1CHQD

Surprising leads for a cholera toxin receptor binding antagonist; crystallographic studies of ctb mutants
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKDEMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHOLERA TOXIN B PENTAMER
publication title Surprising leads for a cholera toxin receptor-binding antagonist: crystallographic studies of CTB mutants.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 22
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1995-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1chqD00
3R8BA 4UDUC 3BZDB 1D5ZC 1SJHD 1PRTB 3EFXD 5FK9C 1SEBD 3DWQA 1XXGA 1EEID 1S5ED 1TS4A 2J4XA 3W2DA 1CHPD 1D5MC 1D5XC 1I4XA 1TS5A 3KLSX 3R2TA 1V1PA 2NTTA 4K6LA 1PRTD 1BXTA 1I4PA 2RDHA 1M4VA 5FKAC 2G9HD 1LT3D 1EWCA 2NTSA 4O1NA 3V05A 1EFID 1KTKA 1HA5A 2O2LD 3BVZA 1I4RA 1BCPD 1TY0A 2ICIA 1PTOH 1B44D 1PTOB 4RGNA 1RF2D 1UUPA 1D6EC 1S5DD 1G8ZD 1V1OA 1MD2D 1HXYD 4C56C 1DJRD 1RD9D 1PZJD 1SE3A 1PRTC 1PTOD 3EA6A 5ELFA 3O13A 1SJED 1I4GA 4BWGB 4ZYSA 4RHSA 5D3IB 3DWPA 4RGMA 1BCPB 2AQ1B 1JWSD 2QEJC 1KLGD 2WV6D 2AQ3B 1BCPC 1LT6D 1JQYD 1CQVA 5ELBA 2XNAC 4OHJA 4Z9CB 1TS2A 1SE2A 1DYQA 1B1ZA 1S5BD 5ELDA 3BYTB 1EU3A 1CK1A 4RHRA 1I4HA 1CHQD 3OWEB 1V1PB 2RDGA 1PTOC 2XRQD 1SBBB 1FNVA 4RGOS 2QILA 3URYA 1RDPD 1AN8A 1ET9A 5TSSA 1PRTF 3TSSA 3SEBA 2XRSD 1ET6A 1PZKD 3MC0B 4RCOA 5ELCA 2Z8LA 2IPKD 3MFGA 1LTAD 1ENFA 1LT5D 1L0XB 1UNSA 1FGBD 1HQRD 1KLUD 1HTLD 1XTCD 2CHBD 2R61A 5D3DA 1L0YB 1LO5D 1AW7A 1CT1D 1JCKB 1T5XD 3R2IA 1SE4A 1S5CD 1GOZA 1JWMD 1TY2A 3GP7A 4L6TB 1PYWD 4L63B 5I4DA 1JWUD 3CHBD 1ESFA 4TSSA 1STEA 1LTSD 1PTOF 1LLRD 1QILA 2SEBD 1LTID 1LTGD 3BYYB 1S5FD 5ELEA 1FNUA 2IJ0A 3DWAA 1EEFD 1EU4A 1FD7D 4RGTA 3BVMA 1FNWA 1LTBD 3BVGA 1TS3A 4RFBA 1LTRD 1RCVD 4DXFA 2XN9C 1BCPF 1PZID 2TSSA 1LT4D 1I4QA 1LTTD 4RH6A 4DXGA 1JR0D 1F77A 2AQ2B 1SXTA
chains in the Genus database with same CATH superfamily
3VDYA 3KDFA 3NXWA 1EY5A 2J4XA 3S9WA 1TS5A 4B3SL 1JOQA 4IJHA 4OX9L 3X3NA 4NB3A 1X9NA 3D8GA 2FFKB 4FF2A 1CKOA 1KTKA 4QIWB 1CSPA 4DV7Q 5FO8B 3PO2G 1TY0A 3UDIA 5FLMG 1UAPA 2F0MA 2MGSA 4KLKA 4A3GH 2K7VA 3HOZG 2ALYB 5C3EH 1V1OA 1DJRD 3LWEA 2Q8RE 1YNJC 1AFPA 1Q46A 1YHBA 1NMGA 4ULLA 4OELB 4U673 3GTGH 4R4IA 3RD4A 4RHSA 1A62A 1QUQA 2JA8B 3P1HA 3PIP3 2QEXA 1X6OA 5CMDA 1G51A 2WV6D 3A8JE 4R8IA 1NE3A 1Q7YC 2G5DA 5I6WA 4GKJL 4RKLA 5C0XH 3NBHA 3CQZH 4Q0FA 1PH9A 4POFA 1HNXL 2QDBA 3HOVB 4C3IB 2K04A 4LF6L 2F0WA 1Q8IA 3MFYA 5KYIA 4K5XA 5KRUA 3A54A 1HRJA 2LXKA 1AN8A 4M8AA 1ET9A 3M7NA 4ID6A 1VQCA 3M4OH 1B7YB 2LSSA 5BN5A 3PUZA 3FKIH 4EQ5A 2WP8J 5G3LF 1G91A 2JQOA 3CCMA 3I73A 2XTIA 1F2LA 2AUKA 2Q2HA 5I6YA 4JK1C 4L8JA 1JC7A 1U4MA 4XYQA 5M3MB 1HZCA 3IKJA 1K0SA 3BU2A 2B2VC 4A3BG 1G6ZA 3I56A 1F9SA 3DEOA 2F0KA 2N78A 1YVCA 4UY8C 2NN6I 2R7FA 3TP5A 5BR8L 5M3FG 4LAAA 2CQOA 4DPGA 4ILWA 4A76A 3S17B 4QIWE 1O7YA 3BVMA 2I5HA 5IP7H 2H5XA 1LTBD 3ERQA 2WFWA 1MKHA 1LTRD 4X3UA 4JI8L 3JAML 4LUVA 2EYJA 2EY2A 2NZ1D 5LMNL 1I4QA 4KKTA 1OO9B 3S1MB 2ZT9C 1W3SA 1VQNA 4A3FB 3VYRA 4AQYQ 4F8MA 1GO3E 3RZOB 3MXPA 4IFDH 3CC7A 4HEDA 5IP9G 4N9PA 4JI2Q 4TVAB 1S3OA 1I4PA 2JA7G 3CW2C 2E76C 4ZRZA 2M2LA 3S15B 1KDAA 4DAYA 4XTCS 1N34Q 4AH6A 2J0TD 3OWFA 3QIAA 1QCBD 4TQUS 4B9XA 1RF2D 1UUPA 2A6HC 4P2CB 3ULLA 4LF9L 1XX8A 3NTHA 2L11A 3GV6A 4QF4A 3JAMi 2CCZA 3L2PA 5IGBA 4BBSB 3GTPH 1W6KA 4JI0L 2ZTEA 2PZUA 4ZYSA 3M4QA 2F0TA 1A15A 4F87A 1SNDA 3F2DA 2B8GA 5HGQA 4CJ0B 3UE1A 1JJ2A 2N8NA 1EYDA 1LV9A 3KLRA 3FMCA 3PMFA 1YJNA 2HIVA 1I4HA 3CCRA 3J81L 4A3EG 3FVQA 4X3TA 1PH1A 1U4LA 1RHPA 3GTLB 4DR1Q 1YZ6A 1EY7A 1ZYRD 4RCOA 4DV6L 2JA6G 5AJ3Q 1PH7A 5KNDA 1GUWA 1K8MA 2AUJD 3I4MG 5M5YH 2A74C 1KQSA 3E9IA 1TY2A 1KAWA 1DOMA 5IOCA 3FDTA 1UE6A 5I4DA 4IN3A 1A3TA 1VQ9A 4EQNA 3K81C 2D2CC 1HUNA 3PF5A 1U4PA 4DR7L 3OPOA 4GS3A 3J81i 4JYAQ 3RUZA 2K5WA 4TRDA 4C3HH 1HR0L 2NWGA 3A8IE 5L37A 3BVGA 3SK8A 4XT1B 5M3MH 1PZID 1LTTD 3K7AH 3ND9A 2AQ2B 3TDQA 1T5EA 4A3KG 1NR2A 4PZ8A 2KQ3A 4AIMA 4N8X1 3AFPA 4A3MG 2DNEA 1VQJA 5CGKA 4IOAA 1CHPD 3S17H 3I4OA 1XPOA 3E0EA 1BVSA 1SNPA 4EQPA 1DD2A 2QDLA 1IKMA 4P75A 2I07B 4X62Q 2R93B 1TWFB 2I0QA 4JCVE 4KKUA 3NELA 3GO5A 1K83B 2B2VA 1RD9D 5I2YA 4R4CA 4BA2I 1HFGA 4OWTB 3KBGA 4K0KQ 1I5FA 3E6ZX 2C5CA 4JBJA 1J5EL 4NXML 2PQEA 4BBRB 2F4VL 3G6EA 1SN8A 4A3DB 1JWSD 3ZYYX 2F0SA 4A93H 2Z4HA 1K8OA 5GQOA 4APVA 1F2MA 1FR3A 2JJQA 1FVIA 4H0LC 3W5OA 4I7ZC 3J7AV 4L5TA 5ELDA 4DR5Q 1CK1A 3T1HQ 1FJGQ 3S1RB 4IUVA 1WD1A 4QMGA 1PTOC 3L0OA 2QILA 2R92G 2RF4A 4KHVA 1B70B 2VW9A 2IL8A 1HZ9A 4DUZQ 1EQQA 2PMZB 2UXDQ 2IPKD 1DXMA 2D5DA 4DR4Q 2M9VA 1L0XB 3Q23A 1KLUD 4M1UB 4IUTA 2BDOA 1LO5D 1UWVA 5E1FA 1STGA 3MTSA 1S40A 2A6EC 1JCKB 2OT2A 5HY6A 4CDFC 5JPMC 3QB3A 5BN3A 5HGTA 3A5UA 4FF4A 4ZCKA 2NVQB 3M4YA 4Q5VA 3S1NB 2EY6A 1AH9A 3MA2B 3H3VH 4O42A 1B3AA 3HOXG 3M7GA 1A3VA 1EWIA 3K5NA 4C3JB 2B63G 1OXXK 3K5OA 4HTHA 4DV2L 2JA5B 2RCFA 4NW2A 2EIFA 4HCSA 4CDEC 5LMUQ 2TSSA 2MNAA 4BS9A 3OIQA 2L12A 2MUYA 1STBA 2A69C 1KL9A 4C2MH 1S5ED 1JMCA 2VQEL 3I7FA 3OW2A 1M1KC 1D5XC 1BBUA 3R2TA 2HHHQ 1V1PA 2L55A 4DR3Q 1PRTD 2K28A 1PYSB 1O78A 4GKKQ 1YBYA 3RN5A 3LX0A 4OWWB 4BY7G 3EVQA 4DAVA 3UE0A 4PV1C 1LYLA 3CMAA 5IE8A 4KJOA 4PZ6A 5FLXE 4DV3Q 3VA7A 1LACA 4XXEA 3GTJB 1GHJA 1C9OA 3CP0A 3MXNB 1QWYA 3MHBA 2ZTCA 2PQAA 4QL5A 3F8TA 3H0GH 3DWPA 1WOCA 2F1MA 4B3ML 3CPWA 4K6DA 1SNOA 2KA7A 2YV5A 4LFAQ 2AQ3B 1WTVA 4UAIA 2UUBQ 1B53A 1YJWA 1N9WA 1KHIA 4Y7NH 4X66L 3NTKA 5EQ0A 5I9OA 1N33L 1S72A 1FGUA 2K5NA 1KABA 4R8NA 1VQOA 1K83H 1Y1VG 3OWEB 4KHZA 4HJAA 1II3A 4IJLA 2UUAQ 3K80C 2EYHA 1Z7TA 3F2CA 1RDPD 4CDCC 1Z6HA 3MXNA 5CV7A 4WJ3M 3BS1A 5CV4A 4A3DH 4BXXH 4FO2A 2ZXOA 1ENFA 2CHBD 3VR2A 5C4XG 1PH2A 2ENBA 1HTLD 2NN6G 2B2UA 1MJEA 1Y8OB 2EJMA 3Q22A 4X3KA 4QUFA 1YNND 2MQHA 1D2BA 2SNSA 3C1EA 4B3RL 3S1RH 3ONAB 5I9PA 4LFBQ 2MHVA 1LLRD 2K75A 2UXDL 4XIGS 2AWNA 4CJ1B 1Y14B 2WB1E 3RN2A 2IX1A 2OEOA 1HFNA 3AEVA 4G57A 4J8QA 3HOUG 2KOLA 4RFBA 1W6JA 2JEBI 1MGSA 2HQEA 3NE5B 2VB3X 1PFSA 2IW3A 2J7ZA 1KRSA 2PPBC 1IL8A 3S14B 3OYYA 3JAMc 3BZDB 1YITA 1K0RA 3S1NH 4HSVA 5C0XI 3A74A 1M8AA 3I72A 1OXVA 5GROA 2MJ8A 3A8KE 1BBWA 1EEID 1I4XA 5M5XH 1Q82C 1E24A 2DJGC 5LMUL 3BDCA 2KJXA 1EFID 4G7HC 2VB2X 5C4HA 4LMQD 4A75A 3GTOB 3OW7A 3BDLA 4YY3Q 4A3LG 5C3EB 1ONLA 2JYOA 1VF5C 2LY7A 1L1OB 2NVXH 3CKIB 2EJFC 1RTNA 4K8IA 1ESRA 4KJNA 3J80c 3D6WA 2YTYA 3A5ZB 1PYBA 2PO4A 1XTDA 2N49A 3PO3G 3PCOB 4X6AH 4DNIA 1K8AC 3MVVA 3CCLA 3CQZB 2CW0C 1J8IA 3PO2H 1QJOA 5FLMH 3GTJH 2F0NA 2E5LQ 4BA1I 3OTOL 4RKBA 4RGOS 3CF5A 1BBXC 1WTOA 3HP3A 1X3FA 4JI6Q 5TSSA 1GD7A 3J81c 3CCSA 3M4OB 2HCCA 2MFIA 3RZDH 4IFDI 1UNSA 3S16H 2F0PA 3DXJC 3FPPA 5C4JB 1WTXA 4Y52H 3CCEA 1ICFB 2HD3A 4NKLA 2UUAL 1AE2A 1K3BC 4LF7Q 1PH3A 1H9RA 3A56A 4L6TB 1PYWD 2F4IA 4TSSA 4B9WA 1STYA 4GOPB 3LGJA 3LWUA 3NWTA 1XYIA 1SSOA 2F0UA 2CVRA 1K73C 4R4TA 1K3RA 2FMCA 4GN4B 4QY7A 5EKIA 4K2KA 5EAYA 4JI3L 1WTHA 1Y8PB 4QGUA 1VQFA 3W3AA 3CCQA 4DKAC 1IKLA 1QOHA 1H9MA 1MSHA 1SRUA 5FJ8G 1SXTA 2XGTA 5C0XJ 1PRTB 4DV0L 4A3BH 1I6HB 4BY1G 3C3LA 4LK1C 2L4NA 5M3FH 3KLSX 4QQBX 3S2HH 4JI1L 1TWAH 5EKKA 1A8VA 3RLNA 4C1NI 2YYZA 2K5QA 1DCZA 3V05A 2KVMA 3V2TA 3H09A 3MEFA 3PUWA 4OONA 2ICIA 1KIXA 1PTOH 2HCIA 4DK3C 3S14H 2Y0SE 1MD2D 5EPKA 4LFCL 1TU2B 1BUVT 5JEAJ 1TKWB 4L5QA 3K0XA 1PH6A 3GTPB 3R3OA 4LNQA 5D3IB 1IHZA 1CKMA 1C0AA 5IP9H 1BCPB 2WAQB 1H95A 2JA7H 1R9TB 1PXUA 1QVFA 2MO1A 1SFOH 2D9UA 2XNAC 3GTOH 1IZ6A 4JV5Q 3T13A 1B1ZA 3T53B 5EJWA 3GQBA 4KD3A 1HNZQ 1GUTA 2EZVA 3CC4A 3J81j 4JI5Q 2RDGA 1EL0A 1HH2P 2XRQD 4PZ7A 1JJCB 1Y8NB 3SDZA 1F2ZA 1XNQQ 1MSGA 5H1SE 1PRTF 2WB1G 3STBC 4HAEA 1TWCH 4O2DA 4IFDJ 3MFGA 2CH4W 3IRBA 1K8GA 2KECA 3HRZC 4X65Q 1Y1WG 3SVMA 5F2DA 2UUCL 4MTKA 2E5LL 1AEXA 1WJJA 1SE4A 1TT2A 4P71A 4XT3B 4QCLA 5M5YB 3SK5A 5C6AA 1U5KA 2A68C 1SR3A 5DM73 1DZ1A 4RG1A 2KHIA 3VYTA 2Q8TA 5IYBG 4A3EH 1N36L 1RTOA 2IJ0A 3DWAA 3EN2A 1XWEA 2UXCQ 4C3HB 5J22A 2F0GA 5C4JH 1KAAA 1TS3A 2JA6H 4A3JG 4KY7A 1BCPF 4YHHL 1SNQA 4JPBW 2TMPA 1CKNB 5KEEA 2PZWA 3GTMH 2FXQA 5E4WC 4DXGA 1JR0D 4A3IG 3EJIA 1WTWA 3I4MH 4KKSA 3K7AB 3HOYB 2CKZB 2OTJA 3FPUB 4V0BA 1SJHD 5JEAH 1NAPA 2A6HD 4MZ9A 1WCMB 4DAPA 2HDLA 2K6AA 4IUNA 1SEBD 2VY3A 1SYGA 3TS2A 2R7DA 1SYCA 3I55A 2WAQE 3KK7A 4CDDC 2NVTH 2YTVA 2JP1A 1Q3LA 3IL8A 2R7ZG 5IWAQ 5EBDA 5DEHA 4A3CG 4H7BA 2L9HA 4IPGA 2O2LD 1IW7D 5A2QL 2ATWA 1B44D 3VR5A 4YIJA 1T9HA 1SNMA 1EQRA 4PMWA 1I6HH 4RCNA 4A3KH 1PZJD 2E75C 3G48A 3DUZA 4A3MH 1LUZA 2ZJRA 4C1NK 1VQKA 2WINB 2B3GA 2UU9L 3I90A 4GNXB 3H3VI 1JOOA 2DNCA 4A93B 4O0AA 1JB3A 3KLWA 3D6CA 3OHXC 2O5IC 5IYDG 5CV8A 5IGCA 5HURA 2C35B 4HIKA 2K5HA 4ZKCB 2MP1A 5EPJA 3ERSX 1BF4A 2OQKA 5IY0A 1STHA 1TR5A 1QNKA 2PW5A 1C48A 3NP8A 2PYKA 2EE1A 2L1BA 1NR4A 3PUVA 5DAUA 4DV7L 3VYSA 3NWSA 1LTAD 1H9JA 4OGQC 1CZGA 1R9TH 1MJCA 1FGBD 5D3DA 5E4XA 3SXHA 4A3GG 1LTLA 1JWMD 3I4NB 2K50A 1N32Q 3ND8A 3AQQA 1YI2A 3H91A 3Q8DA 4K14A 1LTID 2RVLA 3A0JA 2EOTA 3BYYB 2F0LA 4X65L 1BQQT 3ULPA 2R92H 1EU4A 2EQSA 3Q24A 1VQ8A 3PIOA 1TXYA 4IALA 1OXSC 2OQ0A 2Y0SG 1DGSA 4X64Q 1FL0A 4WJWA 3G4SA 4QJFA 4GN5A 4C2MB 3WOEA 3FKIG 2HIXA 3DWQA 1TWHB 4K2LA 2UXCL 2KCNA 3TQYA 1HJPA 3K8AA 3HOXH 1D8LA 1BXTA 1EWCA 1QVCA 3L3OC 2B63H 1C4QA 1IYJB 1E1OA 1WD0A 4DFAA 1QVGA 1Z47A 3RNUA 1EOTA 3KYHC 5IGDA 3HOYH 3SR1A 4HIMA 2IT1A 4HSPA 3FRPB 4C56C 1B50A 1WCMH 1CUKA 5C5LA 4DV4Q 2VUMB 1GUOA 1PTOD 1X54A 2XVSA 3TZDA 1VQ4A 3GV3A 1OXTA 2O4XA 4JI7Q 2FHTA 4FXGC 4PG3A 3H0GB 2AQ1B 5CV6A 1GXDC 5JJIA 2BH8A 2B2UC 5CORA 4YCVA 5J3BA 1JQYD 1E22A 3X3MA 4BY7H 4Y7NB 3S2DB 3HOWG 2PZTA 4AQYL 3AMUA 2A6ED 1TIID 4N8FA 4AYBB 5EKLA 1BOSA 1FNVA 4JI2L 3K59A 3CU7A 5C3WA 2JK8A 3RLOA 1CZWA 3QG1A 4K8JA 5KYLA 2JSOA 4TKOB 3QR8A 4DNTB 1N34L 2A73B 3QWNA 1NCVA 2KCMA 3FEWX 5C44G 1LT5D 3JAME 1JJGA 2EY5A 1SMXA 3U9OA 1F9PA 2KEDA 2ZXPA 4YWMA 4CHTB 4JBKA 2V1CC 3OMGA 4DGZA 1IBLQ 1SMYC 1XNRQ 1JWUD 1HHVA 2R6GA 3KF6B 1CA6A 1H9SB 1LTSD 1STEA 1Y1VH 1QILA 4OO1H 2EYPA 2EPBA 2MPMA 2CWPA 1ILPA 1M90C 2ES2A 3DEPA 2B2YC 2BE5D 4HJ8A 4R4QA 2OXPA 5I2XA 1RCVD 2Z9HA 4XDXA 5CR3A 5C4XH 1STAA 1N32L 2IX3A 4GLVB 1SNCA 1UEBA 2DUDA 3I4NH 3HS0C 1X56A 5C5MA 3EFXD 2BCOA 4DR1L 5NUCA 3J80E 2JA8G 3E0JA 3KF6A 5CC4A 4GZYC 5AJ3L 5M5XB 1YHQA 3M85A 1SYFA 3BZKA 3KF8B 1EY0A 3HKZB 4DUYQ 3G6JB 1P8LA 1HA5A 3AU7A 3HOUH 1I4RA 3HOVG 4ABNA 4C3IG 2ICEC 3TP6A 3IAYA 3J81E 1VQEA 1RKNA 4LUZA 4MHEA 4LWCA 5IT9L 3L7ZC 2B2TA 2EVBA 3MZ5A 1TWHH 3U4ZA 2K03A 4JYAL 2RBMA 3O13A 2VNUD 1G2TA 4LF5Q 5JOBA 2AWOA 1ENAA 2NVXB 1L1OC 1AZQA 4DV5Q 5M3MG 1IBKQ 1H9KA 5CBAE 1CQVA 1XMQQ 3KF8A 1SLJA 1NJIC 4Z9CB 2FJ2A 1VS0A 1HNWQ 2VL6A 3PO2B 4IQZA 2P5ZX 3HOZB 2PCFB 5GAGC 2VUMH 3EBEA 3U4VA 2OCEA 3DMUA 1SYDA 1RJTA 3RMHA 5IYCH 3AFQA 3R93A 2PMZE 3MC0B 4X62L 2Z8LA 2VQFQ 2B39A 4IUPA 3RZDB 2R61A 3S16B 1JORA 4A3FG 3PO3H 3S2DH 1T5XD 1S5CD 1HPCA 1TVXA 2E2DC 2KBNA 3M4PA 3PQIA 1EYAA 3BJUA 4HCEA 1ZKOA 1BKBA 3CAMA 4DR2Q 4K0KL 1ESFA 1HUMA 1F9RA 3W1GA 1IL2A 3S1QH 2IWHA 1OTCA 2GVBA 2PI2E 5GAHC 2HDMA 3KOJA 4I7AA 5G3LD 3TMEA 1S4ZA 3F2BA 2Z6KA 3MEHA 3NBIA 1JOKA 2JXMB 4FF1A 2I5MX 4DR5L 2LKVA 1XNRL 4P74A 3T1HL 1EIGA 1FJGL 1LT4D 3NTIA 3AB9A 2QGQA 4BBSG 2RSNA 4IPCA 3H15A 1E2WA 1L0WA 4WFN3 1GHKA 4A3BB 5C4ZA 1HZAA 4DUZL 4UPAA 2UXBQ 4LJZC 3I91A 4KD4A 4EGVA 5M3FB 4DR4L 2B29A 3S2HB 3CD6A 4OIJA 1TWAB 2DJFC 2C9OA 3QOLA 3P20A 4HN7A 5T1GA 3D4WA 1CI3M 2Q2TA 5K36G 4LF8Q 1PTOB 4L5RC 2ZM6Q 1X3EA 4DR6Q 1E1TA 1QNUA 2CW0D 4H44C 1IBMQ 3OOCA 4IURA 1VF7A 4JI4Q 2AHOB 4BY1H 4JOIC 1ICWA 3B6YA 2PNRC 1XMOQ 1I4GA 4POGA 1VQAA 1QG7A 3PF4A 2B2YA 1VQ7A 3MWYW 2HQLA 3P7JA 1BCPC 1LT6D 2JA7B 3VR3A 2D62A 1C7YA 1SFOB 1SE2A 1V43A 4NXNQ 1GJXA 4R1JA 2L0CA 1CHQD 1SBBB 2HHHL 4DR3L 5JJLA 4DV5L 4X3SA 4DAMA 2Q2UA 4GKKL 4YWLA 3I4LA 4ALPA 3MAQA 3PIPA 5ELCA 4B3SQ 1TWCB 4RWSC 4WJ4A 4JBWA 4OX9Q 4S3SA 3UI2A 4DV3L 4PQXA 2B8FA 3KBXA 5ELOA 4PMBA 5IGFA 1SYBA 2NVYH 3HOZH 2E74C 3KJPA 2AKWB 1PTOF 1P16A 1G6PA 1B8AA 1GUGA 2FINB 4A3EB 3D0FA 3H94A 4LFAL 2R93G 2E2IH 3GD7A 2UUBL 1L1OA 1SAPA 1O7LA 2DY7A 2RHSB 5CYUA 3CXCA 5LL6X 4UP7A 1YHAA 4DXFA 4A4IA 5IODA 2XN9C 1F9QA 4DV1Q 1Y1WH 2JA6B 4DR2L 3M3YB 3M9BA 3G7LA 2F0QA 1F77A 4GKJQ 3GTMB 2DGYA 2LMCB 4UDUC 1Q81C 4B08A 1BR9A 3I4MB 1A3UA 3TP7A 4U68A 5FK9C 4IOCA 4ZAIA 5JPNC 1ZXTA 4BBRG 4A3DG 5IYBH 2F52A 3P75A 2A8VA 4L5SA 4OXPA 2NVTB 1LT3D 2IHFA 3J7A5 1A63A 2EJGC 5J1ZA 4UHVA 3TRZA 2GVAA 4A3JH 1KDBA 2XWBB 3KLSA 4HMJA 5EBCA 1PV4A 1WYDA 2N3SA 4NP5A 4LFBL 1VQMA 1D6EC 5LHY1 1EUJA 5DM63 2UXBL 4A3IH 2K05A 3PUXA 2Q8IB 1PA6A 1F2YA 3NUCA 1D7QA 4A3KB 1JB7A 3IFTA 1YNJD 4A3MB 5BR8Q 4GOPA 2R3ZA 5CV5A 3ICEA 1J9OA 4G4KA 3STBD 3A55A 4GNXC 2F0VA 3U50C 2R7ZH 1DOKA 2NUCA 4OHJA 5T1IA 2KUMA 4A3CH 2CQAA 3KDFB 2YU9H 3HKSA 3EIVA 4JI8Q 2A5HA 3V96A 2ZJPA 2BH2A 1HZBA 1Q1BA 2Z1CA 1Q1EA 4C3JG 2F0OA 5JJKA 3H6MA 2KEEA 4YCUA 2ZJQA 3QJYA 3Q0AA 3TSSA 2XRSD 2JA5G 1EQTA 1N8RC 1X32A 4MIUA 3QO2A 2VZAA 5KNBA 4N9TA 1EIHA 2SNMA 2EDGA 2QW7A 4HIOA 4YY3L 3PSIA 4FYDA 4JVZA 1QB5D 3K7UC 3IFDA 4FXKC 1GOZA 3CRLC 3A7LA 1I50H 5IYDH 1RIPA 3VA5A 3EROA 2QA4A 1QUQB 4LF9Q 1ZEQX 4JG2A 4F7XA 4DA2A 4DNRB 3HGBA 5ELEA 1FNUA 2NB0A 4R4OA 4JOIA 3H3VC 1D1IA 5M5WB 4KHPQ 1NNXA 2LXJA 2R92B 1FD7D 3S24A 5J39A 3CCVA 1J6QA 3NBHB 1BNZA 4JI0Q 1TQOA 2E8GA 4FVMA 1YIJA 3WDNA 1VQIA 1NY4A 2B2WC 4KY5A 1D1KA 1YNXA 4JI6L 3ER0A 1EYCA 5K5PA 3DM1A 1X3GA 5IGEA 5FOBB 1E2ZA 1TS4A 1YEZA 4CBVA 1Q90A 5D65A 4K5WA 3HOXB 2RDHA 2QF7A 4DV1L 1OXUA 2NTSA 2KCTA 2B63B 4PNYA 4DV6Q 3NENA 2WKCA 4LF7L 3M3YH 1EWHA 1RODA 1SYEA 2Z6BA 4DK0A 3TREA 4MN3A 2VS1A 2O5JC 2EY1A 3EA6A 1B3QA 2RQXA 2ASBA 2NBFA 1MBYA 5IT9c 4OO1I 3J7AF 4IZ8A 2F0JA 4DR7Q 4K5VA 1PHJA 2K14A 1HR0Q 4J15A 2E2HH 3FHWA 1CSQA 1I3QH 4KN4C 4WRDA 2F0DA 1CQFA 1Z9FA 3N52A 4BY7B 3I70A 1PFMA 3KFUA 3BYTB 3FP9A 4RHRA 3U9SA 1CKNA 4RA8A 4GLXA 1X55A 3SEBA 4DAYB 2HT1A 1ET6A 2E2JB 4MTNA 3PUYA 3CCUA 2A1AA 1L2FA 1DONA 1XTCD 2EYOA 4NMZA 2G9DA 5IGGA 1AW7A 2K33A 5LL6S 2H1EA 3GP7A 3MXGA 4R9WA 3HOWH 4L63B 3C2PA 3TZUA 4XYOA 4IPHA 2N55A 1E0BA 1Y1VB 1S5FD 3LNNA 3GTQB 1XPUA 2N88A 3SGIA 1PH8A 2L15A 1J5EQ 4NXMQ 2K5DA 4JV5L 2F4VQ 5C44H 4ZUIA 4GNXA 4JC0A 1U0LA 2X6LA 1HNZL 2I46A 3HZXA 1BO0A 4JI5L 1XPRA 1MIUA 5C4XB 5C3EG 1G291 1EYGA 1I6VC 3R8BA 1XNQL 5ISRA 2F3WA 3ZJYC 3GTKB 2IX0A 4FXDA 4G7OC 2B2TC 4PMCA 4KHPL 1STNA 3J80L 2F0HA 1EZ6A 2SOBA 2WACA 5M5WH 2CWAA 1KDCA 2LS01 3E3XA 4J1MA 2EXZA 2G9HD 1EZ8A 3T1YQ 5BN4A 4OWXB 2Q2IA 1IW7C 1UE5A 5C0XG 1Q8KA 1SE8A 4RMFA 1LABA 3D31A 2RHQB 3HOUB 1SDFA 3A7AB 4ZQ3A 3I3CA 5KNCA 1W2BA 1S5DD 1UE1A 1SROA 3BG3A 1R4PB 3NQTA 4HMIA 3T16A 3HEJA 1WVLA 2JA8H 1JT8A 2JE6I 3JC66 4EX5A 5ELNA 1DOLA 3J80i 2QEJC 4DV2Q 2F3VA 5KGUA 2F03A 3WWVA 2QCPX 5JEAG 5FO7B 1EY4A 2B2WA 3HOVH 4C3IH 1EU3A 3K5LA 3UDXA 5FLXL 1SMYD 3MXUA 1Q86C 4H02A 5E3FA 4P73A 3TP8A 4RAUC 4F88A 5IWAL 4IUQA 1EOVA 5IP7G 2Z6KC 2VQEQ 3E9HA 2X69A 1U4RA 1MHWC 1JICA 2ZTDA 4HJ9A 1VQPA 1L0YB 3K6OA 2X6GA 4OIKA 1VCIA 1CT1D 3PO3B 1IYUA 2IY5B 3KUPA 3SK4A 4ZLTF 2Z4IA 1VQLA 1K9MC 4J6HA 4DN4M 4IFDG 3UDGA 4LF4Q 2SEBD 4H13C 2GN5A 1ZYRC 2YTXA 1B9MA 3S1QB 2NYZD 1NBWA 2E2JH 4XQNA 1EEFD 2I5LX 2OTLA 3PGZA 1NSNS 2FMMA 2WIIB 3GDEA 5A2QE 4B3MQ 4ZK9B 2ZXRA 3S1MH 4A3FH 3EQLC 4X66Q 5JJZA 1N33Q 3RZOH 4OEMB 5E7NA 5EPLA 1EY8A 2A69D 3W2DA 3K57A 1D5MC 1A6XA 1IYVA 2WAQG 3TN2A 3GTQH 5AFWA 3S15H 3W1BA 1PH4A 1M4VA 5FKAC 4O1NA 3SE0A 3N6RA 1KNEA 3ITPA 1VQ5A 2NN6H 4CKEA 2QKIC 4LW1A 3GTKH 1EIFA 3L9AX 4HJ7A 4NDXA 4BBSH 4B3RQ 1JE4A 1U9RA 2EYLA 4P72A 4QUCA 2M00A 3T1YL 1I94Q 4BY1B 1SJED 1KRTA 1CFMA 4UP9A 1H9SA 5C3XA 3BZCA 5COYA 4IPDA 1O80A 2K32A 2L5TA 1B9NA 4KV6A 3CCJA 4X64L 3CPFA 1KXLA 2VXWA 1DYQA 3QOJA 1S5BD 1WTPA 3K0YA 4KMUC 4CKBA 1EY9A 4AYBE 1GVPA 5K36H 4DF7A 2GA4B 1V1PB 5KIXA 3Q6SA 1DM0B 1GKHA 2D0OA 3C1FA 3HFZB 4KK7A 4OL7A 4YCWA 3GTLH 3AYHB 1E3PA 1PFNA 4HJ5A 2JN4A 4CKCA 4C3HG 1PZKD 1V9PA 2BDNA 4GN3B 2PNHA 3DHQA 1LM0A 2JA9A 2KHJA 1UE7A 2ID0A 4ZUJA 1R4QB 3NPPA 3NSWA 2IHEA 3PIO3 3HOYG 3G71A 2PI2A 4ME3A 4NPSA 3R2IA 1WCMG 4DV4L 1Y69U 1NMFA 1BDOA 4E6IA 2PQAB 2F3IA 2MO0A 2EYMA 2A19A 2NVYB 4LUOA 1ILQA 2XSCA 1KC8C 4JI7L 4EQOA 4A3LH 3T56B 1O7IA 2BE5C 2KCCA 2OWOA 1A2TA 2HUGA 1EY6A 4IO9A 1FYCA 2E2IB 2WB1B 1FNWA 3DM3A 3J7YW 4ZKBB 2KHSA 4QB4A 1K28A 1Q12A 1Y1WB 5JVH3 2OF1A 4UP8A 4RH6A 4LF4L 3C46A 4IUUA 3ULJA 1D5ZC 3CRKC 1A0IA 2DN8A 1NUCA 2V4DA 5D14A 1X3QA 3OTOQ 1ENCA 5LMNW 4GOPC 1CA5A 5GADC 1AE3A 4KTAA 4G7ZC 3HKZE 1CM9A 4ME5A 4A93G 3TEHB 1VQ6A 2R93H 1TWFH 5IIFA 1ASZA 1X3PA 3OIPA 2DY8A 1BCPD 1E7ZA 3F1ZA 4DK1A 1IBLL 3DLLA 4A3JB 1CTMA 4RGNA 1G8ZD 5A35A 5CV9A 3D3RA 1HXYD 5GAEC 4OO1G 1PMRA 3NEMA 3VR4A 4A3IB 1AP0A 1SE3A 1TWGB 1PRTC 1HTPA 1VQDA 2RKSA 4BBRH 4BWGB 2BA0A 1C8CA 4B3TQ 4YWKA 4XQQA 1PLFA 2WKDA 4WORA 1EIYB 5ELBA 4JBMA 3U58A 2R7ZB 3I4NG 1XJVA 5DLQE 4JI3Q 2RDFA 4EVOA 4I65A 2KENA 4DK6C 1PDQA 1WFQA 2YU9B 1EQVA 3I2ZA 5CBEE 1I94L 5FJ8H 4KI0A 1VQGA 4HIDA 4DV0Q 1V1QA 2BOSA 4FDBA 4DU9A 3CMEA 4DUYL 5M9OA 5JAVA 2SDFA 4JI1Q 1HQRD 1GUSA 2BA1A 2LFNA 2Z0SA 2K5VA 1IXRA 2NVQH 4CGYB 1HQMC 1O7ZA 1I50B 3CHBD 4LF5L 4KY6A 1WTQA 1VQBA 3NHHA 4C3JH 4CJ2C 2CH4A 1GUNA 2RSOA 4FNFA 4LFCQ 3D4DA 4KN7C 1VMPA 1B4OA 1IBKL 4RGTA 1XMQL 2JA5H 1PVOA 3OSOA 1V8QA 1UEAB 1HNWL 1YNNC 2K4KA 1ASYA 2K52A 4A3GB 2NZOA 2VUMG 5IT9E 1HR0W 3T4AC 1PH5A 5IYCG 3RR5A 3VYUA 1XXGA 4V190 3H0GG 2VQFL 4K6LA 3GTGB 2NTTA 2RCNA 2H4OA 4MNOA 2F0FA 1AZPA 3TBIB 5JVG3 1KD1C 3HG9A 1QE6A 3NQIA 3F2UA 2EXDA 3BVZA 1HCZA 3J7ZC 4AYBG 2K1BA 4FP5D 2UUCQ 3TS0A 3KJOA 3K58A 2Y0SB 2F0IA 1G2SA 3I8ZA 2D0PA 3T51B 1VMCA 1YJ9A 1HNXQ 1WTRA 5ELFA 4LF6Q 3SHLA 1VQHA 4BXXG 5EGTA 3CC2A 1QZHA 3FKIB 1A2UA 3PV0A 1N36Q 4RGMA 1GM5A 2CFMA 4XQJA 1KLGD 2E2HB 1PFBA 1TS2A 1I3QB 1X65A 3RLFA 2F0EA 4YHHQ 1NTGA 4JW0A 4FF3A 1WI5A 1B2TA 1TWGH 3URYA 3OMCA 4B3TL 1KNAA 1VDZA 5FLXc 2K01A 2AMCB 4LF8L 4HR7B 3WOFA 2ZM6L 3NK9A 4DR6L 3K5MA 1E2VA 1JE5A 1IBML 4JI4L 5DNFA 2PW7A 2XIWA 3SK6A 3HOWB 5LMNQ 1XMOL 1RL2A 2RA4A 2A68D 3D4RA 4ODGA 1EFWA 1MI2A 2NZHA 1LTGD 5FO9B 3UDFA 3HKZG 3BDOA 3VR6A 4GLAC 2EYFA 2XWJB 2UU9Q 4NXNL 3E5SA 5C44B 1QZGA 2JEAI 1HA6A 1ML0D
chains in the Genus database with same CATH topology
3NXWA 1EY5A 2J4XA 3S9WA 1TS5A 1JOQA 3X3NA 3D8GA 2FFKB 4FF2A 1KTKA 4QIWB 5FO8B 1TY0A 1UAPA 2F0MA 2MGSA 2K7VA 1V1OA 1DJRD 3LWEA 2Q8RE 1YNJC 1AFPA 4ULLA 4U673 3RD4A 4RHSA 2JA8B 3P1HA 3PIP3 5CMDA 2WV6D 3A8JE 4R8IA 5I6WA 4RKLA 5C0XH 3NBHA 4Q0FA 2QDBA 3HOVB 4C3IB 2K04A 2F0WA 1Q8IA 3MFYA 5KYIA 4K5XA 5KRUA 3A54A 1HRJA 1AN8A 4M8AA 1ET9A 3M7NA 4ID6A 5BN5A 3PUZA 2WP8J 5G3LF 1G91A 3I73A 1F2LA 2AUKA 5I6YA 4JK1C 4L8JA 1JC7A 1U4MA 4XYQA 5M3MB 3IKJA 2B2VC 1G6ZA 1F9SA 3DEOA 2F0KA 2NN6I 3TP5A 4LAAA 4ILWA 3S17B 1O7YA 3BVMA 1LTBD 3ERQA 1LTRD 4X3UA 3JAML 2EYJA 2EY2A 2NZ1D 1I4QA 4KKTA 1OO9B 3S1MB 2ZT9C 4A3FB 3VYRA 4F8MA 3RZOB 3MXPA 4IFDH 4HEDA 4N9PA 1I4PA 3S15B 2E76C 4ZRZA 2M2LA 1KDAA 4DAYA 4XTCS 2J0TD 3OWFA 3QIAA 1QCBD 4TQUS 4B9XA 1RF2D 1UUPA 2A6HC 4P2CB 1XX8A 3NTHA 2L11A 3GV6A 4QF4A 5IGBA 4BBSB 1W6KA 2PZUA 4ZYSA 2F0TA 1A15A 4F87A 1SNDA 2B8GA 4CJ0B 1EYDA 1LV9A 3KLRA 3FMCA 3PMFA 1I4HA 3J81L 3FVQA 4X3TA 1U4LA 1RHPA 3GTLB 1EY7A 1ZYRD 4RCOA 5KNDA 1GUWA 1K8MA 2AUJD 2A74C 1TY2A 1DOMA 5IOCA 3FDTA 5I4DA 4IN3A 1A3TA 4EQNA 2D2CC 1HUNA 1U4PA 3OPOA 3RUZA 2K5WA 4TRDA 2NWGA 3A8IE 3BVGA 3SK8A 4XT1B 1PZID 1LTTD 3ND9A 2AQ2B 3TDQA 1T5EA 1NR2A 2KQ3A 2DNEA 5CGKA 1CHPD 1SNPA 4EQPA 1DD2A 1IKMA 2I07B 2R93B 1TWFB 4KKUA 3GO5A 1K83B 2B2VA 1RD9D 5I2YA 4BA2I 1HFGA 3KBGA 3E6ZX 2C5CA 2PQEA 4BBRB 4A3DB 1JWSD 3ZYYX 2F0SA 2Z4HA 1K8OA 1F2MA 1FR3A 4H0LC 4I7ZC 3J7AV 5ELDA 1CK1A 3S1RB 4IUVA 1WD1A 4QMGA 1PTOC 2QILA 4KHVA 2IL8A 2PMZB 2IPKD 1DXMA 2D5DA 2M9VA 1L0XB 3Q23A 1KLUD 4M1UB 4IUTA 2BDOA 1LO5D 5E1FA 1STGA 3MTSA 2A6EC 1JCKB 2OT2A 5JPMC 3QB3A 5BN3A 5HGTA 4FF4A 2NVQB 3M4YA 4Q5VA 3S1NB 2EY6A 3MA2B 4O42A 1B3AA 3M7GA 1A3VA 3K5NA 4C3JB 1OXXK 3K5OA 4HTHA 2JA5B 4NW2A 4HCSA 2TSSA 4BS9A 3OIQA 2L12A 2MUYA 1STBA 2A69C 1S5ED 1D5XC 3R2TA 1V1PA 2L55A 1PRTD 2K28A 1O78A 3LX0A 3EVQA 4DAVA 4PV1C 4KJOA 5FLXE 3VA7A 1LACA 4XXEA 3GTJB 1GHJA 1QWYA 3MHBA 3DWPA 2F1MA 4K6DA 1SNOA 2KA7A 2AQ3B 1WTVA 4UAIA 1B53A 3NTKA 5EQ0A 5I9OA 1KABA 4R8NA 3OWEB 4KHZA 1II3A 2EYHA 1Z7TA 1RDPD 1Z6HA 3MXNA 5CV7A 3BS1A 5CV4A 4FO2A 2ZXOA 1ENFA 2CHBD 3VR2A 2ENBA 1HTLD 2NN6G 2B2UA 1Y8OB 2EJMA 3Q22A 4X3KA 4QUFA 1YNND 1D2BA 2SNSA 3C1EA 3ONAB 5I9PA 2MHVA 1LLRD 4XIGS 2AWNA 4CJ1B 2IX1A 2OEOA 1HFNA 4G57A 4J8QA 2KOLA 4RFBA 1W6JA 2JEBI 1MGSA 2HQEA 3NE5B 2VB3X 2IW3A 2J7ZA 2PPBC 1IL8A 3S14B 3BZDB 4HSVA 5C0XI 1M8AA 3I72A 1OXVA 2MJ8A 3A8KE 1EEID 1I4XA 3BDCA 2KJXA 1EFID 4G7HC 2VB2X 5C4HA 4LMQD 3GTOB 3OW7A 3BDLA 5C3EB 1ONLA 2JYOA 1VF5C 2LY7A 3CKIB 2EJFC 1RTNA 4K8IA 1ESRA 4KJNA 3D6WA 2PO4A 3MVVA 3CQZB 2CW0C 1J8IA 1QJOA 2F0NA 4BA1I 4RKBA 4RGOS 1BBXC 1WTOA 3HP3A 5TSSA 3M4OB 2HCCA 4IFDI 1UNSA 2F0PA 3DXJC 3FPPA 5C4JB 1WTXA 4NKLA 1H9RA 3A56A 4L6TB 1PYWD 2F4IA 4TSSA 4B9WA 1STYA 3LWUA 3NWTA 1XYIA 1SSOA 2F0UA 2CVRA 2FMCA 5EKIA 4K2KA 1Y8PB 3W3AA 1IKLA 1QOHA 1H9MA 1MSHA 1SXTA 5C0XJ 1PRTB 1I6HB 3C3LA 4LK1C 2L4NA 3KLSX 5EKKA 4C1NI 2YYZA 2K5QA 1DCZA 3V05A 2KVMA 3V2TA 3H09A 3PUWA 2ICIA 1PTOH 2HCIA 1MD2D 5EPKA 1TU2B 1BUVT 5JEAJ 1TKWB 3GTPB 3R3OA 5D3IB 1IHZA 1BCPB 2WAQB 1R9TB 1PXUA 2D9UA 2XNAC 3T13A 1B1ZA 3T53B 5EJWA 3GQBA 4KD3A 1GUTA 2EZVA 2RDGA 1EL0A 2XRQD 1Y8NB 3SDZA 1F2ZA 1MSGA 1PRTF 4HAEA 4IFDJ 3MFGA 2KECA 3HRZC 3SVMA 5F2DA 1AEXA 1SE4A 1TT2A 4XT3B 4QCLA 5M5YB 3SK5A 5C6AA 2A68C 5DM73 1DZ1A 3VYTA 2Q8TA 1RTOA 2IJ0A 3DWAA 1XWEA 4C3HB 5J22A 2F0GA 1KAAA 1TS3A 4KY7A 1BCPF 1SNQA 5KEEA 2TMPA 2PZWA 5E4WC 4DXGA 1WTWA 1JR0D 3EJIA 4KKSA 3K7AB 3HOYB 3FPUB 4V0BA 1SJHD 5JEAH 1NAPA 2A6HD 1WCMB 4DAPA 2HDLA 2K6AA 4IUNA 1SEBD 1SYGA 1SYCA 3KK7A 2JP1A 1Q3LA 3IL8A 5EBDA 5DEHA 4H7BA 2L9HA 2O2LD 1IW7D 5A2QL 1B44D 3VR5A 4YIJA 1SNMA 4PMWA 4RCNA 1PZJD 2E75C 3DUZA 4C1NK 2WINB 3I90A 1JOOA 2DNCA 4A93B 1JB3A 3D6CA 3OHXC 2O5IC 5CV8A 5IGCA 5HURA 4ZKCB 2MP1A 5EPJA 1BF4A 1STHA 1TR5A 1QNKA 2PW5A 1C48A 3NP8A 2PYKA 2EE1A 2L1BA 1NR4A 3PUVA 5DAUA 3VYSA 3NWSA 1LTAD 1H9JA 4OGQC 1CZGA 1FGBD 5D3DA 5E4XA 3SXHA 1JWMD 3I4NB 3ND8A 3H91A 4K14A 1LTID 2RVLA 2EOTA 3BYYB 2F0LA 1BQQT 1EU4A 3Q24A 4IALA 1OXSC 4WJWA 4C2MB 3WOEA 3DWQA 1TWHB 4K2LA 2KCNA 1BXTA 1EWCA 3L3OC 1C4QA 1WD0A 4DFAA 1Z47A 1EOTA 5IGDA 3SR1A 2IT1A 4HSPA 3FRPB 4C56C 1B50A 5C5LA 2VUMB 1GUOA 1PTOD 2XVSA 3TZDA 3GV3A 1OXTA 2O4XA 2FHTA 4FXGC 3H0GB 2AQ1B 5CV6A 1GXDC 5CORA 2B2UC 1JQYD 3X3MA 4Y7NB 3S2DB 2PZTA 3AMUA 2A6ED 1TIID 4AYBB 5EKLA 1BOSA 1FNVA 3K59A 3CU7A 5C3WA 1CZWA 3QG1A 4K8JA 5KYLA 2JSOA 4TKOB 4DNTB 2A73B 3QWNA 1NCVA 3FEWX 1LT5D 3JAME 2EY5A 3U9OA 1F9PA 2KEDA 2ZXPA 4CHTB 3OMGA 4DGZA 1SMYC 1JWUD 1HHVA 2R6GA 1CA6A 1H9SB 1LTSD 1STEA 1QILA 4OO1H 2EYPA 2EPBA 2MPMA 1ILPA 3DEPA 2B2YC 2BE5D 2OXPA 5I2XA 1RCVD 4XDXA 5CR3A 1STAA 2IX3A 1SNCA 3HS0C 5C5MA 3EFXD 2BCOA 5NUCA 3J80E 3E0JA 5CC4A 4GZYC 5M5XB 3M85A 1SYFA 1EY0A 3HKZB 3G6JB 1HA5A 3AU7A 1I4RA 4ABNA 4C3IG 2ICEC 3TP6A 3IAYA 3J81E 1RKNA 4MHEA 5IT9L 3L7ZC 2B2TA 2EVBA 3MZ5A 2K03A 2RBMA 3O13A 2VNUD 1G2TA 5JOBA 2AWOA 1ENAA 2NVXB 1AZQA 1H9KA 5CBAE 1CQVA 3KF8A 4Z9CB 2FJ2A 3PO2B 4IQZA 3HOZB 2PCFB 3DMUA 1SYDA 1RJTA 3RMHA 3R93A 3MC0B 2Z8LA 2B39A 4IUPA 3RZDB 2R61A 3S16B 1JORA 1T5XD 1S5CD 1HPCA 1TVXA 2E2DC 1EYAA 4HCEA 1ZKOA 1ESFA 1HUMA 1F9RA 2IWHA 2HDMA 5G3LD 3TMEA 1S4ZA 3MEHA 3NBIA 1JOKA 2JXMB 4FF1A 2LKVA 1EIGA 1LT4D 3NTIA 3AB9A 2RSNA 1E2WA 4WFN3 1GHKA 4A3BB 5C4ZA 4LJZC 3I91A 4KD4A 4EGVA 5M3FB 3S2HB 4OIJA 1TWAB 2C9OA 3QOLA 3P20A 4HN7A 5T1GA 3D4WA 1CI3M 5K36G 1PTOB 1QNUA 2CW0D 4H44C 3OOCA 4IURA 1VF7A 1ICWA 2PNRC 1I4GA 1QG7A 2B2YA 3MWYW 3P7JA 1BCPC 1LT6D 2JA7B 3VR3A 2D62A 1SFOB 1SE2A 1V43A 1GJXA 2L0CA 1CHQD 1SBBB 4X3SA 3I4LA 3MAQA 5ELCA 1TWCB 4RWSC 4JBWA 4S3SA 3UI2A 4PQXA 2B8FA 3KBXA 4PMBA 5IGFA 1SYBA 2E74C 1PTOF 1GUGA 2FINB 4A3EB 3H94A 3GD7A 1SAPA 1O7LA 2DY7A 5CYUA 5LL6X 4DXFA 5IODA 2JA6B 2XN9C 1F9QA 3M3YB 3G7LA 2F0QA 1F77A 3GTMB 2LMCB 4UDUC 4B08A 1BR9A 3I4MB 1A3UA 3TP7A 4U68A 5FK9C 4ZAIA 5JPNC 1ZXTA 3P75A 2NVTB 1LT3D 2EJGC 5J1ZA 1KDBA 2XWBB 3KLSA 4HMJA 5EBCA 4NP5A 1D6EC 5LHY1 5DM63 2K05A 3PUXA 2Q8IB 1F2YA 3NUCA 4A3KB 3IFTA 1YNJD 4A3MB 2R3ZA 5CV5A 1J9OA 4G4KA 3A55A 2F0VA 1DOKA 2NUCA 4OHJA 5T1IA 2KUMA 2CQAA 2A5HA 3V96A 1Q1BA 2Z1CA 1Q1EA 4C3JG 2F0OA 3H6MA 2KEEA 3QJYA 3Q0AA 3TSSA 2XRSD 1EQTA 1X32A 4MIUA 3QO2A 5KNBA 4N9TA 1EIHA 2SNMA 2EDGA 4FYDA 1QB5D 3IFDA 4FXKC 1GOZA 3CRLC 3A7LA 3VA5A 3EROA 1ZEQX 4F7XA 4DA2A 4DNRB 3HGBA 5ELEA 1FNUA 2NB0A 3H3VC 1D1IA 5M5WB 2R92B 1FD7D 5J39A 1BNZA 1TQOA 4FVMA 3WDNA 2B2WC 4KY5A 1D1KA 1EYCA 5K5PA 3DM1A 5IGEA 5FOBB 1E2ZA 1TS4A 4CBVA 1Q90A 5D65A 4K5WA 3HOXB 2RDHA 2QF7A 1OXUA 2NTSA 2B63B 4PNYA 2WKCA 1EWHA 1RODA 1SYEA 4DK0A 4MN3A 2O5JC 2EY1A 3EA6A 2RQXA 2NBFA 1MBYA 4OO1I 3J7AF 4IZ8A 2F0JA 4K5VA 4KN4C 4WRDA 2F0DA 1CQFA 3N52A 4BY7B 3I70A 1PFMA 3BYTB 4RHRA 3U9SA 4RA8A 3SEBA 1ET6A 2E2JB 3PUYA 1DONA 1XTCD 2EYOA 4NMZA 2G9DA 5IGGA 1AW7A 2K33A 5LL6S 2H1EA 3GP7A 3MXGA 4R9WA 4L63B 3C2PA 3TZUA 4XYOA 2N55A 1E0BA 1Y1VB 1S5FD 3LNNA 3GTQB 2N88A 2K5DA 4ZUIA 2X6LA 2I46A 3HZXA 1BO0A 5C4XB 1G291 1I6VC 3R8BA 5ISRA 2F3WA 3GTKB 2IX0A 4FXDA 4G7OC 2B2TC 4PMCA 1STNA 3J80L 2F0HA 1EZ6A 2SOBA 2WACA 1KDCA 2LS01 4J1MA 2EXZA 2G9HD 1EZ8A 5BN4A 1IW7C 5C0XG 1LABA 3D31A 3HOUB 1SDFA 3A7AB 4ZQ3A 3I3CA 5KNCA 1S5DD 3BG3A 1R4PB 3NQTA 4HMIA 3T16A 3HEJA 1WVLA 2JE6I 1DOLA 2QEJC 2F3VA 5KGUA 2F03A 2QCPX 5JEAG 5FO7B 1EY4A 2B2WA 1EU3A 3K5LA 5FLXL 1SMYD 3MXUA 5E3FA 3TP8A 4RAUC 4F88A 4IUQA 2X69A 1U4RA 1JICA 1L0YB 3K6OA 2X6GA 4OIKA 1VCIA 1CT1D 3PO3B 1IYUA 3KUPA 3SK4A 4ZLTF 2Z4IA 4J6HA 4DN4M 4IFDG 2SEBD 4H13C 1ZYRC 3S1QB 1B9MA 2NYZD 4XQNA 1EEFD 1NSNS 2FMMA 2WIIB 5A2QE 4ZK9B 2ZXRA 3EQLC 5JJZA 5EPLA 1EY8A 2A69D 3W2DA 3K57A 1D5MC 1A6XA 1IYVA 3TN2A 5AFWA 1M4VA 5FKAC 4O1NA 3SE0A 3N6RA 1KNEA 3ITPA 2NN6H 4CKEA 2QKIC 3L9AX 4NDXA 1JE4A 1U9RA 2EYLA 4QUCA 2M00A 4BY1B 1SJED 1CFMA 1H9SA 5C3XA 5COYA 1O80A 2K32A 2L5TA 1B9NA 4KV6A 2VXWA 1DYQA 3QOJA 1S5BD 1WTPA 3K0YA 4KMUC 4CKBA 1EY9A 5K36H 4DF7A 2GA4B 1V1PB 5KIXA 3Q6SA 1DM0B 3C1FA 4OL7A 4KK7A 1PFNA 4CKCA 4C3HG 1PZKD 2BDNA 3DHQA 2ID0A 4ZUJA 1R4QB 3NPPA 3NSWA 3PIO3 3R2IA 1Y69U 1BDOA 4E6IA 2EYMA 2NVYB 1ILQA 2XSCA 4EQOA 3T56B 2BE5C 2KCCA 1A2TA 2HUGA 1EY6A 1FYCA 2E2IB 2WB1B 1FNWA 3J7YW 4ZKBB 2KHSA 4QB4A 1Q12A 1Y1WB 5JVH3 2OF1A 4RH6A 3C46A 4IUUA 1D5ZC 3CRKC 2DN8A 1NUCA 2V4DA 5D14A 1X3QA 1ENCA 1CA5A 4KTAA 4G7ZC 1CM9A 4ME5A 5IIFA 1X3PA 3OIPA 2DY8A 1BCPD 4DK1A 4A3JB 1CTMA 4RGNA 1G8ZD 5A35A 5CV9A 3D3RA 1HXYD 4OO1G 1PMRA 3VR4A 4A3IB 1AP0A 1SE3A 1TWGB 1PRTC 1HTPA 2RKSA 4BWGB 2BA0A 1C8CA 4XQQA 1PLFA 2WKDA 4WORA 5ELBA 2R7ZB 2RDFA 4EVOA 4I65A 1PDQA 2YU9B 1EQVA 5CBEE 4KI0A 2BOSA 4DU9A 5M9OA 5JAVA 2SDFA 1HQRD 1GUSA 2BA1A 2LFNA 4CGYB 1HQMC 1O7ZA 1I50B 3CHBD 4KY6A 1WTQA 3NHHA 4CJ2C 2RSOA 1GUNA 4FNFA 3D4DA 4KN7C 1VMPA 1B4OA 4RGTA 3OSOA 1V8QA 1UEAB 1YNNC 4A3GB 5IT9E 3T4AC 3VYUA 1XXGA 4V190 4K6LA 3GTGB 2NTTA 2H4OA 2F0FA 1AZPA 3TBIB 5JVG3 3HG9A 1QE6A 3NQIA 3F2UA 3BVZA 1HCZA 2K1BA 4FP5D 3K58A 2Y0SB 2F0IA 1G2SA 3I8ZA 3T51B 1VMCA 1WTRA 5ELFA 3SHLA 5EGTA 3FKIB 1A2UA 3PV0A 4RGMA 4XQJA 1KLGD 2E2HB 1PFBA 1TS2A 1I3QB 3RLFA 2F0EA 4FF3A 1B2TA 3URYA 3OMCA 1KNAA 1VDZA 2K01A 4HR7B 3WOFA 3NK9A 3K5MA 1E2VA 5DNFA 2PW7A 2XIWA 3SK6A 3HOWB 2RA4A 2A68D 3D4RA 4ODGA 1MI2A 1LTGD 5FO9B 3BDOA 3VR6A 2EYFA 2XWJB 3E5SA 5C44B 2JEAI 1HA6A 1ML0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R8B A;  4UDU C;  3BZD B;  1D5Z C;  1SJH D;  1PRT B;  3EFX D;  5FK9 C;  1SEB D;  3DWQ A;  1XXG A;  1EEI D;  1S5E D;  1TS4 A;  2J4X A;  3W2D A;  1CHP D;  1D5M C;  1D5X C;  1I4X A;  1TS5 A;  3KLS X;  3R2T A;  1V1P A;  2NTT A;  4K6L A;  1PRT D;  1BXT A;  1I4P A;  2RDH A;  1M4V A;  5FKA C;  2G9H D;  1LT3 D;  1EWC A;  2NTS A;  4O1N A;  3V05 A;  1EFI D;  1KTK A;  1HA5 A;  2O2L D;  3BVZ A;  1I4R A;  1BCP D;  1TY0 A;  2ICI A;  1PTO H;  1B44 D;  1PTO B;  4RGN A;  1RF2 D;  1UUP A;  1D6E C;  1S5D D;  1G8Z D;  1V1O A;  1MD2 D;  1HXY D;  4C56 C;  1DJR D;  1RD9 D;  1PZJ D;  1SE3 A;  1PRT C;  1PTO D;  3EA6 A;  5ELF A;  3O13 A;  1SJE D;  1I4G A;  4BWG B;  4ZYS A;  4RHS A;  5D3I B;  3DWP A;  4RGM A;  1BCP B;  2AQ1 B;  1JWS D;  2QEJ C;  1KLG D;  2WV6 D;  2AQ3 B;  1BCP C;  1LT6 D;  1JQY D;  1CQV A;  5ELB A;  2XNA C;  4OHJ A;  4Z9C B;  1TS2 A;  1SE2 A;  1DYQ A;  1B1Z A;  1S5B D;  5ELD A;  3BYT B;  1EU3 A;  1CK1 A;  4RHR A;  1I4H A;  1CHQ D;  3OWE B;  1V1P B;  2RDG A;  1PTO C;  2XRQ D;  1SBB B;  1FNV A;  4RGO S;  2QIL A;  3URY A;  1RDP D;  1AN8 A;  1ET9 A;  5TSS A;  1PRT F;  3TSS A;  3SEB A;  2XRS D;  1ET6 A;  1PZK D;  3MC0 B;  4RCO A;  5ELC A;  2Z8L A;  2IPK D;  3MFG A;  1LTA D;  1ENF A;  1LT5 D;  1L0X B;  1UNS A;  1FGB D;  1HQR D;  1KLU D;  1HTL D;  1XTC D;  2CHB D;  2R61 A;  5D3D A;  1L0Y B;  1LO5 D;  1AW7 A;  1CT1 D;  1JCK B;  1T5X D;  3R2I A;  1SE4 A;  1S5C D;  1GOZ A;  1JWM D;  1TY2 A;  3GP7 A;  4L6T B;  1PYW D;  4L63 B;  5I4D A;  1JWU D;  3CHB D;  1ESF A;  4TSS A;  1STE A;  1LTS D;  1PTO F;  1LLR D;  1QIL A;  2SEB D;  1LTI D;  1LTG D;  3BYY B;  1S5F D;  5ELE A;  1FNU A;  2IJ0 A;  3DWA A;  1EEF D;  1EU4 A;  1FD7 D;  4RGT A;  3BVM A;  1FNW A;  1LTB D;  3BVG A;  1TS3 A;  4RFB A;  1LTR D;  1RCV D;  4DXF A;  2XN9 C;  1BCP F;  1PZI D;  2TSS A;  1LT4 D;  1I4Q A;  1LTT D;  4RH6 A;  4DXG A;  1JR0 D;  1F77 A;  2AQ2 B;  1SXT A; 
#chains in the Genus database with same CATH topology
 3VDY A;  3KDF A;  3NXW A;  1EY5 A;  2J4X A;  3S9W A;  1TS5 A;  4B3S L;  1JOQ A;  4IJH A;  4OX9 L;  3X3N A;  4NB3 A;  1X9N A;  3D8G A;  2FFK B;  4FF2 A;  1CKO A;  1KTK A;  4QIW B;  1CSP A;  4DV7 Q;  5FO8 B;  3PO2 G;  1TY0 A;  3UDI A;  5FLM G;  1UAP A;  2F0M A;  2MGS A;  4KLK A;  4A3G H;  2K7V A;  3HOZ G;  2ALY B;  5C3E H;  1V1O A;  1DJR D;  3LWE A;  2Q8R E;  1YNJ C;  1AFP A;  1Q46 A;  1YHB A;  1NMG A;  4ULL A;  4OEL B;  4U67 3;  3GTG H;  4R4I A;  3RD4 A;  4RHS A;  1A62 A;  1QUQ A;  2JA8 B;  3P1H A;  3PIP 3;  2QEX A;  1X6O A;  5CMD A;  1G51 A;  2WV6 D;  3A8J E;  4R8I A;  1NE3 A;  1Q7Y C;  2G5D A;  5I6W A;  4GKJ L;  4RKL A;  5C0X H;  3NBH A;  3CQZ H;  4Q0F A;  1PH9 A;  4POF A;  1HNX L;  2QDB A;  3HOV B;  4C3I B;  2K04 A;  4LF6 L;  2F0W A;  1Q8I A;  3MFY A;  5KYI A;  4K5X A;  5KRU A;  3A54 A;  1HRJ A;  2LXK A;  1AN8 A;  4M8A A;  1ET9 A;  3M7N A;  4ID6 A;  1VQC A;  3M4O H;  1B7Y B;  2LSS A;  5BN5 A;  3PUZ A;  3FKI H;  4EQ5 A;  2WP8 J;  5G3L F;  1G91 A;  2JQO A;  3CCM A;  3I73 A;  2XTI A;  1F2L A;  2AUK A;  2Q2H A;  5I6Y A;  4JK1 C;  4L8J A;  1JC7 A;  1U4M A;  4XYQ A;  5M3M B;  1HZC A;  3IKJ A;  1K0S A;  3BU2 A;  2B2V C;  4A3B G;  1G6Z A;  3I56 A;  1F9S A;  3DEO A;  2F0K A;  2N78 A;  1YVC A;  4UY8 C;  2NN6 I;  2R7F A;  3TP5 A;  5BR8 L;  5M3F G;  4LAA A;  2CQO A;  4DPG A;  4ILW A;  4A76 A;  3S17 B;  4QIW E;  1O7Y A;  3BVM A;  2I5H A;  5IP7 H;  2H5X A;  1LTB D;  3ERQ A;  2WFW A;  1MKH A;  1LTR D;  4X3U A;  4JI8 L;  3JAM L;  4LUV A;  2EYJ A;  2EY2 A;  2NZ1 D;  5LMN L;  1I4Q A;  4KKT A;  1OO9 B;  3S1M B;  2ZT9 C;  1W3S A;  1VQN A;  4A3F B;  3VYR A;  4AQY Q;  4F8M A;  1GO3 E;  3RZO B;  3MXP A;  4IFD H;  3CC7 A;  4HED A;  5IP9 G;  4N9P A;  4JI2 Q;  4TVA B;  1S3O A;  1I4P A;  2JA7 G;  3CW2 C;  2E76 C;  4ZRZ A;  2M2L A;  3S15 B;  1KDA A;  4DAY A;  4XTC S;  1N34 Q;  4AH6 A;  2J0T D;  3OWF A;  3QIA A;  1QCB D;  4TQU S;  4B9X A;  1RF2 D;  1UUP A;  2A6H C;  4P2C B;  3ULL A;  4LF9 L;  1XX8 A;  3NTH A;  2L11 A;  3GV6 A;  4QF4 A;  3JAM i;  2CCZ A;  3L2P A;  5IGB A;  4BBS B;  3GTP H;  1W6K A;  4JI0 L;  2ZTE A;  2PZU A;  4ZYS A;  3M4Q A;  2F0T A;  1A15 A;  4F87 A;  1SND A;  3F2D A;  2B8G A;  5HGQ A;  4CJ0 B;  3UE1 A;  1JJ2 A;  2N8N A;  1EYD A;  1LV9 A;  3KLR A;  3FMC A;  3PMF A;  1YJN A;  2HIV A;  1I4H A;  3CCR A;  3J81 L;  4A3E G;  3FVQ A;  4X3T A;  1PH1 A;  1U4L A;  1RHP A;  3GTL B;  4DR1 Q;  1YZ6 A;  1EY7 A;  1ZYR D;  4RCO A;  4DV6 L;  2JA6 G;  5AJ3 Q;  1PH7 A;  5KND A;  1GUW A;  1K8M A;  2AUJ D;  3I4M G;  5M5Y H;  2A74 C;  1KQS A;  3E9I A;  1TY2 A;  1KAW A;  1DOM A;  5IOC A;  3FDT A;  1UE6 A;  5I4D A;  4IN3 A;  1A3T A;  1VQ9 A;  4EQN A;  3K81 C;  2D2C C;  1HUN A;  3PF5 A;  1U4P A;  4DR7 L;  3OPO A;  4GS3 A;  3J81 i;  4JYA Q;  3RUZ A;  2K5W A;  4TRD A;  4C3H H;  1HR0 L;  2NWG A;  3A8I E;  5L37 A;  3BVG A;  3SK8 A;  4XT1 B;  5M3M H;  1PZI D;  1LTT D;  3K7A H;  3ND9 A;  2AQ2 B;  3TDQ A;  1T5E A;  4A3K G;  1NR2 A;  4PZ8 A;  2KQ3 A;  4AIM A;  4N8X 1;  3AFP A;  4A3M G;  2DNE A;  1VQJ A;  5CGK A;  4IOA A;  1CHP D;  3S17 H;  3I4O A;  1XPO A;  3E0E A;  1BVS A;  1SNP A;  4EQP A;  1DD2 A;  2QDL A;  1IKM A;  4P75 A;  2I07 B;  4X62 Q;  2R93 B;  1TWF B;  2I0Q A;  4JCV E;  4KKU A;  3NEL A;  3GO5 A;  1K83 B;  2B2V A;  1RD9 D;  5I2Y A;  4R4C A;  4BA2 I;  1HFG A;  4OWT B;  3KBG A;  4K0K Q;  1I5F A;  3E6Z X;  2C5C A;  4JBJ A;  1J5E L;  4NXM L;  2PQE A;  4BBR B;  2F4V L;  3G6E A;  1SN8 A;  4A3D B;  1JWS D;  3ZYY X;  2F0S A;  4A93 H;  2Z4H A;  1K8O A;  5GQO A;  4APV A;  1F2M A;  1FR3 A;  2JJQ A;  1FVI A;  4H0L C;  3W5O A;  4I7Z C;  3J7A V;  4L5T A;  5ELD A;  4DR5 Q;  1CK1 A;  3T1H Q;  1FJG Q;  3S1R B;  4IUV A;  1WD1 A;  4QMG A;  1PTO C;  3L0O A;  2QIL A;  2R92 G;  2RF4 A;  4KHV A;  1B70 B;  2VW9 A;  2IL8 A;  1HZ9 A;  4DUZ Q;  1EQQ A;  2PMZ B;  2UXD Q;  2IPK D;  1DXM A;  2D5D A;  4DR4 Q;  2M9V A;  1L0X B;  3Q23 A;  1KLU D;  4M1U B;  4IUT A;  2BDO A;  1LO5 D;  1UWV A;  5E1F A;  1STG A;  3MTS A;  1S40 A;  2A6E C;  1JCK B;  2OT2 A;  5HY6 A;  4CDF C;  5JPM C;  3QB3 A;  5BN3 A;  5HGT A;  3A5U A;  4FF4 A;  4ZCK A;  2NVQ B;  3M4Y A;  4Q5V A;  3S1N B;  2EY6 A;  1AH9 A;  3MA2 B;  3H3V H;  4O42 A;  1B3A A;  3HOX G;  3M7G A;  1A3V A;  1EWI A;  3K5N A;  4C3J B;  2B63 G;  1OXX K;  3K5O A;  4HTH A;  4DV2 L;  2JA5 B;  2RCF A;  4NW2 A;  2EIF A;  4HCS A;  4CDE C;  5LMU Q;  2TSS A;  2MNA A;  4BS9 A;  3OIQ A;  2L12 A;  2MUY A;  1STB A;  2A69 C;  1KL9 A;  4C2M H;  1S5E D;  1JMC A;  2VQE L;  3I7F A;  3OW2 A;  1M1K C;  1D5X C;  1BBU A;  3R2T A;  2HHH Q;  1V1P A;  2L55 A;  4DR3 Q;  1PRT D;  2K28 A;  1PYS B;  1O78 A;  4GKK Q;  1YBY A;  3RN5 A;  3LX0 A;  4OWW B;  4BY7 G;  3EVQ A;  4DAV A;  3UE0 A;  4PV1 C;  1LYL A;  3CMA A;  5IE8 A;  4KJO A;  4PZ6 A;  5FLX E;  4DV3 Q;  3VA7 A;  1LAC A;  4XXE A;  3GTJ B;  1GHJ A;  1C9O A;  3CP0 A;  3MXN B;  1QWY A;  3MHB A;  2ZTC A;  2PQA A;  4QL5 A;  3F8T A;  3H0G H;  3DWP A;  1WOC A;  2F1M A;  4B3M L;  3CPW A;  4K6D A;  1SNO A;  2KA7 A;  2YV5 A;  4LFA Q;  2AQ3 B;  1WTV A;  4UAI A;  2UUB Q;  1B53 A;  1YJW A;  1N9W A;  1KHI A;  4Y7N H;  4X66 L;  3NTK A;  5EQ0 A;  5I9O A;  1N33 L;  1S72 A;  1FGU A;  2K5N A;  1KAB A;  4R8N A;  1VQO A;  1K83 H;  1Y1V G;  3OWE B;  4KHZ A;  4HJA A;  1II3 A;  4IJL A;  2UUA Q;  3K80 C;  2EYH A;  1Z7T A;  3F2C A;  1RDP D;  4CDC C;  1Z6H A;  3MXN A;  5CV7 A;  4WJ3 M;  3BS1 A;  5CV4 A;  4A3D H;  4BXX H;  4FO2 A;  2ZXO A;  1ENF A;  2CHB D;  3VR2 A;  5C4X G;  1PH2 A;  2ENB A;  1HTL D;  2NN6 G;  2B2U A;  1MJE A;  1Y8O B;  2EJM A;  3Q22 A;  4X3K A;  4QUF A;  1YNN D;  2MQH A;  1D2B A;  2SNS A;  3C1E A;  4B3R L;  3S1R H;  3ONA B;  5I9P A;  4LFB Q;  2MHV A;  1LLR D;  2K75 A;  2UXD L;  4XIG S;  2AWN A;  4CJ1 B;  1Y14 B;  2WB1 E;  3RN2 A;  2IX1 A;  2OEO A;  1HFN A;  3AEV A;  4G57 A;  4J8Q A;  3HOU G;  2KOL A;  4RFB A;  1W6J A;  2JEB I;  1MGS A;  2HQE A;  3NE5 B;  2VB3 X;  1PFS A;  2IW3 A;  2J7Z A;  1KRS A;  2PPB C;  1IL8 A;  3S14 B;  3OYY A;  3JAM c;  3BZD B;  1YIT A;  1K0R A;  3S1N H;  4HSV A;  5C0X I;  3A74 A;  1M8A A;  3I72 A;  1OXV A;  5GRO A;  2MJ8 A;  3A8K E;  1BBW A;  1EEI D;  1I4X A;  5M5X H;  1Q82 C;  1E24 A;  2DJG C;  5LMU L;  3BDC A;  2KJX A;  1EFI D;  4G7H C;  2VB2 X;  5C4H A;  4LMQ D;  4A75 A;  3GTO B;  3OW7 A;  3BDL A;  4YY3 Q;  4A3L G;  5C3E B;  1ONL A;  2JYO A;  1VF5 C;  2LY7 A;  1L1O B;  2NVX H;  3CKI B;  2EJF C;  1RTN A;  4K8I A;  1ESR A;  4KJN A;  3J80 c;  3D6W A;  2YTY A;  3A5Z B;  1PYB A;  2PO4 A;  1XTD A;  2N49 A;  3PO3 G;  3PCO B;  4X6A H;  4DNI A;  1K8A C;  3MVV A;  3CCL A;  3CQZ B;  2CW0 C;  1J8I A;  3PO2 H;  1QJO A;  5FLM H;  3GTJ H;  2F0N A;  2E5L Q;  4BA1 I;  3OTO L;  4RKB A;  4RGO S;  3CF5 A;  1BBX C;  1WTO A;  3HP3 A;  1X3F A;  4JI6 Q;  5TSS A;  1GD7 A;  3J81 c;  3CCS A;  3M4O B;  2HCC A;  2MFI A;  3RZD H;  4IFD I;  1UNS A;  3S16 H;  2F0P A;  3DXJ C;  3FPP A;  5C4J B;  1WTX A;  4Y52 H;  3CCE A;  1ICF B;  2HD3 A;  4NKL A;  2UUA L;  1AE2 A;  1K3B C;  4LF7 Q;  1PH3 A;  1H9R A;  3A56 A;  4L6T B;  1PYW D;  2F4I A;  4TSS A;  4B9W A;  1STY A;  4GOP B;  3LGJ A;  3LWU A;  3NWT A;  1XYI A;  1SSO A;  2F0U A;  2CVR A;  1K73 C;  4R4T A;  1K3R A;  2FMC A;  4GN4 B;  4QY7 A;  5EKI A;  4K2K A;  5EAY A;  4JI3 L;  1WTH A;  1Y8P B;  4QGU A;  1VQF A;  3W3A A;  3CCQ A;  4DKA C;  1IKL A;  1QOH A;  1H9M A;  1MSH A;  1SRU A;  5FJ8 G;  1SXT A;  2XGT A;  5C0X J;  1PRT B;  4DV0 L;  4A3B H;  1I6H B;  4BY1 G;  3C3L A;  4LK1 C;  2L4N A;  5M3F H;  3KLS X;  4QQB X;  3S2H H;  4JI1 L;  1TWA H;  5EKK A;  1A8V A;  3RLN A;  4C1N I;  2YYZ A;  2K5Q A;  1DCZ A;  3V05 A;  2KVM A;  3V2T A;  3H09 A;  3MEF A;  3PUW A;  4OON A;  2ICI A;  1KIX A;  1PTO H;  2HCI A;  4DK3 C;  3S14 H;  2Y0S E;  1MD2 D;  5EPK A;  4LFC L;  1TU2 B;  1BUV T;  5JEA J;  1TKW B;  4L5Q A;  3K0X A;  1PH6 A;  3GTP B;  3R3O A;  4LNQ A;  5D3I B;  1IHZ A;  1CKM A;  1C0A A;  5IP9 H;  1BCP B;  2WAQ B;  1H95 A;  2JA7 H;  1R9T B;  1PXU A;  1QVF A;  2MO1 A;  1SFO H;  2D9U A;  2XNA C;  3GTO H;  1IZ6 A;  4JV5 Q;  3T13 A;  1B1Z A;  3T53 B;  5EJW A;  3GQB A;  4KD3 A;  1HNZ Q;  1GUT A;  2EZV A;  3CC4 A;  3J81 j;  4JI5 Q;  2RDG A;  1EL0 A;  1HH2 P;  2XRQ D;  4PZ7 A;  1JJC B;  1Y8N B;  3SDZ A;  1F2Z A;  1XNQ Q;  1MSG A;  5H1S E;  1PRT F;  2WB1 G;  3STB C;  4HAE A;  1TWC H;  4O2D A;  4IFD J;  3MFG A;  2CH4 W;  3IRB A;  1K8G A;  2KEC A;  3HRZ C;  4X65 Q;  1Y1W G;  3SVM A;  5F2D A;  2UUC L;  4MTK A;  2E5L L;  1AEX A;  1WJJ A;  1SE4 A;  1TT2 A;  4P71 A;  4XT3 B;  4QCL A;  5M5Y B;  3SK5 A;  5C6A A;  1U5K A;  2A68 C;  1SR3 A;  5DM7 3;  1DZ1 A;  4RG1 A;  2KHI A;  3VYT A;  2Q8T A;  5IYB G;  4A3E H;  1N36 L;  1RTO A;  2IJ0 A;  3DWA A;  3EN2 A;  1XWE A;  2UXC Q;  4C3H B;  5J22 A;  2F0G A;  5C4J H;  1KAA A;  1TS3 A;  2JA6 H;  4A3J G;  4KY7 A;  1BCP F;  4YHH L;  1SNQ A;  4JPB W;  2TMP A;  1CKN B;  5KEE A;  2PZW A;  3GTM H;  2FXQ A;  5E4W C;  4DXG A;  1JR0 D;  4A3I G;  3EJI A;  1WTW A;  3I4M H;  4KKS A;  3K7A B;  3HOY B;  2CKZ B;  2OTJ A;  3FPU B;  4V0B A;  1SJH D;  5JEA H;  1NAP A;  2A6H D;  4MZ9 A;  1WCM B;  4DAP A;  2HDL A;  2K6A A;  4IUN A;  1SEB D;  2VY3 A;  1SYG A;  3TS2 A;  2R7D A;  1SYC A;  3I55 A;  2WAQ E;  3KK7 A;  4CDD C;  2NVT H;  2YTV A;  2JP1 A;  1Q3L A;  3IL8 A;  2R7Z G;  5IWA Q;  5EBD A;  5DEH A;  4A3C G;  4H7B A;  2L9H A;  4IPG A;  2O2L D;  1IW7 D;  5A2Q L;  2ATW A;  1B44 D;  3VR5 A;  4YIJ A;  1T9H A;  1SNM A;  1EQR A;  4PMW A;  1I6H H;  4RCN A;  4A3K H;  1PZJ D;  2E75 C;  3G48 A;  3DUZ A;  4A3M H;  1LUZ A;  2ZJR A;  4C1N K;  1VQK A;  2WIN B;  2B3G A;  2UU9 L;  3I90 A;  4GNX B;  3H3V I;  1JOO A;  2DNC A;  4A93 B;  4O0A A;  1JB3 A;  3KLW A;  3D6C A;  3OHX C;  2O5I C;  5IYD G;  5CV8 A;  5IGC A;  5HUR A;  2C35 B;  4HIK A;  2K5H A;  4ZKC B;  2MP1 A;  5EPJ A;  3ERS X;  1BF4 A;  2OQK A;  5IY0 A;  1STH A;  1TR5 A;  1QNK A;  2PW5 A;  1C48 A;  3NP8 A;  2PYK A;  2EE1 A;  2L1B A;  1NR4 A;  3PUV A;  5DAU A;  4DV7 L;  3VYS A;  3NWS A;  1LTA D;  1H9J A;  4OGQ C;  1CZG A;  1R9T H;  1MJC A;  1FGB D;  5D3D A;  5E4X A;  3SXH A;  4A3G G;  1LTL A;  1JWM D;  3I4N B;  2K50 A;  1N32 Q;  3ND8 A;  3AQQ A;  1YI2 A;  3H91 A;  3Q8D A;  4K14 A;  1LTI D;  2RVL A;  3A0J A;  2EOT A;  3BYY B;  2F0L A;  4X65 L;  1BQQ T;  3ULP A;  2R92 H;  1EU4 A;  2EQS A;  3Q24 A;  1VQ8 A;  3PIO A;  1TXY A;  4IAL A;  1OXS C;  2OQ0 A;  2Y0S G;  1DGS A;  4X64 Q;  1FL0 A;  4WJW A;  3G4S A;  4QJF A;  4GN5 A;  4C2M B;  3WOE A;  3FKI G;  2HIX A;  3DWQ A;  1TWH B;  4K2L A;  2UXC L;  2KCN A;  3TQY A;  1HJP A;  3K8A A;  3HOX H;  1D8L A;  1BXT A;  1EWC A;  1QVC A;  3L3O C;  2B63 H;  1C4Q A;  1IYJ B;  1E1O A;  1WD0 A;  4DFA A;  1QVG A;  1Z47 A;  3RNU A;  1EOT A;  3KYH C;  5IGD A;  3HOY H;  3SR1 A;  4HIM A;  2IT1 A;  4HSP A;  3FRP B;  4C56 C;  1B50 A;  1WCM H;  1CUK A;  5C5L A;  4DV4 Q;  2VUM B;  1GUO A;  1PTO D;  1X54 A;  2XVS A;  3TZD A;  1VQ4 A;  3GV3 A;  1OXT A;  2O4X A;  4JI7 Q;  2FHT A;  4FXG C;  4PG3 A;  3H0G B;  2AQ1 B;  5CV6 A;  1GXD C;  5JJI A;  2BH8 A;  2B2U C;  5COR A;  4YCV A;  5J3B A;  1JQY D;  1E22 A;  3X3M A;  4BY7 H;  4Y7N B;  3S2D B;  3HOW G;  2PZT A;  4AQY L;  3AMU A;  2A6E D;  1TII D;  4N8F A;  4AYB B;  5EKL A;  1BOS A;  1FNV A;  4JI2 L;  3K59 A;  3CU7 A;  5C3W A;  2JK8 A;  3RLO A;  1CZW A;  3QG1 A;  4K8J A;  5KYL A;  2JSO A;  4TKO B;  3QR8 A;  4DNT B;  1N34 L;  2A73 B;  3QWN A;  1NCV A;  2KCM A;  3FEW X;  5C44 G;  1LT5 D;  3JAM E;  1JJG A;  2EY5 A;  1SMX A;  3U9O A;  1F9P A;  2KED A;  2ZXP A;  4YWM A;  4CHT B;  4JBK A;  2V1C C;  3OMG A;  4DGZ A;  1IBL Q;  1SMY C;  1XNR Q;  1JWU D;  1HHV A;  2R6G A;  3KF6 B;  1CA6 A;  1H9S B;  1LTS D;  1STE A;  1Y1V H;  1QIL A;  4OO1 H;  2EYP A;  2EPB A;  2MPM A;  2CWP A;  1ILP A;  1M90 C;  2ES2 A;  3DEP A;  2B2Y C;  2BE5 D;  4HJ8 A;  4R4Q A;  2OXP A;  5I2X A;  1RCV D;  2Z9H A;  4XDX A;  5CR3 A;  5C4X H;  1STA A;  1N32 L;  2IX3 A;  4GLV B;  1SNC A;  1UEB A;  2DUD A;  3I4N H;  3HS0 C;  1X56 A;  5C5M A;  3EFX D;  2BCO A;  4DR1 L;  5NUC A;  3J80 E;  2JA8 G;  3E0J A;  3KF6 A;  5CC4 A;  4GZY C;  5AJ3 L;  5M5X B;  1YHQ A;  3M85 A;  1SYF A;  3BZK A;  3KF8 B;  1EY0 A;  3HKZ B;  4DUY Q;  3G6J B;  1P8L A;  1HA5 A;  3AU7 A;  3HOU H;  1I4R A;  3HOV G;  4ABN A;  4C3I G;  2ICE C;  3TP6 A;  3IAY A;  3J81 E;  1VQE A;  1RKN A;  4LUZ A;  4MHE A;  4LWC A;  5IT9 L;  3L7Z C;  2B2T A;  2EVB A;  3MZ5 A;  1TWH H;  3U4Z A;  2K03 A;  4JYA L;  2RBM A;  3O13 A;  2VNU D;  1G2T A;  4LF5 Q;  5JOB A;  2AWO A;  1ENA A;  2NVX B;  1L1O C;  1AZQ A;  4DV5 Q;  5M3M G;  1IBK Q;  1H9K A;  5CBA E;  1CQV A;  1XMQ Q;  3KF8 A;  1SLJ A;  1NJI C;  4Z9C B;  2FJ2 A;  1VS0 A;  1HNW Q;  2VL6 A;  3PO2 B;  4IQZ A;  2P5Z X;  3HOZ B;  2PCF B;  5GAG C;  2VUM H;  3EBE A;  3U4V A;  2OCE A;  3DMU A;  1SYD A;  1RJT A;  3RMH A;  5IYC H;  3AFQ A;  3R93 A;  2PMZ E;  3MC0 B;  4X62 L;  2Z8L A;  2VQF Q;  2B39 A;  4IUP A;  3RZD B;  2R61 A;  3S16 B;  1JOR A;  4A3F G;  3PO3 H;  3S2D H;  1T5X D;  1S5C D;  1HPC A;  1TVX A;  2E2D C;  2KBN A;  3M4P A;  3PQI A;  1EYA A;  3BJU A;  4HCE A;  1ZKO A;  1BKB A;  3CAM A;  4DR2 Q;  4K0K L;  1ESF A;  1HUM A;  1F9R A;  3W1G A;  1IL2 A;  3S1Q H;  2IWH A;  1OTC A;  2GVB A;  2PI2 E;  5GAH C;  2HDM A;  3KOJ A;  4I7A A;  5G3L D;  3TME A;  1S4Z A;  3F2B A;  2Z6K A;  3MEH A;  3NBI A;  1JOK A;  2JXM B;  4FF1 A;  2I5M X;  4DR5 L;  2LKV A;  1XNR L;  4P74 A;  3T1H L;  1EIG A;  1FJG L;  1LT4 D;  3NTI A;  3AB9 A;  2QGQ A;  4BBS G;  2RSN A;  4IPC A;  3H15 A;  1E2W A;  1L0W A;  4WFN 3;  1GHK A;  4A3B B;  5C4Z A;  1HZA A;  4DUZ L;  4UPA A;  2UXB Q;  4LJZ C;  3I91 A;  4KD4 A;  4EGV A;  5M3F B;  4DR4 L;  2B29 A;  3S2H B;  3CD6 A;  4OIJ A;  1TWA B;  2DJF C;  2C9O A;  3QOL A;  3P20 A;  4HN7 A;  5T1G A;  3D4W A;  1CI3 M;  2Q2T A;  5K36 G;  4LF8 Q;  1PTO B;  4L5R C;  2ZM6 Q;  1X3E A;  4DR6 Q;  1E1T A;  1QNU A;  2CW0 D;  4H44 C;  1IBM Q;  3OOC A;  4IUR A;  1VF7 A;  4JI4 Q;  2AHO B;  4BY1 H;  4JOI C;  1ICW A;  3B6Y A;  2PNR C;  1XMO Q;  1I4G A;  4POG A;  1VQA A;  1QG7 A;  3PF4 A;  2B2Y A;  1VQ7 A;  3MWY W;  2HQL A;  3P7J A;  1BCP C;  1LT6 D;  2JA7 B;  3VR3 A;  2D62 A;  1C7Y A;  1SFO B;  1SE2 A;  1V43 A;  4NXN Q;  1GJX A;  4R1J A;  2L0C A;  1CHQ D;  1SBB B;  2HHH L;  4DR3 L;  5JJL A;  4DV5 L;  4X3S A;  4DAM A;  2Q2U A;  4GKK L;  4YWL A;  3I4L A;  4ALP A;  3MAQ A;  3PIP A;  5ELC A;  4B3S Q;  1TWC B;  4RWS C;  4WJ4 A;  4JBW A;  4OX9 Q;  4S3S A;  3UI2 A;  4DV3 L;  4PQX A;  2B8F A;  3KBX A;  5ELO A;  4PMB A;  5IGF A;  1SYB A;  2NVY H;  3HOZ H;  2E74 C;  3KJP A;  2AKW B;  1PTO F;  1P16 A;  1G6P A;  1B8A A;  1GUG A;  2FIN B;  4A3E B;  3D0F A;  3H94 A;  4LFA L;  2R93 G;  2E2I H;  3GD7 A;  2UUB L;  1L1O A;  1SAP A;  1O7L A;  2DY7 A;  2RHS B;  5CYU A;  3CXC A;  5LL6 X;  4UP7 A;  1YHA A;  4DXF A;  4A4I A;  5IOD A;  2XN9 C;  1F9Q A;  4DV1 Q;  1Y1W H;  2JA6 B;  4DR2 L;  3M3Y B;  3M9B A;  3G7L A;  2F0Q A;  1F77 A;  4GKJ Q;  3GTM B;  2DGY A;  2LMC B;  4UDU C;  1Q81 C;  4B08 A;  1BR9 A;  3I4M B;  1A3U A;  3TP7 A;  4U68 A;  5FK9 C;  4IOC A;  4ZAI A;  5JPN C;  1ZXT A;  4BBR G;  4A3D G;  5IYB H;  2F52 A;  3P75 A;  2A8V A;  4L5S A;  4OXP A;  2NVT B;  1LT3 D;  2IHF A;  3J7A 5;  1A63 A;  2EJG C;  5J1Z A;  4UHV A;  3TRZ A;  2GVA A;  4A3J H;  1KDB A;  2XWB B;  3KLS A;  4HMJ A;  5EBC A;  1PV4 A;  1WYD A;  2N3S A;  4NP5 A;  4LFB L;  1VQM A;  1D6E C;  5LHY 1;  1EUJ A;  5DM6 3;  2UXB L;  4A3I H;  2K05 A;  3PUX A;  2Q8I B;  1PA6 A;  1F2Y A;  3NUC A;  1D7Q A;  4A3K B;  1JB7 A;  3IFT A;  1YNJ D;  4A3M B;  5BR8 Q;  4GOP A;  2R3Z A;  5CV5 A;  3ICE A;  1J9O A;  4G4K A;  3STB D;  3A55 A;  4GNX C;  2F0V A;  3U50 C;  2R7Z H;  1DOK A;  2NUC A;  4OHJ A;  5T1I A;  2KUM A;  4A3C H;  2CQA A;  3KDF B;  2YU9 H;  3HKS A;  3EIV A;  4JI8 Q;  2A5H A;  3V96 A;  2ZJP A;  2BH2 A;  1HZB A;  1Q1B A;  2Z1C A;  1Q1E A;  4C3J G;  2F0O A;  5JJK A;  3H6M A;  2KEE A;  4YCU A;  2ZJQ A;  3QJY A;  3Q0A A;  3TSS A;  2XRS D;  2JA5 G;  1EQT A;  1N8R C;  1X32 A;  4MIU A;  3QO2 A;  2VZA A;  5KNB A;  4N9T A;  1EIH A;  2SNM A;  2EDG A;  2QW7 A;  4HIO A;  4YY3 L;  3PSI A;  4FYD A;  4JVZ A;  1QB5 D;  3K7U C;  3IFD A;  4FXK C;  1GOZ A;  3CRL C;  3A7L A;  1I50 H;  5IYD H;  1RIP A;  3VA5 A;  3ERO A;  2QA4 A;  1QUQ B;  4LF9 Q;  1ZEQ X;  4JG2 A;  4F7X A;  4DA2 A;  4DNR B;  3HGB A;  5ELE A;  1FNU A;  2NB0 A;  4R4O A;  4JOI A;  3H3V C;  1D1I A;  5M5W B;  4KHP Q;  1NNX A;  2LXJ A;  2R92 B;  1FD7 D;  3S24 A;  5J39 A;  3CCV A;  1J6Q A;  3NBH B;  1BNZ A;  4JI0 Q;  1TQO A;  2E8G A;  4FVM A;  1YIJ A;  3WDN A;  1VQI A;  1NY4 A;  2B2W C;  4KY5 A;  1D1K A;  1YNX A;  4JI6 L;  3ER0 A;  1EYC A;  5K5P A;  3DM1 A;  1X3G A;  5IGE A;  5FOB B;  1E2Z A;  1TS4 A;  1YEZ A;  4CBV A;  1Q90 A;  5D65 A;  4K5W A;  3HOX B;  2RDH A;  2QF7 A;  4DV1 L;  1OXU A;  2NTS A;  2KCT A;  2B63 B;  4PNY A;  4DV6 Q;  3NEN A;  2WKC A;  4LF7 L;  3M3Y H;  1EWH A;  1ROD A;  1SYE A;  2Z6B A;  4DK0 A;  3TRE A;  4MN3 A;  2VS1 A;  2O5J C;  2EY1 A;  3EA6 A;  1B3Q A;  2RQX A;  2ASB A;  2NBF A;  1MBY A;  5IT9 c;  4OO1 I;  3J7A F;  4IZ8 A;  2F0J A;  4DR7 Q;  4K5V A;  1PHJ A;  2K14 A;  1HR0 Q;  4J15 A;  2E2H H;  3FHW A;  1CSQ A;  1I3Q H;  4KN4 C;  4WRD A;  2F0D A;  1CQF A;  1Z9F A;  3N52 A;  4BY7 B;  3I70 A;  1PFM A;  3KFU A;  3BYT B;  3FP9 A;  4RHR A;  3U9S A;  1CKN A;  4RA8 A;  4GLX A;  1X55 A;  3SEB A;  4DAY B;  2HT1 A;  1ET6 A;  2E2J B;  4MTN A;  3PUY A;  3CCU A;  2A1A A;  1L2F A;  1DON A;  1XTC D;  2EYO A;  4NMZ A;  2G9D A;  5IGG A;  1AW7 A;  2K33 A;  5LL6 S;  2H1E A;  3GP7 A;  3MXG A;  4R9W A;  3HOW H;  4L63 B;  3C2P A;  3TZU A;  4XYO A;  4IPH A;  2N55 A;  1E0B A;  1Y1V B;  1S5F D;  3LNN A;  3GTQ B;  1XPU A;  2N88 A;  3SGI A;  1PH8 A;  2L15 A;  1J5E Q;  4NXM Q;  2K5D A;  4JV5 L;  2F4V Q;  5C44 H;  4ZUI A;  4GNX A;  4JC0 A;  1U0L A;  2X6L A;  1HNZ L;  2I46 A;  3HZX A;  1BO0 A;  4JI5 L;  1XPR A;  1MIU A;  5C4X B;  5C3E G;  1G29 1;  1EYG A;  1I6V C;  3R8B A;  1XNQ L;  5ISR A;  2F3W A;  3ZJY C;  3GTK B;  2IX0 A;  4FXD A;  4G7O C;  2B2T C;  4PMC A;  4KHP L;  1STN A;  3J80 L;  2F0H A;  1EZ6 A;  2SOB A;  2WAC A;  5M5W H;  2CWA A;  1KDC A;  2LS0 1;  3E3X A;  4J1M A;  2EXZ A;  2G9H D;  1EZ8 A;  3T1Y Q;  5BN4 A;  4OWX B;  2Q2I A;  1IW7 C;  1UE5 A;  5C0X G;  1Q8K A;  1SE8 A;  4RMF A;  1LAB A;  3D31 A;  2RHQ B;  3HOU B;  1SDF A;  3A7A B;  4ZQ3 A;  3I3C A;  5KNC A;  1W2B A;  1S5D D;  1UE1 A;  1SRO A;  3BG3 A;  1R4P B;  3NQT A;  4HMI A;  3T16 A;  3HEJ A;  1WVL A;  2JA8 H;  1JT8 A;  2JE6 I;  3JC6 6;  4EX5 A;  5ELN A;  1DOL A;  3J80 i;  2QEJ C;  4DV2 Q;  2F3V A;  5KGU A;  2F03 A;  3WWV A;  2QCP X;  5JEA G;  5FO7 B;  1EY4 A;  2B2W A;  3HOV H;  4C3I H;  1EU3 A;  3K5L A;  3UDX A;  5FLX L;  1SMY D;  3MXU A;  1Q86 C;  4H02 A;  5E3F A;  4P73 A;  3TP8 A;  4RAU C;  4F88 A;  5IWA L;  4IUQ A;  1EOV A;  5IP7 G;  2Z6K C;  2VQE Q;  3E9H A;  2X69 A;  1U4R A;  1MHW C;  1JIC A;  2ZTD A;  4HJ9 A;  1VQP A;  1L0Y B;  3K6O A;  2X6G A;  4OIK A;  1VCI A;  1CT1 D;  3PO3 B;  1IYU A;  2IY5 B;  3KUP A;  3SK4 A;  4ZLT F;  2Z4I A;  1VQL A;  1K9M C;  4J6H A;  4DN4 M;  4IFD G;  3UDG A;  4LF4 Q;  2SEB D;  4H13 C;  2GN5 A;  1ZYR C;  2YTX A;  1B9M A;  3S1Q B;  2NYZ D;  1NBW A;  2E2J H;  4XQN A;  1EEF D;  2I5L X;  2OTL A;  3PGZ A;  1NSN S;  2FMM A;  2WII B;  3GDE A;  5A2Q E;  4B3M Q;  4ZK9 B;  2ZXR A;  3S1M H;  4A3F H;  3EQL C;  4X66 Q;  5JJZ A;  1N33 Q;  3RZO H;  4OEM B;  5E7N A;  5EPL A;  1EY8 A;  2A69 D;  3W2D A;  3K57 A;  1D5M C;  1A6X A;  1IYV A;  2WAQ G;  3TN2 A;  3GTQ H;  5AFW A;  3S15 H;  3W1B A;  1PH4 A;  1M4V A;  5FKA C;  4O1N A;  3SE0 A;  3N6R A;  1KNE A;  3ITP A;  1VQ5 A;  2NN6 H;  4CKE A;  2QKI C;  4LW1 A;  3GTK H;  1EIF A;  3L9A X;  4HJ7 A;  4NDX A;  4BBS H;  4B3R Q;  1JE4 A;  1U9R A;  2EYL A;  4P72 A;  4QUC A;  2M00 A;  3T1Y L;  1I94 Q;  4BY1 B;  1SJE D;  1KRT A;  1CFM A;  4UP9 A;  1H9S A;  5C3X A;  3BZC A;  5COY A;  4IPD A;  1O80 A;  2K32 A;  2L5T A;  1B9N A;  4KV6 A;  3CCJ A;  4X64 L;  3CPF A;  1KXL A;  2VXW A;  1DYQ A;  3QOJ A;  1S5B D;  1WTP A;  3K0Y A;  4KMU C;  4CKB A;  1EY9 A;  4AYB E;  1GVP A;  5K36 H;  4DF7 A;  2GA4 B;  1V1P B;  5KIX A;  3Q6S A;  1DM0 B;  1GKH A;  2D0O A;  3C1F A;  3HFZ B;  4KK7 A;  4OL7 A;  4YCW A;  3GTL H;  3AYH B;  1E3P A;  1PFN A;  4HJ5 A;  2JN4 A;  4CKC A;  4C3H G;  1PZK D;  1V9P A;  2BDN A;  4GN3 B;  2PNH A;  3DHQ A;  1LM0 A;  2JA9 A;  2KHJ A;  1UE7 A;  2ID0 A;  4ZUJ A;  1R4Q B;  3NPP A;  3NSW A;  2IHE A;  3PIO 3;  3HOY G;  3G71 A;  2PI2 A;  4ME3 A;  4NPS A;  3R2I A;  1WCM G;  4DV4 L;  1Y69 U;  1NMF A;  1BDO A;  4E6I A;  2PQA B;  2F3I A;  2MO0 A;  2EYM A;  2A19 A;  2NVY B;  4LUO A;  1ILQ A;  2XSC A;  1KC8 C;  4JI7 L;  4EQO A;  4A3L H;  3T56 B;  1O7I A;  2BE5 C;  2KCC A;  2OWO A;  1A2T A;  2HUG A;  1EY6 A;  4IO9 A;  1FYC A;  2E2I B;  2WB1 B;  1FNW A;  3DM3 A;  3J7Y W;  4ZKB B;  2KHS A;  4QB4 A;  1K28 A;  1Q12 A;  1Y1W B;  5JVH 3;  2OF1 A;  4UP8 A;  4RH6 A;  4LF4 L;  3C46 A;  4IUU A;  3ULJ A;  1D5Z C;  3CRK C;  1A0I A;  2DN8 A;  1NUC A;  2V4D A;  5D14 A;  1X3Q A;  3OTO Q;  1ENC A;  5LMN W;  4GOP C;  1CA5 A;  5GAD C;  1AE3 A;  4KTA A;  4G7Z C;  3HKZ E;  1CM9 A;  4ME5 A;  4A93 G;  3TEH B;  1VQ6 A;  2R93 H;  1TWF H;  5IIF A;  1ASZ A;  1X3P A;  3OIP A;  2DY8 A;  1BCP D;  1E7Z A;  3F1Z A;  4DK1 A;  1IBL L;  3DLL A;  4A3J B;  1CTM A;  4RGN A;  1G8Z D;  5A35 A;  5CV9 A;  3D3R A;  1HXY D;  5GAE C;  4OO1 G;  1PMR A;  3NEM A;  3VR4 A;  4A3I B;  1AP0 A;  1SE3 A;  1TWG B;  1PRT C;  1HTP A;  1VQD A;  2RKS A;  4BBR H;  4BWG B;  2BA0 A;  1C8C A;  4B3T Q;  4YWK A;  4XQQ A;  1PLF A;  2WKD A;  4WOR A;  1EIY B;  5ELB A;  4JBM A;  3U58 A;  2R7Z B;  3I4N G;  1XJV A;  5DLQ E;  4JI3 Q;  2RDF A;  4EVO A;  4I65 A;  2KEN A;  4DK6 C;  1PDQ A;  1WFQ A;  2YU9 B;  1EQV A;  3I2Z A;  5CBE E;  1I94 L;  5FJ8 H;  4KI0 A;  1VQG A;  4HID A;  4DV0 Q;  1V1Q A;  2BOS A;  4FDB A;  4DU9 A;  3CME A;  4DUY L;  5M9O A;  5JAV A;  2SDF A;  4JI1 Q;  1HQR D;  1GUS A;  2BA1 A;  2LFN A;  2Z0S A;  2K5V A;  1IXR A;  2NVQ H;  4CGY B;  1HQM C;  1O7Z A;  1I50 B;  3CHB D;  4LF5 L;  4KY6 A;  1WTQ A;  1VQB A;  3NHH A;  4C3J H;  4CJ2 C;  2CH4 A;  1GUN A;  2RSO A;  4FNF A;  4LFC Q;  3D4D A;  4KN7 C;  1VMP A;  1B4O A;  1IBK L;  4RGT A;  1XMQ L;  2JA5 H;  1PVO A;  3OSO A;  1V8Q A;  1UEA B;  1HNW L;  1YNN C;  2K4K A;  1ASY A;  2K52 A;  4A3G B;  2NZO A;  2VUM G;  5IT9 E;  1HR0 W;  3T4A C;  1PH5 A;  5IYC G;  3RR5 A;  3VYU A;  1XXG A;  4V19 0;  3H0G G;  2VQF L;  4K6L A;  3GTG B;  2NTT A;  2RCN A;  2H4O A;  4MNO A;  2F0F A;  1AZP A;  3TBI B;  5JVG 3;  1KD1 C;  3HG9 A;  1QE6 A;  3NQI A;  3F2U A;  2EXD A;  3BVZ A;  1HCZ A;  3J7Z C;  4AYB G;  2K1B A;  4FP5 D;  2UUC Q;  3TS0 A;  3KJO A;  3K58 A;  2Y0S B;  2F0I A;  1G2S A;  3I8Z A;  2D0P A;  3T51 B;  1VMC A;  1YJ9 A;  1HNX Q;  1WTR A;  5ELF A;  4LF6 Q;  3SHL A;  1VQH A;  4BXX G;  5EGT A;  3CC2 A;  1QZH A;  3FKI B;  1A2U A;  3PV0 A;  1N36 Q;  4RGM A;  1GM5 A;  2CFM A;  4XQJ A;  1KLG D;  2E2H B;  1PFB A;  1TS2 A;  1I3Q B;  1X65 A;  3RLF A;  2F0E A;  4YHH Q;  1NTG A;  4JW0 A;  4FF3 A;  1WI5 A;  1B2T A;  1TWG H;  3URY A;  3OMC A;  4B3T L;  1KNA A;  1VDZ A;  5FLX c;  2K01 A;  2AMC B;  4LF8 L;  4HR7 B;  3WOF A;  2ZM6 L;  3NK9 A;  4DR6 L;  3K5M A;  1E2V A;  1JE5 A;  1IBM L;  4JI4 L;  5DNF A;  2PW7 A;  2XIW A;  3SK6 A;  3HOW B;  5LMN Q;  1XMO L;  1RL2 A;  2RA4 A;  2A68 D;  3D4R A;  4ODG A;  1EFW A;  1MI2 A;  2NZH A;  1LTG D;  5FO9 B;  3UDF A;  3HKZ G;  3BDO A;  3VR6 A;  4GLA C;  2EYF A;  2XWJ B;  2UU9 Q;  4NXN L;  3E5S A;  5C44 B;  1QZG A;  2JEA I;  1HA6 A;  1ML0 D; 
#chains in the Genus database with same CATH homology
 3NXW A;  1EY5 A;  2J4X A;  3S9W A;  1TS5 A;  1JOQ A;  3X3N A;  3D8G A;  2FFK B;  4FF2 A;  1KTK A;  4QIW B;  5FO8 B;  1TY0 A;  1UAP A;  2F0M A;  2MGS A;  2K7V A;  1V1O A;  1DJR D;  3LWE A;  2Q8R E;  1YNJ C;  1AFP A;  4ULL A;  4U67 3;  3RD4 A;  4RHS A;  2JA8 B;  3P1H A;  3PIP 3;  5CMD A;  2WV6 D;  3A8J E;  4R8I A;  5I6W A;  4RKL A;  5C0X H;  3NBH A;  4Q0F A;  2QDB A;  3HOV B;  4C3I B;  2K04 A;  2F0W A;  1Q8I A;  3MFY A;  5KYI A;  4K5X A;  5KRU A;  3A54 A;  1HRJ A;  1AN8 A;  4M8A A;  1ET9 A;  3M7N A;  4ID6 A;  5BN5 A;  3PUZ A;  2WP8 J;  5G3L F;  1G91 A;  3I73 A;  1F2L A;  2AUK A;  5I6Y A;  4JK1 C;  4L8J A;  1JC7 A;  1U4M A;  4XYQ A;  5M3M B;  3IKJ A;  2B2V C;  1G6Z A;  1F9S A;  3DEO A;  2F0K A;  2NN6 I;  3TP5 A;  4LAA A;  4ILW A;  3S17 B;  1O7Y A;  3BVM A;  1LTB D;  3ERQ A;  1LTR D;  4X3U A;  3JAM L;  2EYJ A;  2EY2 A;  2NZ1 D;  1I4Q A;  4KKT A;  1OO9 B;  3S1M B;  2ZT9 C;  4A3F B;  3VYR A;  4F8M A;  3RZO B;  3MXP A;  4IFD H;  4HED A;  4N9P A;  1I4P A;  3S15 B;  2E76 C;  4ZRZ A;  2M2L A;  1KDA A;  4DAY A;  4XTC S;  2J0T D;  3OWF A;  3QIA A;  1QCB D;  4TQU S;  4B9X A;  1RF2 D;  1UUP A;  2A6H C;  4P2C B;  1XX8 A;  3NTH A;  2L11 A;  3GV6 A;  4QF4 A;  5IGB A;  4BBS B;  1W6K A;  2PZU A;  4ZYS A;  2F0T A;  1A15 A;  4F87 A;  1SND A;  2B8G A;  4CJ0 B;  1EYD A;  1LV9 A;  3KLR A;  3FMC A;  3PMF A;  1I4H A;  3J81 L;  3FVQ A;  4X3T A;  1U4L A;  1RHP A;  3GTL B;  1EY7 A;  1ZYR D;  4RCO A;  5KND A;  1GUW A;  1K8M A;  2AUJ D;  2A74 C;  1TY2 A;  1DOM A;  5IOC A;  3FDT A;  5I4D A;  4IN3 A;  1A3T A;  4EQN A;  2D2C C;  1HUN A;  1U4P A;  3OPO A;  3RUZ A;  2K5W A;  4TRD A;  2NWG A;  3A8I E;  3BVG A;  3SK8 A;  4XT1 B;  1PZI D;  1LTT D;  3ND9 A;  2AQ2 B;  3TDQ A;  1T5E A;  1NR2 A;  2KQ3 A;  2DNE A;  5CGK A;  1CHP D;  1SNP A;  4EQP A;  1DD2 A;  1IKM A;  2I07 B;  2R93 B;  1TWF B;  4KKU A;  3GO5 A;  1K83 B;  2B2V A;  1RD9 D;  5I2Y A;  4BA2 I;  1HFG A;  3KBG A;  3E6Z X;  2C5C A;  2PQE A;  4BBR B;  4A3D B;  1JWS D;  3ZYY X;  2F0S A;  2Z4H A;  1K8O A;  1F2M A;  1FR3 A;  4H0L C;  4I7Z C;  3J7A V;  5ELD A;  1CK1 A;  3S1R B;  4IUV A;  1WD1 A;  4QMG A;  1PTO C;  2QIL A;  4KHV A;  2IL8 A;  2PMZ B;  2IPK D;  1DXM A;  2D5D A;  2M9V A;  1L0X B;  3Q23 A;  1KLU D;  4M1U B;  4IUT A;  2BDO A;  1LO5 D;  5E1F A;  1STG A;  3MTS A;  2A6E C;  1JCK B;  2OT2 A;  5JPM C;  3QB3 A;  5BN3 A;  5HGT A;  4FF4 A;  2NVQ B;  3M4Y A;  4Q5V A;  3S1N B;  2EY6 A;  3MA2 B;  4O42 A;  1B3A A;  3M7G A;  1A3V A;  3K5N A;  4C3J B;  1OXX K;  3K5O A;  4HTH A;  2JA5 B;  4NW2 A;  4HCS A;  2TSS A;  4BS9 A;  3OIQ A;  2L12 A;  2MUY A;  1STB A;  2A69 C;  1S5E D;  1D5X C;  3R2T A;  1V1P A;  2L55 A;  1PRT D;  2K28 A;  1O78 A;  3LX0 A;  3EVQ A;  4DAV A;  4PV1 C;  4KJO A;  5FLX E;  3VA7 A;  1LAC A;  4XXE A;  3GTJ B;  1GHJ A;  1QWY A;  3MHB A;  3DWP A;  2F1M A;  4K6D A;  1SNO A;  2KA7 A;  2AQ3 B;  1WTV A;  4UAI A;  1B53 A;  3NTK A;  5EQ0 A;  5I9O A;  1KAB A;  4R8N A;  3OWE B;  4KHZ A;  1II3 A;  2EYH A;  1Z7T A;  1RDP D;  1Z6H A;  3MXN A;  5CV7 A;  3BS1 A;  5CV4 A;  4FO2 A;  2ZXO A;  1ENF A;  2CHB D;  3VR2 A;  2ENB A;  1HTL D;  2NN6 G;  2B2U A;  1Y8O B;  2EJM A;  3Q22 A;  4X3K A;  4QUF A;  1YNN D;  1D2B A;  2SNS A;  3C1E A;  3ONA B;  5I9P A;  2MHV A;  1LLR D;  4XIG S;  2AWN A;  4CJ1 B;  2IX1 A;  2OEO A;  1HFN A;  4G57 A;  4J8Q A;  2KOL A;  4RFB A;  1W6J A;  2JEB I;  1MGS A;  2HQE A;  3NE5 B;  2VB3 X;  2IW3 A;  2J7Z A;  2PPB C;  1IL8 A;  3S14 B;  3BZD B;  4HSV A;  5C0X I;  1M8A A;  3I72 A;  1OXV A;  2MJ8 A;  3A8K E;  1EEI D;  1I4X A;  3BDC A;  2KJX A;  1EFI D;  4G7H C;  2VB2 X;  5C4H A;  4LMQ D;  3GTO B;  3OW7 A;  3BDL A;  5C3E B;  1ONL A;  2JYO A;  1VF5 C;  2LY7 A;  3CKI B;  2EJF C;  1RTN A;  4K8I A;  1ESR A;  4KJN A;  3D6W A;  2PO4 A;  3MVV A;  3CQZ B;  2CW0 C;  1J8I A;  1QJO A;  2F0N A;  4BA1 I;  4RKB A;  4RGO S;  1BBX C;  1WTO A;  3HP3 A;  5TSS A;  3M4O B;  2HCC A;  4IFD I;  1UNS A;  2F0P A;  3DXJ C;  3FPP A;  5C4J B;  1WTX A;  4NKL A;  1H9R A;  3A56 A;  4L6T B;  1PYW D;  2F4I A;  4TSS A;  4B9W A;  1STY A;  3LWU A;  3NWT A;  1XYI A;  1SSO A;  2F0U A;  2CVR A;  2FMC A;  5EKI A;  4K2K A;  1Y8P B;  3W3A A;  1IKL A;  1QOH A;  1H9M A;  1MSH A;  1SXT A;  5C0X J;  1PRT B;  1I6H B;  3C3L A;  4LK1 C;  2L4N A;  3KLS X;  5EKK A;  4C1N I;  2YYZ A;  2K5Q A;  1DCZ A;  3V05 A;  2KVM A;  3V2T A;  3H09 A;  3PUW A;  2ICI A;  1PTO H;  2HCI A;  1MD2 D;  5EPK A;  1TU2 B;  1BUV T;  5JEA J;  1TKW B;  3GTP B;  3R3O A;  5D3I B;  1IHZ A;  1BCP B;  2WAQ B;  1R9T B;  1PXU A;  2D9U A;  2XNA C;  3T13 A;  1B1Z A;  3T53 B;  5EJW A;  3GQB A;  4KD3 A;  1GUT A;  2EZV A;  2RDG A;  1EL0 A;  2XRQ D;  1Y8N B;  3SDZ A;  1F2Z A;  1MSG A;  1PRT F;  4HAE A;  4IFD J;  3MFG A;  2KEC A;  3HRZ C;  3SVM A;  5F2D A;  1AEX A;  1SE4 A;  1TT2 A;  4XT3 B;  4QCL A;  5M5Y B;  3SK5 A;  5C6A A;  2A68 C;  5DM7 3;  1DZ1 A;  3VYT A;  2Q8T A;  1RTO A;  2IJ0 A;  3DWA A;  1XWE A;  4C3H B;  5J22 A;  2F0G A;  1KAA A;  1TS3 A;  4KY7 A;  1BCP F;  1SNQ A;  5KEE A;  2TMP A;  2PZW A;  5E4W C;  4DXG A;  1WTW A;  1JR0 D;  3EJI A;  4KKS A;  3K7A B;  3HOY B;  3FPU B;  4V0B A;  1SJH D;  5JEA H;  1NAP A;  2A6H D;  1WCM B;  4DAP A;  2HDL A;  2K6A A;  4IUN A;  1SEB D;  1SYG A;  1SYC A;  3KK7 A;  2JP1 A;  1Q3L A;  3IL8 A;  5EBD A;  5DEH A;  4H7B A;  2L9H A;  2O2L D;  1IW7 D;  5A2Q L;  1B44 D;  3VR5 A;  4YIJ A;  1SNM A;  4PMW A;  4RCN A;  1PZJ D;  2E75 C;  3DUZ A;  4C1N K;  2WIN B;  3I90 A;  1JOO A;  2DNC A;  4A93 B;  1JB3 A;  3D6C A;  3OHX C;  2O5I C;  5CV8 A;  5IGC A;  5HUR A;  4ZKC B;  2MP1 A;  5EPJ A;  1BF4 A;  1STH A;  1TR5 A;  1QNK A;  2PW5 A;  1C48 A;  3NP8 A;  2PYK A;  2EE1 A;  2L1B A;  1NR4 A;  3PUV A;  5DAU A;  3VYS A;  3NWS A;  1LTA D;  1H9J A;  4OGQ C;  1CZG A;  1FGB D;  5D3D A;  5E4X A;  3SXH A;  1JWM D;  3I4N B;  3ND8 A;  3H91 A;  4K14 A;  1LTI D;  2RVL A;  2EOT A;  3BYY B;  2F0L A;  1BQQ T;  1EU4 A;  3Q24 A;  4IAL A;  1OXS C;  4WJW A;  4C2M B;  3WOE A;  3DWQ A;  1TWH B;  4K2L A;  2KCN A;  1BXT A;  1EWC A;  3L3O C;  1C4Q A;  1WD0 A;  4DFA A;  1Z47 A;  1EOT A;  5IGD A;  3SR1 A;  2IT1 A;  4HSP A;  3FRP B;  4C56 C;  1B50 A;  5C5L A;  2VUM B;  1GUO A;  1PTO D;  2XVS A;  3TZD A;  3GV3 A;  1OXT A;  2O4X A;  2FHT A;  4FXG C;  3H0G B;  2AQ1 B;  5CV6 A;  1GXD C;  5COR A;  2B2U C;  1JQY D;  3X3M A;  4Y7N B;  3S2D B;  2PZT A;  3AMU A;  2A6E D;  1TII D;  4AYB B;  5EKL A;  1BOS A;  1FNV A;  3K59 A;  3CU7 A;  5C3W A;  1CZW A;  3QG1 A;  4K8J A;  5KYL A;  2JSO A;  4TKO B;  4DNT B;  2A73 B;  3QWN A;  1NCV A;  3FEW X;  1LT5 D;  3JAM E;  2EY5 A;  3U9O A;  1F9P A;  2KED A;  2ZXP A;  4CHT B;  3OMG A;  4DGZ A;  1SMY C;  1JWU D;  1HHV A;  2R6G A;  1CA6 A;  1H9S B;  1LTS D;  1STE A;  1QIL A;  4OO1 H;  2EYP A;  2EPB A;  2MPM A;  1ILP A;  3DEP A;  2B2Y C;  2BE5 D;  2OXP A;  5I2X A;  1RCV D;  4XDX A;  5CR3 A;  1STA A;  2IX3 A;  1SNC A;  3HS0 C;  5C5M A;  3EFX D;  2BCO A;  5NUC A;  3J80 E;  3E0J A;  5CC4 A;  4GZY C;  5M5X B;  3M85 A;  1SYF A;  1EY0 A;  3HKZ B;  3G6J B;  1HA5 A;  3AU7 A;  1I4R A;  4ABN A;  4C3I G;  2ICE C;  3TP6 A;  3IAY A;  3J81 E;  1RKN A;  4MHE A;  5IT9 L;  3L7Z C;  2B2T A;  2EVB A;  3MZ5 A;  2K03 A;  2RBM A;  3O13 A;  2VNU D;  1G2T A;  5JOB A;  2AWO A;  1ENA A;  2NVX B;  1AZQ A;  1H9K A;  5CBA E;  1CQV A;  3KF8 A;  4Z9C B;  2FJ2 A;  3PO2 B;  4IQZ A;  3HOZ B;  2PCF B;  3DMU A;  1SYD A;  1RJT A;  3RMH A;  3R93 A;  3MC0 B;  2Z8L A;  2B39 A;  4IUP A;  3RZD B;  2R61 A;  3S16 B;  1JOR A;  1T5X D;  1S5C D;  1HPC A;  1TVX A;  2E2D C;  1EYA A;  4HCE A;  1ZKO A;  1ESF A;  1HUM A;  1F9R A;  2IWH A;  2HDM A;  5G3L D;  3TME A;  1S4Z A;  3MEH A;  3NBI A;  1JOK A;  2JXM B;  4FF1 A;  2LKV A;  1EIG A;  1LT4 D;  3NTI A;  3AB9 A;  2RSN A;  1E2W A;  4WFN 3;  1GHK A;  4A3B B;  5C4Z A;  4LJZ C;  3I91 A;  4KD4 A;  4EGV A;  5M3F B;  3S2H B;  4OIJ A;  1TWA B;  2C9O A;  3QOL A;  3P20 A;  4HN7 A;  5T1G A;  3D4W A;  1CI3 M;  5K36 G;  1PTO B;  1QNU A;  2CW0 D;  4H44 C;  3OOC A;  4IUR A;  1VF7 A;  1ICW A;  2PNR C;  1I4G A;  1QG7 A;  2B2Y A;  3MWY W;  3P7J A;  1BCP C;  1LT6 D;  2JA7 B;  3VR3 A;  2D62 A;  1SFO B;  1SE2 A;  1V43 A;  1GJX A;  2L0C A;  1CHQ D;  1SBB B;  4X3S A;  3I4L A;  3MAQ A;  5ELC A;  1TWC B;  4RWS C;  4JBW A;  4S3S A;  3UI2 A;  4PQX A;  2B8F A;  3KBX A;  4PMB A;  5IGF A;  1SYB A;  2E74 C;  1PTO F;  1GUG A;  2FIN B;  4A3E B;  3H94 A;  3GD7 A;  1SAP A;  1O7L A;  2DY7 A;  5CYU A;  5LL6 X;  4DXF A;  5IOD A;  2JA6 B;  2XN9 C;  1F9Q A;  3M3Y B;  3G7L A;  2F0Q A;  1F77 A;  3GTM B;  2LMC B;  4UDU C;  4B08 A;  1BR9 A;  3I4M B;  1A3U A;  3TP7 A;  4U68 A;  5FK9 C;  4ZAI A;  5JPN C;  1ZXT A;  3P75 A;  2NVT B;  1LT3 D;  2EJG C;  5J1Z A;  1KDB A;  2XWB B;  3KLS A;  4HMJ A;  5EBC A;  4NP5 A;  1D6E C;  5LHY 1;  5DM6 3;  2K05 A;  3PUX A;  2Q8I B;  1F2Y A;  3NUC A;  4A3K B;  3IFT A;  1YNJ D;  4A3M B;  2R3Z A;  5CV5 A;  1J9O A;  4G4K A;  3A55 A;  2F0V A;  1DOK A;  2NUC A;  4OHJ A;  5T1I A;  2KUM A;  2CQA A;  2A5H A;  3V96 A;  1Q1B A;  2Z1C A;  1Q1E A;  4C3J G;  2F0O A;  3H6M A;  2KEE A;  3QJY A;  3Q0A A;  3TSS A;  2XRS D;  1EQT A;  1X32 A;  4MIU A;  3QO2 A;  5KNB A;  4N9T A;  1EIH A;  2SNM A;  2EDG A;  4FYD A;  1QB5 D;  3IFD A;  4FXK C;  1GOZ A;  3CRL C;  3A7L A;  3VA5 A;  3ERO A;  1ZEQ X;  4F7X A;  4DA2 A;  4DNR B;  3HGB A;  5ELE A;  1FNU A;  2NB0 A;  3H3V C;  1D1I A;  5M5W B;  2R92 B;  1FD7 D;  5J39 A;  1BNZ A;  1TQO A;  4FVM A;  3WDN A;  2B2W C;  4KY5 A;  1D1K A;  1EYC A;  5K5P A;  3DM1 A;  5IGE A;  5FOB B;  1E2Z A;  1TS4 A;  4CBV A;  1Q90 A;  5D65 A;  4K5W A;  3HOX B;  2RDH A;  2QF7 A;  1OXU A;  2NTS A;  2B63 B;  4PNY A;  2WKC A;  1EWH A;  1ROD A;  1SYE A;  4DK0 A;  4MN3 A;  2O5J C;  2EY1 A;  3EA6 A;  2RQX A;  2NBF A;  1MBY A;  4OO1 I;  3J7A F;  4IZ8 A;  2F0J A;  4K5V A;  4KN4 C;  4WRD A;  2F0D A;  1CQF A;  3N52 A;  4BY7 B;  3I70 A;  1PFM A;  3BYT B;  4RHR A;  3U9S A;  4RA8 A;  3SEB A;  1ET6 A;  2E2J B;  3PUY A;  1DON A;  1XTC D;  2EYO A;  4NMZ A;  2G9D A;  5IGG A;  1AW7 A;  2K33 A;  5LL6 S;  2H1E A;  3GP7 A;  3MXG A;  4R9W A;  4L63 B;  3C2P A;  3TZU A;  4XYO A;  2N55 A;  1E0B A;  1Y1V B;  1S5F D;  3LNN A;  3GTQ B;  2N88 A;  2K5D A;  4ZUI A;  2X6L A;  2I46 A;  3HZX A;  1BO0 A;  5C4X B;  1G29 1;  1I6V C;  3R8B A;  5ISR A;  2F3W A;  3GTK B;  2IX0 A;  4FXD A;  4G7O C;  2B2T C;  4PMC A;  1STN A;  3J80 L;  2F0H A;  1EZ6 A;  2SOB A;  2WAC A;  1KDC A;  2LS0 1;  4J1M A;  2EXZ A;  2G9H D;  1EZ8 A;  5BN4 A;  1IW7 C;  5C0X G;  1LAB A;  3D31 A;  3HOU B;  1SDF A;  3A7A B;  4ZQ3 A;  3I3C A;  5KNC A;  1S5D D;  3BG3 A;  1R4P B;  3NQT A;  4HMI A;  3T16 A;  3HEJ A;  1WVL A;  2JE6 I;  1DOL A;  2QEJ C;  2F3V A;  5KGU A;  2F03 A;  2QCP X;  5JEA G;  5FO7 B;  1EY4 A;  2B2W A;  1EU3 A;  3K5L A;  5FLX L;  1SMY D;  3MXU A;  5E3F A;  3TP8 A;  4RAU C;  4F88 A;  4IUQ A;  2X69 A;  1U4R A;  1JIC A;  1L0Y B;  3K6O A;  2X6G A;  4OIK A;  1VCI A;  1CT1 D;  3PO3 B;  1IYU A;  3KUP A;  3SK4 A;  4ZLT F;  2Z4I A;  4J6H A;  4DN4 M;  4IFD G;  2SEB D;  4H13 C;  1ZYR C;  3S1Q B;  1B9M A;  2NYZ D;  4XQN A;  1EEF D;  1NSN S;  2FMM A;  2WII B;  5A2Q E;  4ZK9 B;  2ZXR A;  3EQL C;  5JJZ A;  5EPL A;  1EY8 A;  2A69 D;  3W2D A;  3K57 A;  1D5M C;  1A6X A;  1IYV A;  3TN2 A;  5AFW A;  1M4V A;  5FKA C;  4O1N A;  3SE0 A;  3N6R A;  1KNE A;  3ITP A;  2NN6 H;  4CKE A;  2QKI C;  3L9A X;  4NDX A;  1JE4 A;  1U9R A;  2EYL A;  4QUC A;  2M00 A;  4BY1 B;  1SJE D;  1CFM A;  1H9S A;  5C3X A;  5COY A;  1O80 A;  2K32 A;  2L5T A;  1B9N A;  4KV6 A;  2VXW A;  1DYQ A;  3QOJ A;  1S5B D;  1WTP A;  3K0Y A;  4KMU C;  4CKB A;  1EY9 A;  5K36 H;  4DF7 A;  2GA4 B;  1V1P B;  5KIX A;  3Q6S A;  1DM0 B;  3C1F A;  4OL7 A;  4KK7 A;  1PFN A;  4CKC A;  4C3H G;  1PZK D;  2BDN A;  3DHQ A;  2ID0 A;  4ZUJ A;  1R4Q B;  3NPP A;  3NSW A;  3PIO 3;  3R2I A;  1Y69 U;  1BDO A;  4E6I A;  2EYM A;  2NVY B;  1ILQ A;  2XSC A;  4EQO A;  3T56 B;  2BE5 C;  2KCC A;  1A2T A;  2HUG A;  1EY6 A;  1FYC A;  2E2I B;  2WB1 B;  1FNW A;  3J7Y W;  4ZKB B;  2KHS A;  4QB4 A;  1Q12 A;  1Y1W B;  5JVH 3;  2OF1 A;  4RH6 A;  3C46 A;  4IUU A;  1D5Z C;  3CRK C;  2DN8 A;  1NUC A;  2V4D A;  5D14 A;  1X3Q A;  1ENC A;  1CA5 A;  4KTA A;  4G7Z C;  1CM9 A;  4ME5 A;  5IIF A;  1X3P A;  3OIP A;  2DY8 A;  1BCP D;  4DK1 A;  4A3J B;  1CTM A;  4RGN A;  1G8Z D;  5A35 A;  5CV9 A;  3D3R A;  1HXY D;  4OO1 G;  1PMR A;  3VR4 A;  4A3I B;  1AP0 A;  1SE3 A;  1TWG B;  1PRT C;  1HTP A;  2RKS A;  4BWG B;  2BA0 A;  1C8C A;  4XQQ A;  1PLF A;  2WKD A;  4WOR A;  5ELB A;  2R7Z B;  2RDF A;  4EVO A;  4I65 A;  1PDQ A;  2YU9 B;  1EQV A;  5CBE E;  4KI0 A;  2BOS A;  4DU9 A;  5M9O A;  5JAV A;  2SDF A;  1HQR D;  1GUS A;  2BA1 A;  2LFN A;  4CGY B;  1HQM C;  1O7Z A;  1I50 B;  3CHB D;  4KY6 A;  1WTQ A;  3NHH A;  4CJ2 C;  2RSO A;  1GUN A;  4FNF A;  3D4D A;  4KN7 C;  1VMP A;  1B4O A;  4RGT A;  3OSO A;  1V8Q A;  1UEA B;  1YNN C;  4A3G B;  5IT9 E;  3T4A C;  3VYU A;  1XXG A;  4V19 0;  4K6L A;  3GTG B;  2NTT A;  2H4O A;  2F0F A;  1AZP A;  3TBI B;  5JVG 3;  3HG9 A;  1QE6 A;  3NQI A;  3F2U A;  3BVZ A;  1HCZ A;  2K1B A;  4FP5 D;  3K58 A;  2Y0S B;  2F0I A;  1G2S A;  3I8Z A;  3T51 B;  1VMC A;  1WTR A;  5ELF A;  3SHL A;  5EGT A;  3FKI B;  1A2U A;  3PV0 A;  4RGM A;  4XQJ A;  1KLG D;  2E2H B;  1PFB A;  1TS2 A;  1I3Q B;  3RLF A;  2F0E A;  4FF3 A;  1B2T A;  3URY A;  3OMC A;  1KNA A;  1VDZ A;  2K01 A;  4HR7 B;  3WOF A;  3NK9 A;  3K5M A;  1E2V A;  5DNF A;  2PW7 A;  2XIW A;  3SK6 A;  3HOW B;  2RA4 A;  2A68 D;  3D4R A;  4ODG A;  1MI2 A;  1LTG D;  5FO9 B;  3BDO A;  3VR6 A;  2EYF A;  2XWJ B;  3E5S A;  5C44 B;  2JEA I;  1HA6 A;  1ML0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...