1CHQD

Surprising leads for a cholera toxin receptor binding antagonist; crystallographic studies of ctb mutants
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKDEMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Surprising leads for a cholera toxin receptor-binding antagonist: crystallographic studies of CTB mutants.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
molecule keywords CHOLERA TOXIN B PENTAMER
total genus 22
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1995-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1chqD00
1LTID 3W2DA 3BVZA 1BCPC 1XTCD 2IJ0A 2R61A 1DJRD 1ENFA 1KTKA 1CHQD 1D5XC 1BXTA 1PZJD 5FKAC 3R2IA 1GOZA 1TS5A 2RDHA 1LT5D 1ET6A 1TY2A 1LT4D 4L63B 1L0YB 1LTGD 1KLUD 3OWEB 5ELEA 5D3DA 1S5CD 1UNSA 4UDUC 4RGOS 1LTAD 2ICIA 3BZDB 1PZID 1S5FD 1CK1A 1V1OA 1HTLD 3BYYB 1S5BD 1HA5A 3O13A 2O2LD 3URYA 1EWCA 1XXGA 1FNWA 1I4HA 1V1PA 1ESFA 1PTOC 1PTOB 1BCPB 1V1PB 2XN9C 3BVMA 1CHPD 1I4QA 1RDPD 3BVGA 1EEFD 5ELDA 1LTSD 1HXYD 1JQYD 3R2TA 1EU3A 1FGBD 1LTTD 1SEBD 5ELBA 1KLGD 4DXFA 1CQVA 1PTOH 3SEBA 1SE4A 3MC0B 1MD2D 4C56C 4Z9CB 1I4PA 1JCKB 2QILA 1JWMD 1PRTB 1DYQA 1FNUA 1S5DD 1SJED 2RDGA 2AQ2B 3V05A 1LTBD 1QILA 2WV6D 1D5MC 3DWPA 1EEID 1I4XA 3DWQA 4RFBA 1FNVA 1JWUD 3DWAA 1TS3A 2NTSA 5I4DA 5TSSA 3R8BA 1S5ED 1SE2A 1ET9A 1I4GA 1LT3D 3EFXD 4RGTA 4TSSA 5ELCA 2XNAC 2SEBD 1HQRD 1STEA 1T5XD 4K6LA 1TS4A 3MFGA 4BWGB 1I4RA 3CHBD 3KLSX 1TY0A 1PRTF 2Z8LA 1UUPA 1EFID 4RH6A 2NTTA 1LT6D 3EA6A 4ZYSA 1M4VA 2IPKD 1L0XB 3GP7A 1BCPD 1JWSD 4OHJA 1LO5D 1LTRD 1CT1D 1FD7D 4O1NA 2AQ1B 2TSSA 1EU4A 2XRQD 1G8ZD 1B44D 2XRSD 1PZKD 1PTOD 1JR0D 1PRTC 1F77A 1SXTA 3BYTB 4RGMA 1B1ZA 1BCPF 1AN8A 1TS2A 1D6EC 5ELFA 2J4XA 1RCVD 2QEJC 4L6TB 5D3IB 1PYWD 5FK9C 3TSSA 4RGNA 1D5ZC 2CHBD 1PRTD 2G9HD 1LLRD 1SE3A 1PTOF 4RCOA 1RD9D 4DXGA 1AW7A 1RF2D 4RHSA 1SJHD 4RHRA 2AQ3B 1SBBB
chains in the Genus database with same CATH superfamily
2ZXRA 3CAMA 1YJNA 4BY1H 5EPLA 2UUBL 1IW7C 2EDGA 3I4MG 2VNUD 1H9KA 1G91A 2F0KA 5A2QL 4DK3C 1VQ7A 1PZJD 4HJ8A 1I6HH 4IALA 5T1GA 2NUCA 1A3UA 2Q2IA 1LT4D 4IFDH 3T1HQ 3OWEB 5JPMC 1MIUA 4BXXH 5CV8A 1VMPA 3CPFA 4G7OC 4C3JH 1SNQA 2H1EA 1XPOA 3EIVA 5KYIA 4UPAA 2JA6H 2KCTA 3T53B 3VDYA 4EQOA 2O2LD 1WTPA 1J5EL 4A3GB 2B2TC 4AYBG 5C3EB 3H0GH 5IGEA 4ZUJA 4EQNA 3TRZA 2RVLA 4PZ8A 1B3QA 3D4DA 4PV1C 4X3TA 1ESRA 3HOVB 1E2ZA 3PF5A 2A68D 4GLAC 2YU9H 3GTGH 1F2YA 1G6ZA 2MUYA 1SYCA 4XT1B 1JMCA 3KDFA 3CCUA 4HIKA 1H9SB 4K5WA 2E2HH 2O4XA 2BDOA 3DXJC 3K80C 4A3EH 4A3IB 1T5EA 1YIJA 4JI3Q 2EY2A 1XJVA 1PA6A 3EQLC 4KY6A 4RCNA 4JBMA 1B70B 1I4GA 5ELCA 2R92H 1RIPA 2EXZA 3CQZH 4QJFA 4GNXC 1PYSB 3KLSX 1D2BA 3JAME 2QGQA 1ZYRC 4N8FA 3J7AF 3PO2H 5T1IA 2Q2TA 3EA6A 1KNAA 1B53A 1N33L 1G51A 3RZDH 4JI3L 1UE7A 1Q3LA 3IFDA 3NK9A 3CXCA 1E24A 1TR5A 3CP0A 3GD7A 3BU2A 4GKKQ 1F2LA 3TP7A 4FF3A 3MEHA 3U9SA 4DR3L 4C3IG 2F03A 5D14A 4A3EB 4JBKA 2NVTB 2HUGA 1Q12A 4V190 3PUZA 1O78A 3H15A 4KKSA 2QW7A 2Z0SA 5IODA 1WFQA 4A3CG 1TIID 4DV6Q 5GAGC 3STBC 1KNEA 2KJXA 4A93G 3HZXA 4K6DA 2QF7A 3TP6A 3TN2A 3ULLA 3ONAB 4OXPA 3Q22A 3J7A5 1ET6A 1IL2A 2CCZA 2D5DA 2VQEL 3VR4A 1NR2A 5IYBG 2GVBA 5E3FA 1DONA 1SYGA 1V1OA 4H02A 3K8AA 2J7ZA 3OIQA 1VQOA 2B2WA 3KUPA 1NBWA 1DM0B 1K73C 2P5ZX 1PTOC 4WJ3M 2CW0D 1WI5A 4IPCA 1S3OA 4GOPB 4A3BH 3D6WA 1IYUA 4KY5A 3A0JA 1WOCA 4CJ2C 5EKKA 2Z1CA 1EU3A 1NR4A 4POFA 1S40A 2VB2X 4ZKCB 4C3IH 1YBYA 4MTNA 4MZ9A 4OWXB 3BDCA 2NN6G 1J5EQ 1SNMA 1EQVA 1JCKB 4HCEA 4YWLA 1PFBA 3K7AH 2BCOA 1IYJB 2B2YA 1EYGA 1U4RA 2OF1A 1XNRL 2Y0SB 5CV4A 2WV6D 5EPJA 1E1OA 1EY6A 3I4LA 3UI2A 3PO3H 3S9WA 2IHEA 5E1FA 3M3YB 3FPPA 2KCMA 2F4VL 4X6AH 3X3MA 1HQRD 3EROA 3GTMH 1Q46A 3A5ZB 3NBIA 4I7AA 4RWSC 4C3HG 3HOWB 2Z8LA 4OL7A 2EJMA 3PCOB 5M5WH 2NTTA 1XMOL 5IGFA 2ZT9C 1M4VA 3A74A 3L3OC 2CH4W 1ENCA 3GV3A 2F0FA 5IT9L 1PYBA 4C3HH 2JE6I 3GQBA 5C44H 3NP8A 2BA0A 5IYDH 1A0IA 4DV7L 1ASZA 3AMUA 2CVRA 3NUCA 3S1RH 3T16A 2F0DA 1U4MA 2CWAA 4O0AA 2NYZD 1SFOH 4L6TB 2CH4A 1BUVT 4LF9L 2MNAA 3CMEA 4DXGA 1BO0A 4IPGA 3J81E 3MWYW 1H9SA 4DU9A 1MI2A 4QF4A 5M3MB 3T51B 4DV0Q 2L0CA 4DFAA 3CRKC 1QVCA 4X3SA 1UNSA 1YJ9A 5EBDA 2B2UC 1N9WA 3S16H 4C3HB 1VF7A 4HIOA 2F0NA 3TDQA 4DV4Q 5IE8A 1HTLD 1S5BD 4KD3A 1HA5A 1Q1BA 2RBMA 5J22A 3KFUA 1VQFA 1U5KA 3HKSA 3S1RB 1KL9A 3J80E 5M5XH 2EY6A 2UUBQ 4GNXA 2DY7A 3ITPA 4EQPA 1SSOA 1I4QA 1RDPD 1RODA 4L5TA 3F8TA 3IKJA 1E1TA 1T9HA 2MP1A 1FGBD 5ELBA 5C4JH 5ELNA 1Y8NB 1MD2D 2JP1A 4C56C 2VB3X 1U0LA 4FDBA 1IBLL 1ENAA 5LMNQ 3MEFA 3HOZH 1L1OC 5C0XJ 3F2DA 2K03A 4DUYQ 1IL8A 1EYDA 4KI0A 3F2CA 2RDGA 5JEAJ 3V05A 2EVBA 1HNXL 3S16B 3P1HA 3F2UA 4X62L 3ERSX 1JWUD 1TT2A 1WTWA 3K81C 4WRDA 4AQYQ 1LM0A 1PFNA 1SYBA 5LL6X 5IGDA 4ZCKA 5JJIA 5IP7G 1HZBA 3FMCA 4CKEA 5I9PA 1TS4A 5C4XG 3L7ZC 2Z6BA 3KF6B 2Q2HA 1MHWC 2TMPA 3SGIA 3DHQA 3MHBA 2DN8A 1YITA 1HNXQ 3CCQA 5IGBA 1GUNA 3PO2B 3TQYA 1X9NA 5DM63 3MXNB 3GTLH 4ODGA 3KJOA 1B1ZA 3UE1A 5M3FH 4OO1I 1OTCA 1V43A 2F4VQ 3Q24A 4K14A 4QIWE 1X6OA 5CC4A 1HZCA 1WD0A 1PTOF 2A74C 3I4OA 4UHVA 3CC2A 3EBEA 4RHSA 1SJHD 4RHRA 2CQOA 1WTXA 1STAA 3MVVA 5CV9A 3R93A 2I0QA 2EYPA 4TVAB 3CC4A 4DV2Q 1XTCD 4XQJA 2UUAL 3M4PA 1WTOA 3C2PA 3LNNA 3SK8A 2NVXH 1ILPA 1GOZA 1TS5A 3FPUB 1TWGH 5FLXE 5C3WA 4HSVA 4L63B 4DV5Q 4BY7H 4ALPA 1YZ6A 3I56A 3I4MB 2WINB 1JOKA 1GUTA 2L15A 3DM1A 3A56A 2ZTDA 1QG7A 3S1NB 4FF1A 2AUJD 4XQNA 1STYA 4DK1A 3H3VH 1VDZA 3QB3A 2ZXPA 1ESFA 3EVQA 3MTSA 1CKMA 5IP7H 4JI1Q 4ME3A 1GUOA 4YY3Q 4FO2A 1Q1EA 2QEXA 2ATWA 3I4NB 1MJCA 4A3IG 1UE1A 4IPDA 2R7FA 4DR5L 1XMQQ 2NVXB 1BKBA 2K75A 1FJGL 2IWHA 1RTNA 2KHJA 4HJAA 1K83B 3K5OA 1LTBD 3BZKA 1AEXA 3DWQA 4A93H 4B3TL 4XYQA 2R7DA 4EQ5A 2RHSB 3S1NH 2F0PA 1II3A 2LS01 3FRPB 1GJXA 4DR5Q 3A5UA 4G57A 3GTJB 4AH6A 1PH2A 1JORA 1VQGA 3S14H 1Y1VH 4GN3B 3SK5A 4BBRH 3GP7A 3M4OH 4OHJA 1LO5D 3A54A 5M5WB 2KBNA 3PUXA 4DNTB 3I4NH 4IFDI 1R9TB 2MHVA 3HOXB 3D3RA 1BVSA 4NKLA 2E2IB 2H5XA 2R6GA 1JR0D 2PQEA 3L2PA 3CCVA 1YHQA 5DLQE 2Q8TA 3Q8DA 2V4DA 2ENBA 4ZAIA 5A2QE 5IWAL 4R4IA 2EYFA 2CW0C 4ZQ3A 4A3FG 4TKOB 4IUTA 3NENA 1QZHA 4JW0A 3GO5A 3KBGA 4K8JA 3QOLA 2I5MX 1HPCA 2PW5A 3D31A 2UXCQ 3H6MA 3RZOH 1Y1WB 3W5OA 1BXTA 1STGA 1ML0D 1L0YB 2K28A 3OW2A 2VY3A 3U4ZA 5M3MH 4PG3A 2WAQE 4KHPQ 2F1MA 3AFQA 3ULPA 1TKWB 1CUKA 4G4KA 3E6ZX 3N52A 3L0OA 1KRTA 4DR4Q 3QJYA 1CHPD 1O80A 2HQLA 2R93B 3GTPB 4DAYB 1YJWA 1QZGA 2DNEA 3JAMc 4LF6Q 2F3IA 3MC0B 1CZGA 1EWIA 1IZ6A 4NW2A 4ZRZA 1I4PA 5A35A 4XQQA 3H3VI 4A3LG 1TWFH 4J1MA 5JPNC 5LMUQ 4DR2L 5IYCH 3HOVH 4P71A 3A8JE 1VQEA 1HUMA 5C4HA 1X3FA 1EEID 4B3TQ 3HP3A 5BN5A 5GADC 3B6YA 2RDFA 2Q2UA 1XPUA 5ISRA 3LGJA 3R8BA 3OW7A 3PSIA 2Z6KC 5JJZA 3A7AB 3CCLA 4EVOA 4IO9A 3CHBD 2OTJA 3M85A 3KLRA 2KCCA 2JA5H 1F9RA 5CBAE 3GDEA 3OMCA 4CGYB 1X54A 1CKOA 1C0AA 1EU4A 2XWJB 4OIJA 1DOMA 2HHHL 4A3DG 4LFAL 2L1BA 5EJWA 2X69A 3HKZG 5EGTA 1BBUA 5C3EG 5FK9C 3VYTA 4YHHL 1QE6A 1CQFA 3CCSA 3BJUA 1VQIA 1HNWL 1BF4A 4X65L 4O42A 2JA6G 2KQ3A 1NAPA 2AQ3B 4QQBX 1B4OA 5FLMH 5C4XH 5L37A 5C3EH 5C44B 1I3QH 3RUZA 2PO4A 3K7AB 1NCVA 1CHQD 2OQKA 2OWOA 1LT5D 1UE5A 1CZWA 4MIUA 2UUCL 3PO3B 1Q86C 2RSNA 1XNRQ 4DAPA 5C0XH 4KJOA 2XSCA 4A3FH 1VQ5A 1GM5A 1QUQB 3T4AC 2XIWA 3S24A 2JA6B 4Y52H 1VQDA 1X56A 3TS2A 2PPBC 4P75A 5M5YH 4YWMA 3VR5A 1H9MA 1EEFD 2WAQB 4HSPA 1VQMA 4GOPA 5KNCA 1N36L 4DAVA 2RCNA 4IUPA 4S3SA 3F2BA 3S1MB 1XNQQ 1XMQL 2E76C 3SEBA 4ZLTF 3A55A 2F0HA 1STHA 3ULJA 2B63B 1JWMD 2E2JB 1JT8A 1FNUA 2N78A 4DV4L 2JA8H 1F2MA 3S2DB 1HJPA 3DWAA 3HOXG 5I9OA 2B2VA 4R1JA 4OWWB 2R3ZA 3HFZB 1PH5A 3KLSA 4TSSA 2IX1A 4A93B 4F87A 3KDFB 1I4RA 1LABA 3K5LA 4CHTB 1UUPA 1EFID 3NTHA 2A6HD 3HOZB 4BA2I 2Z4HA 1Z47A 4PMBA 2FXQA 1TWAB 4DNRB 3HOWH 4IPHA 3RZDB 4K2LA 1JJ2A 2MO0A 4KKTA 3U50C 2AWOA 3J81L 1EOVA 5IGCA 4R4CA 3PQIA 2VUMG 2ZJQA 5DNFA 4LF7L 3U58A 2CFMA 2IL8A 2VQEQ 1JB3A 5M9OA 1SAPA 1GD7A 2Y0SE 3RR5A 1B50A 1GHJA 4AIMA 2JYOA 1A2TA 2KOLA 2KHIA 4LF8L 1VQPA 4FF2A 3R2IA 2B2WC 3J7AV 5EAYA 4FXDA 1Y1WH 1KHIA 1CTMA 1WTVA 5GQOA 1IBMQ 3I90A 4HMJA 1Y1VG 4LFCL 1NY4A 3HKZB 2RA4A 3BG3A 1V1PA 4NXNQ 3TP5A 4JI4L 1GKHA 3CCEA 3K59A 2F0JA 1U9RA 2MPMA 2CWPA 4DV1Q 3J80i 1K0RA 4HTHA 2E5LL 3S17H 3QIAA 2L55A 3HGBA 3HKZE 4DXFA 4DR7L 2WB1B 2EPBA 1VMCA 1SNCA 3H94A 1TQOA 2UU9L 1CA5A 1NNXA 4GLXA 1YNJD 1SYDA 1PMRA 1PRTB 3K0XA 4DV2L 2IT1A 1N36Q 4A3MB 2HD3A 3FKIH 2HIVA 2K05A 2IW3A 1GVPA 4NP5A 4XTCS 2NTSA 4CBVA 5I4DA 1SE2A 1IHZA 2GA4B 1KDAA 3J7ZC 4K6LA 4R4QA 1PH6A 4NXML 4OIKA 3G71A 1GUGA 1E22A 1SNDA 3GTOH 4AQYL 2PNRC 2JN4A 4C3JB 1WVLA 1C48A 4KKUA 4XIGS 4IJLA 3JC66 3CPWA 2AQ1B 2TSSA 1YNNC 1Q90A 4OWTB 4B3SL 1OXSC 3MXGA 3M9BA 1HTPA 1HNZL 5E4XA 1AH9A 1PRTC 2BA1A 4H0LC 5C4ZA 1C8CA 3ERQA 3AQQA 4DKAC 1UWVA 2DJGC 2HCIA 3A7LA 3KYHC 4DV6L 1HR0W 4A3BG 1Z9FA 1OXTA 2SNSA 3Q23A 3A8IE 1AE3A 1TWAH 4WORA 1PYWD 4A3MH 3UDIA 2VUMB 1D5ZC 3SDZA 2B2VC 1ASYA 1HH2P 2K33A 5JEAH 1V9PA 3GTPH 1AW7A 1ICWA 2FMMA 2XWBB 1N34Q 1IBKL 4LW1A 4A3MG 4F88A 2LMCB 4K2KA 3ND9A 1DJRD 1ENFA 2OCEA 1Q7YC 3D0FA 3VR2A 4PZ7A 3DLLA 2KVMA 4OO1G 5ELEA 1IKLA 1WJJA 4YHHQ 3BZDB 4DR3Q 2KHSA 3VYRA 1HQMC 4HIDA 2ZJRA 4ID6A 4MHEA 4X3KA 4JI4Q 4JI5L 3OMGA 2L9HA 1FVIA 1ONLA 1PTOB 2EY1A 4RKLA 4ILWA 1N32L 4DR1L 1SN8A 1X32A 5COYA 3HOXH 1SEBD 2K6AA 1I6HB 2K52A 3F1ZA 5FJ8H 3GTKH 1GHKA 3BZCA 3H09A 2QILA 4DNIA 4P2CB 1PHJA 3MA2B 2I5LX 3DM3A 3W1BA 4Q5VA 3UDXA 2NN6H 1W2BA 3EJIA 4BXXG 1ILQA 2XVSA 2K5DA 4L8JA 5FLMG 1L1OB 3VR6A 5H1SE 1NSNS 3I55A 3K5MA 3TBIB 4DK0A 3CCMA 1ET9A 3RLFA 2D2CC 3D4RA 4DR2Q 1WTQA 2NZ1D 2HIXA 2F0UA 4I7ZC 2E8GA 3NWSA 1I3QB 2GVAA 1TY0A 1OO9B 3OOCA 3Q6SA 1SFOB 2E2HB 3HG9A 4JI0Q 1EY8A 2AKWB 4JI7L 3PIO3 1E7ZA 3HOWG 1PVOA 3FKIG 3GTJH 4GN4B 1EQRA 1B7YB 3OYYA 3CC7A 1HUNA 2XRSD 1J8IA 1TWCB 1J9OA 1SXTA 1GO3E 2EY5A 2J0TD 2A8VA 2DJFC 1SMYC 1VQCA 5C44G 3KK7A 2JA7H 4KHPL 2CHBD 2NBFA 2HQEA 2R92B 1NE3A 2PQAB 2IX0A 3HS0C 4RCOA 1AZPA 4ZKBB 3JAMi 4DAMA 1CKNA 2NVYB 5I6WA 1TVXA 1KDCA 3AB9A 2EJGC 2PZWA 4PZ6A 3I8ZA 1SNPA 3CU7A 5AJ3Q 2O5JC 2E2DC 3PGZA 5CGKA 3S2HB 4DK6C 2A69D 2VQFL 3ZYYX 1EOTA 3A8KE 1EFWA 4LF6L 5KRUA 2YU9B 4JI1L 3GTGB 1QCBD 2YV5A 3HOYG 3M3YH 4UP9A 1PZID 1S5FD 5NUCA 1H95A 3E0EA 2G5DA 3KBXA 4LUVA 1XTDA 2D62A 1LACA 4C2MB 3GTQH 5G3LD 4TQUS 1I4HA 1O7LA 4JOIC 4KN4C 4QGUA 2XN9C 2K5HA 1PH1A 1HR0Q 1K8GA 1HXYD 1LTTD 4DAYA 2E74C 4KLKA 4CDFC 1CQVA 1AZQA 1LUZA 2K5QA 1SYFA 3I3CA 4B9XA 1N8RC 1DD2A 3BS1A 1NMFA 1A3TA 2QKIC 2QCPX 4YY3L 3NBHA 1KD1C 4L5RC 4A3DH 2L12A 1KAAA 3SR1A 3H0GB 3U9OA 2F0MA 4LUOA 2JJQA 5JOBA 1Q82C 3K57A 2JQOA 1QNUA 3E5SA 4KHZA 3G6JB 4QL5A 3LWUA 1STEA 3AEVA 4DV0L 4FVMA 2FFKB 4K5VA 5FJ8G 1EYCA 4IQZA 2UU9Q 2K7VA 4DPGA 1O7IA 3NSWA 3S15B 2B2UA 1X55A 2C9OA 1LT6D 5LMNW 4DV5L 3IFTA 4RAUC 3P75A 4JI6Q 3PV0A 1IYVA 4MTKA 3KOJA 3H91A 3G4SA 4GN5A 3I4NG 4BBRB 5HGTA 4BY1B 4BY7B 5CMDA 1PTOD 4GLVB 3BDOA 1J6QA 3T1YL 4RGMA 1NJIC 1BCPF 4N9PA 4LK1C 5E4WC 3NTIA 1AE2A 2A68C 4A3LH 5J39A 2E2IH 2AWNA 1M1KC 3FHWA 3TSSA 1M90C 4JI8L 2EYOA 4V0BA 4BBSG 4NMZA 3N6RA 2LFNA 3PF4A 1VQ4A 1RKNA 3QR8A 3SK4A 1E0BA 4J8QA 4LUZA 3J81j 3GV6A 1BCPC 1HCZA 3H0GG 3RD4A 1EIGA 1S72A 4DA2A 4A3GH 1SDFA 2WFWA 3T1YQ 1HFGA 4WFN3 2RDHA 2X6GA 2RKSA 1LV9A 4K0KL 2AUKA 4JI5Q 1YEZA 4IFDG 4LFBQ 1A62A 2BH8A 1QUQA 2IX3A 2A6ED 4OX9L 2VXWA 4CJ0B 3QO2A 4RA8A 4X66L 4X64Q 1W6JA 3BVMA 4BY1G 3C3LA 1SMXA 3BVGA 5EKLA 4C2MH 3MAQA 1FJGQ 4HIMA 4CDDC 1C7YA 2XTIA 5DM73 3OTOL 1JC7A 1ZYRD 4R9WA 3M4OB 4BBSB 3QOJA 5IT9c 3DEPA 1FYCA 5FO7B 3M7GA 4IUVA 1A2UA 5JEAG 1PH3A 3S1MH 1RTOA 3CD6A 1PXUA 2E5LQ 2N3SA 2PQAA 3QG1A 2UUCQ 3DWPA 1I4XA 3MXPA 1JB7A 1H9JA 4IFDJ 4DR1Q 1ZXTA 5CYUA 5LL6S 1QOHA 3HOUH 2K32A 2CQAA 1JE4A 1EWHA 2PZUA 5CBEE 3CMAA 3DUZA 3D8GA 4Y7NH 3OSOA 1LYLA 5K36H 4KD4A 2WACA 5K5PA 3OHXC 5EKIA 1IW7D 2D0PA 2VQFQ 2YYZA 4QB4A 4LF8Q 4X64L 3D4WA 1K8AC 1DZ1A 4IUQA 4BY7G 1L2FA 1X3EA 4ZK9B 5JJKA 3W3AA 1FR3A 5D65A 5JVG3 1KRSA 3RZOB 3CKIB 4CKBA 4RG1A 3FVQA 4JOIA 4GNXB 1KABA 4JI0L 4ZUIA 3HOYB 2NN6I 4QUFA 1HR0L 3ND8A 1EQQA 2RHQB 4AYBB 3NE5B 1SLJA 3GTKB 4NDXA 2HDLA 2R61A 3CQZB 3ZJYC 3NBHB 2JEBI 1D5XC 1K83H 2K5VA 1KXLA 5J1ZA 3S1QH 1LTGD 1KLUD 1JICA 3J80L 3PO3G 2JXMB 4DR6Q 1G291 2KA7A 2VL6A 4DR7Q 5C5LA 2PMZE 4DN4M 5JAVA 4RGOS 4QIWB 1B9MA 4YCUA 4JC0A 4IZ8A 4IURA 2Z4IA 4A3FB 1Q81C 3C1EA 1JJGA 2MQHA 1IBML 1V1PB 4A3IH 5KNBA 2QDLA 4LJZC 1D7QA 2A5HA 2LXJA 4DR6L 1I5FA 2ICEC 1MJEA 3R2TA 4YCWA 1A6XA 3RMHA 2A6HC 3R3OA 1K3RA 2ZJPA 1KQSA 2F0OA 4UY8C 4JK1C 2EQSA 5CV6A 1DXMA 2PZTA 1L0WA 3CW2C 1CI3M 1D5MC 4RFBA 4FXGC 4OX9Q 3P20A 1S5ED 1LT3D 1CSQA 1E3PA 1PH4A 2RSOA 1Q8IA 3AU7A 1T5XD 1WTRA 1K9MC 4B3ML 1UAPA 2NVTH 2EYHA 1VQBA 4DV3Q 2K04A 2ZM6L 2YTVA 1BCPD 4L5QA 4O1NA 1G8ZD 5I2YA 2IHFA 1Y69U 1TXYA 1HRJA 1BBXC 4OO1H 4C3IB 1UE6A 4LNQA 3HOUG 2BE5D 5CR3A 2EYJA 4DGZA 4ULLA 3K5NA 2AMCB 4B3SQ 4LFBL 1D6EC 1MKHA 5HY6A 2QEJC 5D3IB 1BDOA 4C1NI 1V8QA 2A73B 2B3GA 1RD9D 1P16A 3PMFA 1DCZA 4DF7A 2Q8IB 3UE0A 3KF8B 4JI6L 3NQTA 2NWGA 3T1HL 3S14B 4XXEA 1EUJA 4JCVE 4U673 1ZEQX 2R92G 3OTOQ 5I2XA 1VQNA 4HCSA 1U4LA 1EY7A 5FKAC 2WB1E 2V1CC 3UDFA 1N33Q 5D3DA 1S5CD 1K3BC 1UEAB 2UXBQ 1TWHH 4A3JB 1YNJC 2L4NA 3G6EA 1LTAD 1VQLA 4KY7A 2F0LA 2K5NA 4HMIA 1HZAA 4P73A 4X66Q 3URYA 1JOOA 1HZ9A 2F0EA 5EBCA 4IOAA 3WOFA 1B8AA 1SNOA 3FEWX 3J81c 3PIP3 2OTLA 1Z6HA 2VS1A 3NWTA 4K8IA 5ELDA 5BR8L 1WD1A 1QVFA 2FINB 5HGQA 1K0SA 3S2HH 1JQYD 2EOTA 2WP8J 1JE5A 1AP0A 3PIOA 3EN2A 1PTOH 2ASBA 4JBWA 1YNXA 5FO9B 2EYLA 4YCVA 3S17B 1Y8PB 4KTAA 1U4PA 2KECA 3C46A 2ALYB 3OWFA 4IN3A 4A3BB 3RN5A 3E3XA 2AQ2B 2JK8A 4A3EG 3NELA 2N88A 1TWHB 1EIYB 3MZ5A 2OXPA 4YIJA 3AFPA 2A6EC 3K0YA 4CKCA 4JPBW 2B29A 1EZ8A 3RLNA 2WAQG 5IT9E 2SDFA 1YHAA 2EIFA 4B3MQ 1C9OA 1RHPA 3PUVA 2HHHQ 1EYAA 1SROA 5G3LF 5FOBB 4OONA 5C3XA 1SRUA 2PMZB 3E9HA 1HFNA 1LTLA 1DOLA 1EZ6A 5BN4A 5C0XI 3BDLA 1CT1D 1MBYA 2DUDA 1TWFB 3M7NA 5IP9G 2XRQD 4R4TA 1P8LA 4APVA 2RF4A 4KJNA 4H7BA 2LKVA 3I72A 2ZXOA 3HOZG 3GTQB 2B39A 1NUCA 1NTGA 2NZOA 5ELFA 1VS0A 1RCVD 1ICFB 2N55A 1QJOA 1D1IA 4H44C 4DV1L 1TWCH 5AFWA 1EY9A 5IYCG 3GTMB 1VQ6A 3I2ZA 5BN3A 1QWYA 4DUZL 4A3CH 1F9QA 1CKNB 1EIHA 4F8MA 1LTID 1TU2B 2KEEA 4G7ZC 2F52A 4IUUA 4GKKL 3W1GA 4JYAQ 3V2TA 3C1FA 4PQXA 3IL8A 2PI2A 2Y0SG 3DMUA 4UDUC 5IYBH 1BNZA 2JA7G 4A75A 1FGUA 1O7YA 1BOSA 1XMOQ 4I65A 4OEMB 3O13A 4DUYL 4N9TA 4HJ9A 3RN2A 5K36G 2F0WA 1FNWA 2K50A 4A3JH 1BCPB 1HNZQ 2N49A 2YTYA 4PMCA 1VQHA 4CDCC 1E2WA 3J81i 1SE8A 4QY7A 3I73A 5ELOA 3TREA 2ZM6Q 3MFYA 4LF4L 1B3AA 4G7HC 1XPRA 3RLOA 3KLWA 5EQ0A 2ID0A 5HURA 1WCMB 2JA8G 5KEEA 5IP9H 2NZHA 4WJ4A 3HOVG 4P72A 2R7ZB 3PO2G 3CRLC 2O5IC 1Y1VB 3WWVA 1HA6A 1QILA 2VZAA 4JI2L 1Y8OB 3TMEA 3L9AX 5M3FG 1PV4A 1K8MA 4M1UB 5JJLA 3SXHA 5TSSA 4R8IA 4FF4A 3EFXD 4QUCA 5I6YA 2A1AA 2Q8RE 4CDEC 2JA7B 2B2YC 5M3MG 1GUSA 1I94Q 2M9VA 3SHLA 2WKDA 4RMFA 4A76A 1HNWQ 1YVCA 2GN5A 3G48A 4EX5A 4KV6A 2K1BA 4YWKA 1I6VC 2WIIB 1E2VA 2EJFC 2F0IA 3FKIB 5DAUA 1B44D 3T56B 3SE0A 1PH7A 1AN8A 4GKJL 2PCFB 1PH9A 1TS2A 4JG2A 1EY0A 2J4XA 2BE5C 3I4MH 2I5HA 1PRTD 3K7UC 4HJ5A 3DEOA 1SE3A 2JA9A 4JV5L 1A3VA 1SMYD 4LF5L 3I7FA 4X3UA 2CKZB 1VQJA 2HDMA 1SBBB 2K5WA 1PDQA 3W2DA 3NXWA 3D6CA 1EY4A 5M3FB 3MXUA 5LHY1 3M4QA 3NPPA 5IY0A 1KDBA 1JJCB 5KGUA 3LWEA 2R93H 2B8GA 3CF5A 2VUMH 4OELB 1OXVA 2EE1A 5M5XB 1CSPA 3CCJA 3Q0AA 1H9RA 3BYYB 5KNDA 4KK7A 1F9PA 4MNOA 1FL0A 2JA5G 4L5SA 2DY8A 4B9WA 4C1NK 5CV7A 3GTOB 4QCLA 3ER0A 2UXDL 5KIXA 2D0OA 4A4IA 5IIFA 1PLFA 1EY5A 2EYMA 1KAWA 1I50H 4HN7A 4MN3A 1LTSD 3WDNA 3H3VC 2NVQB 4DV3L 1K28A 1WYDA 2HCCA 1A8VA 2OEOA 1QB5D 5KYLA 1PFSA 5GAEC 3VYSA 2F4IA 3KF6A 4KN7C 4TRDA 2RCFA 5CORA 1S5DD 1XWEA 4GOPC 1SJED 2JA5B 1A15A 3LX0A 2N8NA 3VR3A 1G2TA 1UEBA 1M8AA 3OIPA 2R7ZH 2FMCA 2KCNA 4RGTA 5IGGA 1QNKA 2Z9HA 5IYDG 1SYEA 1F9SA 1IBLQ 3VYUA 3T13A 2E75C 3K6OA 3NQIA 2B63G 1G2SA 3S1QB 4X65Q 4WJWA 4J6HA 3HOUB 4ZYSA 1G6PA 1CA6A 1XNQL 4JI2Q 3NTKA 1L0XB 4FXKC 4JI8Q 1DGSA 1IXRA 2F0QA 2LSSA 1WCMG 2JA8B 2ES2A 2NVYH 3I70A 4N8X1 1Z7TA 4PNYA 2K01A 3WOEA 2SNMA 5EPKA 4K5XA 1PZKD 2F0VA 1N34L 1IBKQ 2SOBA 4GKJQ 2JEAI 2DNCA 4KMUC 4A3KG 4FYDA 3QWNA 3HEJA 4RGNA 1ZKOA 4DUZQ 3M4YA 4K0KQ 2F3WA 2BDNA 3E0JA 1GUWA 4O2DA 4BA1I 4LWCA 4LAAA 5M5YB 1F2ZA 4KHVA 4A3JG 2IJ0A 1EL0A 4P74A 1KTKA 3J80c 1YNND 5GAHC 2HT1A 3NEMA 2ZTEA 2EZVA 4LF5Q 4POGA 1O7ZA 5FO8B 2KENA 2B63H 4H13C 2XGTA 1VQ8A 1W6KA 1PFMA 2WB1G 1CK1A 4BBRG 4NXNL 5JVH3 1MSGA 2UUAQ 2PYKA 3S2DH 1EWCA 1X3QA 1QVGA 2LY7A 4LFAQ 4JBJA 1JOQA 5C4JB 2G9DA 1EIFA 4A3DB 3E9IA 1KC8C 3HRZC 4R4OA 5LMNL 2BH2A 2M2LA 1CM9A 1NMGA 1SE4A 4Y7NB 1Y14B 4Z9CB 1XYIA 3ICEA 4XDXA 4ABNA 2FHTA 1IKMA 1AFPA 4BBSH 2H4OA 5IOCA 2QDBA 2IY5B 1OXXK 4JVZA 4NB3A 4A3KH 3UDGA 1STNA 2VW9A 1S4ZA 1TS3A 3V96A 2MGSA 3IAYA 1N32Q 2KUMA 4FP5D 2B2TA 2MFIA 1YI2A 5AJ3L 2EXDA 4B3RQ 3MFGA 4F7XA 1STBA 3TP8A 2F0GA 1EQTA 1PRTF 2K14A 1C4QA 2M00A 2OQ0A 1Y1WG 2L11A 1BR9A 3NHHA 3FDTA 4RKBA 2FJ2A 3G7LA 2C35B 4AYBE 3K58A 2UXBL 2BOSA 5C4XB 5FLXc 3CCRA 3MXNA 3PUWA 4DR4L 4HJ7A 3JAML 4J15A 1X3GA 1A63A 1F77A 3BYTB 1X3PA 5CV5A 1RJTA 4OGQC 4B08A 3U4VA 3SK6A 1XX8A 5F2DA 1GXDC 4ME5A 4JV5Q 1V1QA 2R93G 4C3JG 1LLRD 3TS0A 5BR8Q 1R4PB 4XT3B 2B8FA 1TWGB 5C6AA 2D9UA 2MO1A 2C5CA 1KIXA 3KF8A 4NXMQ 1MSHA 3BVZA 1PH8A 1WCMH 2LXKA 4FNFA 1YHBA 4XYOA 3IRBA 5J3BA 4HR7B 2YTXA 3FP9A 4E6IA 1TY2A 2F0SA 4QMGA 4X62Q 4LMQD 2RQXA 3RNUA 2F0TA 2ICIA 1VQ9A 1BQQT 2ZTCA 4GS3A 3TEHB 3TZDA 4HAEA 3SVMA 4EGVA 2WKCA 2E2JH 4GZYC 1L1OA 5DEHA 2K4KA 4PMWA 2DGYA 2I46A 3J7YW 5E7NA 1XXGA 4IUNA 3GTLB 1SR3A 2PW7A 2X6LA 1VQAA 3KJPA 5GROA 2JSOA 4U68A 2R7ZG 1CFMA 2PNHA 4LF7Q 3OPOA 3P7JA 1KLGD 1I50B 5FLXL 4JYAL 1VCIA 1MGSA 2MJ8A 4BS9A 2PI2E 4UP7A 1D8LA 2NVQH 4DV7Q 1DYQA 1BBWA 4M8AA 3STBD 5IWAQ 2NB0A 4Q0FA 1W3SA 3PUYA 4CJ1B 2OT2A 1D1KA 1FNVA 1B9NA 2I07B 2L5TA 2AHOB 5C5MA 4NPSA 1B2TA 2XNAC 2SEBD 5LMUL 4B3RL 2A69C 5C0XG 2UXDQ 3HOYH 4BWGB 2UXCL 4A3KB 1R9TH 4LFCQ 4RH6A 4HEDA 4JI7Q 1OXUA 3AYHB 4LF4Q 2IPKD 1JWSD 1LTRD 1FD7D 4A3GG 1X65A 4R8NA 2Z6KA 3VA7A 2QA4A 4UAIA 4UP8A 2A19A 4IOCA 3PIPA 1R4QB 4IJHA 1Q8KA 1I94L 2F3VA 1VQKA 1K8OA 1DOKA 2G9HD 2KEDA 3VA5A 1HHVA 1VF5C 3I91A 1RF2D 1WTHA 1RL2A 3X3NA 4LF9Q 3S15H 3TZUA
chains in the Genus database with same CATH topology
2ZXRA 5EPLA 1IW7C 2EDGA 2VNUD 1H9KA 1G91A 2F0KA 5A2QL 1PZJD 4IALA 5T1GA 2NUCA 1A3UA 1LT4D 4IFDH 3OWEB 5JPMC 5CV8A 1VMPA 4G7OC 1SNQA 2H1EA 5KYIA 3T53B 4EQOA 2O2LD 1WTPA 4A3GB 2B2TC 5C3EB 5IGEA 4ZUJA 4EQNA 2RVLA 3D4DA 4PV1C 4X3TA 1ESRA 3HOVB 1E2ZA 2A68D 1G6ZA 1F2YA 2MUYA 1SYCA 4XT1B 1H9SB 4K5WA 2O4XA 2BDOA 3DXJC 4A3IB 1T5EA 2EY2A 3EQLC 4KY6A 4RCNA 1I4GA 5ELCA 2EXZA 3KLSX 1D2BA 3JAME 1ZYRC 3J7AF 5T1IA 3EA6A 1KNAA 1B53A 1Q3LA 3IFDA 3NK9A 1TR5A 3GD7A 1F2LA 3TP7A 4FF3A 3MEHA 3U9SA 4C3IG 2F03A 5D14A 4A3EB 2NVTB 2HUGA 1Q12A 4V190 3PUZA 1O78A 4KKSA 5IODA 1TIID 1KNEA 2KJXA 3HZXA 4K6DA 2QF7A 3TP6A 3TN2A 3ONAB 3Q22A 1ET6A 2D5DA 3VR4A 1NR2A 5E3FA 1DONA 1SYGA 1V1OA 2J7ZA 3OIQA 2B2WA 3KUPA 1DM0B 1PTOC 2CW0D 3D6WA 1IYUA 4KY5A 4CJ2C 5EKKA 2Z1CA 1EU3A 1NR4A 2VB2X 4ZKCB 3BDCA 2NN6G 1SNMA 1EQVA 1JCKB 4HCEA 1PFBA 2BCOA 2B2YA 1U4RA 2OF1A 2Y0SB 5CV4A 2WV6D 5EPJA 1EY6A 3I4LA 3UI2A 3S9WA 5E1FA 3M3YB 3FPPA 3X3MA 1HQRD 3EROA 3NBIA 4C3HG 4RWSC 3HOWB 2Z8LA 4OL7A 2EJMA 2NTTA 5IGFA 2ZT9C 1M4VA 3L3OC 1ENCA 3GV3A 2F0FA 5IT9L 2JE6I 3GQBA 3NP8A 2BA0A 3AMUA 2CVRA 3NUCA 3T16A 2F0DA 1U4MA 2NYZD 4L6TB 1BUVT 4DXGA 1BO0A 3J81E 3MWYW 1H9SA 4DU9A 1MI2A 4QF4A 5M3MB 3T51B 2L0CA 4DFAA 3CRKC 4X3SA 1UNSA 5EBDA 2B2UC 4C3HB 1VF7A 2F0NA 3TDQA 1HTLD 1S5BD 4KD3A 1HA5A 1Q1BA 2RBMA 5J22A 3S1RB 3J80E 2EY6A 2DY7A 3ITPA 4EQPA 1SSOA 1I4QA 1RDPD 1RODA 3IKJA 2MP1A 1FGBD 5ELBA 1Y8NB 1MD2D 2JP1A 4C56C 2VB3X 1ENAA 5C0XJ 2K03A 1IL8A 1EYDA 4KI0A 2RDGA 5JEAJ 3V05A 2EVBA 3S16B 3P1HA 3F2UA 1JWUD 1TT2A 1WTWA 4WRDA 1SYBA 1PFNA 5LL6X 5IGDA 3FMCA 4CKEA 5I9PA 1TS4A 3L7ZC 2TMPA 3DHQA 3MHBA 2DN8A 5IGBA 1GUNA 3PO2B 5DM63 4ODGA 1B1ZA 4OO1I 1V43A 3Q24A 4K14A 5CC4A 1WD0A 1PTOF 2A74C 4RHSA 1SJHD 4RHRA 1WTXA 1STAA 3MVVA 5CV9A 3R93A 2EYPA 1XTCD 4XQJA 3C2PA 1WTOA 3LNNA 3SK8A 1ILPA 1GOZA 1TS5A 3FPUB 5FLXE 5C3WA 4HSVA 4L63B 3I4MB 2WINB 1JOKA 1GUTA 3DM1A 3A56A 1QG7A 3S1NB 4FF1A 2AUJD 4XQNA 1STYA 4DK1A 1VDZA 3QB3A 2ZXPA 1ESFA 3EVQA 3MTSA 1GUOA 4FO2A 1Q1EA 3I4NB 2NVXB 2IWHA 1RTNA 1K83B 3K5OA 1LTBD 1AEXA 3DWQA 4XYQA 2F0PA 1II3A 2LS01 3FRPB 1GJXA 3GTJB 4G57A 1JORA 3SK5A 3GP7A 4OHJA 1LO5D 3A54A 5M5WB 3PUXA 4DNTB 4IFDI 1R9TB 2MHVA 3HOXB 3D3RA 4NKLA 2E2IB 2R6GA 1JR0D 2PQEA 2Q8TA 2V4DA 2ENBA 4ZAIA 5A2QE 2EYFA 2CW0C 4ZQ3A 4TKOB 4IUTA 3GO5A 3KBGA 4K8JA 3QOLA 1HPCA 2PW5A 3D31A 3H6MA 1Y1WB 1BXTA 1STGA 1ML0D 1L0YB 2K28A 2F1MA 1TKWB 4G4KA 3E6ZX 3N52A 3QJYA 1CHPD 1O80A 2R93B 3GTPB 2DNEA 3MC0B 1CZGA 4NW2A 4ZRZA 1I4PA 5A35A 4XQQA 4J1MA 5JPNC 3A8JE 1HUMA 5C4HA 1EEID 3HP3A 5BN5A 2RDFA 5ISRA 3R8BA 3OW7A 5JJZA 3A7AB 4EVOA 3CHBD 3M85A 3KLRA 2KCCA 1F9RA 5CBAE 3OMCA 4CGYB 1EU4A 2XWJB 4OIJA 1DOMA 2L1BA 5EJWA 2X69A 5EGTA 5FK9C 3VYTA 1QE6A 1CQFA 1BF4A 4O42A 2KQ3A 1NAPA 2AQ3B 1B4OA 5C44B 3RUZA 2PO4A 3K7AB 1NCVA 1CHQD 1LT5D 1CZWA 4MIUA 3PO3B 2RSNA 4DAPA 5C0XH 4KJOA 2XSCA 3T4AC 2XIWA 2JA6B 2PPBC 3VR5A 1H9MA 1EEFD 2WAQB 4HSPA 5KNCA 4DAVA 4IUPA 4S3SA 3S1MB 2E76C 3SEBA 4ZLTF 3A55A 2F0HA 1STHA 2B63B 1JWMD 2E2JB 1FNUA 1F2MA 3S2DB 3DWAA 5I9OA 2B2VA 2R3ZA 3KLSA 4TSSA 2IX1A 4A93B 4F87A 1I4RA 1LABA 3K5LA 4CHTB 1UUPA 1EFID 3NTHA 2A6HD 3HOZB 4BA2I 2Z4HA 1Z47A 4PMBA 1TWAB 4DNRB 3RZDB 4K2LA 4KKTA 3J81L 2AWOA 5IGCA 5DNFA 2IL8A 1JB3A 5M9OA 1SAPA 1B50A 1GHJA 2JYOA 1A2TA 2KOLA 4FF2A 3R2IA 2B2WC 3J7AV 4FXDA 1CTMA 1WTVA 3I90A 4HMJA 3HKZB 2RA4A 3BG3A 1V1PA 3TP5A 3K59A 2F0JA 1U9RA 2MPMA 4HTHA 3QIAA 2L55A 3HGBA 4DXFA 2WB1B 2EPBA 1VMCA 1SNCA 3H94A 1TQOA 1CA5A 1YNJD 1SYDA 1PMRA 1PRTB 2IT1A 4A3MB 2K05A 2IW3A 4NP5A 4XTCS 2NTSA 4CBVA 5I4DA 1SE2A 1IHZA 2GA4B 1KDAA 4K6LA 4OIKA 1GUGA 1SNDA 2PNRC 4C3JB 1WVLA 1C48A 4KKUA 4XIGS 2AQ1B 2TSSA 1YNNC 1Q90A 1OXSC 3MXGA 1HTPA 5E4XA 1PRTC 2BA1A 5C4ZA 4H0LC 1C8CA 3ERQA 2HCIA 3A7LA 1OXTA 2SNSA 3Q23A 3A8IE 4WORA 1PYWD 2VUMB 1D5ZC 3SDZA 2B2VC 2K33A 5JEAH 1AW7A 1ICWA 2FMMA 2XWBB 4F88A 2LMCB 4K2KA 3ND9A 1DJRD 1ENFA 3VR2A 2KVMA 4OO1G 5ELEA 1IKLA 3BZDB 2KHSA 3VYRA 1HQMC 4ID6A 4MHEA 4X3KA 3OMGA 2L9HA 1ONLA 1PTOB 2EY1A 4RKLA 4ILWA 1X32A 5COYA 1SEBD 2K6AA 1I6HB 1GHKA 3H09A 2QILA 4P2CB 3MA2B 4Q5VA 2NN6H 3EJIA 1ILQA 2XVSA 2K5DA 4L8JA 3VR6A 1NSNS 3K5MA 3TBIB 4DK0A 1ET9A 3RLFA 2D2CC 3D4RA 1WTQA 2NZ1D 2F0UA 4I7ZC 3NWSA 1I3QB 1TY0A 1OO9B 3OOCA 3Q6SA 1SFOB 2E2HB 3HG9A 1EY8A 3PIO3 1HUNA 2XRSD 1J8IA 1TWCB 1J9OA 1SXTA 2EY5A 2J0TD 1SMYC 3KK7A 2CHBD 2NBFA 2HQEA 2R92B 3HS0C 2IX0A 4RCOA 1AZPA 4ZKBB 2NVYB 5I6WA 1TVXA 1KDCA 3AB9A 2EJGC 2PZWA 3I8ZA 1SNPA 3CU7A 2O5JC 2E2DC 5CGKA 3S2HB 2A69D 3ZYYX 1EOTA 3A8KE 5KRUA 2YU9B 3GTGB 1QCBD 1PZID 1S5FD 5NUCA 3KBXA 2D62A 1LACA 4C2MB 5G3LD 4TQUS 1I4HA 1O7LA 4KN4C 2XN9C 1HXYD 1LTTD 4DAYA 2E74C 1CQVA 1AZQA 2K5QA 1SYFA 3I3CA 4B9XA 1DD2A 3BS1A 1A3TA 2QKIC 2QCPX 3NBHA 2L12A 1KAAA 3SR1A 3H0GB 3U9OA 2F0MA 5JOBA 3K57A 1QNUA 3E5SA 4KHZA 3G6JB 3LWUA 1STEA 4FVMA 2FFKB 4K5VA 1EYCA 4IQZA 2K7VA 3NSWA 3S15B 2B2UA 2C9OA 1LT6D 3IFTA 4RAUC 3P75A 3PV0A 1IYVA 3H91A 4BBRB 5HGTA 4BY1B 4BY7B 5CMDA 1PTOD 3BDOA 4RGMA 1BCPF 4N9PA 4LK1C 5E4WC 3NTIA 2A68C 5J39A 2AWNA 3TSSA 2EYOA 4V0BA 4NMZA 3N6RA 2LFNA 1RKNA 3SK4A 1E0BA 4J8QA 3GV6A 1BCPC 1HCZA 3RD4A 1EIGA 4DA2A 1SDFA 1HFGA 4WFN3 2RDHA 2X6GA 2RKSA 1LV9A 2AUKA 4IFDG 2IX3A 2A6ED 2VXWA 4CJ0B 3QO2A 4RA8A 1W6JA 3BVMA 3C3LA 3BVGA 5EKLA 3MAQA 5DM73 1JC7A 1ZYRD 4R9WA 3M4OB 4BBSB 3QOJA 3DEPA 1FYCA 5FO7B 3M7GA 4IUVA 1A2UA 5JEAG 1RTOA 1PXUA 3QG1A 3DWPA 1I4XA 3MXPA 1H9JA 4IFDJ 1ZXTA 5CYUA 5LL6S 1QOHA 2K32A 2CQAA 1JE4A 1EWHA 2PZUA 5CBEE 3DUZA 3D8GA 3OSOA 5K36H 4KD4A 2WACA 5K5PA 3OHXC 5EKIA 1IW7D 2YYZA 4QB4A 1DZ1A 3D4WA 4IUQA 4ZK9B 3W3AA 1FR3A 5D65A 5JVG3 3RZOB 3CKIB 4CKBA 3FVQA 1KABA 4ZUIA 3HOYB 2NN6I 4QUFA 3ND8A 4AYBB 3NE5B 3GTKB 4NDXA 2HDLA 2R61A 3CQZB 2JEBI 1D5XC 5J1ZA 1LTGD 1KLUD 1JICA 3J80L 2JXMB 1G291 2KA7A 5C5LA 4DN4M 5JAVA 4RGOS 4QIWB 1B9MA 4IZ8A 4IURA 2Z4IA 4A3FB 3C1EA 1V1PB 5KNBA 4LJZC 2A5HA 2ICEC 3R2TA 1A6XA 3RMHA 2A6HC 3R3OA 2F0OA 4JK1C 5CV6A 1DXMA 2PZTA 1CI3M 1D5MC 4RFBA 4FXGC 3P20A 1S5ED 1LT3D 2RSOA 1Q8IA 3AU7A 1T5XD 1WTRA 1UAPA 2EYHA 2K04A 1BCPD 4O1NA 1G8ZD 5I2YA 1Y69U 1HRJA 1BBXC 4OO1H 4C3IB 2BE5D 5CR3A 2EYJA 4DGZA 4ULLA 3K5NA 1D6EC 2QEJC 5D3IB 1BDOA 4C1NI 1V8QA 2A73B 1RD9D 3PMFA 1DCZA 4DF7A 2Q8IB 3NQTA 2NWGA 3S14B 4XXEA 4U673 1ZEQX 5I2XA 4HCSA 1U4LA 1EY7A 5FKAC 5D3DA 1S5CD 1UEAB 4A3JB 1YNJC 2L4NA 1LTAD 4KY7A 2F0LA 4HMIA 3URYA 1JOOA 2F0EA 5EBCA 3WOFA 1SNOA 3FEWX 3PIP3 1Z6HA 3NWTA 4K8IA 5ELDA 1WD1A 2FINB 1JQYD 2EOTA 2WP8J 1AP0A 1PTOH 4JBWA 5FO9B 2EYLA 3S17B 1Y8PB 4KTAA 1U4PA 2KECA 3C46A 3OWFA 4IN3A 4A3BB 2AQ2B 2N88A 1TWHB 3MZ5A 2OXPA 4YIJA 2A6EC 3K0YA 4CKCA 1EZ8A 5IT9E 2SDFA 1RHPA 3PUVA 1EYAA 5G3LF 5FOBB 5C3XA 2PMZB 1HFNA 1DOLA 1EZ6A 5BN4A 5C0XI 3BDLA 1CT1D 1MBYA 1TWFB 3M7NA 2XRQD 4KJNA 4H7BA 2LKVA 3I72A 2ZXOA 3GTQB 2B39A 1NUCA 5ELFA 1RCVD 2N55A 1QJOA 1D1IA 4H44C 5AFWA 1EY9A 3GTMB 5BN3A 1QWYA 1F9QA 1EIHA 4F8MA 1LTID 1TU2B 2KEEA 4G7ZC 4IUUA 3V2TA 3C1FA 4PQXA 3IL8A 3DMUA 4UDUC 1BNZA 1O7YA 1BOSA 4I65A 3O13A 4N9TA 5K36G 2F0WA 1FNWA 1BCPB 4PMCA 1E2WA 3I73A 3MFYA 1B3AA 4G7HC 5EQ0A 2ID0A 5HURA 1WCMB 5KEEA 2R7ZB 3CRLC 2O5IC 1Y1VB 1HA6A 1QILA 1Y8OB 3TMEA 3L9AX 1K8MA 4M1UB 3SXHA 5TSSA 4R8IA 4FF4A 3EFXD 4QUCA 5I6YA 2Q8RE 2JA7B 2B2YC 1GUSA 2M9VA 3SHLA 2WKDA 4KV6A 2K1BA 1I6VC 2WIIB 1E2VA 2EJFC 2F0IA 3FKIB 5DAUA 1B44D 3T56B 3SE0A 1AN8A 2PCFB 1TS2A 1EY0A 2J4XA 2BE5C 1PRTD 3DEOA 1SE3A 1A3VA 1SMYD 4X3UA 2HDMA 1SBBB 2K5WA 1PDQA 3W2DA 3NXWA 3D6CA 1EY4A 5M3FB 3MXUA 5LHY1 3NPPA 1KDBA 5KGUA 3LWEA 2B8GA 1OXVA 2EE1A 5M5XB 3Q0AA 1H9RA 3BYYB 5KNDA 4KK7A 1F9PA 2DY8A 4B9WA 4C1NK 5CV7A 3GTOB 4QCLA 5KIXA 5IIFA 1PLFA 1EY5A 2EYMA 4HN7A 4MN3A 1LTSD 3WDNA 3H3VC 2NVQB 2HCCA 2OEOA 1QB5D 5KYLA 3VYSA 2F4IA 4KN7C 4TRDA 5CORA 1S5DD 1XWEA 1SJED 2JA5B 1A15A 3LX0A 3VR3A 1G2TA 1M8AA 3OIPA 2FMCA 2KCNA 4RGTA 5IGGA 1QNKA 1SYEA 1F9SA 3VYUA 3T13A 2E75C 3K6OA 3NQIA 1G2SA 3S1QB 4WJWA 4J6HA 3HOUB 4ZYSA 1CA6A 3NTKA 1L0XB 4FXKC 2F0QA 2JA8B 3I70A 3WOEA 1Z7TA 4PNYA 2K01A 2SNMA 5EPKA 4K5XA 1PZKD 2F0VA 2SOBA 2JEAI 2DNCA 4KMUC 4FYDA 3QWNA 3HEJA 4RGNA 1ZKOA 3M4YA 2F3WA 2BDNA 3E0JA 1GUWA 4BA1I 4LAAA 5M5YB 1F2ZA 4KHVA 2IJ0A 1EL0A 1KTKA 1YNND 2EZVA 1O7ZA 5FO8B 4H13C 1W6KA 1PFMA 1CK1A 5JVH3 1MSGA 2PYKA 1EWCA 1X3QA 2LY7A 1JOQA 5C4JB 2G9DA 4A3DB 3HRZC 2M2LA 1CM9A 1SE4A 4Y7NB 4Z9CB 1XYIA 4XDXA 4ABNA 2FHTA 1IKMA 1AFPA 2H4OA 5IOCA 2QDBA 1OXXK 1STNA 1S4ZA 1TS3A 3V96A 2MGSA 3IAYA 2KUMA 4FP5D 2B2TA 3MFGA 4F7XA 1STBA 3TP8A 2F0GA 1EQTA 1PRTF 1C4QA 2M00A 2L11A 1BR9A 3NHHA 3FDTA 4RKBA 2FJ2A 3G7LA 3K58A 2BOSA 5C4XB 3MXNA 3PUWA 3JAML 1F77A 3BYTB 1X3PA 5CV5A 1RJTA 4OGQC 4B08A 3SK6A 1XX8A 5F2DA 1GXDC 4ME5A 4C3JG 1LLRD 1R4PB 4XT3B 2B8FA 1TWGB 5C6AA 2D9UA 2C5CA 3KF8A 1MSHA 3BVZA 4FNFA 4XYOA 4HR7B 4E6IA 1TY2A 2F0SA 4QMGA 4LMQD 2RQXA 2F0TA 2ICIA 1BQQT 3TZDA 3SVMA 4HAEA 4EGVA 2WKCA 4GZYC 5DEHA 4PMWA 3J7YW 2I46A 1XXGA 4IUNA 3GTLB 2PW7A 2X6LA 2JSOA 4U68A 1CFMA 3OPOA 3P7JA 1KLGD 1I50B 5FLXL 1VCIA 1MGSA 2MJ8A 4BS9A 1DYQA 4M8AA 2NB0A 4Q0FA 4CJ1B 3PUYA 2OT2A 1D1KA 1FNVA 1B9NA 2I07B 2L5TA 5C5MA 1B2TA 2XNAC 2SEBD 2A69C 5C0XG 4BWGB 4A3KB 4RH6A 4HEDA 1OXUA 2IPKD 1JWSD 1LTRD 1FD7D 4R8NA 3VA7A 4UAIA 1R4QB 2F3VA 1K8OA 1DOKA 3VA5A 2G9HD 2KEDA 1HHVA 1VF5C 3I91A 1RF2D 3X3NA 3TZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTI D;  3W2D A;  3BVZ A;  1BCP C;  1XTC D;  2IJ0 A;  2R61 A;  1DJR D;  1ENF A;  1KTK A;  1CHQ D;  1D5X C;  1BXT A;  1PZJ D;  5FKA C;  3R2I A;  1GOZ A;  1TS5 A;  2RDH A;  1LT5 D;  1ET6 A;  1TY2 A;  1LT4 D;  4L63 B;  1L0Y B;  1LTG D;  1KLU D;  3OWE B;  5ELE A;  5D3D A;  1S5C D;  1UNS A;  4UDU C;  4RGO S;  1LTA D;  2ICI A;  3BZD B;  1PZI D;  1S5F D;  1CK1 A;  1V1O A;  1HTL D;  3BYY B;  1S5B D;  1HA5 A;  3O13 A;  2O2L D;  3URY A;  1EWC A;  1XXG A;  1FNW A;  1I4H A;  1V1P A;  1ESF A;  1PTO C;  1PTO B;  1BCP B;  1V1P B;  2XN9 C;  3BVM A;  1CHP D;  1I4Q A;  1RDP D;  3BVG A;  1EEF D;  5ELD A;  1LTS D;  1HXY D;  1JQY D;  3R2T A;  1EU3 A;  1FGB D;  1LTT D;  1SEB D;  5ELB A;  1KLG D;  4DXF A;  1CQV A;  1PTO H;  3SEB A;  1SE4 A;  3MC0 B;  1MD2 D;  4C56 C;  4Z9C B;  1I4P A;  1JCK B;  2QIL A;  1JWM D;  1PRT B;  1DYQ A;  1FNU A;  1S5D D;  1SJE D;  2RDG A;  2AQ2 B;  3V05 A;  1LTB D;  1QIL A;  2WV6 D;  1D5M C;  3DWP A;  1EEI D;  1I4X A;  3DWQ A;  4RFB A;  1FNV A;  1JWU D;  3DWA A;  1TS3 A;  2NTS A;  5I4D A;  5TSS A;  3R8B A;  1S5E D;  1SE2 A;  1ET9 A;  1I4G A;  1LT3 D;  3EFX D;  4RGT A;  4TSS A;  5ELC A;  2XNA C;  2SEB D;  1HQR D;  1STE A;  1T5X D;  4K6L A;  1TS4 A;  3MFG A;  4BWG B;  1I4R A;  3CHB D;  3KLS X;  1TY0 A;  1PRT F;  2Z8L A;  1UUP A;  1EFI D;  4RH6 A;  2NTT A;  1LT6 D;  3EA6 A;  4ZYS A;  1M4V A;  2IPK D;  1L0X B;  3GP7 A;  1BCP D;  1JWS D;  4OHJ A;  1LO5 D;  1LTR D;  1CT1 D;  1FD7 D;  4O1N A;  2AQ1 B;  2TSS A;  1EU4 A;  2XRQ D;  1G8Z D;  1B44 D;  2XRS D;  1PZK D;  1PTO D;  1JR0 D;  1PRT C;  1F77 A;  1SXT A;  3BYT B;  4RGM A;  1B1Z A;  1BCP F;  1AN8 A;  1TS2 A;  1D6E C;  5ELF A;  2J4X A;  1RCV D;  2QEJ C;  4L6T B;  5D3I B;  1PYW D;  5FK9 C;  3TSS A;  4RGN A;  1D5Z C;  2CHB D;  1PRT D;  2G9H D;  1LLR D;  1SE3 A;  1PTO F;  4RCO A;  1RD9 D;  4DXG A;  1AW7 A;  1RF2 D;  4RHS A;  1SJH D;  4RHR A;  2AQ3 B;  1SBB B; 
#chains in the Genus database with same CATH topology
 2ZXR A;  3CAM A;  1YJN A;  4BY1 H;  5EPL A;  2UUB L;  1IW7 C;  2EDG A;  3I4M G;  2VNU D;  1H9K A;  1G91 A;  2F0K A;  5A2Q L;  4DK3 C;  1VQ7 A;  1PZJ D;  4HJ8 A;  1I6H H;  4IAL A;  5T1G A;  2NUC A;  1A3U A;  2Q2I A;  1LT4 D;  4IFD H;  3T1H Q;  3OWE B;  5JPM C;  1MIU A;  4BXX H;  5CV8 A;  1VMP A;  3CPF A;  4G7O C;  4C3J H;  1SNQ A;  2H1E A;  1XPO A;  3EIV A;  5KYI A;  4UPA A;  2JA6 H;  2KCT A;  3T53 B;  3VDY A;  4EQO A;  2O2L D;  1WTP A;  1J5E L;  4A3G B;  2B2T C;  4AYB G;  5C3E B;  3H0G H;  5IGE A;  4ZUJ A;  4EQN A;  3TRZ A;  2RVL A;  4PZ8 A;  1B3Q A;  3D4D A;  4PV1 C;  4X3T A;  1ESR A;  3HOV B;  1E2Z A;  3PF5 A;  2A68 D;  4GLA C;  2YU9 H;  3GTG H;  1F2Y A;  1G6Z A;  2MUY A;  1SYC A;  4XT1 B;  1JMC A;  3KDF A;  3CCU A;  4HIK A;  1H9S B;  4K5W A;  2E2H H;  2O4X A;  2BDO A;  3DXJ C;  3K80 C;  4A3E H;  4A3I B;  1T5E A;  1YIJ A;  4JI3 Q;  2EY2 A;  1XJV A;  1PA6 A;  3EQL C;  4KY6 A;  4RCN A;  4JBM A;  1B70 B;  1I4G A;  5ELC A;  2R92 H;  1RIP A;  2EXZ A;  3CQZ H;  4QJF A;  4GNX C;  1PYS B;  3KLS X;  1D2B A;  3JAM E;  2QGQ A;  1ZYR C;  4N8F A;  3J7A F;  3PO2 H;  5T1I A;  2Q2T A;  3EA6 A;  1KNA A;  1B53 A;  1N33 L;  1G51 A;  3RZD H;  4JI3 L;  1UE7 A;  1Q3L A;  3IFD A;  3NK9 A;  3CXC A;  1E24 A;  1TR5 A;  3CP0 A;  3GD7 A;  3BU2 A;  4GKK Q;  1F2L A;  3TP7 A;  4FF3 A;  3MEH A;  3U9S A;  4DR3 L;  4C3I G;  2F03 A;  5D14 A;  4A3E B;  4JBK A;  2NVT B;  2HUG A;  1Q12 A;  4V19 0;  3PUZ A;  1O78 A;  3H15 A;  4KKS A;  2QW7 A;  2Z0S A;  5IOD A;  1WFQ A;  4A3C G;  1TII D;  4DV6 Q;  5GAG C;  3STB C;  1KNE A;  2KJX A;  4A93 G;  3HZX A;  4K6D A;  2QF7 A;  3TP6 A;  3TN2 A;  3ULL A;  3ONA B;  4OXP A;  3Q22 A;  3J7A 5;  1ET6 A;  1IL2 A;  2CCZ A;  2D5D A;  2VQE L;  3VR4 A;  1NR2 A;  5IYB G;  2GVB A;  5E3F A;  1DON A;  1SYG A;  1V1O A;  4H02 A;  3K8A A;  2J7Z A;  3OIQ A;  1VQO A;  2B2W A;  3KUP A;  1NBW A;  1DM0 B;  1K73 C;  2P5Z X;  1PTO C;  4WJ3 M;  2CW0 D;  1WI5 A;  4IPC A;  1S3O A;  4GOP B;  4A3B H;  3D6W A;  1IYU A;  4KY5 A;  3A0J A;  1WOC A;  4CJ2 C;  5EKK A;  2Z1C A;  1EU3 A;  1NR4 A;  4POF A;  1S40 A;  2VB2 X;  4ZKC B;  4C3I H;  1YBY A;  4MTN A;  4MZ9 A;  4OWX B;  3BDC A;  2NN6 G;  1J5E Q;  1SNM A;  1EQV A;  1JCK B;  4HCE A;  4YWL A;  1PFB A;  3K7A H;  2BCO A;  1IYJ B;  2B2Y A;  1EYG A;  1U4R A;  2OF1 A;  1XNR L;  2Y0S B;  5CV4 A;  2WV6 D;  5EPJ A;  1E1O A;  1EY6 A;  3I4L A;  3UI2 A;  3PO3 H;  3S9W A;  2IHE A;  5E1F A;  3M3Y B;  3FPP A;  2KCM A;  2F4V L;  4X6A H;  3X3M A;  1HQR D;  3ERO A;  3GTM H;  1Q46 A;  3A5Z B;  3NBI A;  4I7A A;  4RWS C;  4C3H G;  3HOW B;  2Z8L A;  4OL7 A;  2EJM A;  3PCO B;  5M5W H;  2NTT A;  1XMO L;  5IGF A;  2ZT9 C;  1M4V A;  3A74 A;  3L3O C;  2CH4 W;  1ENC A;  3GV3 A;  2F0F A;  5IT9 L;  1PYB A;  4C3H H;  2JE6 I;  3GQB A;  5C44 H;  3NP8 A;  2BA0 A;  5IYD H;  1A0I A;  4DV7 L;  1ASZ A;  3AMU A;  2CVR A;  3NUC A;  3S1R H;  3T16 A;  2F0D A;  1U4M A;  2CWA A;  4O0A A;  2NYZ D;  1SFO H;  4L6T B;  2CH4 A;  1BUV T;  4LF9 L;  2MNA A;  3CME A;  4DXG A;  1BO0 A;  4IPG A;  3J81 E;  3MWY W;  1H9S A;  4DU9 A;  1MI2 A;  4QF4 A;  5M3M B;  3T51 B;  4DV0 Q;  2L0C A;  4DFA A;  3CRK C;  1QVC A;  4X3S A;  1UNS A;  1YJ9 A;  5EBD A;  2B2U C;  1N9W A;  3S16 H;  4C3H B;  1VF7 A;  4HIO A;  2F0N A;  3TDQ A;  4DV4 Q;  5IE8 A;  1HTL D;  1S5B D;  4KD3 A;  1HA5 A;  1Q1B A;  2RBM A;  5J22 A;  3KFU A;  1VQF A;  1U5K A;  3HKS A;  3S1R B;  1KL9 A;  3J80 E;  5M5X H;  2EY6 A;  2UUB Q;  4GNX A;  2DY7 A;  3ITP A;  4EQP A;  1SSO A;  1I4Q A;  1RDP D;  1ROD A;  4L5T A;  3F8T A;  3IKJ A;  1E1T A;  1T9H A;  2MP1 A;  1FGB D;  5ELB A;  5C4J H;  5ELN A;  1Y8N B;  1MD2 D;  2JP1 A;  4C56 C;  2VB3 X;  1U0L A;  4FDB A;  1IBL L;  1ENA A;  5LMN Q;  3MEF A;  3HOZ H;  1L1O C;  5C0X J;  3F2D A;  2K03 A;  4DUY Q;  1IL8 A;  1EYD A;  4KI0 A;  3F2C A;  2RDG A;  5JEA J;  3V05 A;  2EVB A;  1HNX L;  3S16 B;  3P1H A;  3F2U A;  4X62 L;  3ERS X;  1JWU D;  1TT2 A;  1WTW A;  3K81 C;  4WRD A;  4AQY Q;  1LM0 A;  1PFN A;  1SYB A;  5LL6 X;  5IGD A;  4ZCK A;  5JJI A;  5IP7 G;  1HZB A;  3FMC A;  4CKE A;  5I9P A;  1TS4 A;  5C4X G;  3L7Z C;  2Z6B A;  3KF6 B;  2Q2H A;  1MHW C;  2TMP A;  3SGI A;  3DHQ A;  3MHB A;  2DN8 A;  1YIT A;  1HNX Q;  3CCQ A;  5IGB A;  1GUN A;  3PO2 B;  3TQY A;  1X9N A;  5DM6 3;  3MXN B;  3GTL H;  4ODG A;  3KJO A;  1B1Z A;  3UE1 A;  5M3F H;  4OO1 I;  1OTC A;  1V43 A;  2F4V Q;  3Q24 A;  4K14 A;  4QIW E;  1X6O A;  5CC4 A;  1HZC A;  1WD0 A;  1PTO F;  2A74 C;  3I4O A;  4UHV A;  3CC2 A;  3EBE A;  4RHS A;  1SJH D;  4RHR A;  2CQO A;  1WTX A;  1STA A;  3MVV A;  5CV9 A;  3R93 A;  2I0Q A;  2EYP A;  4TVA B;  3CC4 A;  4DV2 Q;  1XTC D;  4XQJ A;  2UUA L;  3M4P A;  1WTO A;  3C2P A;  3LNN A;  3SK8 A;  2NVX H;  1ILP A;  1GOZ A;  1TS5 A;  3FPU B;  1TWG H;  5FLX E;  5C3W A;  4HSV A;  4L63 B;  4DV5 Q;  4BY7 H;  4ALP A;  1YZ6 A;  3I56 A;  3I4M B;  2WIN B;  1JOK A;  1GUT A;  2L15 A;  3DM1 A;  3A56 A;  2ZTD A;  1QG7 A;  3S1N B;  4FF1 A;  2AUJ D;  4XQN A;  1STY A;  4DK1 A;  3H3V H;  1VDZ A;  3QB3 A;  2ZXP A;  1ESF A;  3EVQ A;  3MTS A;  1CKM A;  5IP7 H;  4JI1 Q;  4ME3 A;  1GUO A;  4YY3 Q;  4FO2 A;  1Q1E A;  2QEX A;  2ATW A;  3I4N B;  1MJC A;  4A3I G;  1UE1 A;  4IPD A;  2R7F A;  4DR5 L;  1XMQ Q;  2NVX B;  1BKB A;  2K75 A;  1FJG L;  2IWH A;  1RTN A;  2KHJ A;  4HJA A;  1K83 B;  3K5O A;  1LTB D;  3BZK A;  1AEX A;  3DWQ A;  4A93 H;  4B3T L;  4XYQ A;  2R7D A;  4EQ5 A;  2RHS B;  3S1N H;  2F0P A;  1II3 A;  2LS0 1;  3FRP B;  1GJX A;  4DR5 Q;  3A5U A;  4G57 A;  3GTJ B;  4AH6 A;  1PH2 A;  1JOR A;  1VQG A;  3S14 H;  1Y1V H;  4GN3 B;  3SK5 A;  4BBR H;  3GP7 A;  3M4O H;  4OHJ A;  1LO5 D;  3A54 A;  5M5W B;  2KBN A;  3PUX A;  4DNT B;  3I4N H;  4IFD I;  1R9T B;  2MHV A;  3HOX B;  3D3R A;  1BVS A;  4NKL A;  2E2I B;  2H5X A;  2R6G A;  1JR0 D;  2PQE A;  3L2P A;  3CCV A;  1YHQ A;  5DLQ E;  2Q8T A;  3Q8D A;  2V4D A;  2ENB A;  4ZAI A;  5A2Q E;  5IWA L;  4R4I A;  2EYF A;  2CW0 C;  4ZQ3 A;  4A3F G;  4TKO B;  4IUT A;  3NEN A;  1QZH A;  4JW0 A;  3GO5 A;  3KBG A;  4K8J A;  3QOL A;  2I5M X;  1HPC A;  2PW5 A;  3D31 A;  2UXC Q;  3H6M A;  3RZO H;  1Y1W B;  3W5O A;  1BXT A;  1STG A;  1ML0 D;  1L0Y B;  2K28 A;  3OW2 A;  2VY3 A;  3U4Z A;  5M3M H;  4PG3 A;  2WAQ E;  4KHP Q;  2F1M A;  3AFQ A;  3ULP A;  1TKW B;  1CUK A;  4G4K A;  3E6Z X;  3N52 A;  3L0O A;  1KRT A;  4DR4 Q;  3QJY A;  1CHP D;  1O80 A;  2HQL A;  2R93 B;  3GTP B;  4DAY B;  1YJW A;  1QZG A;  2DNE A;  3JAM c;  4LF6 Q;  2F3I A;  3MC0 B;  1CZG A;  1EWI A;  1IZ6 A;  4NW2 A;  4ZRZ A;  1I4P A;  5A35 A;  4XQQ A;  3H3V I;  4A3L G;  1TWF H;  4J1M A;  5JPN C;  5LMU Q;  4DR2 L;  5IYC H;  3HOV H;  4P71 A;  3A8J E;  1VQE A;  1HUM A;  5C4H A;  1X3F A;  1EEI D;  4B3T Q;  3HP3 A;  5BN5 A;  5GAD C;  3B6Y A;  2RDF A;  2Q2U A;  1XPU A;  5ISR A;  3LGJ A;  3R8B A;  3OW7 A;  3PSI A;  2Z6K C;  5JJZ A;  3A7A B;  3CCL A;  4EVO A;  4IO9 A;  3CHB D;  2OTJ A;  3M85 A;  3KLR A;  2KCC A;  2JA5 H;  1F9R A;  5CBA E;  3GDE A;  3OMC A;  4CGY B;  1X54 A;  1CKO A;  1C0A A;  1EU4 A;  2XWJ B;  4OIJ A;  1DOM A;  2HHH L;  4A3D G;  4LFA L;  2L1B A;  5EJW A;  2X69 A;  3HKZ G;  5EGT A;  1BBU A;  5C3E G;  5FK9 C;  3VYT A;  4YHH L;  1QE6 A;  1CQF A;  3CCS A;  3BJU A;  1VQI A;  1HNW L;  1BF4 A;  4X65 L;  4O42 A;  2JA6 G;  2KQ3 A;  1NAP A;  2AQ3 B;  4QQB X;  1B4O A;  5FLM H;  5C4X H;  5L37 A;  5C3E H;  5C44 B;  1I3Q H;  3RUZ A;  2PO4 A;  3K7A B;  1NCV A;  1CHQ D;  2OQK A;  2OWO A;  1LT5 D;  1UE5 A;  1CZW A;  4MIU A;  2UUC L;  3PO3 B;  1Q86 C;  2RSN A;  1XNR Q;  4DAP A;  5C0X H;  4KJO A;  2XSC A;  4A3F H;  1VQ5 A;  1GM5 A;  1QUQ B;  3T4A C;  2XIW A;  3S24 A;  2JA6 B;  4Y52 H;  1VQD A;  1X56 A;  3TS2 A;  2PPB C;  4P75 A;  5M5Y H;  4YWM A;  3VR5 A;  1H9M A;  1EEF D;  2WAQ B;  4HSP A;  1VQM A;  4GOP A;  5KNC A;  1N36 L;  4DAV A;  2RCN A;  4IUP A;  4S3S A;  3F2B A;  3S1M B;  1XNQ Q;  1XMQ L;  2E76 C;  3SEB A;  4ZLT F;  3A55 A;  2F0H A;  1STH A;  3ULJ A;  2B63 B;  1JWM D;  2E2J B;  1JT8 A;  1FNU A;  2N78 A;  4DV4 L;  2JA8 H;  1F2M A;  3S2D B;  1HJP A;  3DWA A;  3HOX G;  5I9O A;  2B2V A;  4R1J A;  4OWW B;  2R3Z A;  3HFZ B;  1PH5 A;  3KLS A;  4TSS A;  2IX1 A;  4A93 B;  4F87 A;  3KDF B;  1I4R A;  1LAB A;  3K5L A;  4CHT B;  1UUP A;  1EFI D;  3NTH A;  2A6H D;  3HOZ B;  4BA2 I;  2Z4H A;  1Z47 A;  4PMB A;  2FXQ A;  1TWA B;  4DNR B;  3HOW H;  4IPH A;  3RZD B;  4K2L A;  1JJ2 A;  2MO0 A;  4KKT A;  3U50 C;  2AWO A;  3J81 L;  1EOV A;  5IGC A;  4R4C A;  3PQI A;  2VUM G;  2ZJQ A;  5DNF A;  4LF7 L;  3U58 A;  2CFM A;  2IL8 A;  2VQE Q;  1JB3 A;  5M9O A;  1SAP A;  1GD7 A;  2Y0S E;  3RR5 A;  1B50 A;  1GHJ A;  4AIM A;  2JYO A;  1A2T A;  2KOL A;  2KHI A;  4LF8 L;  1VQP A;  4FF2 A;  3R2I A;  2B2W C;  3J7A V;  5EAY A;  4FXD A;  1Y1W H;  1KHI A;  1CTM A;  1WTV A;  5GQO A;  1IBM Q;  3I90 A;  4HMJ A;  1Y1V G;  4LFC L;  1NY4 A;  3HKZ B;  2RA4 A;  3BG3 A;  1V1P A;  4NXN Q;  3TP5 A;  4JI4 L;  1GKH A;  3CCE A;  3K59 A;  2F0J A;  1U9R A;  2MPM A;  2CWP A;  4DV1 Q;  3J80 i;  1K0R A;  4HTH A;  2E5L L;  3S17 H;  3QIA A;  2L55 A;  3HGB A;  3HKZ E;  4DXF A;  4DR7 L;  2WB1 B;  2EPB A;  1VMC A;  1SNC A;  3H94 A;  1TQO A;  2UU9 L;  1CA5 A;  1NNX A;  4GLX A;  1YNJ D;  1SYD A;  1PMR A;  1PRT B;  3K0X A;  4DV2 L;  2IT1 A;  1N36 Q;  4A3M B;  2HD3 A;  3FKI H;  2HIV A;  2K05 A;  2IW3 A;  1GVP A;  4NP5 A;  4XTC S;  2NTS A;  4CBV A;  5I4D A;  1SE2 A;  1IHZ A;  2GA4 B;  1KDA A;  3J7Z C;  4K6L A;  4R4Q A;  1PH6 A;  4NXM L;  4OIK A;  3G71 A;  1GUG A;  1E22 A;  1SND A;  3GTO H;  4AQY L;  2PNR C;  2JN4 A;  4C3J B;  1WVL A;  1C48 A;  4KKU A;  4XIG S;  4IJL A;  3JC6 6;  3CPW A;  2AQ1 B;  2TSS A;  1YNN C;  1Q90 A;  4OWT B;  4B3S L;  1OXS C;  3MXG A;  3M9B A;  1HTP A;  1HNZ L;  5E4X A;  1AH9 A;  1PRT C;  2BA1 A;  4H0L C;  5C4Z A;  1C8C A;  3ERQ A;  3AQQ A;  4DKA C;  1UWV A;  2DJG C;  2HCI A;  3A7L A;  3KYH C;  4DV6 L;  1HR0 W;  4A3B G;  1Z9F A;  1OXT A;  2SNS A;  3Q23 A;  3A8I E;  1AE3 A;  1TWA H;  4WOR A;  1PYW D;  4A3M H;  3UDI A;  2VUM B;  1D5Z C;  3SDZ A;  2B2V C;  1ASY A;  1HH2 P;  2K33 A;  5JEA H;  1V9P A;  3GTP H;  1AW7 A;  1ICW A;  2FMM A;  2XWB B;  1N34 Q;  1IBK L;  4LW1 A;  4A3M G;  4F88 A;  2LMC B;  4K2K A;  3ND9 A;  1DJR D;  1ENF A;  2OCE A;  1Q7Y C;  3D0F A;  3VR2 A;  4PZ7 A;  3DLL A;  2KVM A;  4OO1 G;  5ELE A;  1IKL A;  1WJJ A;  4YHH Q;  3BZD B;  4DR3 Q;  2KHS A;  3VYR A;  1HQM C;  4HID A;  2ZJR A;  4ID6 A;  4MHE A;  4X3K A;  4JI4 Q;  4JI5 L;  3OMG A;  2L9H A;  1FVI A;  1ONL A;  1PTO B;  2EY1 A;  4RKL A;  4ILW A;  1N32 L;  4DR1 L;  1SN8 A;  1X32 A;  5COY A;  3HOX H;  1SEB D;  2K6A A;  1I6H B;  2K52 A;  3F1Z A;  5FJ8 H;  3GTK H;  1GHK A;  3BZC A;  3H09 A;  2QIL A;  4DNI A;  4P2C B;  1PHJ A;  3MA2 B;  2I5L X;  3DM3 A;  3W1B A;  4Q5V A;  3UDX A;  2NN6 H;  1W2B A;  3EJI A;  4BXX G;  1ILQ A;  2XVS A;  2K5D A;  4L8J A;  5FLM G;  1L1O B;  3VR6 A;  5H1S E;  1NSN S;  3I55 A;  3K5M A;  3TBI B;  4DK0 A;  3CCM A;  1ET9 A;  3RLF A;  2D2C C;  3D4R A;  4DR2 Q;  1WTQ A;  2NZ1 D;  2HIX A;  2F0U A;  4I7Z C;  2E8G A;  3NWS A;  1I3Q B;  2GVA A;  1TY0 A;  1OO9 B;  3OOC A;  3Q6S A;  1SFO B;  2E2H B;  3HG9 A;  4JI0 Q;  1EY8 A;  2AKW B;  4JI7 L;  3PIO 3;  1E7Z A;  3HOW G;  1PVO A;  3FKI G;  3GTJ H;  4GN4 B;  1EQR A;  1B7Y B;  3OYY A;  3CC7 A;  1HUN A;  2XRS D;  1J8I A;  1TWC B;  1J9O A;  1SXT A;  1GO3 E;  2EY5 A;  2J0T D;  2A8V A;  2DJF C;  1SMY C;  1VQC A;  5C44 G;  3KK7 A;  2JA7 H;  4KHP L;  2CHB D;  2NBF A;  2HQE A;  2R92 B;  1NE3 A;  2PQA B;  2IX0 A;  3HS0 C;  4RCO A;  1AZP A;  4ZKB B;  3JAM i;  4DAM A;  1CKN A;  2NVY B;  5I6W A;  1TVX A;  1KDC A;  3AB9 A;  2EJG C;  2PZW A;  4PZ6 A;  3I8Z A;  1SNP A;  3CU7 A;  5AJ3 Q;  2O5J C;  2E2D C;  3PGZ A;  5CGK A;  3S2H B;  4DK6 C;  2A69 D;  2VQF L;  3ZYY X;  1EOT A;  3A8K E;  1EFW A;  4LF6 L;  5KRU A;  2YU9 B;  4JI1 L;  3GTG B;  1QCB D;  2YV5 A;  3HOY G;  3M3Y H;  4UP9 A;  1PZI D;  1S5F D;  5NUC A;  1H95 A;  3E0E A;  2G5D A;  3KBX A;  4LUV A;  1XTD A;  2D62 A;  1LAC A;  4C2M B;  3GTQ H;  5G3L D;  4TQU S;  1I4H A;  1O7L A;  4JOI C;  4KN4 C;  4QGU A;  2XN9 C;  2K5H A;  1PH1 A;  1HR0 Q;  1K8G A;  1HXY D;  1LTT D;  4DAY A;  2E74 C;  4KLK A;  4CDF C;  1CQV A;  1AZQ A;  1LUZ A;  2K5Q A;  1SYF A;  3I3C A;  4B9X A;  1N8R C;  1DD2 A;  3BS1 A;  1NMF A;  1A3T A;  2QKI C;  2QCP X;  4YY3 L;  3NBH A;  1KD1 C;  4L5R C;  4A3D H;  2L12 A;  1KAA A;  3SR1 A;  3H0G B;  3U9O A;  2F0M A;  4LUO A;  2JJQ A;  5JOB A;  1Q82 C;  3K57 A;  2JQO A;  1QNU A;  3E5S A;  4KHZ A;  3G6J B;  4QL5 A;  3LWU A;  1STE A;  3AEV A;  4DV0 L;  4FVM A;  2FFK B;  4K5V A;  5FJ8 G;  1EYC A;  4IQZ A;  2UU9 Q;  2K7V A;  4DPG A;  1O7I A;  3NSW A;  3S15 B;  2B2U A;  1X55 A;  2C9O A;  1LT6 D;  5LMN W;  4DV5 L;  3IFT A;  4RAU C;  3P75 A;  4JI6 Q;  3PV0 A;  1IYV A;  4MTK A;  3KOJ A;  3H91 A;  3G4S A;  4GN5 A;  3I4N G;  4BBR B;  5HGT A;  4BY1 B;  4BY7 B;  5CMD A;  1PTO D;  4GLV B;  3BDO A;  1J6Q A;  3T1Y L;  4RGM A;  1NJI C;  1BCP F;  4N9P A;  4LK1 C;  5E4W C;  3NTI A;  1AE2 A;  2A68 C;  4A3L H;  5J39 A;  2E2I H;  2AWN A;  1M1K C;  3FHW A;  3TSS A;  1M90 C;  4JI8 L;  2EYO A;  4V0B A;  4BBS G;  4NMZ A;  3N6R A;  2LFN A;  3PF4 A;  1VQ4 A;  1RKN A;  3QR8 A;  3SK4 A;  1E0B A;  4J8Q A;  4LUZ A;  3J81 j;  3GV6 A;  1BCP C;  1HCZ A;  3H0G G;  3RD4 A;  1EIG A;  1S72 A;  4DA2 A;  4A3G H;  1SDF A;  2WFW A;  3T1Y Q;  1HFG A;  4WFN 3;  2RDH A;  2X6G A;  2RKS A;  1LV9 A;  4K0K L;  2AUK A;  4JI5 Q;  1YEZ A;  4IFD G;  4LFB Q;  1A62 A;  2BH8 A;  1QUQ A;  2IX3 A;  2A6E D;  4OX9 L;  2VXW A;  4CJ0 B;  3QO2 A;  4RA8 A;  4X66 L;  4X64 Q;  1W6J A;  3BVM A;  4BY1 G;  3C3L A;  1SMX A;  3BVG A;  5EKL A;  4C2M H;  3MAQ A;  1FJG Q;  4HIM A;  4CDD C;  1C7Y A;  2XTI A;  5DM7 3;  3OTO L;  1JC7 A;  1ZYR D;  4R9W A;  3M4O B;  4BBS B;  3QOJ A;  5IT9 c;  3DEP A;  1FYC A;  5FO7 B;  3M7G A;  4IUV A;  1A2U A;  5JEA G;  1PH3 A;  3S1M H;  1RTO A;  3CD6 A;  1PXU A;  2E5L Q;  2N3S A;  2PQA A;  3QG1 A;  2UUC Q;  3DWP A;  1I4X A;  3MXP A;  1JB7 A;  1H9J A;  4IFD J;  4DR1 Q;  1ZXT A;  5CYU A;  5LL6 S;  1QOH A;  3HOU H;  2K32 A;  2CQA A;  1JE4 A;  1EWH A;  2PZU A;  5CBE E;  3CMA A;  3DUZ A;  3D8G A;  4Y7N H;  3OSO A;  1LYL A;  5K36 H;  4KD4 A;  2WAC A;  5K5P A;  3OHX C;  5EKI A;  1IW7 D;  2D0P A;  2VQF Q;  2YYZ A;  4QB4 A;  4LF8 Q;  4X64 L;  3D4W A;  1K8A C;  1DZ1 A;  4IUQ A;  4BY7 G;  1L2F A;  1X3E A;  4ZK9 B;  5JJK A;  3W3A A;  1FR3 A;  5D65 A;  5JVG 3;  1KRS A;  3RZO B;  3CKI B;  4CKB A;  4RG1 A;  3FVQ A;  4JOI A;  4GNX B;  1KAB A;  4JI0 L;  4ZUI A;  3HOY B;  2NN6 I;  4QUF A;  1HR0 L;  3ND8 A;  1EQQ A;  2RHQ B;  4AYB B;  3NE5 B;  1SLJ A;  3GTK B;  4NDX A;  2HDL A;  2R61 A;  3CQZ B;  3ZJY C;  3NBH B;  2JEB I;  1D5X C;  1K83 H;  2K5V A;  1KXL A;  5J1Z A;  3S1Q H;  1LTG D;  1KLU D;  1JIC A;  3J80 L;  3PO3 G;  2JXM B;  4DR6 Q;  1G29 1;  2KA7 A;  2VL6 A;  4DR7 Q;  5C5L A;  2PMZ E;  4DN4 M;  5JAV A;  4RGO S;  4QIW B;  1B9M A;  4YCU A;  4JC0 A;  4IZ8 A;  4IUR A;  2Z4I A;  4A3F B;  1Q81 C;  3C1E A;  1JJG A;  2MQH A;  1IBM L;  1V1P B;  4A3I H;  5KNB A;  2QDL A;  4LJZ C;  1D7Q A;  2A5H A;  2LXJ A;  4DR6 L;  1I5F A;  2ICE C;  1MJE A;  3R2T A;  4YCW A;  1A6X A;  3RMH A;  2A6H C;  3R3O A;  1K3R A;  2ZJP A;  1KQS A;  2F0O A;  4UY8 C;  4JK1 C;  2EQS A;  5CV6 A;  1DXM A;  2PZT A;  1L0W A;  3CW2 C;  1CI3 M;  1D5M C;  4RFB A;  4FXG C;  4OX9 Q;  3P20 A;  1S5E D;  1LT3 D;  1CSQ A;  1E3P A;  1PH4 A;  2RSO A;  1Q8I A;  3AU7 A;  1T5X D;  1WTR A;  1K9M C;  4B3M L;  1UAP A;  2NVT H;  2EYH A;  1VQB A;  4DV3 Q;  2K04 A;  2ZM6 L;  2YTV A;  1BCP D;  4L5Q A;  4O1N A;  1G8Z D;  5I2Y A;  2IHF A;  1Y69 U;  1TXY A;  1HRJ A;  1BBX C;  4OO1 H;  4C3I B;  1UE6 A;  4LNQ A;  3HOU G;  2BE5 D;  5CR3 A;  2EYJ A;  4DGZ A;  4ULL A;  3K5N A;  2AMC B;  4B3S Q;  4LFB L;  1D6E C;  1MKH A;  5HY6 A;  2QEJ C;  5D3I B;  1BDO A;  4C1N I;  1V8Q A;  2A73 B;  2B3G A;  1RD9 D;  1P16 A;  3PMF A;  1DCZ A;  4DF7 A;  2Q8I B;  3UE0 A;  3KF8 B;  4JI6 L;  3NQT A;  2NWG A;  3T1H L;  3S14 B;  4XXE A;  1EUJ A;  4JCV E;  4U67 3;  1ZEQ X;  2R92 G;  3OTO Q;  5I2X A;  1VQN A;  4HCS A;  1U4L A;  1EY7 A;  5FKA C;  2WB1 E;  2V1C C;  3UDF A;  1N33 Q;  5D3D A;  1S5C D;  1K3B C;  1UEA B;  2UXB Q;  1TWH H;  4A3J B;  1YNJ C;  2L4N A;  3G6E A;  1LTA D;  1VQL A;  4KY7 A;  2F0L A;  2K5N A;  4HMI A;  1HZA A;  4P73 A;  4X66 Q;  3URY A;  1JOO A;  1HZ9 A;  2F0E A;  5EBC A;  4IOA A;  3WOF A;  1B8A A;  1SNO A;  3FEW X;  3J81 c;  3PIP 3;  2OTL A;  1Z6H A;  2VS1 A;  3NWT A;  4K8I A;  5ELD A;  5BR8 L;  1WD1 A;  1QVF A;  2FIN B;  5HGQ A;  1K0S A;  3S2H H;  1JQY D;  2EOT A;  2WP8 J;  1JE5 A;  1AP0 A;  3PIO A;  3EN2 A;  1PTO H;  2ASB A;  4JBW A;  1YNX A;  5FO9 B;  2EYL A;  4YCV A;  3S17 B;  1Y8P B;  4KTA A;  1U4P A;  2KEC A;  3C46 A;  2ALY B;  3OWF A;  4IN3 A;  4A3B B;  3RN5 A;  3E3X A;  2AQ2 B;  2JK8 A;  4A3E G;  3NEL A;  2N88 A;  1TWH B;  1EIY B;  3MZ5 A;  2OXP A;  4YIJ A;  3AFP A;  2A6E C;  3K0Y A;  4CKC A;  4JPB W;  2B29 A;  1EZ8 A;  3RLN A;  2WAQ G;  5IT9 E;  2SDF A;  1YHA A;  2EIF A;  4B3M Q;  1C9O A;  1RHP A;  3PUV A;  2HHH Q;  1EYA A;  1SRO A;  5G3L F;  5FOB B;  4OON A;  5C3X A;  1SRU A;  2PMZ B;  3E9H A;  1HFN A;  1LTL A;  1DOL A;  1EZ6 A;  5BN4 A;  5C0X I;  3BDL A;  1CT1 D;  1MBY A;  2DUD A;  1TWF B;  3M7N A;  5IP9 G;  2XRQ D;  4R4T A;  1P8L A;  4APV A;  2RF4 A;  4KJN A;  4H7B A;  2LKV A;  3I72 A;  2ZXO A;  3HOZ G;  3GTQ B;  2B39 A;  1NUC A;  1NTG A;  2NZO A;  5ELF A;  1VS0 A;  1RCV D;  1ICF B;  2N55 A;  1QJO A;  1D1I A;  4H44 C;  4DV1 L;  1TWC H;  5AFW A;  1EY9 A;  5IYC G;  3GTM B;  1VQ6 A;  3I2Z A;  5BN3 A;  1QWY A;  4DUZ L;  4A3C H;  1F9Q A;  1CKN B;  1EIH A;  4F8M A;  1LTI D;  1TU2 B;  2KEE A;  4G7Z C;  2F52 A;  4IUU A;  4GKK L;  3W1G A;  4JYA Q;  3V2T A;  3C1F A;  4PQX A;  3IL8 A;  2PI2 A;  2Y0S G;  3DMU A;  4UDU C;  5IYB H;  1BNZ A;  2JA7 G;  4A75 A;  1FGU A;  1O7Y A;  1BOS A;  1XMO Q;  4I65 A;  4OEM B;  3O13 A;  4DUY L;  4N9T A;  4HJ9 A;  3RN2 A;  5K36 G;  2F0W A;  1FNW A;  2K50 A;  4A3J H;  1BCP B;  1HNZ Q;  2N49 A;  2YTY A;  4PMC A;  1VQH A;  4CDC C;  1E2W A;  3J81 i;  1SE8 A;  4QY7 A;  3I73 A;  5ELO A;  3TRE A;  2ZM6 Q;  3MFY A;  4LF4 L;  1B3A A;  4G7H C;  1XPR A;  3RLO A;  3KLW A;  5EQ0 A;  2ID0 A;  5HUR A;  1WCM B;  2JA8 G;  5KEE A;  5IP9 H;  2NZH A;  4WJ4 A;  3HOV G;  4P72 A;  2R7Z B;  3PO2 G;  3CRL C;  2O5I C;  1Y1V B;  3WWV A;  1HA6 A;  1QIL A;  2VZA A;  4JI2 L;  1Y8O B;  3TME A;  3L9A X;  5M3F G;  1PV4 A;  1K8M A;  4M1U B;  5JJL A;  3SXH A;  5TSS A;  4R8I A;  4FF4 A;  3EFX D;  4QUC A;  5I6Y A;  2A1A A;  2Q8R E;  4CDE C;  2JA7 B;  2B2Y C;  5M3M G;  1GUS A;  1I94 Q;  2M9V A;  3SHL A;  2WKD A;  4RMF A;  4A76 A;  1HNW Q;  1YVC A;  2GN5 A;  3G48 A;  4EX5 A;  4KV6 A;  2K1B A;  4YWK A;  1I6V C;  2WII B;  1E2V A;  2EJF C;  2F0I A;  3FKI B;  5DAU A;  1B44 D;  3T56 B;  3SE0 A;  1PH7 A;  1AN8 A;  4GKJ L;  2PCF B;  1PH9 A;  1TS2 A;  4JG2 A;  1EY0 A;  2J4X A;  2BE5 C;  3I4M H;  2I5H A;  1PRT D;  3K7U C;  4HJ5 A;  3DEO A;  1SE3 A;  2JA9 A;  4JV5 L;  1A3V A;  1SMY D;  4LF5 L;  3I7F A;  4X3U A;  2CKZ B;  1VQJ A;  2HDM A;  1SBB B;  2K5W A;  1PDQ A;  3W2D A;  3NXW A;  3D6C A;  1EY4 A;  5M3F B;  3MXU A;  5LHY 1;  3M4Q A;  3NPP A;  5IY0 A;  1KDB A;  1JJC B;  5KGU A;  3LWE A;  2R93 H;  2B8G A;  3CF5 A;  2VUM H;  4OEL B;  1OXV A;  2EE1 A;  5M5X B;  1CSP A;  3CCJ A;  3Q0A A;  1H9R A;  3BYY B;  5KND A;  4KK7 A;  1F9P A;  4MNO A;  1FL0 A;  2JA5 G;  4L5S A;  2DY8 A;  4B9W A;  4C1N K;  5CV7 A;  3GTO B;  4QCL A;  3ER0 A;  2UXD L;  5KIX A;  2D0O A;  4A4I A;  5IIF A;  1PLF A;  1EY5 A;  2EYM A;  1KAW A;  1I50 H;  4HN7 A;  4MN3 A;  1LTS D;  3WDN A;  3H3V C;  2NVQ B;  4DV3 L;  1K28 A;  1WYD A;  2HCC A;  1A8V A;  2OEO A;  1QB5 D;  5KYL A;  1PFS A;  5GAE C;  3VYS A;  2F4I A;  3KF6 A;  4KN7 C;  4TRD A;  2RCF A;  5COR A;  1S5D D;  1XWE A;  4GOP C;  1SJE D;  2JA5 B;  1A15 A;  3LX0 A;  2N8N A;  3VR3 A;  1G2T A;  1UEB A;  1M8A A;  3OIP A;  2R7Z H;  2FMC A;  2KCN A;  4RGT A;  5IGG A;  1QNK A;  2Z9H A;  5IYD G;  1SYE A;  1F9S A;  1IBL Q;  3VYU A;  3T13 A;  2E75 C;  3K6O A;  3NQI A;  2B63 G;  1G2S A;  3S1Q B;  4X65 Q;  4WJW A;  4J6H A;  3HOU B;  4ZYS A;  1G6P A;  1CA6 A;  1XNQ L;  4JI2 Q;  3NTK A;  1L0X B;  4FXK C;  4JI8 Q;  1DGS A;  1IXR A;  2F0Q A;  2LSS A;  1WCM G;  2JA8 B;  2ES2 A;  2NVY H;  3I70 A;  4N8X 1;  1Z7T A;  4PNY A;  2K01 A;  3WOE A;  2SNM A;  5EPK A;  4K5X A;  1PZK D;  2F0V A;  1N34 L;  1IBK Q;  2SOB A;  4GKJ Q;  2JEA I;  2DNC A;  4KMU C;  4A3K G;  4FYD A;  3QWN A;  3HEJ A;  4RGN A;  1ZKO A;  4DUZ Q;  3M4Y A;  4K0K Q;  2F3W A;  2BDN A;  3E0J A;  1GUW A;  4O2D A;  4BA1 I;  4LWC A;  4LAA A;  5M5Y B;  1F2Z A;  4KHV A;  4A3J G;  2IJ0 A;  1EL0 A;  4P74 A;  1KTK A;  3J80 c;  1YNN D;  5GAH C;  2HT1 A;  3NEM A;  2ZTE A;  2EZV A;  4LF5 Q;  4POG A;  1O7Z A;  5FO8 B;  2KEN A;  2B63 H;  4H13 C;  2XGT A;  1VQ8 A;  1W6K A;  1PFM A;  2WB1 G;  1CK1 A;  4BBR G;  4NXN L;  5JVH 3;  1MSG A;  2UUA Q;  2PYK A;  3S2D H;  1EWC A;  1X3Q A;  1QVG A;  2LY7 A;  4LFA Q;  4JBJ A;  1JOQ A;  5C4J B;  2G9D A;  1EIF A;  4A3D B;  3E9I A;  1KC8 C;  3HRZ C;  4R4O A;  5LMN L;  2BH2 A;  2M2L A;  1CM9 A;  1NMG A;  1SE4 A;  4Y7N B;  1Y14 B;  4Z9C B;  1XYI A;  3ICE A;  4XDX A;  4ABN A;  2FHT A;  1IKM A;  1AFP A;  4BBS H;  2H4O A;  5IOC A;  2QDB A;  2IY5 B;  1OXX K;  4JVZ A;  4NB3 A;  4A3K H;  3UDG A;  1STN A;  2VW9 A;  1S4Z A;  1TS3 A;  3V96 A;  2MGS A;  3IAY A;  1N32 Q;  2KUM A;  4FP5 D;  2B2T A;  2MFI A;  1YI2 A;  5AJ3 L;  2EXD A;  4B3R Q;  3MFG A;  4F7X A;  1STB A;  3TP8 A;  2F0G A;  1EQT A;  1PRT F;  2K14 A;  1C4Q A;  2M00 A;  2OQ0 A;  1Y1W G;  2L11 A;  1BR9 A;  3NHH A;  3FDT A;  4RKB A;  2FJ2 A;  3G7L A;  2C35 B;  4AYB E;  3K58 A;  2UXB L;  2BOS A;  5C4X B;  5FLX c;  3CCR A;  3MXN A;  3PUW A;  4DR4 L;  4HJ7 A;  3JAM L;  4J15 A;  1X3G A;  1A63 A;  1F77 A;  3BYT B;  1X3P A;  5CV5 A;  1RJT A;  4OGQ C;  4B08 A;  3U4V A;  3SK6 A;  1XX8 A;  5F2D A;  1GXD C;  4ME5 A;  4JV5 Q;  1V1Q A;  2R93 G;  4C3J G;  1LLR D;  3TS0 A;  5BR8 Q;  1R4P B;  4XT3 B;  2B8F A;  1TWG B;  5C6A A;  2D9U A;  2MO1 A;  2C5C A;  1KIX A;  3KF8 A;  4NXM Q;  1MSH A;  3BVZ A;  1PH8 A;  1WCM H;  2LXK A;  4FNF A;  1YHB A;  4XYO A;  3IRB A;  5J3B A;  4HR7 B;  2YTX A;  3FP9 A;  4E6I A;  1TY2 A;  2F0S A;  4QMG A;  4X62 Q;  4LMQ D;  2RQX A;  3RNU A;  2F0T A;  2ICI A;  1VQ9 A;  1BQQ T;  2ZTC A;  4GS3 A;  3TEH B;  3TZD A;  4HAE A;  3SVM A;  4EGV A;  2WKC A;  2E2J H;  4GZY C;  1L1O A;  5DEH A;  2K4K A;  4PMW A;  2DGY A;  2I46 A;  3J7Y W;  5E7N A;  1XXG A;  4IUN A;  3GTL B;  1SR3 A;  2PW7 A;  2X6L A;  1VQA A;  3KJP A;  5GRO A;  2JSO A;  4U68 A;  2R7Z G;  1CFM A;  2PNH A;  4LF7 Q;  3OPO A;  3P7J A;  1KLG D;  1I50 B;  5FLX L;  4JYA L;  1VCI A;  1MGS A;  2MJ8 A;  4BS9 A;  2PI2 E;  4UP7 A;  1D8L A;  2NVQ H;  4DV7 Q;  1DYQ A;  1BBW A;  4M8A A;  3STB D;  5IWA Q;  2NB0 A;  4Q0F A;  1W3S A;  3PUY A;  4CJ1 B;  2OT2 A;  1D1K A;  1FNV A;  1B9N A;  2I07 B;  2L5T A;  2AHO B;  5C5M A;  4NPS A;  1B2T A;  2XNA C;  2SEB D;  5LMU L;  4B3R L;  2A69 C;  5C0X G;  2UXD Q;  3HOY H;  4BWG B;  2UXC L;  4A3K B;  1R9T H;  4LFC Q;  4RH6 A;  4HED A;  4JI7 Q;  1OXU A;  3AYH B;  4LF4 Q;  2IPK D;  1JWS D;  1LTR D;  1FD7 D;  4A3G G;  1X65 A;  4R8N A;  2Z6K A;  3VA7 A;  2QA4 A;  4UAI A;  4UP8 A;  2A19 A;  4IOC A;  3PIP A;  1R4Q B;  4IJH A;  1Q8K A;  1I94 L;  2F3V A;  1VQK A;  1K8O A;  1DOK A;  2G9H D;  2KED A;  3VA5 A;  1HHV A;  1VF5 C;  3I91 A;  1RF2 D;  1WTH A;  1RL2 A;  3X3N A;  4LF9 Q;  3S15 H;  3TZU A; 
#chains in the Genus database with same CATH homology
 2ZXR A;  5EPL A;  1IW7 C;  2EDG A;  2VNU D;  1H9K A;  1G91 A;  2F0K A;  5A2Q L;  1PZJ D;  4IAL A;  5T1G A;  2NUC A;  1A3U A;  1LT4 D;  4IFD H;  3OWE B;  5JPM C;  5CV8 A;  1VMP A;  4G7O C;  1SNQ A;  2H1E A;  5KYI A;  3T53 B;  4EQO A;  2O2L D;  1WTP A;  4A3G B;  2B2T C;  5C3E B;  5IGE A;  4ZUJ A;  4EQN A;  2RVL A;  3D4D A;  4PV1 C;  4X3T A;  1ESR A;  3HOV B;  1E2Z A;  2A68 D;  1G6Z A;  1F2Y A;  2MUY A;  1SYC A;  4XT1 B;  1H9S B;  4K5W A;  2O4X A;  2BDO A;  3DXJ C;  4A3I B;  1T5E A;  2EY2 A;  3EQL C;  4KY6 A;  4RCN A;  1I4G A;  5ELC A;  2EXZ A;  3KLS X;  1D2B A;  3JAM E;  1ZYR C;  3J7A F;  5T1I A;  3EA6 A;  1KNA A;  1B53 A;  1Q3L A;  3IFD A;  3NK9 A;  1TR5 A;  3GD7 A;  1F2L A;  3TP7 A;  4FF3 A;  3MEH A;  3U9S A;  4C3I G;  2F03 A;  5D14 A;  4A3E B;  2NVT B;  2HUG A;  1Q12 A;  4V19 0;  3PUZ A;  1O78 A;  4KKS A;  5IOD A;  1TII D;  1KNE A;  2KJX A;  3HZX A;  4K6D A;  2QF7 A;  3TP6 A;  3TN2 A;  3ONA B;  3Q22 A;  1ET6 A;  2D5D A;  3VR4 A;  1NR2 A;  5E3F A;  1DON A;  1SYG A;  1V1O A;  2J7Z A;  3OIQ A;  2B2W A;  3KUP A;  1DM0 B;  1PTO C;  2CW0 D;  3D6W A;  1IYU A;  4KY5 A;  4CJ2 C;  5EKK A;  2Z1C A;  1EU3 A;  1NR4 A;  2VB2 X;  4ZKC B;  3BDC A;  2NN6 G;  1SNM A;  1EQV A;  1JCK B;  4HCE A;  1PFB A;  2BCO A;  2B2Y A;  1U4R A;  2OF1 A;  2Y0S B;  5CV4 A;  2WV6 D;  5EPJ A;  1EY6 A;  3I4L A;  3UI2 A;  3S9W A;  5E1F A;  3M3Y B;  3FPP A;  3X3M A;  1HQR D;  3ERO A;  3NBI A;  4C3H G;  4RWS C;  3HOW B;  2Z8L A;  4OL7 A;  2EJM A;  2NTT A;  5IGF A;  2ZT9 C;  1M4V A;  3L3O C;  1ENC A;  3GV3 A;  2F0F A;  5IT9 L;  2JE6 I;  3GQB A;  3NP8 A;  2BA0 A;  3AMU A;  2CVR A;  3NUC A;  3T16 A;  2F0D A;  1U4M A;  2NYZ D;  4L6T B;  1BUV T;  4DXG A;  1BO0 A;  3J81 E;  3MWY W;  1H9S A;  4DU9 A;  1MI2 A;  4QF4 A;  5M3M B;  3T51 B;  2L0C A;  4DFA A;  3CRK C;  4X3S A;  1UNS A;  5EBD A;  2B2U C;  4C3H B;  1VF7 A;  2F0N A;  3TDQ A;  1HTL D;  1S5B D;  4KD3 A;  1HA5 A;  1Q1B A;  2RBM A;  5J22 A;  3S1R B;  3J80 E;  2EY6 A;  2DY7 A;  3ITP A;  4EQP A;  1SSO A;  1I4Q A;  1RDP D;  1ROD A;  3IKJ A;  2MP1 A;  1FGB D;  5ELB A;  1Y8N B;  1MD2 D;  2JP1 A;  4C56 C;  2VB3 X;  1ENA A;  5C0X J;  2K03 A;  1IL8 A;  1EYD A;  4KI0 A;  2RDG A;  5JEA J;  3V05 A;  2EVB A;  3S16 B;  3P1H A;  3F2U A;  1JWU D;  1TT2 A;  1WTW A;  4WRD A;  1SYB A;  1PFN A;  5LL6 X;  5IGD A;  3FMC A;  4CKE A;  5I9P A;  1TS4 A;  3L7Z C;  2TMP A;  3DHQ A;  3MHB A;  2DN8 A;  5IGB A;  1GUN A;  3PO2 B;  5DM6 3;  4ODG A;  1B1Z A;  4OO1 I;  1V43 A;  3Q24 A;  4K14 A;  5CC4 A;  1WD0 A;  1PTO F;  2A74 C;  4RHS A;  1SJH D;  4RHR A;  1WTX A;  1STA A;  3MVV A;  5CV9 A;  3R93 A;  2EYP A;  1XTC D;  4XQJ A;  3C2P A;  1WTO A;  3LNN A;  3SK8 A;  1ILP A;  1GOZ A;  1TS5 A;  3FPU B;  5FLX E;  5C3W A;  4HSV A;  4L63 B;  3I4M B;  2WIN B;  1JOK A;  1GUT A;  3DM1 A;  3A56 A;  1QG7 A;  3S1N B;  4FF1 A;  2AUJ D;  4XQN A;  1STY A;  4DK1 A;  1VDZ A;  3QB3 A;  2ZXP A;  1ESF A;  3EVQ A;  3MTS A;  1GUO A;  4FO2 A;  1Q1E A;  3I4N B;  2NVX B;  2IWH A;  1RTN A;  1K83 B;  3K5O A;  1LTB D;  1AEX A;  3DWQ A;  4XYQ A;  2F0P A;  1II3 A;  2LS0 1;  3FRP B;  1GJX A;  3GTJ B;  4G57 A;  1JOR A;  3SK5 A;  3GP7 A;  4OHJ A;  1LO5 D;  3A54 A;  5M5W B;  3PUX A;  4DNT B;  4IFD I;  1R9T B;  2MHV A;  3HOX B;  3D3R A;  4NKL A;  2E2I B;  2R6G A;  1JR0 D;  2PQE A;  2Q8T A;  2V4D A;  2ENB A;  4ZAI A;  5A2Q E;  2EYF A;  2CW0 C;  4ZQ3 A;  4TKO B;  4IUT A;  3GO5 A;  3KBG A;  4K8J A;  3QOL A;  1HPC A;  2PW5 A;  3D31 A;  3H6M A;  1Y1W B;  1BXT A;  1STG A;  1ML0 D;  1L0Y B;  2K28 A;  2F1M A;  1TKW B;  4G4K A;  3E6Z X;  3N52 A;  3QJY A;  1CHP D;  1O80 A;  2R93 B;  3GTP B;  2DNE A;  3MC0 B;  1CZG A;  4NW2 A;  4ZRZ A;  1I4P A;  5A35 A;  4XQQ A;  4J1M A;  5JPN C;  3A8J E;  1HUM A;  5C4H A;  1EEI D;  3HP3 A;  5BN5 A;  2RDF A;  5ISR A;  3R8B A;  3OW7 A;  5JJZ A;  3A7A B;  4EVO A;  3CHB D;  3M85 A;  3KLR A;  2KCC A;  1F9R A;  5CBA E;  3OMC A;  4CGY B;  1EU4 A;  2XWJ B;  4OIJ A;  1DOM A;  2L1B A;  5EJW A;  2X69 A;  5EGT A;  5FK9 C;  3VYT A;  1QE6 A;  1CQF A;  1BF4 A;  4O42 A;  2KQ3 A;  1NAP A;  2AQ3 B;  1B4O A;  5C44 B;  3RUZ A;  2PO4 A;  3K7A B;  1NCV A;  1CHQ D;  1LT5 D;  1CZW A;  4MIU A;  3PO3 B;  2RSN A;  4DAP A;  5C0X H;  4KJO A;  2XSC A;  3T4A C;  2XIW A;  2JA6 B;  2PPB C;  3VR5 A;  1H9M A;  1EEF D;  2WAQ B;  4HSP A;  5KNC A;  4DAV A;  4IUP A;  4S3S A;  3S1M B;  2E76 C;  3SEB A;  4ZLT F;  3A55 A;  2F0H A;  1STH A;  2B63 B;  1JWM D;  2E2J B;  1FNU A;  1F2M A;  3S2D B;  3DWA A;  5I9O A;  2B2V A;  2R3Z A;  3KLS A;  4TSS A;  2IX1 A;  4A93 B;  4F87 A;  1I4R A;  1LAB A;  3K5L A;  4CHT B;  1UUP A;  1EFI D;  3NTH A;  2A6H D;  3HOZ B;  4BA2 I;  2Z4H A;  1Z47 A;  4PMB A;  1TWA B;  4DNR B;  3RZD B;  4K2L A;  4KKT A;  3J81 L;  2AWO A;  5IGC A;  5DNF A;  2IL8 A;  1JB3 A;  5M9O A;  1SAP A;  1B50 A;  1GHJ A;  2JYO A;  1A2T A;  2KOL A;  4FF2 A;  3R2I A;  2B2W C;  3J7A V;  4FXD A;  1CTM A;  1WTV A;  3I90 A;  4HMJ A;  3HKZ B;  2RA4 A;  3BG3 A;  1V1P A;  3TP5 A;  3K59 A;  2F0J A;  1U9R A;  2MPM A;  4HTH A;  3QIA A;  2L55 A;  3HGB A;  4DXF A;  2WB1 B;  2EPB A;  1VMC A;  1SNC A;  3H94 A;  1TQO A;  1CA5 A;  1YNJ D;  1SYD A;  1PMR A;  1PRT B;  2IT1 A;  4A3M B;  2K05 A;  2IW3 A;  4NP5 A;  4XTC S;  2NTS A;  4CBV A;  5I4D A;  1SE2 A;  1IHZ A;  2GA4 B;  1KDA A;  4K6L A;  4OIK A;  1GUG A;  1SND A;  2PNR C;  4C3J B;  1WVL A;  1C48 A;  4KKU A;  4XIG S;  2AQ1 B;  2TSS A;  1YNN C;  1Q90 A;  1OXS C;  3MXG A;  1HTP A;  5E4X A;  1PRT C;  2BA1 A;  5C4Z A;  4H0L C;  1C8C A;  3ERQ A;  2HCI A;  3A7L A;  1OXT A;  2SNS A;  3Q23 A;  3A8I E;  4WOR A;  1PYW D;  2VUM B;  1D5Z C;  3SDZ A;  2B2V C;  2K33 A;  5JEA H;  1AW7 A;  1ICW A;  2FMM A;  2XWB B;  4F88 A;  2LMC B;  4K2K A;  3ND9 A;  1DJR D;  1ENF A;  3VR2 A;  2KVM A;  4OO1 G;  5ELE A;  1IKL A;  3BZD B;  2KHS A;  3VYR A;  1HQM C;  4ID6 A;  4MHE A;  4X3K A;  3OMG A;  2L9H A;  1ONL A;  1PTO B;  2EY1 A;  4RKL A;  4ILW A;  1X32 A;  5COY A;  1SEB D;  2K6A A;  1I6H B;  1GHK A;  3H09 A;  2QIL A;  4P2C B;  3MA2 B;  4Q5V A;  2NN6 H;  3EJI A;  1ILQ A;  2XVS A;  2K5D A;  4L8J A;  3VR6 A;  1NSN S;  3K5M A;  3TBI B;  4DK0 A;  1ET9 A;  3RLF A;  2D2C C;  3D4R A;  1WTQ A;  2NZ1 D;  2F0U A;  4I7Z C;  3NWS A;  1I3Q B;  1TY0 A;  1OO9 B;  3OOC A;  3Q6S A;  1SFO B;  2E2H B;  3HG9 A;  1EY8 A;  3PIO 3;  1HUN A;  2XRS D;  1J8I A;  1TWC B;  1J9O A;  1SXT A;  2EY5 A;  2J0T D;  1SMY C;  3KK7 A;  2CHB D;  2NBF A;  2HQE A;  2R92 B;  3HS0 C;  2IX0 A;  4RCO A;  1AZP A;  4ZKB B;  2NVY B;  5I6W A;  1TVX A;  1KDC A;  3AB9 A;  2EJG C;  2PZW A;  3I8Z A;  1SNP A;  3CU7 A;  2O5J C;  2E2D C;  5CGK A;  3S2H B;  2A69 D;  3ZYY X;  1EOT A;  3A8K E;  5KRU A;  2YU9 B;  3GTG B;  1QCB D;  1PZI D;  1S5F D;  5NUC A;  3KBX A;  2D62 A;  1LAC A;  4C2M B;  5G3L D;  4TQU S;  1I4H A;  1O7L A;  4KN4 C;  2XN9 C;  1HXY D;  1LTT D;  4DAY A;  2E74 C;  1CQV A;  1AZQ A;  2K5Q A;  1SYF A;  3I3C A;  4B9X A;  1DD2 A;  3BS1 A;  1A3T A;  2QKI C;  2QCP X;  3NBH A;  2L12 A;  1KAA A;  3SR1 A;  3H0G B;  3U9O A;  2F0M A;  5JOB A;  3K57 A;  1QNU A;  3E5S A;  4KHZ A;  3G6J B;  3LWU A;  1STE A;  4FVM A;  2FFK B;  4K5V A;  1EYC A;  4IQZ A;  2K7V A;  3NSW A;  3S15 B;  2B2U A;  2C9O A;  1LT6 D;  3IFT A;  4RAU C;  3P75 A;  3PV0 A;  1IYV A;  3H91 A;  4BBR B;  5HGT A;  4BY1 B;  4BY7 B;  5CMD A;  1PTO D;  3BDO A;  4RGM A;  1BCP F;  4N9P A;  4LK1 C;  5E4W C;  3NTI A;  2A68 C;  5J39 A;  2AWN A;  3TSS A;  2EYO A;  4V0B A;  4NMZ A;  3N6R A;  2LFN A;  1RKN A;  3SK4 A;  1E0B A;  4J8Q A;  3GV6 A;  1BCP C;  1HCZ A;  3RD4 A;  1EIG A;  4DA2 A;  1SDF A;  1HFG A;  4WFN 3;  2RDH A;  2X6G A;  2RKS A;  1LV9 A;  2AUK A;  4IFD G;  2IX3 A;  2A6E D;  2VXW A;  4CJ0 B;  3QO2 A;  4RA8 A;  1W6J A;  3BVM A;  3C3L A;  3BVG A;  5EKL A;  3MAQ A;  5DM7 3;  1JC7 A;  1ZYR D;  4R9W A;  3M4O B;  4BBS B;  3QOJ A;  3DEP A;  1FYC A;  5FO7 B;  3M7G A;  4IUV A;  1A2U A;  5JEA G;  1RTO A;  1PXU A;  3QG1 A;  3DWP A;  1I4X A;  3MXP A;  1H9J A;  4IFD J;  1ZXT A;  5CYU A;  5LL6 S;  1QOH A;  2K32 A;  2CQA A;  1JE4 A;  1EWH A;  2PZU A;  5CBE E;  3DUZ A;  3D8G A;  3OSO A;  5K36 H;  4KD4 A;  2WAC A;  5K5P A;  3OHX C;  5EKI A;  1IW7 D;  2YYZ A;  4QB4 A;  1DZ1 A;  3D4W A;  4IUQ A;  4ZK9 B;  3W3A A;  1FR3 A;  5D65 A;  5JVG 3;  3RZO B;  3CKI B;  4CKB A;  3FVQ A;  1KAB A;  4ZUI A;  3HOY B;  2NN6 I;  4QUF A;  3ND8 A;  4AYB B;  3NE5 B;  3GTK B;  4NDX A;  2HDL A;  2R61 A;  3CQZ B;  2JEB I;  1D5X C;  5J1Z A;  1LTG D;  1KLU D;  1JIC A;  3J80 L;  2JXM B;  1G29 1;  2KA7 A;  5C5L A;  4DN4 M;  5JAV A;  4RGO S;  4QIW B;  1B9M A;  4IZ8 A;  4IUR A;  2Z4I A;  4A3F B;  3C1E A;  1V1P B;  5KNB A;  4LJZ C;  2A5H A;  2ICE C;  3R2T A;  1A6X A;  3RMH A;  2A6H C;  3R3O A;  2F0O A;  4JK1 C;  5CV6 A;  1DXM A;  2PZT A;  1CI3 M;  1D5M C;  4RFB A;  4FXG C;  3P20 A;  1S5E D;  1LT3 D;  2RSO A;  1Q8I A;  3AU7 A;  1T5X D;  1WTR A;  1UAP A;  2EYH A;  2K04 A;  1BCP D;  4O1N A;  1G8Z D;  5I2Y A;  1Y69 U;  1HRJ A;  1BBX C;  4OO1 H;  4C3I B;  2BE5 D;  5CR3 A;  2EYJ A;  4DGZ A;  4ULL A;  3K5N A;  1D6E C;  2QEJ C;  5D3I B;  1BDO A;  4C1N I;  1V8Q A;  2A73 B;  1RD9 D;  3PMF A;  1DCZ A;  4DF7 A;  2Q8I B;  3NQT A;  2NWG A;  3S14 B;  4XXE A;  4U67 3;  1ZEQ X;  5I2X A;  4HCS A;  1U4L A;  1EY7 A;  5FKA C;  5D3D A;  1S5C D;  1UEA B;  4A3J B;  1YNJ C;  2L4N A;  1LTA D;  4KY7 A;  2F0L A;  4HMI A;  3URY A;  1JOO A;  2F0E A;  5EBC A;  3WOF A;  1SNO A;  3FEW X;  3PIP 3;  1Z6H A;  3NWT A;  4K8I A;  5ELD A;  1WD1 A;  2FIN B;  1JQY D;  2EOT A;  2WP8 J;  1AP0 A;  1PTO H;  4JBW A;  5FO9 B;  2EYL A;  3S17 B;  1Y8P B;  4KTA A;  1U4P A;  2KEC A;  3C46 A;  3OWF A;  4IN3 A;  4A3B B;  2AQ2 B;  2N88 A;  1TWH B;  3MZ5 A;  2OXP A;  4YIJ A;  2A6E C;  3K0Y A;  4CKC A;  1EZ8 A;  5IT9 E;  2SDF A;  1RHP A;  3PUV A;  1EYA A;  5G3L F;  5FOB B;  5C3X A;  2PMZ B;  1HFN A;  1DOL A;  1EZ6 A;  5BN4 A;  5C0X I;  3BDL A;  1CT1 D;  1MBY A;  1TWF B;  3M7N A;  2XRQ D;  4KJN A;  4H7B A;  2LKV A;  3I72 A;  2ZXO A;  3GTQ B;  2B39 A;  1NUC A;  5ELF A;  1RCV D;  2N55 A;  1QJO A;  1D1I A;  4H44 C;  5AFW A;  1EY9 A;  3GTM B;  5BN3 A;  1QWY A;  1F9Q A;  1EIH A;  4F8M A;  1LTI D;  1TU2 B;  2KEE A;  4G7Z C;  4IUU A;  3V2T A;  3C1F A;  4PQX A;  3IL8 A;  3DMU A;  4UDU C;  1BNZ A;  1O7Y A;  1BOS A;  4I65 A;  3O13 A;  4N9T A;  5K36 G;  2F0W A;  1FNW A;  1BCP B;  4PMC A;  1E2W A;  3I73 A;  3MFY A;  1B3A A;  4G7H C;  5EQ0 A;  2ID0 A;  5HUR A;  1WCM B;  5KEE A;  2R7Z B;  3CRL C;  2O5I C;  1Y1V B;  1HA6 A;  1QIL A;  1Y8O B;  3TME A;  3L9A X;  1K8M A;  4M1U B;  3SXH A;  5TSS A;  4R8I A;  4FF4 A;  3EFX D;  4QUC A;  5I6Y A;  2Q8R E;  2JA7 B;  2B2Y C;  1GUS A;  2M9V A;  3SHL A;  2WKD A;  4KV6 A;  2K1B A;  1I6V C;  2WII B;  1E2V A;  2EJF C;  2F0I A;  3FKI B;  5DAU A;  1B44 D;  3T56 B;  3SE0 A;  1AN8 A;  2PCF B;  1TS2 A;  1EY0 A;  2J4X A;  2BE5 C;  1PRT D;  3DEO A;  1SE3 A;  1A3V A;  1SMY D;  4X3U A;  2HDM A;  1SBB B;  2K5W A;  1PDQ A;  3W2D A;  3NXW A;  3D6C A;  1EY4 A;  5M3F B;  3MXU A;  5LHY 1;  3NPP A;  1KDB A;  5KGU A;  3LWE A;  2B8G A;  1OXV A;  2EE1 A;  5M5X B;  3Q0A A;  1H9R A;  3BYY B;  5KND A;  4KK7 A;  1F9P A;  2DY8 A;  4B9W A;  4C1N K;  5CV7 A;  3GTO B;  4QCL A;  5KIX A;  5IIF A;  1PLF A;  1EY5 A;  2EYM A;  4HN7 A;  4MN3 A;  1LTS D;  3WDN A;  3H3V C;  2NVQ B;  2HCC A;  2OEO A;  1QB5 D;  5KYL A;  3VYS A;  2F4I A;  4KN7 C;  4TRD A;  5COR A;  1S5D D;  1XWE A;  1SJE D;  2JA5 B;  1A15 A;  3LX0 A;  3VR3 A;  1G2T A;  1M8A A;  3OIP A;  2FMC A;  2KCN A;  4RGT A;  5IGG A;  1QNK A;  1SYE A;  1F9S A;  3VYU A;  3T13 A;  2E75 C;  3K6O A;  3NQI A;  1G2S A;  3S1Q B;  4WJW A;  4J6H A;  3HOU B;  4ZYS A;  1CA6 A;  3NTK A;  1L0X B;  4FXK C;  2F0Q A;  2JA8 B;  3I70 A;  3WOE A;  1Z7T A;  4PNY A;  2K01 A;  2SNM A;  5EPK A;  4K5X A;  1PZK D;  2F0V A;  2SOB A;  2JEA I;  2DNC A;  4KMU C;  4FYD A;  3QWN A;  3HEJ A;  4RGN A;  1ZKO A;  3M4Y A;  2F3W A;  2BDN A;  3E0J A;  1GUW A;  4BA1 I;  4LAA A;  5M5Y B;  1F2Z A;  4KHV A;  2IJ0 A;  1EL0 A;  1KTK A;  1YNN D;  2EZV A;  1O7Z A;  5FO8 B;  4H13 C;  1W6K A;  1PFM A;  1CK1 A;  5JVH 3;  1MSG A;  2PYK A;  1EWC A;  1X3Q A;  2LY7 A;  1JOQ A;  5C4J B;  2G9D A;  4A3D B;  3HRZ C;  2M2L A;  1CM9 A;  1SE4 A;  4Y7N B;  4Z9C B;  1XYI A;  4XDX A;  4ABN A;  2FHT A;  1IKM A;  1AFP A;  2H4O A;  5IOC A;  2QDB A;  1OXX K;  1STN A;  1S4Z A;  1TS3 A;  3V96 A;  2MGS A;  3IAY A;  2KUM A;  4FP5 D;  2B2T A;  3MFG A;  4F7X A;  1STB A;  3TP8 A;  2F0G A;  1EQT A;  1PRT F;  1C4Q A;  2M00 A;  2L11 A;  1BR9 A;  3NHH A;  3FDT A;  4RKB A;  2FJ2 A;  3G7L A;  3K58 A;  2BOS A;  5C4X B;  3MXN A;  3PUW A;  3JAM L;  1F77 A;  3BYT B;  1X3P A;  5CV5 A;  1RJT A;  4OGQ C;  4B08 A;  3SK6 A;  1XX8 A;  5F2D A;  1GXD C;  4ME5 A;  4C3J G;  1LLR D;  1R4P B;  4XT3 B;  2B8F A;  1TWG B;  5C6A A;  2D9U A;  2C5C A;  3KF8 A;  1MSH A;  3BVZ A;  4FNF A;  4XYO A;  4HR7 B;  4E6I A;  1TY2 A;  2F0S A;  4QMG A;  4LMQ D;  2RQX A;  2F0T A;  2ICI A;  1BQQ T;  3TZD A;  3SVM A;  4HAE A;  4EGV A;  2WKC A;  4GZY C;  5DEH A;  4PMW A;  3J7Y W;  2I46 A;  1XXG A;  4IUN A;  3GTL B;  2PW7 A;  2X6L A;  2JSO A;  4U68 A;  1CFM A;  3OPO A;  3P7J A;  1KLG D;  1I50 B;  5FLX L;  1VCI A;  1MGS A;  2MJ8 A;  4BS9 A;  1DYQ A;  4M8A A;  2NB0 A;  4Q0F A;  4CJ1 B;  3PUY A;  2OT2 A;  1D1K A;  1FNV A;  1B9N A;  2I07 B;  2L5T A;  5C5M A;  1B2T A;  2XNA C;  2SEB D;  2A69 C;  5C0X G;  4BWG B;  4A3K B;  4RH6 A;  4HED A;  1OXU A;  2IPK D;  1JWS D;  1LTR D;  1FD7 D;  4R8N A;  3VA7 A;  4UAI A;  1R4Q B;  2F3V A;  1K8O A;  1DOK A;  3VA5 A;  2G9H D;  2KED A;  1HHV A;  1VF5 C;  3I91 A;  1RF2 D;  3X3N A;  3TZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...