA4A 1U5KA 2HQEA 4BBSG 1CA6A 4G7OC 1QG7A 5M5YB 5COYA 4XQQA 5KIXA 1XPRA 3PUVA 2MQHA 1NSNS 5I2XA 4PQXA 1SLJA 1HZCA 3NENA 1EYGA 4DR6Q 3U9OA 5JJKA 3C3LA 1S5BD 1A3UA 1KD1C 1X6OA 4DUZL 1D5XC 3CD6A 3KFUA 3K7UC 3KBXA 5C3XA 4QMGA 4A75A 3JC66 2VS1A 2E76C 2HCCA 4YHHL 1FNWA 3A54A 4DV6L 3E6ZX 1VQEA 1LYLA 4X62L 1Y1WH 2SEBD 5DLQE 3A74A 2OQ0A 4KKTA 4M8AA 2IL8A 1J9OA 3K0XA 4HSPA 5I4DA 3MFGA 1K9MC 4O0AA 4RHRA 4CKBA 4AYBG 4B3RQ 5ELBA 5I6YA 1A3TA 1EY7A 4A3MH 2PMZB 1VQKA 1WFQA 3S1QB 4DV5L 5JJIA 1K8OA 1FYCA 4C3IB 3LX0A 4C56C 2MFIA 2L12A 1EIHA 4GNXC 4CJ0B 4BA1I 3M4QA 5JAVA 5C0XG 1JE4A 1BBWA 5I9PA 4BXXG 3GTQB 3CRKC 1N36Q 2WFWA 2IY5B 2EYOA 3CCRA 1TS2A 3KF8B 4C3JH 4BY1B 2E75C 4AYBE 1PFNA 1VQJA 2KUMA 2BCOA 1AEXA 3QJYA 5IY0A 3ULLA 4E6IA 1I3QB 1RCVD 5C0XJ 4RGOS 4JOIA 3RNUA 2PI2E 5TSSA 4O2DA 2Y0SE 1X54A 4EGVA 5JVG3 2F4VQ 4DV7Q 1LTTD 1N34Q 1IYVA 3EBEA 4TVAB 2F3VA 5D3DA 1BBUA 1XMOQ 4IJHA 4B3SQ 1EY6A 1EY4A 4PZ6A 3SK4A 4JCVE 1HR0L 1OXXK 4L6TB 3AU7A 3WDNA 1Y1WG 4BY7H 4L5RC 4JI1Q 3Q24A 1LTSD 2D0OA 1ET6A 2FXQA 2I0QA 1A8VA 3S24A 3S2DH 4XIGS 3VR4A 4S3SA 1W3SA 3V05A 1ICWA 3I4LA 3A7AB 3EROA 4WORA 1DM0B 4YWMA 1C9OA 3ND9A 3QOLA 3PGZA 3BJUA 3BDLA 1CA5A 2YYZA 3PF5A 2NB0A 4K5XA 5EKLA 2B63B 4A3MG 1K8MA 5M3FB 2Q8IB 3A8JE 4OL7A 3OSOA 4QF4A 3A8KE 2EYFA 2FJ2A 1S5DD 4JK1C 1STHA 2VZAA 1YIJA 3CCQA 2QDLA 3HOXH 1CM9A 1H9SA 1PH6A 2K5HA 3RZOB 2AQ1B 4L5TA 4PZ7A 1CHQD 5FLMH 2NWGA 3KOJA 3J81i 4C3JG 3I56A 1CZWA 2RCFA 4R8NA 4GLXA 2R7ZB 2RSOA 4ULLA 1WD1A 1TU2B 2HQLA 3A0JA 5GROA 5CGKA 2E2IB 3FMCA 4DKAC 4HJ5A 3KYHC 1CKNA 1OXTA 2KA7A 3OIPA 3SEBA 3BVZA 2CVRA 2HIVA 3M4YA 2V4DA 3RLOA 1MJCA 5JOBA 1X56A 1ZEQX 4Q5VA 4IPHA 3CMAA 3NBIA 4OEMB 4KMUC 4XQJA 3CC2A 4BY7G 2B2YA 2O4XA 1WTHA 2RQXA 1AN8A 3HOZB 4QUFA 2Q2UA 2PZWA 5C4JH 3OMCA 2Z6BA 5E7NA 1HR0W 2ZXOA 1E24A 5HGQA 1EEID 2IT1A 3T13A 4OELB 4WFN3 2JJQA 2ZTCA 3HOVH 3H0GB 3UDFA 2UXBL 1BKBA 5IYBH 3SR1A 2RKSA 5C5LA 3CCLA 1ZXTA 5BN5A 1OXUA 3MFYA 1NE3A 1GJXA 4JOIC 3MAQA 1Q90A 1SMYC 3STBC 2CWPA 3V2TA 1VQPA 1XWEA 4JI4Q 3NQIA 1MD2D 4KHPQ 3HOXG 1KRSA 4JI5L 2D5DA 4NB3A 2Z4HA 4MTNA 3H3VI 4HTHA 3RR5A 1L1OB 5FLMG 4ZYSA 3OYYA 1KNAA 3R8BA 1HTPA 1BR9A 4DR4Q 1IXRA 1TWAH 4NP5A 5D14A 5EJWA 3VYUA 1LTBD 3OTOQ 1T9HA 5M5WH 1Q1BA 4DV0Q 3A7LA 1ILPA 4L5SA 2UU9Q 1E2WA 3NK9A 1BVSA 4K2KA 4H44C 4DV2L 1JOOA 3P7JA 1L0XB 2NVYH 1PFMA 5AJ3L 1FR3A 3G6EA 1GO3E 2I5HA 2XTIA 5KYIA 1AE3A 1VQBA 1KDCA 3OWEB 1GHKA 1IKLA 1QE6A 5A2QE 2SOBA 1QNKA 1B3QA 4A3FH 4LW1A 1PTOH 1ZYRC 2EJMA 3I4MB 2TSSA 5LHY1 3EN2A 5FO8B 2EQSA 3TN2A 1LTLA 2QKIC 1JICA 3DXJC 3HOVG 2ASBA 3IL8A 3KJPA 5IYBG 4KJNA 1SE2A 3UE0A 4UHVA 4GS3A 1HTLD 2ALYB 2BH2A 1SMXA 1JWUD 1EWIA 3PSIA 4JBMA 3PUZA 1HH2P 1KNEA 1JORA 5LMNL 3CCEA 4KKUA 5IT9c 4IUTA 3NSWA 4IPCA 4EQ5A 3HOUH 4MNOA 4JC0A 1HRJA 4DAPA 2J7ZA 4DR3L 2PCFB 2B2YC 2X69A 3W2DA 5DNFA 2M9VA 2VUMB 1E3PA 4GKJL 5KNBA 1K0SA 3ONAB 1AW7A 4I65A 4GKKQ 1N9WA 4JI8L 5NUCA 1AZPA 3PO2H 4P75A 4IURA 4V190 3W1GA 1RDPD 1BF4A 2F0JA 2Z0SA 1L2FA 5DM73 5LMUL 2JEAI 3K5MA 1YHAA 1Y14B 2H5XA 4RHSA 3I4NH 1KAAA 1PH9A 4DK6C 1VQLA 2OCEA 4A3FG 2JN4A 1YI2A 4IOAA 3D4RA 3JAMc 3ER0A 1O7ZA 3QOJA 4DUZQ 4ID6A 3L2PA 1B70B 3TP7A 1K8AC 3HOYH 1V1PB 4DN4M 2F1MA 4YHHQ 1GUWA 5ELOA 1TVXA 1WTVA 2CH4A 4DV6Q 3EA6A 4X62Q 4C3HH 3S16B 1Y8OB 2BA1A 2K52A 3PO3B 2VY3A 4DXFA 3TP5A 3K6OA 2E2JB 4ZQ3A 3J81c 1STYA 1WJJA 1TXYA 4KV6A 3M85A 4IFDI 1KLUD 1SRUA 2KEDA 3EQLC 4TRDA 3VA5A 3F8TA 1LTAD 1K3BC 4DK1A 3LWUA 1S3OA 2UXDL 3FRPB 1H95A 2F0TA 5ELFA 3J7ZC 4IN3A 1HFGA 4RGTA 1HHVA 3TS0A 5IGDA 1N8RC 1NBWA 2MPMA 5J1ZA 4HIMA 3HOUG 1BUVT 2HDLA 1PRTC 3M7NA 4IQZA 4DV5Q 4LUVA 3MXPA 2G5DA 1X3EA 1J5EL 5LMNW 2PQAA 4XT3B 3S9WA 1EQVA 3HEJA 1STGA 4FF3A 1I4XA 3OIQA 3WOEA 3SVMA 3NPPA 3OPOA 1R4QB 4IOCA 5IYDH 3PO2G 1EFWA 2JA8B 1QOHA 2Q2IA 5DEHA 4HN7A 3D31A 3HRZC 1Z7TA 1G291 1D8LA 4KY5A 5C4HA 1B50A 4IALA 2JA5H 3BZDB 1I4RA 2JSOA 2F0PA 3MXGA 3HFZB 1SSOA 1IW7D 5E4XA 2Z6KA 4FNFA 1EL0A 1QUQB 4X6AH 4EQPA 2RBMA 4TKOB 4XYQA 2K5DA 3G71A 3HOYG 1D1KA 1F2ZA 5EGTA 3S15H 1GUOA 3K57A 4QGUA 2JA7H 2KECA 1HR0Q 4C3HG 4PV1C 2KCNA 1M90C 1C0AA 2IW3A 4A3KB 4ZUJA 1F9QA 1BCPD 2K5QA 4POFA 2B2VA 3KLWA 2IHFA 1KTKA 1I50B 4A3GB 2N88A 3E5SA 2GA4B 3K80C 3TZUA 4KD3A 1D2BA 3CHBD 2JA9A 1AP0A 1L0YB 2DJGC 2XIWA 4A93B 2DN8A 1UEAB 5M9OA 2L1BA 4AQYL 1HA5A 2VNUD 3KDFA 1UUPA 1RTNA 3MEFA 4N9TA 2ZM6L 1YJ9A 3U4ZA 4RGNA 4FF4A 4KD4A 1PXUA 5IYDG 1UE5A 3FVQA 1WTRA 2SNSA 3DEOA 1L0WA 2X6LA 4HR7B
chains in the Genus database with same CATH topology
4FP5D 3V96A 2NVTB 2DY7A 3R3OA 1CT1D 3S14B 3VYTA 1ENAA 1JWMD 4KKSA 4RKLA 4FO2A 4P2CB 4XT1B 4OO1I 4HSVA 5C44B 1CQFA 4IUQA 3GTLB 2EYPA 3T56B 3RD4A 3M7GA 1SE4A 2A6EC 2A74C 1WTPA 1HUMA 2LKVA 1SJED 4X3UA 4MIUA 3MC0B 2A69C 1UAPA 1U9RA 1C4QA 2HCIA 2A6HD 5FKAC 1DXMA 3I8ZA 4K5VA 3EJIA 3J7AF 2MP1A 3C1EA 3BYYB 3NBHA 1VMPA 3JAML 1RF2D 2JYOA 2A73B 1GHJA 2F0IA 4C2MB 1EZ6A 3QO2A 5IODA 3NXWA 3D4WA 2F0EA 2QEJC 1X3QA 3L9AX 3PV0A 1G2SA 5T1GA 4KY6A 3RLFA 5I9OA 1PZJD 3GQBA 5T1IA 2PZTA 4KK7A 3IAYA 4A3DB 2J4XA 4TSSA 3A56A 2K6AA 2XNAC 2FMMA 4RKBA 5CV6A 3IKJA 3BYTB 5J22A 2Z1CA 2NZ1D 1I6HB 4FF2A 1HQRD 4QUCA 5D65A 5LL6X 3J7YW 1Q12A 1H9MA 1TS5A 1SYGA 4DU9A 2HDMA 1SNPA 2IX3A 5CBAE 2MJ8A 4NW2A 4WRDA 4CJ1B 3K58A 3K7AB 4A3EB 1SAPA 3GTKB 1O7LA 1CTMA 1SNQA 2L5TA 2B2TA 3KF8A 1LV9A 3H91A 5IGFA 2NVXB 1DYQA 1SBBB 1STBA 5BN4A 1WCMB 4F87A 2QF7A 1VMCA 1BBXC 2WKDA 3GTJB 1RHPA 2K32A 3H09A 3ERQA 2R92B 1B9MA 5C6AA 1V43A 4BBSB 4K6DA 2BDNA 2ICIA 4K5WA 3DWAA 2N55A 4PNYA 1DZ1A 3J80L 4RGMA 3PUYA 3M4OB 2B39A 3DEPA 3O13A 3BG3A 3HG9A 4YIJA 1S4ZA 1M8AA 4O1NA 1S5FD 3D3RA 1LTGD 2FMCA 2M00A 1STAA 3VR3A 4ILWA 4ZK9B 1F9PA 1STNA 2XWBB 3KK7A 4ZUIA 1TS4A 2EYMA 3L3OC 4L8JA 5C0XI 3SXHA 3KLSA 3R93A 1TWGB 2DNCA 4AYBB 1F2MA 3A8IE 2PW5A 1Z47A 1EY8A 4B08A 2A68C 1B53A 3R2TA 4IZ8A 2EXZA 1KLGD 4HMIA 3K59A 1EEFD 1G91A 5IGEA 2CQAA 3VR2A 1JOKA 4ZKCB 3TMEA 2L11A 2Q8TA 1KABA 1YNJD 2B2TC 4NDXA 1FGBD 1C8CA 2WACA 5DM63 1DJRD 1SYDA 5ISRA 3GV3A 2ZXRA 3ZYYX 1I4QA 1W6JA 2WP8J 1VCIA 1EY5A 1S5CD 4KHZA 1Y1WB 3NWSA 3PIO3 3OW7A 2KEEA 3Q23A 2XSCA 4QCLA 3K5LA 5EKKA 1XYIA 1EU4A 4PMWA 2CW0D 2MGSA 3CU7A 1ENFA 4J8QA 1PRTD 1UNSA 1LT5D 3QB3A 1SNDA 4A3MB 1XTCD 3QG1A 3TP6A 3RMHA 1SXTA 2NN6I 1EU3A 2CHBD 3MTSA 3DWPA 3J7AV 3BDOA 5A35A 3HGBA 3G7LA 1O7YA 4KN4C 1W6KA 4C3JB 5FLXE 1EY9A 4PMBA 2SDFA 2F4IA 5F2DA 3F2UA 3P75A 2G9DA 5LL6S 2VB2X 3TBIB 4HEDA 3QWNA 2JE6I 4J1MA 2EY6A 2ENBA 3DHQA 2AQ2B 1MGSA 5CV9A 1BXTA 2B8FA 4BY7B 1PZID 4KTAA 5ELEA 2PNRC 4RA8A 2E2DC 4XQNA 3S2DB 1PRTB 1YNND 3P1HA 2L9HA 1NUCA 4KHVA 3OHXC 1Z6HA 2EY1A 3T53B 1QCBD 2IWHA 5K36H 1H9RA 1I4PA 2OXPA 5IGGA 3I3CA 1EYDA 1TIID 2FFKB 2F0OA 2BE5D 2K04A 3HOXB 2RDHA 1D1IA 1G2TA 5A2QL 2PYKA 2R6GA 4HCSA 1V1PA 1AZQA 1SNMA 3FEWX 3ITPA 3OWFA 1IKMA 2F0VA 1NCVA 3SDZA 3NTHA 3Q6SA 5FO9B 1F2LA 1A3VA 1SYFA 1ESFA 3G6JB 1B9NA 5JJZA 1RTOA 1PRTF 1D5ZC 2EVBA 2JP1A 5FK9C 4DNTB 5FOBB 3I90A 3H3VC 4OGQC 3FDTA 2IPKD 5C4JB 3WOFA 4TQUS 2X6GA 4U673 2NBFA 1PTOD 3HOVB 2JEBI 3N6RA 5JPNC 5K36G 4IUPA 5IIFA 1QJOA 1XX8A 1Q8IA 2G9HD 2J0TD 2PQEA 3R2IA 2NTTA 2RDFA 3C46A 1ET9A 5EBDA 1EWCA 3NHHA 1TWAB 5JVH3 2SNMA 2K1BA 4EVOA 5M5WB 2WINB 1U4MA 4LMQD 2NVYB 1DOLA 2WB1B 4BA2I 1S5ED 2F0UA 3X3NA 1BNZA 1B2TA 4A3FB 1LT6D 1PTOB 1Y8PB 3D6CA 5EPLA 2D62A 1X32A 1JWSD 2AWNA 4G4KA 1U4PA 1HPCA 2ZT9C 1HA6A 2F0KA 4DF7A 3NWTA 1ML0D 1TKWB 1EIGA 2F0MA 4CJ2C 3I91A 3NUCA 2BOSA 4QIWB 3HOUB 5J39A 3KLRA 1ZKOA 5CORA 3BVGA 1NR2A 1LTRD 2EY2A 2XRQD 4ODGA 4R9WA 2KVMA 4G57A 1E0BA 3PO2B 1LACA 1PTOF 3OOCA 3PUXA 2F0NA 4LAAA 1IYUA 1CHPD 3N52A 1PZKD 1WTXA 3I4NB 4F8MA 1Q1EA 1MSHA 4RCNA 1CFMA 1MBYA 3RUZA 4MN3A 4X3TA 4DNRB 2EJFC 3C1FA 2F03A 5IT9L 2L55A 2D9UA 3HOYB 4X3SA 1WTWA 4C3HB 4H0LC 4KN7C 2PZUA 2D2CC 4RCOA 2NUCA 4L63B 1AFPA 3GTOB 3GV6A 3HS0C 2K01A 1Q3LA 3OMGA 2IJ0A 2EZVA 4XXEA 1Y69U 4C3IG 1E2ZA 2B2VC 1HXYD 1HQMC 3T51B 1IHZA 2VB3X 1Y8NB 1TWHB 5KGUA 5DAUA 1B1ZA 3DM1A 1BDOA 2NYZD 2F3WA 1I6VC 5ELDA 5CYUA 3J81L 2JA5B 4X3KA 1IW7C 1GUNA 5G3LF 4FXDA 3FPUB 4QB4A 1GUTA 3VYSA 2KCCA 1FD7D 4RAUC 1V8QA 2C9OA 3S15B 2JA7B 3TSSA 4K6LA 2F0GA 1BCPC 5KNDA 2QCPX 3SHLA 3MXUA 2RDGA 3MZ5A 2NTSA 5IGCA 3GP7A 1MSGA 4KY7A 2I07B 3DMUA 4K8IA 2LY7A 1G8ZD 3X3MA 3PMFA 4ZLTF 1BO0A 2WKCA 5IOCA 5CV8A 4DXGA 1SYBA 1SMYD 4OIKA 3J80E 1SNOA 4DA2A 2C5CA 3EVQA 4MHEA 5E1FA 1F9RA 4EQNA 1IL8A 3IFDA 4F7XA 1KDBA 4JBWA 4EQOA 3Q22A 1T5EA 2Q8RE 1H9JA 4B9WA 4F88A 1PMRA 3S17B 2BDOA 1WVLA 3I70A 3AMUA 4BBRB 4I7ZC 4H13C 4B9XA 3EFXD 2NN6H 2RVLA 3S2HB 1FNVA 5CV5A 3MA2B 1TY0A 1ZYRD 3QIAA 1VF7A 1MI2A 3CRLC 3RZDB 4DGZA 5CMDA 4ABNA 3SE0A 5EBCA 1LT4D 1RODA 5EPJA 3VYRA 2A6HC 2F0WA 3LWEA 5ELCA 3W3AA 5C3WA 1LTID 1GXDC 3MXNA 4HAEA 2XN9C 3UI2A 4M1UB 2F0LA 2B2WA 1SNCA 2Y0SB 4K2LA 3GTPB 2RA4A 2OF1A 4DFAA 5AFWA 2AUJD 4RH6A 1R4PB 1SJHD 1TS3A 2EYJA 1RD9D 1H9SB 1LLRD 2EJGC 1CZGA 2NN6G 5EKIA 1F9SA 1XXGA 1D6EC 2Z8LA 5HURA 2XRSD 3H94A 4O42A 1LABA 1EWHA 1KDAA 1RJTA 1GUSA 2B8GA 4DAYA 4UDUC 1QILA 3ND8A 1EOTA 1F2YA 4FYDA 2LFNA 2F0FA 4IFDH 1HCZA 1DOMA 5CBEE 2LS01 5E3FA 3MEHA 2FHTA 4FXKC 4NKLA 1A2UA 1SYEA 5CC4A 5I2YA 1TT2A 1X3PA 5K5PA 3FPPA 3MVVA 4C1NI 4Q0FA 2PW7A 4G7ZC 3K5NA 3GO5A 2F0HA 2EE1A 1B4OA 2ICEC 3MHBA 2EYLA 4LK1C 5M5XB 1A6XA 2PO4A 2AQ3B 4R8IA 2E2HB 3A55A 3T16A 1SYCA 1GOZA 2AUKA 3P20A 3PIP3 2H4OA 3Q0AA 2F0DA 1I4GA 3URYA 3E0JA 2B2WC 3H6MA 1VDZA 3L7ZC 1SEBD 4ZAIA 2EYHA 3VR6A 4IUVA 1CI3M 2PPBC 2JA6B 1WD0A 1ESRA 1JOQA 4Z9CB 1H9KA 5IGBA 5EPKA 2RSNA 3U9SA 3K0YA 1HUNA 4IFDG 2R3ZA 4BWGB 4FVMA 3BDCA 3BS1A 1BOSA 1NAPA 1R9TB 2WAQB 5FLXL 5HGTA 3TZDA 1F77A 4WJWA 1M4VA 5EQ0A 2EOTA 1QWYA 4IUNA 4IFDJ 1I4HA 1II3A 3FKIB 5C4ZA 4LJZC 3GD7A 2K05A 2LMCB 2VXWA 1OXSC 2K7VA 1JB3A 3TDQA 2QILA 4OHJA 2O5JC 1ONLA 1U4RA 3VR5A 1JQYD 3DUZA 1G6ZA 2WV6D 3HOWB 1O80A 2MUYA 2KJXA 3HKZB 1YNJC 2ZXPA 2OEOA 4K14A 2M2LA 3IFTA 2A6ED 1PFBA 5BN3A 3KLSX 4J6HA 3D6WA 4HCEA 1JR0D 1EYAA 4OO1H 1OXVA 5CR3A 1PLFA 2F0SA 2B2UA 1OO9B 4FF1A 1QNUA 3I72A 4Y7NB 2A69D 4GZYC 3SK5A 2NVQB 4RFBA 2TMPA 1O78A 1PYWD 1LO5D 2R93B 1RKNA 3C2PA 1CQVA 1Y1VB 3NTIA 1WTQA 2CW0C 1T5XD 2FINB 1TY2A 3CKIB 5M3MB 1C48A 5FO7B 3M3YB 4H7BA 1EYCA 5KRUA 2EY5A 3NTKA 3DWQA 1DOKA 3NQTA 3PUWA 4KJOA 3VA7A 4FXGC 1WTOA 4BS9A 1ENCA 1ILQA 4CKCA 2XVSA 3SK8A 1U4LA 3D4DA 1V1OA 3D8GA 1TQOA 2IX1A 3GTGB 1STEA 4XYOA 3HP3A 5C3EB 2L0CA 3AB9A 2E74C 5KYLA 4OO1G 3S1RB 3T4AC 2AWOA 3I73A 2K03A 4DK0A 1JCKB 5KNCA 2K5WA 1B44D 4XDXA 2K28A 4N9PA 2A5HA 5KEEA 1HFNA 1YNNC 5G3LD 1DCZA 2DY8A 2L4NA 2R61A 3NP8A 5E4WC 4OIJA 1SFOB 3CQZB 2XWJB 4K8JA 4ZKBB 5C4XB 1TR5A 5IT9E 1EY0A 4NMZA 1FNUA 2YU9B 5JEAH 1A15A 2QDBA 4XTCS 3KUPA 1J8IA 4G7HC 2ID0A 2DNEA 3TP8A 4HMJA 1CK1A 3NE5B 4CGYB 2BE5C 4A3IB 2B2UC 3GTMB 4IUUA 2KOLA 5JPMC 1D5MC 4A3JB 1B3AA 1JC7A 2K33A 2JXMB 1NR4A 1A2TA 4CKEA 1GUGA 1VF5C 2MHVA 3JAME 2KQ3A 4DAVA 1DONA 1BCPB 1LT3D 1EFID 4PMCA 1TWCB 2IX0A 3S1MB 2F0QA 4CBVA 5CV4A 5CV7A 1PDQA 3J81E 2WIIB 2I46A 4U68A 1EZ8A 1QB5D 2H1EA 1PTOC 2Z4IA 2O5IC 4KI0A 3LNNA 4UAIA 5JEAG 4A3BB 1E2VA 4RWSC 4C1NK 5C5MA 4V0BA 2KHSA 2BA0A 4ZRZA 5I6WA 1SDFA 5D3IB 3KBGA 3MWYW 4ME5A 2EPBA 1BQQT 1SE3A 3SK6A 5JEAJ 2HUGA 1DD2A 3HZXA 1BCPF 1TWFB 3K5OA 2EDGA 2A68D 2OT2A 1EQTA 3BVMA 4CHTB 1K83B 3S1NB 5C0XH 2O2LD 2HQEA 1CA6A 4G7OC 1QG7A 5M5YB 5COYA 4XQQA 5KIXA 3PUVA 1NSNS 5I2XA 4PQXA 3U9OA 3C3LA 1S5BD 1A3UA 1D5XC 3KBXA 5C3XA 4QMGA 2E76C 2HCCA 1FNWA 3A54A 3E6ZX 2SEBD 4M8AA 4KKTA 2IL8A 1J9OA 4HSPA 5I4DA 3MFGA 4RHRA 4CKBA 5ELBA 5I6YA 1A3TA 1EY7A 2PMZB 3S1QB 1K8OA 1FYCA 4C3IB 3LX0A 4C56C 2L12A 1EIHA 4CJ0B 4BA1I 5JAVA 5C0XG 1JE4A 5I9PA 3GTQB 3CRKC 2EYOA 1TS2A 4BY1B 2E75C 1PFNA 2KUMA 2BCOA 1AEXA 3QJYA 4E6IA 1I3QB 1RCVD 5C0XJ 4RGOS 5TSSA 5JVG3 4EGVA 1LTTD 1IYVA 2F3VA 5D3DA 1EY6A 1EY4A 3SK4A 1OXXK 4L6TB 3AU7A 3WDNA 3Q24A 1LTSD 1ET6A 4XIGS 3VR4A 4S3SA 3V05A 1ICWA 3I4LA 3A7AB 3EROA 4WORA 1DM0B 3ND9A 3QOLA 3BDLA 1CA5A 2YYZA 2NB0A 4K5XA 5EKLA 2B63B 1K8MA 5M3FB 2Q8IB 3A8JE 4OL7A 3OSOA 4QF4A 3A8KE 2EYFA 2FJ2A 1S5DD 4JK1C 1STHA 1CM9A 1H9SA 3RZOB 2AQ1B 1CHQD 2NWGA 4C3JG 1CZWA 4R8NA 2R7ZB 2RSOA 4ULLA 1WD1A 1TU2B 5CGKA 2E2IB 3FMCA 1OXTA 2KA7A 3OIPA 3SEBA 3BVZA 2CVRA 3M4YA 2V4DA 5JOBA 1ZEQX 4Q5VA 3NBIA 4KMUC 4XQJA 2B2YA 2O4XA 2RQXA 1AN8A 3HOZB 4QUFA 2PZWA 3OMCA 2ZXOA 1EEID 2IT1A 3T13A 4WFN3 3H0GB 3SR1A 2RKSA 5C5LA 1ZXTA 5BN5A 1OXUA 3MFYA 1GJXA 3MAQA 1Q90A 1SMYC 3V2TA 1XWEA 3NQIA 1MD2D 2D5DA 2Z4HA 4HTHA 4ZYSA 1KNAA 3R8BA 1HTPA 1BR9A 4NP5A 5D14A 5EJWA 3VYUA 1LTBD 1Q1BA 3A7LA 1ILPA 1E2WA 3NK9A 4K2KA 4H44C 1JOOA 3P7JA 1L0XB 1PFMA 1FR3A 5KYIA 1KDCA 3OWEB 1GHKA 1IKLA 1QE6A 5A2QE 2SOBA 1QNKA 1PTOH 1ZYRC 2EJMA 3I4MB 2TSSA 5LHY1 5FO8B 3TN2A 2QKIC 3DXJC 1JICA 3IL8A 4KJNA 1SE2A 1HTLD 1JWUD 3PUZA 1KNEA 1JORA 4KKUA 4IUTA 3NSWA 1HRJA 4DAPA 2J7ZA 2PCFB 2B2YC 3W2DA 2X69A 5DNFA 2M9VA 2VUMB 5KNBA 3ONAB 1AW7A 4I65A 5NUCA 1AZPA 4IURA 4V190 1BF4A 1RDPD 2F0JA 5DM73 2JEAI 3K5MA 4RHSA 1KAAA 3D4RA 3QOJA 1O7ZA 4ID6A 3TP7A 1V1PB 4DN4M 2F1MA 1GUWA 1TVXA 1WTVA 3EA6A 3S16B 1Y8OB 2BA1A 3PO3B 4DXFA 3TP5A 3K6OA 2E2JB 4ZQ3A 1STYA 4KV6A 3M85A 4IFDI 1KLUD 2KEDA 4TRDA 3EQLC 3VA5A 1LTAD 4DK1A 3LWUA 3FRPB 2F0TA 5ELFA 4IN3A 1HFGA 4RGTA 1HHVA 5IGDA 2MPMA 5J1ZA 1BUVT 2HDLA 1PRTC 3M7NA 4IQZA 3MXPA 4XT3B 3S9WA 1EQVA 3HEJA 1STGA 4FF3A 1I4XA 3OIQA 3WOEA 3SVMA 3NPPA 3OPOA 1R4QB 2JA8B 1QOHA 5DEHA 4HN7A 3D31A 3HRZC 1Z7TA 1G291 4KY5A 5C4HA 1B50A 4IALA 3BZDB 1I4RA 2JSOA 2F0PA 3MXGA 1SSOA 1IW7D 5E4XA 4FNFA 1EL0A 4EQPA 2RBMA 4TKOB 4XYQA 2K5DA 1D1KA 1F2ZA 5EGTA 1GUOA 3K57A 2KECA 4C3HG 4PV1C 2KCNA 2IW3A 4A3KB 4ZUJA 1F9QA 1BCPD 2K5QA 2B2VA 1KTKA 1I50B 4A3GB 2N88A 3E5SA 2GA4B 3TZUA 4KD3A 1D2BA 3CHBD 1AP0A 1L0YB 2XIWA 4A93B 2DN8A 1UEAB 5M9OA 2L1BA 1HA5A 2VNUD 1UUPA 1RTNA 4N9TA 4RGNA 4FF4A 4KD4A 1PXUA 3FVQA 1WTRA 2SNSA 3DEOA 2X6LA 4HR7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWE B;  1XTC D;  5ELF A;  2AQ1 B;  1JWS D;  1CHQ D;  1HXY D;  2J4X A;  3MFG A;  4TSS A;  4BWG B;  1SXT A;  3O13 A;  4RGT A;  1ESF A;  2XNA C;  1EU3 A;  2CHB D;  1PTO H;  4RHR A;  1CT1 D;  2TSS A;  3DWP A;  5ELB A;  1B1Z A;  1D5Z C;  1PRT F;  1JWM D;  4O1N A;  1PRT C;  1F77 A;  1S5F D;  5FK9 C;  3BYT B;  1V1O A;  1LTG D;  3EFX D;  1M4V A;  1FNV A;  4UDU C;  1STE A;  3SEB A;  5ELD A;  3BVZ A;  1PTO C;  1QIL A;  1TS4 A;  1HQR D;  1I4H A;  1TY0 A;  4C56 C;  1SE2 A;  1I4X A;  2IPK D;  1HTL D;  1TS5 A;  1LT4 D;  1JWU D;  2QIL A;  4OHJ A;  1TS2 A;  3BVG A;  3BZD B;  1SE4 A;  1JCK B;  1PTO D;  1AN8 A;  1I4R A;  1LTR D;  5D3I B;  1FD7 D;  2XRQ D;  1B44 D;  3R2T A;  1JQY D;  1KLG D;  2WV6 D;  1EEI D;  1EEF D;  1SE3 A;  3TSS A;  1SJE D;  1RCV D;  1PTO F;  4K6L A;  2R61 A;  4RGO S;  5ELC A;  1BCP F;  3W2D A;  2AQ2 B;  1BCP C;  3MC0 B;  1CHP D;  5TSS A;  1BXT A;  1LTI D;  1LTT D;  1PZI D;  2RDG A;  3KLS X;  2NTS A;  1PZK D;  2G9H D;  1AW7 A;  5ELE A;  1JR0 D;  1FNU A;  3BVM A;  3GP7 A;  5D3D A;  2XN9 C;  5FKA C;  3R2I A;  1DYQ A;  2O2L D;  1SBB B;  1PRT B;  2NTT A;  1FGB D;  1RDP D;  1ET9 A;  4L6T B;  1BCP D;  1DJR D;  2AQ3 B;  1G8Z D;  1EWC A;  1MD2 D;  1KTK A;  1LTS D;  1CK1 A;  1GOZ A;  3BYY B;  1ET6 A;  4RFB A;  4RHS A;  1PYW D;  1I4G A;  3URY A;  4DXG A;  1LO5 D;  3V05 A;  3CHB D;  4ZYS A;  1I4P A;  1I4Q A;  1CQV A;  1S5C D;  1RF2 D;  3R8B A;  4RH6 A;  1D5M C;  1T5X D;  1S5B D;  1TY2 A;  1L0Y B;  1SJH D;  4RCO A;  1TS3 A;  1LTB D;  1D5X C;  1V1P B;  1SEB D;  1RD9 D;  1S5E D;  4L63 B;  2ICI A;  1LLR D;  2RDH A;  3DWA A;  1HA5 A;  3DWQ A;  3EA6 A;  1UUP A;  1FNW A;  2QEJ C;  4DXF A;  1S5D D;  1EU4 A;  1L0X B;  1XXG A;  2SEB D;  1D6E C;  4RGN A;  4RGM A;  1LT6 D;  1ENF A;  4Z9C B;  1PTO B;  1BCP B;  1KLU D;  2Z8L A;  1PZJ D;  1V1P A;  2XRS D;  1LT3 D;  1LTA D;  2IJ0 A;  1EFI D;  1PRT D;  1UNS A;  5I4D A;  1LT5 D; 
#chains in the Genus database with same CATH topology
 4FP5 D;  3UDX A;  2JA5 G;  2CQO A;  3V96 A;  1MKH A;  2NVT B;  2HIX A;  4DR5 L;  2DY7 A;  3R3O A;  1CT1 D;  3S14 B;  3VYT A;  1ENA A;  4MTK A;  4HJ9 A;  1JWM D;  4JI0 L;  4KKS A;  1VQ5 A;  4RKL A;  4FO2 A;  4P2C B;  4XT1 B;  4OX9 L;  4OO1 I;  1PYB A;  4HSV A;  5C44 B;  1CQF A;  1U0L A;  1VQD A;  3PCO B;  3S17 H;  4IUQ A;  2ZJP A;  3A5U A;  4BBR H;  1A0I A;  4DR2 L;  2K5V A;  1DGS A;  2VQE L;  2JA7 G;  3GTL B;  2EYP A;  1X3F A;  3T56 B;  1YJN A;  2Q2H A;  4LFC L;  3ICE A;  3RD4 A;  3M7G A;  1SE4 A;  2A6E C;  2A74 C;  1WTP A;  3RZD H;  2UUB L;  3BU2 A;  1PYS B;  1HUM A;  2LKV A;  1SJE D;  2UXB Q;  4X3U A;  4MIU A;  2MO0 A;  3MC0 B;  2A69 C;  1UAP A;  1U9R A;  1C4Q A;  2HCI A;  3CPF A;  2Z6K C;  2A6H D;  5FKA C;  1PH4 A;  1DXM A;  3I8Z A;  4K5V A;  3EJI A;  4JI5 Q;  1VQN A;  3J7A F;  1YVC A;  2MP1 A;  3C1E A;  1IBK L;  3BYY B;  3NBH A;  4X66 L;  3I7F A;  1VMP A;  3JAM L;  1RF2 D;  2JYO A;  4LNQ A;  1PH1 A;  2A73 B;  1GHJ A;  2F0I A;  4C2M B;  1EZ6 A;  3QO2 A;  4DUY L;  3GTP H;  4JV5 L;  4QJF A;  5IOD A;  1QZG A;  4LUZ A;  4DV2 Q;  3NXW A;  3D4W A;  2F0E A;  1VQG A;  2QEJ C;  1X3Q A;  5AJ3 Q;  1G51 A;  3L9A X;  2R7F A;  3PV0 A;  1G2S A;  1E22 A;  5T1G A;  4KY6 A;  3RLF A;  4BBR G;  5I9O A;  2A19 A;  1YJW A;  1PZJ D;  3GQB A;  5T1I A;  2PZT A;  4GN4 B;  1O7I A;  2PMZ E;  5GQO A;  1X9N A;  4KK7 A;  3IAY A;  3FHW A;  1W2B A;  4A3D B;  2J4X A;  4TSS A;  3A56 A;  1N33 L;  1VQ4 A;  2K6A A;  2XNA C;  4N8X 1;  2FMM A;  1GKH A;  4RKB A;  5CV6 A;  4PZ8 A;  2Z9H A;  2UUA L;  4NXN L;  3IKJ A;  3BYT B;  5J22 A;  1GD7 A;  2Z1C A;  2NZ1 D;  1I6H B;  1CSP A;  1CKM A;  2ZJR A;  4QY7 A;  4FF2 A;  1HQR D;  4QUC A;  5D65 A;  5LL6 X;  4HIK A;  3J7Y W;  2KEN A;  1Q12 A;  2YTY A;  1H9M A;  1TS5 A;  1SYG A;  4DU9 A;  1LUZ A;  1QZH A;  5LMN Q;  2HDM A;  1SNP A;  2IX3 A;  2QW7 A;  2K5N A;  5CBA E;  2MJ8 A;  4NW2 A;  4WRD A;  3T1Y L;  4CJ1 B;  3K58 A;  1HZ9 A;  3K7A B;  4A3E B;  1HNW L;  4DR3 Q;  1SAP A;  3GTK B;  1O7L A;  1CTM A;  1P8L A;  1SNQ A;  2L5T A;  4GKJ Q;  1JE5 A;  4KLK A;  3E9H A;  2B2T A;  2Y0S G;  3CPW A;  3KF8 A;  3E3X A;  4JI8 Q;  4OWT B;  1LV9 A;  2IHE A;  3H91 A;  5IGF A;  2I5L X;  2NVX B;  1DYQ A;  1SBB B;  1WOC A;  1UE1 A;  1STB A;  5LMU Q;  5BN4 A;  1WCM B;  3SGI A;  4R4I A;  4F87 A;  2QF7 A;  1NJI C;  1VMC A;  1BBX C;  2F3I A;  1KHI A;  2WKD A;  3GTJ B;  1RHP A;  2K32 A;  3H09 A;  4IPD A;  2QGQ A;  5M5X H;  3ERQ A;  2R92 B;  1B9M A;  2E2H H;  2KHI A;  5C6A A;  1V43 A;  4BBS B;  2OWO A;  2VQF L;  2NZO A;  4K6D A;  2BDN A;  1FGU A;  2ICI A;  4K5W A;  3DWA A;  3M9B A;  2N55 A;  4PNY A;  1DZ1 A;  1AE2 A;  3J80 L;  4RGM A;  3PUY A;  3M4O B;  1JJ2 A;  2UXD Q;  2RCN A;  5IE8 A;  4WJ4 A;  2B39 A;  1K3R A;  3DEP A;  2JA6 H;  3O13 A;  3ULJ A;  3BG3 A;  3HG9 A;  3GDE A;  4YIJ A;  1S4Z A;  1M8A A;  1J5E Q;  4O1N A;  1S5F D;  3D3R A;  2BH8 A;  1LTG D;  3NEL A;  2FMC A;  2M00 A;  3QR8 A;  1STA A;  3VR3 A;  1R9T H;  4ILW A;  1F9P A;  1STN A;  2XWB B;  3KK7 A;  4ZUI A;  4ZK9 B;  1TS4 A;  2EYM A;  3L3O C;  4L8J A;  5C0X I;  3SXH A;  1YHQ A;  3KLS A;  3R93 A;  4JYA L;  1TWG B;  4LFA L;  2DNC A;  1NMF A;  4AYB B;  1F2M A;  3CP0 A;  3A8I E;  2PW5 A;  1Z47 A;  2RF4 A;  3W5O A;  1A62 A;  1EY8 A;  3FKI H;  3TRE A;  4B08 A;  2A68 C;  1B53 A;  3R2T A;  4IZ8 A;  2EXZ A;  3MXN B;  1KLG D;  4HMI A;  1Z9F A;  3K59 A;  1EEF D;  4IPG A;  1G91 A;  5IGE A;  2CQA A;  3VR2 A;  4YCU A;  1JOK A;  4ZKC B;  3TME A;  2L11 A;  2GVB A;  3RLN A;  2Q8T A;  3HOW H;  1MJE A;  1KAB A;  4CDC C;  2ZTD A;  1YNJ D;  2B2T C;  4NDX A;  1FGB D;  1C8C A;  2WAC A;  5DM6 3;  5H1S E;  1DJR D;  1SYD A;  1MHW C;  1PHJ A;  2EXD A;  5ISR A;  2I5M X;  3GV3 A;  2ZXR A;  3ZYY X;  3I4O A;  1Q81 C;  2JA6 G;  1I4Q A;  1W6J A;  2WP8 J;  1VCI A;  1EY5 A;  1S5C D;  4Y7N H;  4KHZ A;  1Y1W B;  3E9I A;  3NWS A;  2ATW A;  2NVQ H;  3PIO 3;  3OW7 A;  2VW9 A;  4AQY Q;  1PA6 A;  2KEE A;  3Q23 A;  2K75 A;  2XSC A;  1YIT A;  4QCL A;  5L37 A;  1L1O A;  1PVO A;  2R93 H;  2ZM6 Q;  1Y1V H;  3K5L A;  2HHH L;  3AFQ A;  4JI6 L;  5IP9 H;  5EKK A;  1XYI A;  2WAQ G;  1EU4 A;  4PMW A;  5M3M H;  4LF9 L;  2CW0 D;  3M3Y H;  2OQK A;  2MGS A;  3CU7 A;  1ENF A;  4J8Q A;  1I94 L;  4IO9 A;  1PRT D;  1UNS A;  1LT5 D;  1HZB A;  3QB3 A;  1SND A;  4A3M B;  1XTC D;  3QG1 A;  3TP6 A;  4DR5 Q;  4DAY B;  3RMH A;  2E5L L;  1SXT A;  3FKI G;  2NN6 I;  4JI0 Q;  1EU3 A;  1J6Q A;  2CHB D;  3MTS A;  3CCS A;  1GVP A;  3DWP A;  3TRZ A;  1JT8 A;  4OX9 Q;  3J7A V;  3BDO A;  5A35 A;  4HID A;  1MIU A;  1UE6 A;  2WAQ E;  3HGB A;  3G7L A;  2B29 A;  4DR2 Q;  1O7Y A;  4KN4 C;  1W6K A;  2VQE Q;  4C3J B;  5FLX E;  2GN5 A;  1EY9 A;  3HOW G;  3HKZ G;  4LFC Q;  4DV1 L;  1YHB A;  4PMB A;  2SDF A;  2F4I A;  4DK3 C;  4P72 A;  5F2D A;  3F2U A;  2LSS A;  3GTG H;  3P75 A;  2G9D A;  5LL6 S;  5C3E H;  2A1A A;  2UUB Q;  2VB2 X;  4UPA A;  3TBI B;  4HED A;  3S1R H;  2AMC B;  1AH9 A;  3AEV A;  3QWN A;  4GN5 A;  2JE6 I;  4J1M A;  3CF5 A;  2EY6 A;  4DV3 L;  2ENB A;  1VQA A;  2AQ2 B;  1MGS A;  3DHQ A;  5CV9 A;  1BXT A;  2B8F A;  4DPG A;  4BY7 B;  1PZI D;  2MO1 A;  2RHS B;  4KTA A;  4OON A;  5ELE A;  4DAM A;  2PNR C;  4RA8 A;  3HKZ E;  2E2D C;  2R93 G;  4XQN A;  3S2D B;  1Y1V G;  4ALP A;  1PRT B;  1YNN D;  5IP9 G;  4ZCK A;  3P1H A;  5M3M G;  1SFO H;  1IBK Q;  2L9H A;  3CQZ H;  1NUC A;  4KHV A;  1ASZ A;  1XNR L;  5C4X H;  3OHX C;  4JBJ A;  2YU9 H;  1Z6H A;  2EY1 A;  3T53 B;  4X66 Q;  1QCB D;  2IWH A;  5K36 H;  1H9R A;  1I4P A;  2OXP A;  5IGG A;  2HT1 A;  3I3C A;  4DUY Q;  4JV5 Q;  1EYD A;  1TII D;  1VQM A;  2FFK B;  3F2B A;  2F0O A;  4B3M L;  2BE5 D;  2K04 A;  3HOX B;  4A3I H;  3GTM H;  2RDH A;  1KIX A;  1D1I A;  4DV4 L;  1G2T A;  5A2Q L;  2PYK A;  2R6G A;  4LFB L;  4A3J H;  1VQ7 A;  1N32 L;  4HCS A;  4JI3 L;  1V1P A;  1AZQ A;  1SNM A;  3FEW X;  3ITP A;  4GOP B;  1L1O C;  3OWF A;  1IKM A;  2F0V A;  3D0F A;  1N33 Q;  1NCV A;  3SDZ A;  3NTH A;  3Q6S A;  4A3L H;  1VQC A;  1X65 A;  5FO9 B;  1F2L A;  1A3V A;  5C3E G;  1SYF A;  1HZA A;  1ESF A;  3G6J B;  2UUA Q;  1IBL L;  4NXN Q;  4YY3 L;  1B9N A;  4OWX B;  5JJZ A;  1RTO A;  3UE1 A;  1PRT F;  1D5Z C;  1TWC H;  2EVB A;  2JP1 A;  5FK9 C;  3S1M H;  4DNT B;  5FOB B;  1Q86 C;  3I90 A;  3H3V C;  4EX5 A;  4OGQ C;  3FDT A;  4B3T L;  2IPK D;  5C4J B;  3WOF A;  2JK8 A;  4TQU S;  2X6G A;  4U67 3;  2NBF A;  4QQB X;  1X3G A;  3T1Y Q;  1PTO D;  1XMQ L;  1HNW Q;  5C4X G;  3HOV B;  4A3B H;  2XGT A;  2JEB I;  3N6R A;  5JPN C;  2RHQ B;  5K36 G;  3PIO A;  4IUP A;  1EIF A;  1VQO A;  5IIF A;  1QJO A;  1XX8 A;  1Q8I A;  5GAG C;  2G9H D;  2J0T D;  3DLL A;  4A3I G;  4Y52 H;  1UWV A;  2PQE A;  1QUQ A;  3R2I A;  2NTT A;  2RDF A;  3J81 j;  3C46 A;  1FJG L;  4A3J G;  3OW2 A;  1ET9 A;  1TWF H;  5EBD A;  5HY6 A;  1EWC A;  3NHH A;  1TWA B;  4R4Q A;  5JVH 3;  2SNM A;  1K83 H;  2K1B A;  4J15 A;  3S1N H;  4EVO A;  5M5W B;  3KF6 B;  5IWA L;  4GLA C;  1I5F A;  4RG1 A;  4A3L G;  2WIN B;  1XNQ L;  1U4M A;  4LMQ D;  2VQF Q;  1IBM L;  5M5Y H;  2NVY B;  1DOL A;  1FL0 A;  1SE8 A;  2WB1 B;  4BA2 I;  1PH3 A;  1E1O A;  4K0K L;  4R4T A;  4JBK A;  1S5E D;  4QL5 A;  2F0U A;  2KCT A;  3X3N A;  1BNZ A;  1B2T A;  4A3F B;  1LT6 D;  1PTO B;  4JI7 L;  1Y8P B;  1V9P A;  3D6C A;  5EPL A;  4R4O A;  4LF6 L;  2D62 A;  1X32 A;  1JWS D;  2AWN A;  3RN2 A;  4G4K A;  1U4P A;  1HPC A;  2ZT9 C;  4A3B G;  1P16 A;  1HA6 A;  2F0K A;  4DF7 A;  3NEM A;  4DR7 L;  3NWT A;  4JYA Q;  1UE7 A;  4LFA Q;  1ML0 D;  1TKW B;  1EIG A;  2F0M A;  4CJ2 C;  3I91 A;  3NUC A;  2BOS A;  4QIW B;  4A3E H;  1RIP A;  1JMC A;  3M4P A;  3HOU B;  5J39 A;  3KLR A;  1ZKO A;  3S1Q H;  4C3I H;  5COR A;  5J3B A;  3BVG A;  5JJL A;  1NR2 A;  1LTR D;  2EY2 A;  2XRQ D;  4ODG A;  4R9W A;  2KVM A;  3UDI A;  3CCV A;  1PFS A;  4G57 A;  3GTQ H;  1IL2 A;  1E0B A;  3K81 C;  3PO2 B;  1LAC A;  4DR1 L;  1PTO F;  3OOC A;  3PUX A;  2F0N A;  3AQQ A;  4LAA A;  1IYU A;  4BY1 H;  1CHP D;  3N52 A;  2GVA A;  1PZK D;  1WTX A;  1QVC A;  4HJ8 A;  3I4N B;  1K8G A;  1I3Q H;  4F8M A;  1Q1E A;  4X65 L;  1MSH A;  4RCN A;  3CCM A;  1CFM A;  1MBY A;  3RUZ A;  4MN3 A;  4X3T A;  4DNR B;  2EJF C;  3C1F A;  2F03 A;  5IT9 L;  2L55 A;  1NTG A;  2D9U A;  3HOY B;  4X3S A;  1PH8 A;  4JW0 A;  1WTW A;  4C3H B;  4H0L C;  4KN7 C;  4UP8 A;  2PZU A;  2D2C C;  1ASY A;  4RCO A;  1FVI A;  2NUC A;  4L63 B;  1YBY A;  2HHH Q;  1AFP A;  4JI6 Q;  3WWV A;  3GTO B;  3GV6 A;  3HS0 C;  4LF9 Q;  2K01 A;  2N3S A;  3AYH B;  1XJV A;  1I94 Q;  2LXK A;  4A3E G;  1Q3L A;  3OMG A;  5M3F H;  4GNX B;  2B63 H;  2IJ0 A;  3ULP A;  2EZV A;  3I2Z A;  4XXE A;  2E5L Q;  2D0P A;  1Y69 U;  4C3I G;  1E2Z A;  1OTC A;  2B2V C;  4JI2 L;  1HXY D;  1HQM C;  3T51 B;  2PNH A;  1IHZ A;  2VB3 X;  1Y8N B;  1TWH B;  5KGU A;  5DAU A;  1B1Z A;  1EQR A;  1WYD A;  3DM1 A;  2CWA A;  3RZO H;  1BDO A;  2NYZ D;  2F3W A;  2P5Z X;  1I6V C;  4BY1 G;  1K73 C;  5ELD A;  2JQO A;  5CYU A;  3J81 L;  2JA5 B;  2R7Z H;  4X3K A;  4DV1 Q;  1CUK A;  2F52 A;  5ELN A;  2E2I H;  1IW7 C;  1GUN A;  3Q8D A;  1A63 A;  5G3L F;  2UUC L;  3FPU B;  4QB4 A;  4FXD A;  3E0E A;  3T1H L;  1GUT A;  3VYS A;  1UEB A;  2KCC A;  1SR3 A;  1FD7 D;  4A3C H;  4RAU C;  1V8Q A;  2C9O A;  1XPU A;  4DV3 Q;  3S15 B;  2JA7 B;  3TSS A;  2N78 A;  4NXM L;  4K6L A;  2F0G A;  4H02 A;  1B7Y B;  1YZ6 A;  1BCP C;  2V1C C;  5KND A;  4R4C A;  3HOZ H;  2QCP X;  2N8N A;  3SHL A;  3MXU A;  2RDG A;  3MZ5 A;  2NTS A;  5IGC A;  3GP7 A;  4LF7 L;  3CAM A;  4MZ9 A;  1MSG A;  4KY7 A;  2E8G A;  2I07 B;  3DMU A;  3W1B A;  1XNR Q;  3H0G H;  4K8I A;  2LY7 A;  4HJA A;  1G8Z D;  3X3M A;  2AKW B;  1EUJ A;  2B63 G;  5IYC H;  2KHJ A;  5M3F G;  3PMF A;  4ZLT F;  1BO0 A;  2WKC A;  5IOC A;  4LF5 L;  3CCU A;  5CV8 A;  4DXG A;  1M1K C;  2K50 A;  4UP9 A;  1SYB A;  1VQ6 A;  1SMY D;  1HJP A;  4B3M Q;  1IYJ B;  4OIK A;  3STB D;  3J80 E;  3F2C A;  3H15 A;  1SNO A;  4DA2 A;  2C5C A;  4DV4 Q;  4LF4 L;  1X55 A;  3EVQ A;  4MHE A;  5E1F A;  1F9R A;  4LFB Q;  4EQN A;  5BR8 L;  1IL8 A;  1N32 Q;  3IFD A;  4F7X A;  4JI3 Q;  2R7Z G;  1S40 A;  1KDB A;  4JBW A;  3EIV A;  4EQO A;  3Q22 A;  4I7A A;  1B8A A;  1VS0 A;  1T5E A;  4YCW A;  1IBL Q;  4YY3 Q;  5GAE C;  2MNA A;  2Q8R E;  1H9J A;  3H3V H;  4B9W A;  4F88 A;  5FLX c;  1PMR A;  1RL2 A;  3S17 B;  4A3C G;  2BDO A;  1WVL A;  3I70 A;  3AMU A;  4BBR B;  4I7Z C;  4H13 C;  5IP7 H;  1SN8 A;  4DNI A;  4B9X A;  3EFX D;  3PQI A;  2NN6 H;  2RVL A;  4YWK A;  3S2H B;  1FNV A;  3HOZ G;  5CV5 A;  3MA2 B;  4B3T Q;  1TY0 A;  4UY8 C;  1QVF A;  3I4M H;  1ZYR D;  3QIA A;  1VF7 A;  1MI2 A;  3CRL C;  3RZD B;  4DGZ A;  5CMD A;  4ABN A;  1CKO A;  3SE0 A;  5EBC A;  1LT4 D;  1XMQ Q;  3H0G G;  4APV A;  1ROD A;  3KJO A;  4LWC A;  5EPJ A;  3VYR A;  5IYC G;  3U50 C;  2A6H C;  4GLV B;  2F0W A;  3A5Z B;  3LWE A;  5ELC A;  3W3A A;  4JG2 A;  5C3W A;  1KRT A;  3CC4 A;  1HNZ L;  1LTI D;  2PI2 A;  1GXD C;  3MXN A;  4HAE A;  2XN9 C;  3UI2 A;  1FJG Q;  4YCV A;  3PF4 A;  2CFM A;  4M1U B;  3JAM i;  3AFP A;  2VUM H;  2F0L A;  2B2W A;  2L15 A;  2K14 A;  2C35 B;  1SNC A;  2Y0S B;  4K2L A;  5IWA Q;  3GTP B;  4NPS A;  1XNQ Q;  2RA4 A;  2OF1 A;  1VQ9 A;  4CDF C;  4DFA A;  1IBM Q;  5AFW A;  2AUJ D;  3CW2 C;  4K0K Q;  4RH6 A;  1Q7Y C;  1R4P B;  1SJH D;  1TS3 A;  2YTX A;  2EYJ A;  1RD9 D;  5IP7 G;  1H9S B;  1LLR D;  2EJG C;  1CZG A;  2NN6 G;  5EKI A;  3CC7 A;  1F9S A;  4JI7 Q;  1XXG A;  3I4M G;  1D6E C;  2Z8L A;  5HUR A;  4LF6 Q;  2XRS D;  3CXC A;  1Q82 C;  1C7Y A;  3H94 A;  3S16 H;  3PO3 H;  1CKN B;  4YWL A;  2E2J H;  1G6P A;  1QVG A;  4O42 A;  1LAB A;  1EWH A;  1KDA A;  1RJT A;  3F1Z A;  4DR7 Q;  4AH6 A;  1GUS A;  2UXC L;  2B8G A;  3HKS A;  4DAY A;  1E7Z A;  4UDU C;  1QIL A;  3ND8 A;  1EOT A;  1F2Y A;  4FYD A;  4HJ7 A;  2LFN A;  2F0F A;  4IFD H;  1HCZ A;  1DOM A;  2VUM G;  5CBE E;  1HNX L;  2LS0 1;  1K28 A;  3IRB A;  2YV5 A;  3MEH A;  5E3F A;  4R1J A;  2CCZ A;  2OTJ A;  2FHT A;  2JA8 H;  4X64 L;  4DR1 Q;  4FXK C;  4NKL A;  1A2U A;  1SYE A;  5CC4 A;  5I2Y A;  1TT2 A;  1X3P A;  5K5P A;  3FPP A;  3MVV A;  1YEZ A;  2R7D A;  4C1N I;  3L0O A;  4Q0F A;  3B6Y A;  2PW7 A;  4G7Z C;  4LF8 L;  3K5N A;  3GO5 A;  4WJ3 M;  3ERS X;  2F0H A;  2EE1 A;  2NZH A;  4P74 A;  4X65 Q;  1B4O A;  4GN3 B;  2ICE C;  4FDB A;  3MHB A;  3TS2 A;  2EYL A;  4JPB W;  4LK1 C;  5M5X B;  1A6X A;  2PO4 A;  2AQ3 B;  4R8I A;  5FJ8 H;  2E2H B;  1JJG A;  3A55 A;  3T16 A;  1SYC A;  1GOZ A;  2AUK A;  3P20 A;  3PIP 3;  2H4O A;  3Q0A A;  2F0D A;  3UDG A;  1I4G A;  3URY A;  4A3K H;  3PO3 G;  3E0J A;  3J7A 5;  2B2W C;  3J80 i;  3H6M A;  1VQF A;  1VDZ A;  1I50 H;  4DR6 L;  4A3G H;  3L7Z C;  1SEB D;  2K4K A;  4ZAI A;  2EYH A;  3VR6 A;  4IUV A;  1CI3 M;  2PPB C;  2JA6 B;  1WD0 A;  1ESR A;  1JOQ A;  4Z9C B;  4A93 H;  1K0R A;  1H9K A;  5IGB A;  3TQY A;  5EPK A;  2RSN A;  4JI2 Q;  3U9S A;  3K0Y A;  1HUN A;  4IFD G;  2R3Z A;  1IZ6 A;  4FVM A;  3BDC A;  3BZC A;  4N8F A;  4RMF A;  4A4I A;  4BWG B;  1BOS A;  1NAP A;  3BS1 A;  1R9T B;  2WAQ B;  5FLX L;  2JA8 G;  5HGT A;  3TZD A;  4GOP A;  1F77 A;  4WJW A;  1XPO A;  4B3R L;  3K8A A;  1M4V A;  5EQ0 A;  1SRO A;  2EOT A;  1QWY A;  4IUN A;  2NVT H;  4IFD J;  3S14 H;  1I4H A;  1II3 A;  1KQS A;  4JVZ A;  4POG A;  3FKI B;  5C4Z A;  4LJZ C;  3GD7 A;  2K05 A;  2LMC B;  2VXW A;  1XTD A;  3G48 A;  2UUC Q;  2DJF C;  3T1H Q;  1OXS C;  2K7V A;  1JB3 A;  3TDQ A;  2QIL A;  4OHJ A;  5C44 H;  1EQQ A;  2O5J C;  1ONL A;  5FJ8 G;  1N36 L;  1U4R A;  2WB1 G;  2ZJQ A;  3GTL H;  4AIM A;  3VR5 A;  4NXM Q;  1JQY D;  3DUZ A;  1G6Z A;  2WV6 D;  3HOW B;  1O80 A;  3BZK A;  2MUY A;  2KJX A;  4A3K G;  1D7Q A;  3HKZ B;  1YNJ C;  4OWW B;  2ZXP A;  4LUO A;  2OEO A;  4K14 A;  1PH2 A;  2M2L A;  3IFT A;  4LF7 Q;  4A3G G;  2A6E D;  1PFB A;  5BN3 A;  3KLS X;  4J6H A;  3D6W A;  2LXJ A;  1JR0 D;  1CSQ A;  1EYA A;  4HCE A;  1EIY B;  4OO1 H;  2F4V L;  1OXV A;  4DV7 L;  1N34 L;  5CR3 A;  1PLF A;  2F0S A;  2B2U A;  3VDY A;  1OO9 B;  1XMO L;  2KCM A;  4B3S L;  4FF1 A;  1QNU A;  3I72 A;  4A93 G;  4Y7N B;  2A69 D;  2WB1 E;  4GZY C;  3SK5 A;  4CDD C;  4LF5 Q;  2NVQ B;  4RFB A;  2TMP A;  4JI1 L;  1O78 A;  1VQ8 A;  1PYW D;  3GTO H;  1LO5 D;  1KAW A;  2R93 B;  1RKN A;  3C2P A;  1CQV A;  1Y1V B;  3NTI A;  1WTQ A;  2CW0 C;  1T5X D;  4LF4 Q;  2FIN B;  1TY2 A;  3CKI B;  3ZJY C;  5M3M B;  5GAD C;  1C48 A;  5FO7 B;  3M3Y B;  4H7B A;  5BR8 Q;  1EYC A;  3KF6 A;  2EIF A;  5KRU A;  3RN5 A;  2EY5 A;  3NTK A;  3DWQ A;  1DOK A;  1NNX A;  3NQT A;  3PUW A;  4PG3 A;  4C2M H;  4KJO A;  3VA7 A;  1TWH H;  4FXG C;  3I55 A;  3F2D A;  1KL9 A;  2DUD A;  2AHO B;  1WTO A;  1JB7 A;  2DGY A;  2PQA B;  1PV4 A;  4BS9 A;  1YNX A;  5C44 G;  1VQI A;  1ENC A;  1ILQ A;  4CKC A;  2XVS A;  3SK8 A;  3CCJ A;  1U4L A;  1Q8K A;  3D4D A;  4QIW E;  5GAH C;  3I4N G;  2ZTE A;  3LGJ A;  1V1O A;  3D8G A;  4A3D H;  1TQO A;  2IX1 A;  3GTG B;  1STE A;  3HP3 A;  4XYO A;  4HIO A;  5C3E B;  2L0C A;  3AB9 A;  2E74 C;  5KYL A;  4GOP C;  4OO1 G;  3S1R B;  3T4A C;  2AWO A;  3CME A;  3I73 A;  3PIP A;  1I6H H;  2K03 A;  1PH5 A;  3FP9 A;  4DK0 A;  3TEH B;  1JCK B;  5KNC A;  2K5W A;  1KXL A;  1B44 D;  4XDX A;  2K28 A;  4N9P A;  2A5H A;  3DM3 A;  4IJL A;  5KEE A;  1HFN A;  2A8V A;  1YNN C;  5G3L D;  1HNZ Q;  1DCZ A;  2DY8 A;  2L4N A;  2R61 A;  3NP8 A;  5E4W C;  2Q2T A;  2CH4 W;  4OIJ A;  1SFO B;  3CQZ B;  2XWJ B;  4K8J A;  4ZKB B;  2YTV A;  3K7A H;  5C4X B;  1TR5 A;  5IT9 E;  1EY0 A;  4NMZ A;  1FNU A;  3GTK H;  2YU9 B;  5JEA H;  1A15 A;  2QDB A;  4XTC S;  3KUP A;  1J8I A;  4G7H C;  2ID0 A;  1JJC B;  2DNE A;  3TP8 A;  3J80 c;  1E1T A;  4HMJ A;  1CK1 A;  3NE5 B;  4CGY B;  2BE5 C;  4KHP L;  4JI4 L;  2NVX H;  2OTL A;  4A3I B;  2B2U C;  1KC8 C;  3GTM B;  4IUU A;  1WCM H;  3KDF B;  2QEX A;  2KOL A;  5JPM C;  1D5M C;  4A3J B;  1WI5 A;  1B3A A;  1JC7 A;  2K33 A;  3G4S A;  2JXM B;  1NR4 A;  1A2T A;  1ICF B;  3GTJ H;  4DR4 L;  4CKE A;  1GUG A;  1VF5 C;  4L5Q A;  4A3D G;  3OTO L;  2MHV A;  2R92 H;  4DV0 L;  1S72 A;  3JAM E;  2KQ3 A;  4ME3 A;  2UU9 L;  4BBS H;  2KBN A;  1V1Q A;  4DAV A;  1DON A;  1BCP B;  2N49 A;  1LT3 D;  1NY4 A;  1EFI D;  4PMC A;  1TWC B;  2VL6 A;  2IX0 A;  3S1M B;  2F0Q A;  3S2H H;  4CBV A;  3U4V A;  5CV4 A;  5CV7 A;  1PDQ A;  3M4O H;  4CDE C;  3J81 E;  2UXC Q;  1NMG A;  4GNX A;  2WII B;  2I46 A;  4P73 A;  1Q46 A;  4A76 A;  2CKZ B;  4U68 A;  1EZ8 A;  1QB5 D;  2H1E A;  2B3G A;  1PTO C;  2Z4I A;  2O5I C;  4KI0 A;  4UP7 A;  1GM5 A;  3LNN A;  4UAI A;  5JEA G;  4A3B B;  1E2V A;  4P71 A;  4RWS C;  4C1N K;  1HNX Q;  5C5M A;  1LM0 A;  4V0B A;  2KHS A;  2BA0 A;  4ZRZ A;  1EOV A;  5I6W A;  1SDF A;  4X64 Q;  1TWG H;  5D3I B;  3KBG A;  3U58 A;  3MWY W;  4ME5 A;  2EPB A;  4LF8 Q;  1BQQ T;  1VQH A;  1SE3 A;  3SK6 A;  1WCM G;  5JEA J;  2HUG A;  1DD2 A;  3HZX A;  1PH7 A;  2ES2 A;  1BCP F;  4OXP A;  1TWF B;  3K5O A;  2EDG A;  2A68 D;  2OT2 A;  1EQT A;  3BVM A;  4CHT B;  1K83 B;  3S1N B;  5C0X H;  4BXX H;  3NBH B;  5EAY A;  4GKK L;  2R92 G;  2O2L D;  2HD3 A;  2QA4 A;  1U5K A;  2HQE A;  4BBS G;  1CA6 A;  4G7O C;  1QG7 A;  5M5Y B;  5COY A;  4XQQ A;  5KIX A;  1XPR A;  3PUV A;  2MQH A;  1NSN S;  5I2X A;  4PQX A;  1SLJ A;  1HZC A;  3NEN A;  1EYG A;  4DR6 Q;  3U9O A;  5JJK A;  3C3L A;  1S5B D;  1A3U A;  1KD1 C;  1X6O A;  4DUZ L;  1D5X C;  3CD6 A;  3KFU A;  3K7U C;  3KBX A;  5C3X A;  4QMG A;  4A75 A;  3JC6 6;  2VS1 A;  2E76 C;  2HCC A;  4YHH L;  1FNW A;  3A54 A;  4DV6 L;  3E6Z X;  1VQE A;  1LYL A;  4X62 L;  1Y1W H;  2SEB D;  5DLQ E;  3A74 A;  2OQ0 A;  4KKT A;  4M8A A;  2IL8 A;  1J9O A;  3K0X A;  4HSP A;  5I4D A;  3MFG A;  1K9M C;  4O0A A;  4RHR A;  4CKB A;  4AYB G;  4B3R Q;  5ELB A;  5I6Y A;  1A3T A;  1EY7 A;  4A3M H;  2PMZ B;  1VQK A;  1WFQ A;  3S1Q B;  4DV5 L;  5JJI A;  1K8O A;  1FYC A;  4C3I B;  3LX0 A;  4C56 C;  2MFI A;  2L12 A;  1EIH A;  4GNX C;  4CJ0 B;  4BA1 I;  3M4Q A;  5JAV A;  5C0X G;  1JE4 A;  1BBW A;  5I9P A;  4BXX G;  3GTQ B;  3CRK C;  1N36 Q;  2WFW A;  2IY5 B;  2EYO A;  3CCR A;  1TS2 A;  3KF8 B;  4C3J H;  4BY1 B;  2E75 C;  4AYB E;  1PFN A;  1VQJ A;  2KUM A;  2BCO A;  1AEX A;  3QJY A;  5IY0 A;  3ULL A;  4E6I A;  1I3Q B;  1RCV D;  5C0X J;  4RGO S;  4JOI A;  3RNU A;  2PI2 E;  5TSS A;  4O2D A;  2Y0S E;  1X54 A;  4EGV A;  5JVG 3;  2F4V Q;  4DV7 Q;  1LTT D;  1N34 Q;  1IYV A;  3EBE A;  4TVA B;  2F3V A;  5D3D A;  1BBU A;  1XMO Q;  4IJH A;  4B3S Q;  1EY6 A;  1EY4 A;  4PZ6 A;  3SK4 A;  4JCV E;  1HR0 L;  1OXX K;  4L6T B;  3AU7 A;  3WDN A;  1Y1W G;  4BY7 H;  4L5R C;  4JI1 Q;  3Q24 A;  1LTS D;  2D0O A;  1ET6 A;  2FXQ A;  2I0Q A;  1A8V A;  3S24 A;  3S2D H;  4XIG S;  3VR4 A;  4S3S A;  1W3S A;  3V05 A;  1ICW A;  3I4L A;  3A7A B;  3ERO A;  4WOR A;  1DM0 B;  4YWM A;  1C9O A;  3ND9 A;  3QOL A;  3PGZ A;  3BJU A;  3BDL A;  1CA5 A;  2YYZ A;  3PF5 A;  2NB0 A;  4K5X A;  5EKL A;  2B63 B;  4A3M G;  1K8M A;  5M3F B;  2Q8I B;  3A8J E;  4OL7 A;  3OSO A;  4QF4 A;  3A8K E;  2EYF A;  2FJ2 A;  1S5D D;  4JK1 C;  1STH A;  2VZA A;  1YIJ A;  3CCQ A;  2QDL A;  3HOX H;  1CM9 A;  1H9S A;  1PH6 A;  2K5H A;  3RZO B;  2AQ1 B;  4L5T A;  4PZ7 A;  1CHQ D;  5FLM H;  2NWG A;  3KOJ A;  3J81 i;  4C3J G;  3I56 A;  1CZW A;  2RCF A;  4R8N A;  4GLX A;  2R7Z B;  2RSO A;  4ULL A;  1WD1 A;  1TU2 B;  2HQL A;  3A0J A;  5GRO A;  5CGK A;  2E2I B;  3FMC A;  4DKA C;  4HJ5 A;  3KYH C;  1CKN A;  1OXT A;  2KA7 A;  3OIP A;  3SEB A;  3BVZ A;  2CVR A;  2HIV A;  3M4Y A;  2V4D A;  3RLO A;  1MJC A;  5JOB A;  1X56 A;  1ZEQ X;  4Q5V A;  4IPH A;  3CMA A;  3NBI A;  4OEM B;  4KMU C;  4XQJ A;  3CC2 A;  4BY7 G;  2B2Y A;  2O4X A;  1WTH A;  2RQX A;  1AN8 A;  3HOZ B;  4QUF A;  2Q2U A;  2PZW A;  5C4J H;  3OMC A;  2Z6B A;  5E7N A;  1HR0 W;  2ZXO A;  1E24 A;  5HGQ A;  1EEI D;  2IT1 A;  3T13 A;  4OEL B;  4WFN 3;  2JJQ A;  2ZTC A;  3HOV H;  3H0G B;  3UDF A;  2UXB L;  1BKB A;  5IYB H;  3SR1 A;  2RKS A;  5C5L A;  3CCL A;  1ZXT A;  5BN5 A;  1OXU A;  3MFY A;  1NE3 A;  1GJX A;  4JOI C;  3MAQ A;  1Q90 A;  1SMY C;  3STB C;  2CWP A;  3V2T A;  1VQP A;  1XWE A;  4JI4 Q;  3NQI A;  1MD2 D;  4KHP Q;  3HOX G;  1KRS A;  4JI5 L;  2D5D A;  4NB3 A;  2Z4H A;  4MTN A;  3H3V I;  4HTH A;  3RR5 A;  1L1O B;  5FLM G;  4ZYS A;  3OYY A;  1KNA A;  3R8B A;  1HTP A;  1BR9 A;  4DR4 Q;  1IXR A;  1TWA H;  4NP5 A;  5D14 A;  5EJW A;  3VYU A;  1LTB D;  3OTO Q;  1T9H A;  5M5W H;  1Q1B A;  4DV0 Q;  3A7L A;  1ILP A;  4L5S A;  2UU9 Q;  1E2W A;  3NK9 A;  1BVS A;  4K2K A;  4H44 C;  4DV2 L;  1JOO A;  3P7J A;  1L0X B;  2NVY H;  1PFM A;  5AJ3 L;  1FR3 A;  3G6E A;  1GO3 E;  2I5H A;  2XTI A;  5KYI A;  1AE3 A;  1VQB A;  1KDC A;  3OWE B;  1GHK A;  1IKL A;  1QE6 A;  5A2Q E;  2SOB A;  1QNK A;  1B3Q A;  4A3F H;  4LW1 A;  1PTO H;  1ZYR C;  2EJM A;  3I4M B;  2TSS A;  5LHY 1;  3EN2 A;  5FO8 B;  2EQS A;  3TN2 A;  1LTL A;  2QKI C;  1JIC A;  3DXJ C;  3HOV G;  2ASB A;  3IL8 A;  3KJP A;  5IYB G;  4KJN A;  1SE2 A;  3UE0 A;  4UHV A;  4GS3 A;  1HTL D;  2ALY B;  2BH2 A;  1SMX A;  1JWU D;  1EWI A;  3PSI A;  4JBM A;  3PUZ A;  1HH2 P;  1KNE A;  1JOR A;  5LMN L;  3CCE A;  4KKU A;  5IT9 c;  4IUT A;  3NSW A;  4IPC A;  4EQ5 A;  3HOU H;  4MNO A;  4JC0 A;  1HRJ A;  4DAP A;  2J7Z A;  4DR3 L;  2PCF B;  2B2Y C;  2X69 A;  3W2D A;  5DNF A;  2M9V A;  2VUM B;  1E3P A;  4GKJ L;  5KNB A;  1K0S A;  3ONA B;  1AW7 A;  4I65 A;  4GKK Q;  1N9W A;  4JI8 L;  5NUC A;  1AZP A;  3PO2 H;  4P75 A;  4IUR A;  4V19 0;  3W1G A;  1RDP D;  1BF4 A;  2F0J A;  2Z0S A;  1L2F A;  5DM7 3;  5LMU L;  2JEA I;  3K5M A;  1YHA A;  1Y14 B;  2H5X A;  4RHS A;  3I4N H;  1KAA A;  1PH9 A;  4DK6 C;  1VQL A;  2OCE A;  4A3F G;  2JN4 A;  1YI2 A;  4IOA A;  3D4R A;  3JAM c;  3ER0 A;  1O7Z A;  3QOJ A;  4DUZ Q;  4ID6 A;  3L2P A;  1B70 B;  3TP7 A;  1K8A C;  3HOY H;  1V1P B;  4DN4 M;  2F1M A;  4YHH Q;  1GUW A;  5ELO A;  1TVX A;  1WTV A;  2CH4 A;  4DV6 Q;  3EA6 A;  4X62 Q;  4C3H H;  3S16 B;  1Y8O B;  2BA1 A;  2K52 A;  3PO3 B;  2VY3 A;  4DXF A;  3TP5 A;  3K6O A;  2E2J B;  4ZQ3 A;  3J81 c;  1STY A;  1WJJ A;  1TXY A;  4KV6 A;  3M85 A;  4IFD I;  1KLU D;  1SRU A;  2KED A;  3EQL C;  4TRD A;  3VA5 A;  3F8T A;  1LTA D;  1K3B C;  4DK1 A;  3LWU A;  1S3O A;  2UXD L;  3FRP B;  1H95 A;  2F0T A;  5ELF A;  3J7Z C;  4IN3 A;  1HFG A;  4RGT A;  1HHV A;  3TS0 A;  5IGD A;  1N8R C;  1NBW A;  2MPM A;  5J1Z A;  4HIM A;  3HOU G;  1BUV T;  2HDL A;  1PRT C;  3M7N A;  4IQZ A;  4DV5 Q;  4LUV A;  3MXP A;  2G5D A;  1X3E A;  1J5E L;  5LMN W;  2PQA A;  4XT3 B;  3S9W A;  1EQV A;  3HEJ A;  1STG A;  4FF3 A;  1I4X A;  3OIQ A;  3WOE A;  3SVM A;  3NPP A;  3OPO A;  1R4Q B;  4IOC A;  5IYD H;  3PO2 G;  1EFW A;  2JA8 B;  1QOH A;  2Q2I A;  5DEH A;  4HN7 A;  3D31 A;  3HRZ C;  1Z7T A;  1G29 1;  1D8L A;  4KY5 A;  5C4H A;  1B50 A;  4IAL A;  2JA5 H;  3BZD B;  1I4R A;  2JSO A;  2F0P A;  3MXG A;  3HFZ B;  1SSO A;  1IW7 D;  5E4X A;  2Z6K A;  4FNF A;  1EL0 A;  1QUQ B;  4X6A H;  4EQP A;  2RBM A;  4TKO B;  4XYQ A;  2K5D A;  3G71 A;  3HOY G;  1D1K A;  1F2Z A;  5EGT A;  3S15 H;  1GUO A;  3K57 A;  4QGU A;  2JA7 H;  2KEC A;  1HR0 Q;  4C3H G;  4PV1 C;  2KCN A;  1M90 C;  1C0A A;  2IW3 A;  4A3K B;  4ZUJ A;  1F9Q A;  1BCP D;  2K5Q A;  4POF A;  2B2V A;  3KLW A;  2IHF A;  1KTK A;  1I50 B;  4A3G B;  2N88 A;  3E5S A;  2GA4 B;  3K80 C;  3TZU A;  4KD3 A;  1D2B A;  3CHB D;  2JA9 A;  1AP0 A;  1L0Y B;  2DJG C;  2XIW A;  4A93 B;  2DN8 A;  1UEA B;  5M9O A;  2L1B A;  4AQY L;  1HA5 A;  2VNU D;  3KDF A;  1UUP A;  1RTN A;  3MEF A;  4N9T A;  2ZM6 L;  1YJ9 A;  3U4Z A;  4RGN A;  4FF4 A;  4KD4 A;  1PXU A;  5IYD G;  1UE5 A;  3FVQ A;  1WTR A;  2SNS A;  3DEO A;  1L0W A;  2X6L A;  4HR7 B; 
#chains in the Genus database with same CATH homology
 4FP5 D;  3V96 A;  2NVT B;  2DY7 A;  3R3O A;  1CT1 D;  3S14 B;  3VYT A;  1ENA A;  1JWM D;  4KKS A;  4RKL A;  4FO2 A;  4P2C B;  4XT1 B;  4OO1 I;  4HSV A;  5C44 B;  1CQF A;  4IUQ A;  3GTL B;  2EYP A;  3T56 B;  3RD4 A;  3M7G A;  1SE4 A;  2A6E C;  2A74 C;  1WTP A;  1HUM A;  2LKV A;  1SJE D;  4X3U A;  4MIU A;  3MC0 B;  2A69 C;  1UAP A;  1U9R A;  1C4Q A;  2HCI A;  2A6H D;  5FKA C;  1DXM A;  3I8Z A;  4K5V A;  3EJI A;  3J7A F;  2MP1 A;  3C1E A;  3BYY B;  3NBH A;  1VMP A;  3JAM L;  1RF2 D;  2JYO A;  2A73 B;  1GHJ A;  2F0I A;  4C2M B;  1EZ6 A;  3QO2 A;  5IOD A;  3NXW A;  3D4W A;  2F0E A;  2QEJ C;  1X3Q A;  3L9A X;  3PV0 A;  1G2S A;  5T1G A;  4KY6 A;  3RLF A;  5I9O A;  1PZJ D;  3GQB A;  5T1I A;  2PZT A;  4KK7 A;  3IAY A;  4A3D B;  2J4X A;  4TSS A;  3A56 A;  2K6A A;  2XNA C;  2FMM A;  4RKB A;  5CV6 A;  3IKJ A;  3BYT B;  5J22 A;  2Z1C A;  2NZ1 D;  1I6H B;  4FF2 A;  1HQR D;  4QUC A;  5D65 A;  5LL6 X;  3J7Y W;  1Q12 A;  1H9M A;  1TS5 A;  1SYG A;  4DU9 A;  2HDM A;  1SNP A;  2IX3 A;  5CBA E;  2MJ8 A;  4NW2 A;  4WRD A;  4CJ1 B;  3K58 A;  3K7A B;  4A3E B;  1SAP A;  3GTK B;  1O7L A;  1CTM A;  1SNQ A;  2L5T A;  2B2T A;  3KF8 A;  1LV9 A;  3H91 A;  5IGF A;  2NVX B;  1DYQ A;  1SBB B;  1STB A;  5BN4 A;  1WCM B;  4F87 A;  2QF7 A;  1VMC A;  1BBX C;  2WKD A;  3GTJ B;  1RHP A;  2K32 A;  3H09 A;  3ERQ A;  2R92 B;  1B9M A;  5C6A A;  1V43 A;  4BBS B;  4K6D A;  2BDN A;  2ICI A;  4K5W A;  3DWA A;  2N55 A;  4PNY A;  1DZ1 A;  3J80 L;  4RGM A;  3PUY A;  3M4O B;  2B39 A;  3DEP A;  3O13 A;  3BG3 A;  3HG9 A;  4YIJ A;  1S4Z A;  1M8A A;  4O1N A;  1S5F D;  3D3R A;  1LTG D;  2FMC A;  2M00 A;  1STA A;  3VR3 A;  4ILW A;  4ZK9 B;  1F9P A;  1STN A;  2XWB B;  3KK7 A;  4ZUI A;  1TS4 A;  2EYM A;  3L3O C;  4L8J A;  5C0X I;  3SXH A;  3KLS A;  3R93 A;  1TWG B;  2DNC A;  4AYB B;  1F2M A;  3A8I E;  2PW5 A;  1Z47 A;  1EY8 A;  4B08 A;  2A68 C;  1B53 A;  3R2T A;  4IZ8 A;  2EXZ A;  1KLG D;  4HMI A;  3K59 A;  1EEF D;  1G91 A;  5IGE A;  2CQA A;  3VR2 A;  1JOK A;  4ZKC B;  3TME A;  2L11 A;  2Q8T A;  1KAB A;  1YNJ D;  2B2T C;  4NDX A;  1FGB D;  1C8C A;  2WAC A;  5DM6 3;  1DJR D;  1SYD A;  5ISR A;  3GV3 A;  2ZXR A;  3ZYY X;  1I4Q A;  1W6J A;  2WP8 J;  1VCI A;  1EY5 A;  1S5C D;  4KHZ A;  1Y1W B;  3NWS A;  3PIO 3;  3OW7 A;  2KEE A;  3Q23 A;  2XSC A;  4QCL A;  3K5L A;  5EKK A;  1XYI A;  1EU4 A;  4PMW A;  2CW0 D;  2MGS A;  3CU7 A;  1ENF A;  4J8Q A;  1PRT D;  1UNS A;  1LT5 D;  3QB3 A;  1SND A;  4A3M B;  1XTC D;  3QG1 A;  3TP6 A;  3RMH A;  1SXT A;  2NN6 I;  1EU3 A;  2CHB D;  3MTS A;  3DWP A;  3J7A V;  3BDO A;  5A35 A;  3HGB A;  3G7L A;  1O7Y A;  4KN4 C;  1W6K A;  4C3J B;  5FLX E;  1EY9 A;  4PMB A;  2SDF A;  2F4I A;  5F2D A;  3F2U A;  3P75 A;  2G9D A;  5LL6 S;  2VB2 X;  3TBI B;  4HED A;  3QWN A;  2JE6 I;  4J1M A;  2EY6 A;  2ENB A;  3DHQ A;  2AQ2 B;  1MGS A;  5CV9 A;  1BXT A;  2B8F A;  4BY7 B;  1PZI D;  4KTA A;  5ELE A;  2PNR C;  4RA8 A;  2E2D C;  4XQN A;  3S2D B;  1PRT B;  1YNN D;  3P1H A;  2L9H A;  1NUC A;  4KHV A;  3OHX C;  1Z6H A;  2EY1 A;  3T53 B;  1QCB D;  2IWH A;  5K36 H;  1H9R A;  1I4P A;  2OXP A;  5IGG A;  3I3C A;  1EYD A;  1TII D;  2FFK B;  2F0O A;  2BE5 D;  2K04 A;  3HOX B;  2RDH A;  1D1I A;  1G2T A;  5A2Q L;  2PYK A;  2R6G A;  4HCS A;  1V1P A;  1AZQ A;  1SNM A;  3FEW X;  3ITP A;  3OWF A;  1IKM A;  2F0V A;  1NCV A;  3SDZ A;  3NTH A;  3Q6S A;  5FO9 B;  1F2L A;  1A3V A;  1SYF A;  1ESF A;  3G6J B;  1B9N A;  5JJZ A;  1RTO A;  1PRT F;  1D5Z C;  2EVB A;  2JP1 A;  5FK9 C;  4DNT B;  5FOB B;  3I90 A;  3H3V C;  4OGQ C;  3FDT A;  2IPK D;  5C4J B;  3WOF A;  4TQU S;  2X6G A;  4U67 3;  2NBF A;  1PTO D;  3HOV B;  2JEB I;  3N6R A;  5JPN C;  5K36 G;  4IUP A;  5IIF A;  1QJO A;  1XX8 A;  1Q8I A;  2G9H D;  2J0T D;  2PQE A;  3R2I A;  2NTT A;  2RDF A;  3C46 A;  1ET9 A;  5EBD A;  1EWC A;  3NHH A;  1TWA B;  5JVH 3;  2SNM A;  2K1B A;  4EVO A;  5M5W B;  2WIN B;  1U4M A;  4LMQ D;  2NVY B;  1DOL A;  2WB1 B;  4BA2 I;  1S5E D;  2F0U A;  3X3N A;  1BNZ A;  1B2T A;  4A3F B;  1LT6 D;  1PTO B;  1Y8P B;  3D6C A;  5EPL A;  2D62 A;  1X32 A;  1JWS D;  2AWN A;  4G4K A;  1U4P A;  1HPC A;  2ZT9 C;  1HA6 A;  2F0K A;  4DF7 A;  3NWT A;  1ML0 D;  1TKW B;  1EIG A;  2F0M A;  4CJ2 C;  3I91 A;  3NUC A;  2BOS A;  4QIW B;  3HOU B;  5J39 A;  3KLR A;  1ZKO A;  5COR A;  3BVG A;  1NR2 A;  1LTR D;  2EY2 A;  2XRQ D;  4ODG A;  4R9W A;  2KVM A;  4G57 A;  1E0B A;  3PO2 B;  1LAC A;  1PTO F;  3OOC A;  3PUX A;  2F0N A;  4LAA A;  1IYU A;  1CHP D;  3N52 A;  1PZK D;  1WTX A;  3I4N B;  4F8M A;  1Q1E A;  1MSH A;  4RCN A;  1CFM A;  1MBY A;  3RUZ A;  4MN3 A;  4X3T A;  4DNR B;  2EJF C;  3C1F A;  2F03 A;  5IT9 L;  2L55 A;  2D9U A;  3HOY B;  4X3S A;  1WTW A;  4C3H B;  4H0L C;  4KN7 C;  2PZU A;  2D2C C;  4RCO A;  2NUC A;  4L63 B;  1AFP A;  3GTO B;  3GV6 A;  3HS0 C;  2K01 A;  1Q3L A;  3OMG A;  2IJ0 A;  2EZV A;  4XXE A;  1Y69 U;  4C3I G;  1E2Z A;  2B2V C;  1HXY D;  1HQM C;  3T51 B;  1IHZ A;  2VB3 X;  1Y8N B;  1TWH B;  5KGU A;  5DAU A;  1B1Z A;  3DM1 A;  1BDO A;  2NYZ D;  2F3W A;  1I6V C;  5ELD A;  5CYU A;  3J81 L;  2JA5 B;  4X3K A;  1IW7 C;  1GUN A;  5G3L F;  4FXD A;  3FPU B;  4QB4 A;  1GUT A;  3VYS A;  2KCC A;  1FD7 D;  4RAU C;  1V8Q A;  2C9O A;  3S15 B;  2JA7 B;  3TSS A;  4K6L A;  2F0G A;  1BCP C;  5KND A;  2QCP X;  3SHL A;  3MXU A;  2RDG A;  3MZ5 A;  2NTS A;  5IGC A;  3GP7 A;  1MSG A;  4KY7 A;  2I07 B;  3DMU A;  4K8I A;  2LY7 A;  1G8Z D;  3X3M A;  3PMF A;  4ZLT F;  1BO0 A;  2WKC A;  5IOC A;  5CV8 A;  4DXG A;  1SYB A;  1SMY D;  4OIK A;  3J80 E;  1SNO A;  4DA2 A;  2C5C A;  3EVQ A;  4MHE A;  5E1F A;  1F9R A;  4EQN A;  1IL8 A;  3IFD A;  4F7X A;  1KDB A;  4JBW A;  4EQO A;  3Q22 A;  1T5E A;  2Q8R E;  1H9J A;  4B9W A;  4F88 A;  1PMR A;  3S17 B;  2BDO A;  1WVL A;  3I70 A;  3AMU A;  4BBR B;  4I7Z C;  4H13 C;  4B9X A;  3EFX D;  2NN6 H;  2RVL A;  3S2H B;  1FNV A;  5CV5 A;  3MA2 B;  1TY0 A;  1ZYR D;  3QIA A;  1VF7 A;  1MI2 A;  3CRL C;  3RZD B;  4DGZ A;  5CMD A;  4ABN A;  3SE0 A;  5EBC A;  1LT4 D;  1ROD A;  5EPJ A;  3VYR A;  2A6H C;  2F0W A;  3LWE A;  5ELC A;  3W3A A;  5C3W A;  1LTI D;  1GXD C;  3MXN A;  4HAE A;  2XN9 C;  3UI2 A;  4M1U B;  2F0L A;  2B2W A;  1SNC A;  2Y0S B;  4K2L A;  3GTP B;  2RA4 A;  2OF1 A;  4DFA A;  5AFW A;  2AUJ D;  4RH6 A;  1R4P B;  1SJH D;  1TS3 A;  2EYJ A;  1RD9 D;  1H9S B;  1LLR D;  2EJG C;  1CZG A;  2NN6 G;  5EKI A;  1F9S A;  1XXG A;  1D6E C;  2Z8L A;  5HUR A;  2XRS D;  3H94 A;  4O42 A;  1LAB A;  1EWH A;  1KDA A;  1RJT A;  1GUS A;  2B8G A;  4DAY A;  4UDU C;  1QIL A;  3ND8 A;  1EOT A;  1F2Y A;  4FYD A;  2LFN A;  2F0F A;  4IFD H;  1HCZ A;  1DOM A;  5CBE E;  2LS0 1;  5E3F A;  3MEH A;  2FHT A;  4FXK C;  4NKL A;  1A2U A;  1SYE A;  5CC4 A;  5I2Y A;  1TT2 A;  1X3P A;  5K5P A;  3FPP A;  3MVV A;  4C1N I;  4Q0F A;  2PW7 A;  4G7Z C;  3K5N A;  3GO5 A;  2F0H A;  2EE1 A;  1B4O A;  2ICE C;  3MHB A;  2EYL A;  4LK1 C;  5M5X B;  1A6X A;  2PO4 A;  2AQ3 B;  4R8I A;  2E2H B;  3A55 A;  3T16 A;  1SYC A;  1GOZ A;  2AUK A;  3P20 A;  3PIP 3;  2H4O A;  3Q0A A;  2F0D A;  1I4G A;  3URY A;  3E0J A;  2B2W C;  3H6M A;  1VDZ A;  3L7Z C;  1SEB D;  4ZAI A;  2EYH A;  3VR6 A;  4IUV A;  1CI3 M;  2PPB C;  2JA6 B;  1WD0 A;  1ESR A;  1JOQ A;  4Z9C B;  1H9K A;  5IGB A;  5EPK A;  2RSN A;  3U9S A;  3K0Y A;  1HUN A;  4IFD G;  2R3Z A;  4BWG B;  4FVM A;  3BDC A;  3BS1 A;  1BOS A;  1NAP A;  1R9T B;  2WAQ B;  5FLX L;  5HGT A;  3TZD A;  1F77 A;  4WJW A;  1M4V A;  5EQ0 A;  2EOT A;  1QWY A;  4IUN A;  4IFD J;  1I4H A;  1II3 A;  3FKI B;  5C4Z A;  4LJZ C;  3GD7 A;  2K05 A;  2LMC B;  2VXW A;  1OXS C;  2K7V A;  1JB3 A;  3TDQ A;  2QIL A;  4OHJ A;  2O5J C;  1ONL A;  1U4R A;  3VR5 A;  1JQY D;  3DUZ A;  1G6Z A;  2WV6 D;  3HOW B;  1O80 A;  2MUY A;  2KJX A;  3HKZ B;  1YNJ C;  2ZXP A;  2OEO A;  4K14 A;  2M2L A;  3IFT A;  2A6E D;  1PFB A;  5BN3 A;  3KLS X;  4J6H A;  3D6W A;  4HCE A;  1JR0 D;  1EYA A;  4OO1 H;  1OXV A;  5CR3 A;  1PLF A;  2F0S A;  2B2U A;  1OO9 B;  4FF1 A;  1QNU A;  3I72 A;  4Y7N B;  2A69 D;  4GZY C;  3SK5 A;  2NVQ B;  4RFB A;  2TMP A;  1O78 A;  1PYW D;  1LO5 D;  2R93 B;  1RKN A;  3C2P A;  1CQV A;  1Y1V B;  3NTI A;  1WTQ A;  2CW0 C;  1T5X D;  2FIN B;  1TY2 A;  3CKI B;  5M3M B;  1C48 A;  5FO7 B;  3M3Y B;  4H7B A;  1EYC A;  5KRU A;  2EY5 A;  3NTK A;  3DWQ A;  1DOK A;  3NQT A;  3PUW A;  4KJO A;  3VA7 A;  4FXG C;  1WTO A;  4BS9 A;  1ENC A;  1ILQ A;  4CKC A;  2XVS A;  3SK8 A;  1U4L A;  3D4D A;  1V1O A;  3D8G A;  1TQO A;  2IX1 A;  3GTG B;  1STE A;  4XYO A;  3HP3 A;  5C3E B;  2L0C A;  3AB9 A;  2E74 C;  5KYL A;  4OO1 G;  3S1R B;  3T4A C;  2AWO A;  3I73 A;  2K03 A;  4DK0 A;  1JCK B;  5KNC A;  2K5W A;  1B44 D;  4XDX A;  2K28 A;  4N9P A;  2A5H A;  5KEE A;  1HFN A;  1YNN C;  5G3L D;  1DCZ A;  2DY8 A;  2L4N A;  2R61 A;  3NP8 A;  5E4W C;  4OIJ A;  1SFO B;  3CQZ B;  2XWJ B;  4K8J A;  4ZKB B;  5C4X B;  1TR5 A;  5IT9 E;  1EY0 A;  4NMZ A;  1FNU A;  2YU9 B;  5JEA H;  1A15 A;  2QDB A;  4XTC S;  3KUP A;  1J8I A;  4G7H C;  2ID0 A;  2DNE A;  3TP8 A;  4HMJ A;  1CK1 A;  3NE5 B;  4CGY B;  2BE5 C;  4A3I B;  2B2U C;  3GTM B;  4IUU A;  2KOL A;  5JPM C;  1D5M C;  4A3J B;  1B3A A;  1JC7 A;  2K33 A;  2JXM B;  1NR4 A;  1A2T A;  4CKE A;  1GUG A;  1VF5 C;  2MHV A;  3JAM E;  2KQ3 A;  4DAV A;  1DON A;  1BCP B;  1LT3 D;  1EFI D;  4PMC A;  1TWC B;  2IX0 A;  3S1M B;  2F0Q A;  4CBV A;  5CV4 A;  5CV7 A;  1PDQ A;  3J81 E;  2WII B;  2I46 A;  4U68 A;  1EZ8 A;  1QB5 D;  2H1E A;  1PTO C;  2Z4I A;  2O5I C;  4KI0 A;  3LNN A;  4UAI A;  5JEA G;  4A3B B;  1E2V A;  4RWS C;  4C1N K;  5C5M A;  4V0B A;  2KHS A;  2BA0 A;  4ZRZ A;  5I6W A;  1SDF A;  5D3I B;  3KBG A;  3MWY W;  4ME5 A;  2EPB A;  1BQQ T;  1SE3 A;  3SK6 A;  5JEA J;  2HUG A;  1DD2 A;  3HZX A;  1BCP F;  1TWF B;  3K5O A;  2EDG A;  2A68 D;  2OT2 A;  1EQT A;  3BVM A;  4CHT B;  1K83 B;  3S1N B;  5C0X H;  2O2L D;  2HQE A;  1CA6 A;  4G7O C;  1QG7 A;  5M5Y B;  5COY A;  4XQQ A;  5KIX A;  3PUV A;  1NSN S;  5I2X A;  4PQX A;  3U9O A;  3C3L A;  1S5B D;  1A3U A;  1D5X C;  3KBX A;  5C3X A;  4QMG A;  2E76 C;  2HCC A;  1FNW A;  3A54 A;  3E6Z X;  2SEB D;  4M8A A;  4KKT A;  2IL8 A;  1J9O A;  4HSP A;  5I4D A;  3MFG A;  4RHR A;  4CKB A;  5ELB A;  5I6Y A;  1A3T A;  1EY7 A;  2PMZ B;  3S1Q B;  1K8O A;  1FYC A;  4C3I B;  3LX0 A;  4C56 C;  2L12 A;  1EIH A;  4CJ0 B;  4BA1 I;  5JAV A;  5C0X G;  1JE4 A;  5I9P A;  3GTQ B;  3CRK C;  2EYO A;  1TS2 A;  4BY1 B;  2E75 C;  1PFN A;  2KUM A;  2BCO A;  1AEX A;  3QJY A;  4E6I A;  1I3Q B;  1RCV D;  5C0X J;  4RGO S;  5TSS A;  5JVG 3;  4EGV A;  1LTT D;  1IYV A;  2F3V A;  5D3D A;  1EY6 A;  1EY4 A;  3SK4 A;  1OXX K;  4L6T B;  3AU7 A;  3WDN A;  3Q24 A;  1LTS D;  1ET6 A;  4XIG S;  3VR4 A;  4S3S A;  3V05 A;  1ICW A;  3I4L A;  3A7A B;  3ERO A;  4WOR A;  1DM0 B;  3ND9 A;  3QOL A;  3BDL A;  1CA5 A;  2YYZ A;  2NB0 A;  4K5X A;  5EKL A;  2B63 B;  1K8M A;  5M3F B;  2Q8I B;  3A8J E;  4OL7 A;  3OSO A;  4QF4 A;  3A8K E;  2EYF A;  2FJ2 A;  1S5D D;  4JK1 C;  1STH A;  1CM9 A;  1H9S A;  3RZO B;  2AQ1 B;  1CHQ D;  2NWG A;  4C3J G;  1CZW A;  4R8N A;  2R7Z B;  2RSO A;  4ULL A;  1WD1 A;  1TU2 B;  5CGK A;  2E2I B;  3FMC A;  1OXT A;  2KA7 A;  3OIP A;  3SEB A;  3BVZ A;  2CVR A;  3M4Y A;  2V4D A;  5JOB A;  1ZEQ X;  4Q5V A;  3NBI A;  4KMU C;  4XQJ A;  2B2Y A;  2O4X A;  2RQX A;  1AN8 A;  3HOZ B;  4QUF A;  2PZW A;  3OMC A;  2ZXO A;  1EEI D;  2IT1 A;  3T13 A;  4WFN 3;  3H0G B;  3SR1 A;  2RKS A;  5C5L A;  1ZXT A;  5BN5 A;  1OXU A;  3MFY A;  1GJX A;  3MAQ A;  1Q90 A;  1SMY C;  3V2T A;  1XWE A;  3NQI A;  1MD2 D;  2D5D A;  2Z4H A;  4HTH A;  4ZYS A;  1KNA A;  3R8B A;  1HTP A;  1BR9 A;  4NP5 A;  5D14 A;  5EJW A;  3VYU A;  1LTB D;  1Q1B A;  3A7L A;  1ILP A;  1E2W A;  3NK9 A;  4K2K A;  4H44 C;  1JOO A;  3P7J A;  1L0X B;  1PFM A;  1FR3 A;  5KYI A;  1KDC A;  3OWE B;  1GHK A;  1IKL A;  1QE6 A;  5A2Q E;  2SOB A;  1QNK A;  1PTO H;  1ZYR C;  2EJM A;  3I4M B;  2TSS A;  5LHY 1;  5FO8 B;  3TN2 A;  2QKI C;  3DXJ C;  1JIC A;  3IL8 A;  4KJN A;  1SE2 A;  1HTL D;  1JWU D;  3PUZ A;  1KNE A;  1JOR A;  4KKU A;  4IUT A;  3NSW A;  1HRJ A;  4DAP A;  2J7Z A;  2PCF B;  2B2Y C;  3W2D A;  2X69 A;  5DNF A;  2M9V A;  2VUM B;  5KNB A;  3ONA B;  1AW7 A;  4I65 A;  5NUC A;  1AZP A;  4IUR A;  4V19 0;  1BF4 A;  1RDP D;  2F0J A;  5DM7 3;  2JEA I;  3K5M A;  4RHS A;  1KAA A;  3D4R A;  3QOJ A;  1O7Z A;  4ID6 A;  3TP7 A;  1V1P B;  4DN4 M;  2F1M A;  1GUW A;  1TVX A;  1WTV A;  3EA6 A;  3S16 B;  1Y8O B;  2BA1 A;  3PO3 B;  4DXF A;  3TP5 A;  3K6O A;  2E2J B;  4ZQ3 A;  1STY A;  4KV6 A;  3M85 A;  4IFD I;  1KLU D;  2KED A;  4TRD A;  3EQL C;  3VA5 A;  1LTA D;  4DK1 A;  3LWU A;  3FRP B;  2F0T A;  5ELF A;  4IN3 A;  1HFG A;  4RGT A;  1HHV A;  5IGD A;  2MPM A;  5J1Z A;  1BUV T;  2HDL A;  1PRT C;  3M7N A;  4IQZ A;  3MXP A;  4XT3 B;  3S9W A;  1EQV A;  3HEJ A;  1STG A;  4FF3 A;  1I4X A;  3OIQ A;  3WOE A;  3SVM A;  3NPP A;  3OPO A;  1R4Q B;  2JA8 B;  1QOH A;  5DEH A;  4HN7 A;  3D31 A;  3HRZ C;  1Z7T A;  1G29 1;  4KY5 A;  5C4H A;  1B50 A;  4IAL A;  3BZD B;  1I4R A;  2JSO A;  2F0P A;  3MXG A;  1SSO A;  1IW7 D;  5E4X A;  4FNF A;  1EL0 A;  4EQP A;  2RBM A;  4TKO B;  4XYQ A;  2K5D A;  1D1K A;  1F2Z A;  5EGT A;  1GUO A;  3K57 A;  2KEC A;  4C3H G;  4PV1 C;  2KCN A;  2IW3 A;  4A3K B;  4ZUJ A;  1F9Q A;  1BCP D;  2K5Q A;  2B2V A;  1KTK A;  1I50 B;  4A3G B;  2N88 A;  3E5S A;  2GA4 B;  3TZU A;  4KD3 A;  1D2B A;  3CHB D;  1AP0 A;  1L0Y B;  2XIW A;  4A93 B;  2DN8 A;  1UEA B;  5M9O A;  2L1B A;  1HA5 A;  2VNU D;  1UUP A;  1RTN A;  4N9T A;  4RGN A;  4FF4 A;  4KD4 A;  1PXU A;  3FVQ A;  1WTR A;  2SNS A;  3DEO A;  2X6L A;  4HR7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...