1CI5A

Glycan-free mutant adhesion domain of human cd58 (lfa-3)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
95
structure length
95
Chain Sequence
SSQQIYGVKYGNVTFHVPSNQPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTKSGSLTIYNLTSSDEDEYEMESPNITDSMKFFLYVGES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (LYMPHOCYTE FUNCTION-ASSOCIATED ANTIGEN 3(CD58))
publication title Functional glycan-free adhesion domain of human cell surface receptor CD58: design, production and NMR studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 13
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 1999-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ci5A00
2XFXA 1EEZB 2P8PA 4N90E 4PJHF 3RGVD 1J5OL 3QULB 1MCNA 1U58B 4HFWB 4HJGB 4QLRA 2FSEB 2WBWB 4L8CA 2E7MA 4PJ5A 2ATKA 2R0LH 1Z9OA 5B4MC 5EUOA 1HSBB 1CXKA 4R0LA 4P46D 4JG0H 3GSRB 4ZUVA 3SDYH 2WAHA 2OZ4A 1UENA 1C08A 3V9FA 3PWVB 1RZ7L 2PXYC 4QYOA 1U8PB 4KMTH 1I8KB 1A22B 2Z91A 5T3ZE 1MHPH 3SDCA 2I9TB 2FGZA 1CVRA 1FVEB 4OGYH 4K3DH 3JWDC 5E0QA 3WXWH 1FGVH 2QR0A 1SYVB 2BXZA 1IM9A 4LKXB 4Z7NF 4BK4A 1PSKH 5DJ2B 1G7LB 3ULSB 4PFEA 1DVFA 4JY5L 3FT2A 4OF6A 1TCRA 3DSFL 3FHQA 4XP6H 2WSKA 3ARFD 5FA3B 4LVOB 1SEQL 3FO0H 1IC5L 5DUML 2ZUTA 1CQYA 4ZS6C 4NC2B 3DETC 1GZQB 2X1OA 2GKIA 3ZYOA 1VFOA 3ZDZF 3GSVA 4Y16D 2V9TA 1P4IH 1Q94A 1NDMA 2H32A 2ZUXA 2B1HH 4GBXD 4KUZL 3V7AE 3MUJA 1FZOA 2DD8L 4CUCA 3QSKB 3G08A 1JGVH 2XKUA 3IXAB 1T1WB 4LBEA 5GGRA 4E0RB 4FTVD 2XTLA 2ICES 1WBYA 3QHZH 4G3YH 1HEZB 4P2OD 3EJYC 4JFEE 4Z7VA 1T22B 4RFOH 2BXYA 2R2EA 4FNLL 2VE6B 4L8DA 4UMGA 5AZ2H 3EGSA 3O3DB 3WYRA 4F7MB 1S9VA 2V2XB 2X4RA 2CUHA 1RULH 4OGAC 2BX5A 4AH2B 1OLLA 4AEIH 4PRPE 1XF4A 5C0BA 4MA8H 4GQPH 4YHPA 2IG2H 1L9NA 3MV8B 4I18A 2VH5H 4NQDB 2GJZB 12E8H 4OZFG 4KUCD 4QRSA 4M03A 2C7UB 3C5SA 4NYLB 3QEGH 1OAKH 5FHAH 1AI1H 1KJ3H 2Z35B 1G0YR 1KPUA 1U3ZA 2PXYB 2GY5A 2VDKL 2E8YA 4RX4D 1ZOXA 4WW1A 5I1IL 1E27A 1UWGL 4JY6B 2NY4D 4WI4A 4HX1B 5EB9A 3RPIA 2Q7YB 4DW2L 3SDXB 3ESVF 1A6UH 3OR6B 3WHE1 1M6OB 3GIZL 1J05B 1F3JA 3D69B 4HKBA 5F7WC 2ZWLT 4HHAA 2I60H 5D9SA 3HS0B 4U1HB 1YQVH 2IQ9L 4U6YB 4Q6IB 3BMVA 4EN3C 3MCKA 4M1GH 1BLNA 5FDWA 5AD0B 4XPBL 4FHBD 4JAMA 3NTCL 2XIDA 2VQ1B 4FQLH 4LKCB 1HIML 4CMMB 4RISL 2JELH 5BRZB 5IMOB 5I19H 2Z31A 1N64H 3SJVD 1ES0A 4UZGA 3MLVH 4TUJB 1GGBH 1NCAH 3QUXA 4MHHG 3W11C 3VRIA 3VXSB 4QEGA 1TJIH 5IBUB 3VE0A 5DEGA 4HJ0C 5HDQH 5I15H 3CFJB 5DQDH 4JG1L 5C09B 4PJ9B 4JY4A 1U8NB 4YC2C 3E6HA 2GT9A 1FV1B 1AE6L 1HOCA 1ZGLM 1HYSC 3IDXL 4KK5C 4QHLA 4I9WE 3UTPD 4YFLF 4PRIA 1XCQB 1FYTD 1N8ZB 1PQZB 4HBCL 1JI2A 3FB5B 1MF2L 3DUHA 1X5GA 4WO4B 3WFCL 5MENA 3MRIB 1JNLH 1RZKH 2FZ3A 3F58H 3G5YB 4IOFD 5IUSA 2R23A 5JW3H 2FNBA 2OXGA 3A6OA 2G60H 4PY8I 2GSGB 1G7IA 1JTTA 2DQCL 1MRDH 4PJ5E 1QUNA 4WW2F 5IJVA 4PTTB 2W91A 5EUOE 1S78D 3RVWC 4KHXH 3F7VA 4U2ZA 4YHYC 3ARBC 3C8DA 4UBDC 3D87B 3FOLB 4C4KT 2OL3B 4LVNB 3H7LA 5FV2A 4Y19D 5FM5M 1F4WH 4UNTA 3U46B 3WNLA 1J1OL 1RPQA 2X4PA 4ODSL 2IANA 4J7RA 3TA3A 3MJ9L 2VDNH 4GLRH 5IVXA 3QI9B 5D8JL 5JIKA 4DK3A 4XCCL 3MYJB 2XWJB 4RGNB 5I1LB 1FNLA 3UTTD 1KYOK 4X7TB 4JO4H 1K4CB 4KK6C 1S5HA 4TSAH 1KTLA 1XF5A 4JDVB 1BJ1J 4JHWH 4MX7B 2CGRL 1TMCB 4X5XA 4Z7QF 2ZNWA 3MLZL 4NNXB 3D6GA 3C09C 5EZIH 1YEKL 4U1GB 1FIGL 1OB1B 4N8VB 2VC2H 4Z95H 2IPUG 4UIKH 4V1DB 1U95B 3L5WA 4LRIC 4ZS7L 3D0VB 5C0FB 1R3JA 1NAKH 1I9JH 3F12A 1N5YH 5H35A 5IOPA 3HC4H 5GSVA 2ZNXA 2AXGA 1FNSL 3CVHL 3T4AA 3ZE0E 1EFXA 4Q9QH 4UAOB 4YXLL 3GHEH 3UDWC 5J12B 1IL1A 4RCAA 3LRSB 3Q1SL 5KOVC 3VJ6A 5KSAC 3WNMA 4ZSOB 4R6UA 1PY9A 3SDDD 3H0TA 3KNBB 4Z7VE 4WHCA 5D1XB 3HAEG 4HGKC 3H6JA 1RK1B 3GFUA 1OTTC 2VLKD 4GMTL 4XVSH 2H6PB 5C71A 1DCLA 3GBML 5HVHB 1KN4H 3MPCA 1V7MH 1TETL 2OBGA 5JR1L 4UILH 1MCWM 1MRCH 2CR6A 2J4WH 5CJXC 2E7HA 1RUQH 4NGHH 4C4KO 4CN6A 1P2CB 2AXHA 1W72A 2YS4A 5K9JH 5C0BE 4LEOB 1X5HA 1DE4A 1C16A 1EO8H 4OLXH 1U3HD 2DKUA 3G5VB 2VXUH 3CIQA 3CFCL 3UPRB 4Y4KB 3KLAA 1OD7A 2OTWB 3TO4B 3H8NA 3ARDC 3CLEH 4X6EA 4DEPB 1ZKAA 4DTGH 1I75A 4YHLL 5BV7B 3UYPA 1U8JA 3C8KA 4QF1A 3HRZA 5FUCC 1ODAA 1DQQB 4G5ZH 3QO0A 3ZHDA 4DCQB 3PL6D 5ISZA 3LKRA 2DMKA 3MRFB 3MRBB 4EZMA 2ZG1A 1CICC 2QKIB 5F7HA 2FX9H 2HFFA 3C09B 5ESQB 5FXCH 3AB0C 3UTSB 3EOAB 4X9GA 4YEEA 3VXOA 4Z0BL 3CFDB 5TE7L 2PO6B 3QFJB 1S7TA 4GLRI 5IF0B 3QUYD 5I8EB 3JWNC 4KPHL 5D7JA 5L88H 4C59B 4MA7H 2YBRB 5DJXA 4K71B 4F57L 4PLOB 3A6CL 3HHRB 1EEYA 5K9KA 5KSBF 1JGDA 1SVCP 4TN9A 1CTOA 4CVUA 3VFSA 5K9QI 3LKPB 3B9VA 2ADJA 5EU6A 4AL8H 4JG0L 5FYKD 2R69L 3EUUA 4NN5B 3SDYL 3OR7B 2EDNA 4S11A 1R0AL 1V3KA 1N0XL 1TZGH 3V5KA 3W2DL 4X5WA 1M7IB 2H41A 2ITDB 1MFEH 2WNGA 2NZIA 5KAQF 5SWSA 4KMTL 4D0CA 3O8XD 1MHPL 5HHNB 3BFOA 1U92B 3L6FB 5D7SH 4K3DL 1INDH 3WXWL 1L0XA 4FQXD 1RAMA 3F7QA 5D96B 1XGYL 1ZTXH 3CXDH 1PSKL 2FSEA 4XCEA 4I0PC 1TZIB 1EO5A 5F9WC 3SKNB 3LN9A 1WCQA 4ORGA 5FCUH 3LEVL 5IFHH 3NN8A 4XP6L 2W59A 1NC4B 1FL3A 1T5WA 5IK3B 3WFZA 1U93B 3GNMH 3H9YA 4YWGH 1JGEB 2IANE 1S5IH 1UWXH 1YUHB 4WVRA 1G9EA 1OSPL 1U8PA 5MEOA 5CP7A 5C3TA 1MCDA 3PG2A 2A0LC 4U1JB 4LQFH 5IVXE 1IAOB 2AKRA 1P4IL 1KN2H 5F89B 4LMQI 5CLTA 1KSRA 3T2NH 2Y1VA 5EU4B 1PEWA 4EDXA 4NO3A 3ULSA 5E2UH 3OTTA 2CQVA 3OQ3B 4MDIB 3NGBB 5D2NA 4DWHA 1JHLH 4U6VH 1KNOB 3NIFF 4QRPA 5D7IB 3RWGA 2UZXB 4H0GA 1JVKA 2LAGB 2VDML 5IMLB 4ZOAA 3JWOL 4KROC 2M8XA 3B2VL 4QHNA 5AZ2L 4NFCA 3VXRD 5JXEC 4RMWA 3T0VA 4EIGB 3CDFA 3RUGF 1CXEA 3ORJA 1RULL 4ODWA 1KT2B 4XGZB 1WFTA 1UB5A 1NGZB 3M1BA 3MGOA 4IIQA 2MHAB 5E2JA 5DYOA 4AY0A 1A6AA 1F4YH 12E8L 2IADB 3SDAB 2AJSL 2BNUA 3T1FB 1F3RB 1AI1L 1KJ3L 3K80A 2X70A 5DQJA 3FTGB 3KPSA 3TC9A 5I30L 1F11B 4PG9A 2AJUL 4NO2B 5A2LH 2VN7A 4U7SA 3GK8L 4B7IA 2HA1A 4MAUL 4PJEA 4H5SA 4ZXBA 3RL2A 4HZLA 4WIQA 3D2UD 1BAFH 4I0PB 4PJBF 5D1ZA 3G6DL 4MCYB 2NY1D 3FFDB 2EDJA 2I60L 5CGYC 4HDIA 1YQVL 3MODL 3MV8A 3RVUD 1NMAH 4QRUA 1B0RA 4M1GL 1EHXA 3FB7B 2ZG3A 1QNZH 1U8HA 4DKEH 2AAVA 4KJYB 5E08H 3SY0B 2GUOB 3CPLB 4M8QB 4NKDA 2M2DA 1RUKH 4U49A 5I19L 4M43H 3HZVB 3MLVL 5BS0B 1NCAL 1XGUB 4PJXF 3PP3H 2UV3A 3TFKC 1FN4B 3FRUB 3LIZH 4LHUG 2IGFL 2BK8A 5CWSA 5I15L 4K8RC 1R5WA 2NW2B 4ZTPL 1E6JH 5DQDL 2FO4A 3RZCD 5ISZE 3KJ4B 3HZYA 4GKZB 1JGUH 1WFNA 1I1YA 4HKXA 3MLRL 1L6ZA 4JJHA 4FFYH 2AQ2A 2MQ0A 2VDOH 5HYJB 2FBOJ 5ACZA 3LAFA 3DECA 2VKXA 4KJQD 1YY8B 2ZCHH 3MACH 3MJ9A 3TCLB 3U0TA 5BXFB 3RIAF 2R1YB 3Q0HA 4APQD 4ZAKC 5CKAA 4DZBA 3G6AB 1RZKL 1CFBA 5JW3L 4JRYB 3G5XA 1CK0H 2G60L 1FZJA 5FYKH 1U6AL 3Q6FA 1MRDL 3CCHA 4LPXA 2XN9B 4KHXL 5EU6E 2WUCH 3SCMB 3H7BA 3DRQB 3MX0A 2WBKA 3MV7A 4L4VB 5FF6B 1F4WL 3M17B 1H9VA 1FDLH 5TDOA 4KV5E 4NQEB 4X98B 1NFDB 5SWSE 1AIFB 1CGSH 4R0LC 3W9DA 5K9OA 1T1YA 3GSQB 1EVTC 1KXTB 2VDNL 4WI8A 5TQ2H 4O5LH 1MH5A 1YEIH 3CVHA 1LK3H 4JQVA 1JYXA 2QL1A 1YEFH 4MAYD 2A6IB 3G5YA 4QTIL 4IRSA 4RWYL 2GSGA 2X4QB 3MJ6A 1BFSA 2NR6D 5DFVC 3TZVB 3FRPA 3SDCC 1G7QA 4TSAL 3O6FA 1OOAA 5JIPA 2D7NA 3RX7A 3VXPA 4MD0A 4MA1C 5I1DB 3FMGH 5D6DA 1DVFC 4Y2DD 4CVWA 3U46A 4WFED 4ZTOL 1A21A 1I7TA 2VC2L 3WIIH 3STZA 1CFNA 4UIKL 5CEYB 5K9QG 3GMRB 5EC1A 3MRHB 4U1LA 3QIWB 4N9GA 1NAKL 1I9JL 1WISA 1LP9F 2FEDC 1N5YL 3HC4L 3QIBD 4XWOC 2H2PD 1P4BH 3QDJA 2CRIA 4X0KA 2MPAH 43C9B 1BZ9B 4Q9QL 2XY1A 1VFBB 3KYKH 4TVPE 4F7TB 4ZDHB 1TTGA 1RFDH 3MYJA 3HE6D 5JHLH 4H1LA 4OI8A 2EIEA 1DN2A 3O3AB 3IXTB 2HH0L 5D2NE 3L3KA 4CVXB 4QRPE 5GS1B 3K1DA 2P8LB 1XR8A 3RVVC 1R3LB 4ZPVA 4HUXB 3I02A 5DRZA 3E3QE 1QBBA 1PFCA 3UBXI 4AIXA 4E41B 1KN4L 1S9WA 3S96A 5IHLB 3D0VA 4EUPH 3FQTB 3MMEA 1MRCL 3VXMA 2H8PB 2Q86A 3WO3B 4NZJA 1RUQL 4DUXA 3CSPA 1I8LA 3L9RB 4MJ2A 5K9JL 3L5HA 4U2YA 1TJGH 3FQNB 4ODVL 4P2QA 2CD0A 5KVEH 1EO8L 1W0WA 2Z4QA 4OLXL 5HJ3A 1JE6A 1HWHB 2R1WA 1II4E 2VXUL 1JMXA 1MNUL 3W0WD 2N56A 2ZKHL 4HPYH 4M48H 4KKLC 3FQRB 2R1XA 1VESA 9CGTA 3OKDA 3CLEL 5D7LA 1NSNH 5L0QB 5JO5B 4DTGL 2AQ1A 3KPSE 1IE5A 4I18C 1FFOB 2VAAA 3CMGA 2A2QT 3PWNA 4UOW0 5DC9B 4MJIB 1VCAA 3BGMB 4PJEE 4P2YA 3LPFA 3VFTB 1JUFA 1HHIB 3VI3F 2A6KA 2H9GA 1UT9A 1P2CA 4HT1L 2FR4B 3OXSB 2VOTA 4N8PA 1RJLA 5LVEA 1VERA 3JTSA 1B4RA 3DBXB 3EYQC 4NKOA 5DURB 3FOMA 3E6FA 1S7WA 2IWGA 3MV8E 5GS2D 1A4JB 3BH8A 3JUYA 3QEUB 1W0YT 1EV2E 3MREB 1UQSB 5E8NB 5E4EB 2ZUQB 1KBGH 3VGEA 4PPTA 2ARWA 2HP4A 4KKBD 1FNHA 4XH2B 1SYSB 1RJYA 5SWQA 2EC8A 3BKYH 3TBWB 1VB9A 3P9LB 1I8IA 2Z0BA 4G9FB 3CSBA 1T3FA 5IESH 2EDOA 2YRLA 3D85A 2BNRD 3QG6B 5D93B 3WIFB 3T0EB 2Z31C 4HV8B 1NDGB 3TJEH 3IU3B 3QUXC 2VXTH 1AGEA 1DBBH 3BPLC 3U30C 3EOTH 1G9NH 3P3YA 1GAFH 1BJMA 2YRPA 4GG8A 2DOCA 4R96A 3O6LH 2P5EA 2LU4A 4P5MA 5TH2B 2BY1A 4AMKH 5GGQH 2PYFA 4PR5B 5JUEH 1NEZA 1PX4A 3CFDA 4JPKH 4OZ4B 1Q9WA 4Y7MA 4CU6A 3O2WL 5E70A 4CDHA 1IFHH 4G9DA 3ZKXC 5HD8C 3VXSE 4RMVA 1WWCA 1LO2H 1P7QD 4J2XA 3GI8L 4TQEH 1ZTXL 3CXDL 3L5JA 1ZWIA 2OS7A 2PTUA 3HG1A 1HK6A 1YEHH 3V0VB 5IFHL 5J11C 5CILL 4ZUUA 3CNKA 3MV7E 5CHNA 3GNML 5FUOH 4JFHE 3U6RA 4P4KA 2R9HD 4BZ1H 1CE1L 1S5IL 5IHUL 1T03L 3NH7L 2A6DB 2GAZB 1XCTB 1KN2L 4C56A 4LCCA 3T2NL 1OQXA 3BZEB 1OTSC 2N7AA 1P84K 2BVYA 3GSWA 5MEPB 3TA3C 4XB7A 4TSBL 3QJHB 2P24B 3L3JA 4Y4HD 5LAXA 5T1LA 4U6VL 1H3UA 3L95A 5HGGS 1TTUA 1GYAA 3I75A 4W6XB 4P3CH 3HZMB 1JGEA 4ZFFB 1YECH 1YEDB 4LLYB 1RD6A 1VPOH 2JJSA 5T1MB 3KLDA 3KS0H 4OZHF 5C0GA 5ITFA 5C9JB 3F7YB 1NPUA 1Q72L 3QDJE 1ORSA 1J9CT 2BVOB 2FIKA 4F9LA 1B2WL 1QLFB 3TLRA 2K7PA 3EFDL 4RGNE 5IV2B 1A1MA 2APVA 4M5YH 1TQCB 3OB0H 4UQ2B 1F4YL 3R8BB 2HJLB 4WCYL 1MI5A 1J0KA 1CDCA 5DS8B 4MJ6A 3QXAB 1U42A 2PW1B 4XNMB 1FCGA 4MCZA 2CLVA 2DIBA 5GQBA 1D5BB 1UH4A 1MJUH 1EXUA 2ITCB 2B2XH 3ZYIA 1Q8MA 3VD7A 1BAFL 3CAFA 1KT2A 5B39B 1VKXA 1S8DA 1CG9B 4M6ML 1NGZA 1LO4H 3OPZL 4P2QE 1FAIH 1UB6A 1J8HA 5F9DC 2DDQH 4ZODA 4XPFH 3MZTA 3OJVC 5C7XH 4DKEL 5E08L 4GRWH 2NCMA 4H26B 2W0FA 4EEEA 4HEME 4B53A 1URLA 4DUVA 2NX5D 1RUKL 3FN0H 1F11A 3LSOA 35C8H 2BVPB 4L9DA 4OCXH 3TBVB 5EOTB 5ITBH 1QSFB 3B3IA 1E6JL 1YN6B 5CLWA 4HG4K 4G80B 5JW4N 1JGUL 3UBXG 4ETQA 5IROA 5IKCB 4LLWB 1QVOA 1A6ZB 2IFFH 1YN7B 1BZ7B 3PGFH 3BN9C 1XIWD 4FFYL 3SDXF 2VDOL 1A7BA 1WTGT 2Q7NA 1T7YA 4HWZB 2BOBA 2ZCHL 1XH3A 3O81A 1DEDA 3VWJB 1S7XA 5C07A 2DYPD 3BYYA 3B5TA 1M7XA 5E5MA 3RDTD 5HHQA 3VGAB 1CK0L 3ARFA 1T0NB 5FYKL 1IGTB 3KPRB 4GAYB 2JTDA 3U7WH 1QEWB 3O6ML 2WUCL 4WV1C 5D7JC 3LKSB 5FIEA 1U8IB 2KQMA 3QJFB 3SGKA 1MWAB 5FYLE 2P5EE 3HUJA 5F7KC 3QWRD 3N9GH 5CJOH 3RPKA 3OXRB 5AWNL 2IALA 1UJ3B 4PJAA 4GBXA 4JFDB 1YY8A 4M9OA 3QFJE 5TQ2L 2R1YA 1YEIL 4FOMA 1O0VA 4FTVA 2OI9B 1YEFL 4P2OA 2Y6SC 4TTDC 1HH9A 3B9KD 4NKMA 3TH3T 3HG1E 4JFZL 1QO3B 4MJ4A 2XXCB 4KK9D 5DUBB 1CD8A 4X6CB 5EO1B 3UZVB 1DLHB 4L4VA 2FATH 3GMQB 3U1SH 4UT9H 3QT2A 1AIFA 1ZEAH 3CC5A 3RY5A 4HLJA 5CSZB 5EBWB 3GIVB 5D6CA 2XTJC 4NZTL 3DRTB 3C6LD 3LH2H 4C56E 4XPGH 2CDFB 4IRZH 5EZOH 5GGTH 3DURB 4UDTA 1RFDL 1U9KA 3RTQB 1S7UB 5JHDD 1IQWH 4P5KA 4DGIH 4F3FA 2UUDK 5FDYA 3QFDB 3ARED 3N50A 1Z3GH 3JV4B 5DJYB 3G04B 2HVJA 3ZTJH 1OF2B 1NL0L 5BJTB 1WWWX 4MSWB 5HGHA 5JMRA 3P4LA 3FO9B 1NC2A 4YDLB 4ELKB 1TJGL 4UV4H 3U9UB 4K9EH 1VENA 4WV1B 4RGOL 3SO3C 3THMH 4X6DF 4Z7UF 3SJVA 4HPYL 5HHPA 4PJFB 5D7IE 3V4UH 5ESAA 4IIQC 3LEXB 1NSNL 4P9HC 1S7VA 1OAZH 4QXGH 2Z93A 1HDMA 3QWOB 3RIFF 1K85A 5E6ZA 4E41A 4XXDB 3MA7A 4NN7C 3VRJB 4QXTB 5J1AB 2IAMB 4NHCH 3KPNA 4L4TD 3CSYA 2D4DA 3VFVB 2R4RH 2FGWH 1EK3A 5JW4M 3WCYA 2FJFB 1Y6KR 4OLVL 1FYTA 2QJDA 1MCLA 4ZXBC 1T1XB 2P8MB 5F1KC 2UY7A 3S97C 5D1ZC 2B1AH 4M4RA 1KBGL 4KZDL 3VCLB 1R5IA 5ILTH 3QUML 3V79C 1XGTA 4NCC1 3U9PL 1FLRL 5T5FL 3BKYL 1JIBA 1SEBA 2DL9A 3BIKA 5B3JE 2Y23A 3WUWG 1XF2B 1INEL 5IESL 4XNUH 4XP4H 1GC1L 5EO9A 3VFTA 4Y19A 5JIHA 3K7UA 4OZFB 2QSQA 1JZ5A 2WBJA 4G6ML 1ZANH 4M8VA 2VXTL 2ESVD 4M4PA 1I1RA 3EOTL 1G9NL 1GAFL 1HQRB 1KFAH 2GTWA 4HWEH 2H2SD 1OT1A 3QEUA 3CX5J 5B3NA 5MHSD 5FFLA 2GK0B 3I50H 1J12A 1XR9A 4KRPD 5GGQL 1A02N 5JUEL 4I2XA 3MBED 4KJWD 3WLBB 1RZJH 4JPKL 4J4PC 4LSRH 1IKFL 1TNMA 3TIDB 2YRZA 3UTTA 1MCHA 1IFHL 5C07E 2PTVA 1K8IA 3LS4L 3D39B 5IW6A 4TQEL 5F7LB 4LU5L 4LPCA 2BNQB 2EXYD 4PBWD 1JPTH 4MZ2A 1YEHL 3QDMA 3PHQB 4TNWF 1R24B 1CFTB 4OF3A 3RWHB 4YQXH 1YJDC 3BE1H 3HUJE 3JZ7A 4Z7WF 5FUOL 4KQ4L 2ZP0T 4BZ1L 1XMWA 4KGLA 1CDYA 1G6RH 3BGFC 4HXAH 4CU8A 5JA9A 3IDGB 5DK0A 3MA9H 4NN7B 4WDIA 2HN7A 2NY5L 1Z9LA 2OXHA 4FTVE 4PRHD 4R4FH 1QG3A 1QFUH 4JRYE 3WV0A 4LFHG 3ESUF 3SDDA 1DLFL 4WUUD 4G6KL 2HWZL 3MO1B 4POUB 3VFPA 2QQKH 3TO2A 3E8UL 3DARA 1FE8H 1E4WH 2K9UA 4IRSC 4PIRF 4NRXA 2IQAB 4L4VE 4G8FA 1X5AA 3SKOB 3ULVF 4A2MA 4PLKC 4KU1A 5HY9B 3O6FC 5IWLA 4EXPX 1VPOL 4X83A 4MNQA 2C3GA 3PIQB 5BZDA 5D6DC 3Q5OA 1MCWW 2FO1A 2F74B 1UXSB 4MYWB 1OP3H 2I5YH 5F44A 1FO0H 5DJ8A 4UNVA 4RBPH 4M5YL 3UTZB 2HTKD 3C87A 4JO1H 2JB5H 4YXHH 4EDWL 1T7VA 5IBLD 2GQHA 2V2WB 5IM7A 3IDJB 4I3RH 4RMTA 5F7DB 3PL6A 1BD2B 5HHMD 1JRHH 5E8OB 2JF1A 4XBGA 1CDIA 4L3EB 4XVJL 2LABA 3FKUS 4WNQA 3IJHA 5KANI 1OAXH 1X6LA 3GSNH 1QFWM 3NFSH 4YDJA 3AAZB 2CIKA 5FO7B 2X4UA 3O4LA 2Y5TB 1QLRB 1JYNA 4Y8AA 1LO4L 5JDSA 2Z8SA 5E00B 2C26A 3IB4A 4QCIA 4HFUH 1FAIL 3WE6B 4RDQF 3MNWA 3QAZC 4Q74A 3T77A 3SJVE 4LCIL 2QHLA 4RGMC 3QUYA 1I8LC 4A6YH 4XPFL 4LP5A 5C7XL 3PP3K 1ZT4A 1Z2KA 3QXAA 3QEHB 5C2BH 5FA4A 2X44D 2EIDA 3FN0L 2EZ0C 3QEQB 4E41E 4NFBA 3VFNB 1PGRB 2NNAA 4GQ9H 1S3KH 4MD4A 2XZAL 3BMWA 3V8CA 3V6ZB 2GJ6B 3UTPE 2XQYG 3PE9A 1FYTE 4URTB 2X4NA 2SEBB 3PGFL 3O8XA 3HMXH 2NXYB 5MP6H 4P2RD 5IJKA 2HRLA 4RA0C 1OGTA 4FQXA 3QZWG 1BM3L 1U8OB 4EOWH 3O6KL 1LO0H 1H15B 5HDBF 4N1EA 4QNPE 1LEKA 5IB4B 3BT2H 4HIJA 1DBKL 3WNOA 2K1MA 4UDUB 3U7WL 3VFWB 2BC4A 1UA6H 1IAKB 3HA0A 4LLWA 4NRZA 4N0UB 3OAYH 1PDKA 3N9GL 3P40A 5CJOL 1IM3A 2L7UA 4RAHA 3BAEH 4NO5B 1R3IL 4HXBH 4MQSB 2DQHL 1IGJB 3WFDL 4G9FE 1A9EB 2DQFB 1XEDA 2XPGB 1SJEA 1GIGH 5ENWA 2RJMA 2Q76B 5HGAA 4R2GD 4C58B 3EDKA 5C6PB 3QDME 3RY4A 1WAAF 3B9EA 4XAWH 4YAQB 3N85H 5GXBB 3QNYB 5JMOC 4G6AD 3VXRA 5DO2C 1ITCA 5GRJL 4U3XA 3JUZA 3F5WA 1AD0B 2EDTA 4JGJA 5E94A 4HGMA 1JRHI 3JV0A 1MCBA 5C1MB 1ZEAL 4WGWB 4HZAA 4EUPA 3OWEA 3TIEA 1G9MH 1C5CH 1WZKA 1DBJH 2V7NA 5EFIB 3LH2L 4P4KC 4XPGL 2OJZL 3S6CA 1J18A 3NAAH 4IRZL 3G6JB 3NFNB 1IAIM 4HMCA 4TUOA 4HUUB 4UNUA 1HYRC 2HLAA 4XCFL 4G8IB 2XNAA 1ZVSB 1IQWL 3PABB 2YXFA 1NFDF 4DGIL 3C5ZC 3I6GA 3R0MA 2FL5A 4JLRB 1C7SA 1W0VB 4Z7OE 4LCCC 2BRRH 3P4OB 3CFBB 2YC1A 5A2IH 5BO1H 1Z3GL 3BQUC 4X99B 4NWUL 3FQWA 4G8EA 3R0NA 3HZKB 4YHML 2OP4H 1QRKA 2D31A 3IJYB 4NQVA 5HGBA 2IBZY 4MNQE 4YHIB 4Q9CA 1UH2A 4U1NB 1FIEA 1MY5A 3BD3A 4UT7H 3VGFA 3V5DB 2CK2A 32C2A 5F3BB 4S1DD 2JJSC 5DFWH 4K9EL 4ZFOA 3ULUL 3SQOL 2FECI 4JN2B 4KRMB 2DBLH 2HJKA 1JCKA 3HI6H 3THML 1KG0B 3P77A 4JFXA 5DA0B 4WWKB 3RNKA 3RU8H 3V4UL 5JQHC 2QBWA 3T2OA 4CADB 2Z92B 4I3GA 3JV4A 1CL7H 4HAFA 1OAZL 4ONGH 4QXGL 4PREB 2CPCA 5D5MB 1JZ4A 2AXFA 3REVA 2AEQH 4JDZB 3D0LA 3LDBC 5I73C 5EIVA 2X10A 4ZO6A 4NWTH 1UKSA 3FO9A 5IHZA 3BEVA 2O61B 4OFDA 3O4LE 4HJ0D 4Y4FD 5IG7B 3RAJL 2DM2A 4F7CB 3NVQA 3DNKA 1DBML 2PR4H 5IB2B 3UC0L 4HULB 2B1AL 3U4EB 1WC7B 3PDOA 5C0CB 4QRRB 3BPOC 4LK4A 2ZUSA 1ZHNB 1Q9LB 2APXA 5GJTL 5HYQB 2Q1EA 2GYSA 1Q9KB 4LEXL 3UYRH 2NY2B 4HKZB 2CR3A 4XNUL 1A1NB 3HNVH 2ORBH 2ENSA 3VG0H 5J1AA 3CVIH 4R3SB 4C54A 3CUPA 3PQYD 2Z9TA 3VFVA 5L7XH 3RL1B 1RZKC 1RUMH 2PNDA 1PYWA 2AI0H 3UEZA 2NY0B 1LQSR 3ZTNH 3L5IA 4JREC 1I8MB 2VJXA 3ARBD 1XF3A 4ETYA 3I50L 5DFTA 4MAYA 2CDEA 1MCKA 3P9WB 1RZJL 2AGJH 5IROC 4NRYB 2FB4H 4LSRL 1S9YA 4JJ5B 3TVMB 5E2TH 2MFNA 3DV6A 4F37K 3GB7A 2ZOLB 3RNQB 4NQCB 5EU5B 2EYSB 4FA8A 1JP5A 3LB6D 4GOSA 5LGJB 2HFGH 2YPKB 1I3VA 2OQJA 3O0RL 3HPJA 3MRKA 5F1NA 3FCTB 1HQRA 4YQXL 2YMXH 3ARFC 4LLUB 3BE1L 1OGAD 4JPIA 2DQIH 2J8HA 3QIBA 1AR1D 3QIUB 4QY8A 5HYEA 5DI8B 1TPXC 5LBSH 1G6RL 4LHUB 4BFIB 3VMPA 3EFFB 3MA9L 3AXLB 3QBTB 4Y5XA 3A6BL 1C1EH 2R2CA 5ALBL 4P23A 1V3MA 4E42B 2BSSB 4GBXC 4OQ1A 3KPRE 5LWYH 1I7UB 5CEXB 5I16A 4ODXA 4Y1AD 1GPOH 3C60B 2PW2B 2QQKL 1IQDB 1FE8L 1BIIB 2W0PA 3LQAL 4P2OC 1U8MA 1Y0LA 1HQ4B 1Y6MR 1PJ9A 2QADB 3FHAA 5KS9F 3KPOA 4JFDE 2CLRB 4EVNA 5FKAB 1CXFA 1BF2A 3MJ7B 3RGVB 4U1IA 4Z76A 2BCKB 1S7SA 4QHKI 3OKMA 1HINL 5HTSA 2VAJA 1F45A 4NHUA 1D6VH 3RWDB 5LGHL 3HFMH 1N5AB 3U48A 4WHTA 3TYGH 3NCJH 4P46B 5I6XC 3L5XH 4PJGA 1ZSDA 3BW9B 2JB5L 4OLWH 5D1QD 5CS7A 2DQUL 1WBZA 4ODUB 4EI5B 2VMFA 5I1AA 4KTEL 4J3UA 4I3RL 5DJAB 2V9QA 3L7EB 1JRHL 1WGOA 3HLAB 3VXUB 2D03H 4LARL 3OKEA 2NY4C 5C0ND 3WHXA 3NFSL 4X4ZA 1UXSA 4YPGA 2YZ1A 2NLJB 4J1UB 1JPGA 1OCWH 5J6HB 1IGYA 1MELA 1S7QB 4IRJD 3IGAA 4HFUL 3OX8A 3UZQA 1EZVX 4KH2A 3TJHD 2WUBH 3HI1A 4A6YL 2VZ3A 4H25A 1I7RA 2WV3A 1CICD 1C12A 2G75B 4PGEA 2ICWJ 3VFMA 1U8QA 2AEPL 4G8GD 4R26H 3ZT7A 1JPFB 4L3EA 4Y16B 1BBJB 3IDYC 2ADIA 2HVKA 4GQ9L 4FXLA 1S3KL 2FWOB 3GMNB 3V8OA 2BOCA 2LQRA 4EI6B 3CDCA 1KPRA 4NKIL 5CSGA 3U0WH 5E00A 1BFVL 2FECL 4WTXA 4LLVB 5LG1A 3B83A 3HMXL 3QNZA 4N90D 1ZS8A 4PJFE 3GBNH 3MBXH 4QO1A 1U3JA 5DVOA 1N6VA 2EC9U 3MNZA 1P7QA 5GRXG 2FJGA 2C1OB 4PBVC 2A74B 2VITB 5HI5D 4EOWL 5TPWH 4D9LH 3T0WA 3BT2L 4X4YA 4IOFC 5DMKB 1K8DA 1WCBB 2APFA 2XXMB 5MERB 4CVZB 4N9OB 3DWTA 5E8PB 2H45A 2GJ6A 1S78C 4OKVA 5JW4R 3OV6A 4R9HA 5T3ZD 1A3QA 4JM4H 3HAEA 1MPAH 2APWA 2VISB 1OWRM 3LD8C 1KIQA 1AXSA 2D9CA 4FP8H 4Y2OA 1UYWH 3BAEL 4JZJA 2NY4B 4HXBL 1GIGL 5GGTA 4Y4HA 1WT5A 4OZIA 1I3RB 3R4DA 2FYYA 4XAKE 3G5ZB 3VFOA 3FO2B 4PGBB 3VI4F 4FFZH 1L0YA 3DMMA 4KQ3H 3LN4B 3W82A 3NABH 3VFUB 4YIQB 4KTDL 3HE7A 5ICZA 4QRTB 3DX9B 2X4SB 1C5CL 1H3PH 4CL7A 1IEAB 2W9LA 5HYSA 1B0GB 1FZKB 2YKLH 3D39E 3NAAL 2WWMD 1X9QA 2BNQE 5TGBB 4M02A 2Q76A 5FB8A 3MRNA 5CFHA 2EKSB 5DMGC 1I1AA 2QSVA 1KXQE 1RHHB 1ZVHA 3IKKA 3SDDC 1YNTA 3FL7A 4PB0H 4MLIA 3DVGA 2YSSB 3EYOA 4PRPD 2OP4L 4OJFH 1ZGLP 5GISH 1OD9A 5E8EA 3OAZK 4X6CF 5FKPB 5IWLC 4U0RC 1FBIL 2DQTL 2BHUA 4GS7C 3BZDA 3EYFB 4HIEB 3LRHA 2DBLL 4PJGE 4QHKJ 3HI6L 4RMUA 1R5VA 5I8CA 3RU8L 3BO8A 5F7EL 4GAJL 3T2PA 3L7FA 4ONGL 4D3CH 4Y5VA 2EECA 2F19L 5F1OB 2CKBB 4LSSH 2AEQL 4NO0B 2E27L 2L4OA 5BQ7B 1VDGA 4H0HB 3LHPH 4NWTL 6FABL 5IMMA 5GS3A 1WVZA 3O2DH 3Q3GA 5ECJE 3CFKA 3PL6C 1MCSA 1MFNA 1RMFH 3O9WA 4PJ8A 2PR4L 4HKJB 4AM0A 3U7YH 2VDRH 4ZNEA 5FOBB 3P0GB 1G6VK 3BEWA 3PWLA 1X5IA 3DI2B 2VLJB 3FFCA 3QQ3B 1KCKA 4RAUB 2VDLL 2WLZA 4MLSA 3UYRL 2XI9A 1CFSA 1T04B 3QUYC 3IF1A 4L3EE 4QGTA 3I6LE 3P2TA 5D2LA 4U1SA 5H94B 3VG0L 4GKNB 4PB9H 1O7SA 4ZAKD 3CVIL 4WFFE 3OGCB 4O51A 3NPZB 3QWRA 4A2LA 4Z0XA 4PV8B 2ZPKH 4F15C 2AI0L 1J10A 3AS3A 3MOAL 4NPYA 4O2EA 3FQXB 3NCEB 1NGWB 4JN1H 1I4FA 4AT6A 4F9PC 3AU1A 4NC0B 3HI5L 1S9XA 1G6RA 5MI0C 5C0RH 5I2IA 4GG6B 2XKNB 2VLKB 3KXFD 1ZHNA 1ZAGA 2AGJL 4PJ5D 2I07A 2FB4L 2YPLA 1J0HA 5E2TL 3CGTA 3O8XC 3JWDL 1D9KD 3DSNA 4D8PA 1CLOL 2CO6B 5IJKC 2OCFD 4FQXC 3DROA 2BERA 4OCRL 5T3ZH 4UB0L 5J9PA 4JM2D 1T2QH 2HFGL 5EOCJ 2GJ6E 2VIRA 4L1DA 1MHEB 5AG8A 1EAJA 5KTEL 1U3HB 1BOGA 1WQVT 4R7NA 2EXWD 4OUUB 4K3HA 5DJCB 2JCCB 4NSKB 5H37H 4WTZG 3ZDXE 2DQIL 3TYFA 5KVMC 2E9BA 5C6TH 1IM9D 4JFFA 5LBSL 4QWWD 5CD5D 1PZ5A 5EO0B 4MB4A 4P57A 4L9LB 1KTDB 4NRYA 4QGYA 3HPLB 4HWBA 3MSPA 4JKLA 3MCLH 5ESVA 1CT8B 1C1EL 1FO0A 3UBXB 4ZYKB 2EYSA 2R0ZH 3ZO0A 4GRMB 3AREA 4GH7B 3OKNA 2GY7B 1N59A 4FXKB 4S2SB 3E2HB 3VMOA 5IBUG 2RAMA 3EO9L 1Z9SA 2V2TA 1HHKA 2EDFA 5CD3B 1OP3K 1TJHH 3BI9X 3QHFH 3TBSB 4GRLD 4JPWH 3OHXA 4RBPK 3GSNA 4KDTA 4JZOA 2CK0H 1G0DA 5CCKL 4BQBA 1DQDL 2CIIA 5EN2B 1D6VL 3HFML 1KLFA 1NAMB 2VLLA 4J23A 3TYGL 3NCJL 1KENH 3FN9A 3L5XL 4K7PH 3S37H 5TF1L 1F90H 1IQDA 4A6YA 1XZ0B 4O2CA 5DZNA 2NW3B 4UIMA 1A7PH 5JPMA 5E9DA 1AKJB 5C0BD 3ARRA 1AQKH 4I4WB 3P30H 5F7NC 2D03L 5CEZE 4EBQH 4AENA 4ELMB 1IJ9A 4GW4B 5DDHB 5I17A 3G6JE 2GHWB 1T21B 1E4JA 1OCWL 2BFVH 1UZ6E 4OB5H 3JV5A 3HMXA 3RVUC 5F70A 3BW9A 3EYQD 4BSVA 1HNFA 3B8SA 3TN0D 4IEFB 5DJAA 3L3DB 4HMEA 3HLAA 4X9FA 4L3CB 1MLCA 1MCFA 2AVGA 1ND0A 3PWUB 4GKSB 1OLZA 3B6SA 3UZEA 3U0WL 3MBEA 5K59F 2VABB 3REWA 1D5MA 3KPLB 5DUPH 4ZNEE 5EG6C 1BECA 4W6YB 1MEXH 3MBXL 3K8MA 3SE8H 3FFCE 1G9NC 3C6SA 1D6EA 1UM6H 1CDJA 5CP3H 5KW9L 3VWKA 1FJ1A 1QSEB 3MUY1 4APQC 5IIEA 4BQ9A 2Y7QA 2BSTA 3FN3A 3TWCH 3DUUB 5IVZB 2YK1L 1J1XH 3IJSA 3OAYK 1EGJH 4MA3B 3GJFH 4YGAB 3PNWB 4JM4L 1ONQB 2GW5A 4ZPTB 1MPAL 2N4IA 3CDGA 1NCDH 4FZ8H 1OSZA 5J13B 3HN3A 4PRHA 1TQBB 3HR5A 1KLGB 1RQ5A 5ICYA 4FP8L 4FQ1H 5SWZB 4R97C 3DOSA 2MCG1 3V6OE 2OZ4H 2YPLE 2VRAA 4K7FA 1YMHB 4WUUA 4F7PB 5IMKB 1MLBB 3AS1A 5CBEA 5EU7E 5F9OH 1GVIA 3QDAA 4MAYC 3D2UB 1VADA 2NY1B 2XWTA 4NM8H 2NR6C 1S7RB 2KH2B 4AEHH 3NIGE 1ZGLA 2IAND 3CSGA 1EEQA 1HSAA 5DJZA 2GITB 3SGDI 4FFZL 2VISA 3WSQL 2PYEB 4KQ3L 1X7QA 4Y2DC 4JFFE 2LVCA 3WUWB 2IH3A 3UO1H 3DXAB 3OBAA 2ZCKH 2R2HB 2Q3AA 1X3DA 4TRPH 3WFBL 5ID1B 1FVCA 1E6OL 5B21A 4B50A 4UTBL 2UVEA 3ZT5A 2W65B 1QR4A 3H9HB 4ZUWB 3QUMB 2W0KA 2YKLL 3QIBC 2VL4A 4OFYD 1JTOA 3RZCB 3LRGA 1MOEA 4KKCC 2DWEB 1P1ZB 2WZPD 3HE6C 2Y72A 4JFQB 1CD1B 1JNJA 3NIDF 15C8H 3OJDA 4CJ1A 2H32H 3MRCB 1FCCA 4M7ZB 4NZRH 3FT3B 2LTQC 3P11L 3VD9A 1EFXD 5EU3A 3VFGH 1MAJA 3BZFA 5C92A 4HUWA 2NTFA 3O4OC 3MOQA 1J7VR 5AUMA 4IDJH 4APQB 3GRWH 5GISL 1RK0B 4HUVB 1G7HB 5INCA 1HHGA 2DQGH 4X6BB 1T6WA 3T3ME 1RUPH 4HJJL 4I77H 1MHHB 3FO1B 1SM3H 2RB8A 5M95B 1H3WM 3NZ8A 5CJ5A 4YBLB 3DO7A 2VL5B 1KIRB 4K55A 4LL9A 5E9DE 3HRPA 3LZFH 4LSSL 3BPCB 3QA3B 2A6JA 5ADPH 4ZUTB 3MUHL 3QDGA 3O2DL 3IDNA 4KHTH 4P2RA 4PRDB 1QLEL 4V2BA 4NP4H 2IFGA 4O4YH 4MQ7A 3S3SA 4JRXB 3DX8B 4OTXH 5K33A 3UAJC 4LVEA 4Y2DB 5M7QA 4LPYA 4Z5RA 3J8F7 4KKBC 3S36X 4MXQD 1GCFA 5I75C 3KYOB 4HS3A 5EBLA 1U8KB 4NO0A 3BKMH 1P7KB 3IDIA 4ESKA 3RRQA 2YD7A 5F71A 4P59H 4D0BA 3L3HB 2ZPKL 2GSIA 1Y18A 3TPKA 3TNNA 2W9EL 3L3OA 3ECBA 2YR3A 8FABA 5D5MF 1WEJL 1T1ZB 1B4JH 5DHVA 3C8HA 1GZPA 4OKDA 3EDFA 3LKOA 4DVBB 4YHNA 3V5HA 4WU7A 1RVFL 1INQB 1NLDL 5T1DH 1I7ZA 1QBML 3QUZB 5KSUA 4X9HA 5H94A 5T3ZL 1KTKE 4TSCH 1LEGB 1T2QL 4ALAH 2F5AL 2E9JA 4OM0L 1AC0A 5SWSD 1FFPB 1VGEH 4JFPB 1IEBB 1NUNB 4LF3B 1HHHA 3W0WB 3FAXA 4OLUL 4HIXH 3GZKA 3BSZH 4PRHE 3HC3H 5C6TL 2R9HC 1U3YA 2EYRA 4G43A 2XKNA 4OI7A 4GRWB 5JLZA 5DGQA 5CMAA 1A5FH 3MCLL 5GS0D 1A0QH 5DD1H 4EKXA 4BZ2H 3KGRA 1JGLH 2R0ZL 4NOFA 4JZJC 1NJ9A 4PJ7A 1FYHB 3EYVB 5DHXB 4LMQE 1T0MB 5BZWB 3LPGA 2A9MH 2BHYA 4Y4HC 1WT5C 3QZWB 4MJ5B 1JPST 4YGVA 1CQKA 5FK9A 4CRPA 4TVPD 3FB6A 1TJHL 4OQTH 1CFQB 3L3IA 2C3VA 1BQHA 4JPWL 4Q2ZB 2CK0L 4AYFA 4XNQA 4M6OH 1KCUL 5JPNA 2BNRB 1Z0NA 4QRPD 2CLZA 4XHJD 4RFNB 3HE7C 1ED3A 1XGRB 3O41B 4LCUB 1BQUA 3IRZA 3U2SA 4YO0B 4MB5A 4D2NA 1H8OA 1KENL 1UKQA 1WWBX 5GJSH 3PWPB 1F90L 3GSXA 4GXUN 2BSRA 1ZHLB 4K9EC 3TPUB 4O2FB 1FNEB 1G84A 3ZE2F 1LE9B 1HH6B 4GSDH 5CIPH 3P30L 1I1AC 2EH7L 1I1FB 2B0SH 4LSPL 4Y4FA 2JK5A 3BPNB 2AV1A 4OBRA 5JNYA 1EUTA 5CGMA 2YPVL 1MRFH 4NDMB 1MIML 3ARWA 1AY1L 2UYLA 3KPSD 3QXTA 1DQLL 4LGSB 3ES6A 4N68A 5KG9B 2VR9A 2VXVL 3QXDA 4OF7A 4PJHA 4QRQB 1NBYA 2DN7A 4RZCA 5D1ZD 2A73A 2J88L 3AROA 1MAKA 1C5DA 2HFEB 4G6JH 2NY3B 1JF1A 3MJ8A 5C0AB 2BVUA 4YDVB 3MV8D 4NQDD 1Q0YL 1KB5H 1BWMA 2R0KH 3TV3H 3LVEA 3VXNB 3QCVH 4B0MM 3QDGE 1DEEA 1IILE 4Y5VC 3C9NB 4X8JB 2C3WA 3RFZC 1V8HA 4MNHA 5FO9A 4M93C 1KCVH 5JXAH 5H2BB 4I8DA 3EOBB 5AAMA 1MEXL 4EIZC 3SE8L 4FMKA 4JFYB 4UI2A 4LCWA 3N1FC 4QXUH 3O9WC 1UM6L 2KQNA 2IH1B 1FGNL 4FQQB 1GGCH 3WL9A 2J6EA 3BVNB 4ISVB 1RZJC 3RDTC 3TWCL 1P4LB 3QQ4A 4MDJB 1EGJL 1H0DB 4ONHA 5SX5K 4L8BB 4LNRA 4IJ3B 3EJZC 5E03A 3V52H 4J3VA 3SKJH 3VXSD 4FZ8L 1WJ3A 2EICA 1YEEH 4OV5B 3ARTA 4PJAF 2I26N 2OZ4L 4UQ3A 4KWUA 3RX5A 5JA8B 5IB3B 4M1DH 4PJ9D 3MRMB 1KIPA 5I71B 4S1RH 4NZUL 1QFWH 1SMAA 3FQUB 4DZ8A 5F9OL 5TFSL 3MV7D 3NACH 2NY6B 1IC7H 4JFHD 1NLBL 4NM8L 4F58H 2BMKB 3C2AL 5E1AB 1BVLB 1HI6A 4KK9C 3WN5B 1KULA 4AIZB 2EE9A 4OIIH 4BFBD 4DKFH 3D18B 3D3VB 5GS0H 4GG6E 2YUZA 1MIEH 1KLUA 3UTQB 4OCWL 2NX5B 4NUGH 4PJBB 2ZCKL 3MV9B 5I18L 4TRPL 1JPSH 1M71A 2X4OB 2XZCL 2UZIH 3QHTC 4UV7L 3O6FD 4YEFA 3C6LC 4KUCF 1Z5LB 1A6TB 5ACLA 4NUJB 4OCYH 5D1QA 3CH1A 5I76B 3CZFA 1BVZA 3P4MA 1UZ8A 2F54B 1RJZB 2AABH 4DN4L 2B5IC 2Y06H 4NZRL 5FV1L 4GXUM 4YDIH 4TVPH 4FMFA 3AM8A 4XMKL 2OYPA 1XIWB 3AREC 3GSOA 1FZMB 3QDJD 3QI9D 1SBBA 3VFGL 1FNGB 5BW7A 4X4XB 4R7DA 3QQ9D 4RGND 1MVUB 4IRJA 5SX4H 4OF5A 4ZUWA 5DEFA 5HHOA 5KN5B 4JFOA 4KMQA 4YR6A 1NGYB 4NIKB 1H5BA 1RUPL 2XWBB 1Q9OA 4KAQL 3RGHA 4G8GA 5F6IC 4J8RA 2DM4A 1PEZA 2YUWA 1A4KB 1BZQK 5TDPA 1F00I 1AGBB 3ZE1E 2OJEA 3KDMB 1DANU 3LZFL 1A6WH 4P2QD 3C5JB 5TJWK 1CN4A 3MLYH 4XP9L 1C5BH 2EZ0D 1NGXB 2FJHB 2EO1A 2DQJH 3V95A 5EA0H 3B9KB 2CMRL 1A6PA 1A64A 5D1XD 5C08A 5IR1A 4NP4L 4KTYA 2G5BA 4O4YL 3LMJH 1K5NB 3H2WA 3LN5B 4OTXL 1CE6A 4PJHE 5DD3H 1HKFA 4MD5B 1LO3H 4HW6A 1A7NL 5L8KB 1JWUA 3OKYA 3KR3H 2LAAA 4I48A 5EOQH 3IKCB 5A1AA 3X12B 2VLRB 4WW2A 4UT6L 4AJ0A 1DL7H 3C6LB 3ZZ1A 4MWFB 4HC1A 4OD2A 5HHXH 3CX5K 5FO8A 1IRAY 3BH9B 3TO4D 2H3NA 5JHDB 2ICEA 5C8JB 3W5NA 3O3EB 2IPKA 3ARGA 1FL6A 5GGVL 2H2SC 4JRXA 5F7YC 2ZSWB 2MCPH 1TZHB 2OK0H 1B4JL 4CNIA 3D85D 2VDPL 4LCWE 4KRPC 5J6GB 1ZHKB 4Z7NE 1OAQH 3MBEC 3S36H 2YUVA 4WFGE 3GMMB 1UXWA 2DLEA 2Q6WB 1I9IH 4MB3A 4W6WB 5I1HL 4WHYH 3KG5A 4F33B 4FABH 5HPMB 4BFEA 4G7VL 3CFEB 3JV6B 4F8QA 5GRVK 5FYLD 4TSCL 2P5ED 5ADOH 4NM4L 2EXYC 3VWKC 2V5YA 4G42A 5EOCH 3UTSD 1K6QH 2DJ4A 3QP3A 3QH3A 4XRCB 3MXWH 3MRJB 3QFJD 5JQ6L 1OY3B 5F6IB 4XVUD 3DVNB 4UOW1 3ZDZE 1ZE3C 3L3GB 5FGSA 1CLCA 2ZUUA 4HIXL 2F9BT 3IS0X 5B39G 3CD4A 3TBTA 4N0RA 5DO2D 3W39A 1DQMH 2Y36H 4GMSH 5E6IA 4Z78B 4X6FA 1ZA6B 1IVLA 1T7XA 5DD1L 1NBVH 4BZ2L 2X7LB 1RZFH 1G9MC 1CGYA 5ETUA 4S0TD 3IVKB 2DLIA 1SHMA 5B38A 4DOHB 3GI9H 3I9GH 5INDA 4U6XA 4BQ6A 1N2RB 3OKLA 1CF8L 1MSPA 4C56D 3KWWA 4GAGH 4PGDA 4E5XB 3B9DA 3ARZA 2OL3H 2PUQT 1QACA 3UX9B 1GGTA 2MMXA 2J1KA 1DUZA 4XZUB 4MQTB 1VEMA 3RVTD 4KGJA 3T08A 5EIIA 3VG9C 1NC4D 2JCCF 2EE2A 2VZ1A 3KPQB 3ILQD 4QHMA 3QUKB 1X5JA 5DJDB 2ESVB 7FABH 1F6AA 1QQDA 1VFAA 2HTKC 3FZUD 5GJSL 4DGYH 2X1QA 4P5TB 2PTTB 5I1JH 3RWFA 3QZWA 4TNVF 1MREH 2ICCA 3BP4A 4H1LH 1LDPH 2X1WL 2PYEE 2A1WH 3VXTA 3ZHLA 3TNMB 1D5ZA 3S7GA 3UTOA 4GSDL 1IKNA 2B0SL 3DUSB 1DDHB 2J8UB 3K2UL 4Q2ZA 2H26A 3K74B 4P0DA 5E2VL 5HHOE 5F3HA 4FQCH 3P9MA 3MJGX 5EZLA 1MRFL 2CRZA 1KPVB 2R2BB 2HRPH 3F7PC 1IT9H 2NXZC 3RWIA 3DTXA 1X6NA 1G7PB 3QPXL 3S4SA 1BX2B 1W72L 5IB5A 2GFBA 5I1KH 4Y5YA 4P99A 2FD6H 4HPOL 2VWEE 1VGKA 3PF2A 4U4BA 5CP3A 3D1MC 1FVDA 3CK0L 3O11B 5KSBA 3ILPA 1HH6A 4G6JL 1AP2B 5EC2A 5ICXA 2EIBA 5DJ0B 3TV3L 3SDAD 2YD6A 3DV4B 4XMLH 1BFOA 1A9BB 2BHZA 2Y25A 1EGJA 1B9ZA 1BIHA 3GJFA 5C08E 5EPMB 1FG2B 1TVBA 4RIRB 3KXFA 3VFRB 3BP5A 1KCVL 1DN0A 3H9SA 5JXAL 4HF5L 4ELMF 1D9KA 1ZVYA 1PLGH 2HJFB 1ADQH 4NT6B 4J3TA 5DHYB 4NCDA 3IFPA 4QXUL 1OQOA 2AJZB 1RSFA 3WDHA 5L2KB 4JM2A 4K3EH 2HFEA 2PCPB 5C0AA 5IEKB 3Q5YA 4YDVA 5GGSA 3GJFK 1QYGL 4L4JA 1N7MH 3NFPB 3VXNA 4WRLA 3TBYB 3WJLA 1DZBA 1MHCB 5BV7H 2X4TB 2GIYA 2VO5A 3BJLA 2VXQH 3CLFH 2X42A 1DUYA 4JANB 4LCYB 4JRXE 5BS0D 4OZHB 3V52L 5C07D 3SKJL 4JHAH 4JO3L 3EOBA 4PS4H 4KDWA 3N0PB 1AGFB 1MFAH 5DRWB 3RA7H 2DLFL 5IW1B 4HGWA 1OW0A 4XCNB 4M1DL 5FYLH 3MXVH 1T5XB 3X3FH 5D71L 1A6VH 1B6UA 2HT3D 1CD0A 5F1IB 5C0DA 2L7JA 4Z7QE 1TVHB 5B8CB 3HCVB 1IC7L 4ZUSA 4M6NH 4KXZI 4R2GC 2GI7A 5T33H 3U0PA 1CFVH 3ZKMC 3ZSTA 3VXQB 4LPUA 3FONB 4OIIL 4DKFL 1T6VN 4GRLA 1LVEA 4G6AC 1LO5B 2HG5B 3KPPA 3RUGA 5GS0L 4JRYD 3ZHKA 5JOFA 4OV5A 4NUGL 4V2CB 2CDGB 4X7SL 3ROOB 3GRWA 3DHJA 1A1OB 1JPSL 4ZQKA 2XN9D 3MLXH 3UJIH 3SCMD 3J7HA 4L8SA 2P49B 2EDYA 4L4VD 1YMMA 2W9DH 3AGVA 4FN0A 3SE4A 4NQED 3QCUH 3ULVH 4PRAA 5A43C 1IGCL 5E1AA 1QHOA 2P7TA 1ETZB 4HK0A 1E28B 4HIIB 4YDIL 4TVPL 4OZGB 3SE3A 4OLEA 1FC2D 5F88B 5DD6A 4YHKH 2DB8A 4ERSH 2WLYA 3UP1A 3D3VA 3VRLF 2BY2A 5IEHB 5ANMB 3MLSL 5JORB 1U36A 3TZVD 3GUTA 5EUKA 1J0JA 4WI6A 3MNVB 2YA0A 1H3TA 2JIXB 4NJ9H 4S1DC 3OB8A 3OZ9H 1CIUA 4OLYL 3U7AA 3KYNB 3RWCB 1LHZA 1BQSA 4JPVH 3LQZA 3IETA 4TPRH 3KYAA 4BH7B 3PV6A 4U1KB 2ADFL 4LLQB 3V4PH 3TN0A 3S88H 3QNXB 1MCPL 4IMLA 2EIZB 4OAWB 3ZSSA 4NNYA 4HAGA 1AD9A 4RQQB 3ETBF 2D4FA 1BFTA 5ALCH 1HXMA 4PJXA 4P9HL 4AQOA 1RZGB 1NC2D 1OPGH 3ZL4H 5GSRA 1F3DH 4ODBD 4LLDA 3NA9H 3SEPA 2A83A 1FL5A 4GUPA 1NBZB 4Z77A 4L5FL 1CR9H 1A6WL 1LNUA 4KKNA 5A16A 3MLYL 1C5BL 1X4XA 2I9LA 5DVMA 1UADC 4K2UH 2KUTA 5DTFB 5JW5B 4RNRB 2NZ9D 1KACB 1G7JA 4Y4FC 1X4ZA 1FFNB 5GIRB 3MRLA 3LMJL 4YBQD 3MRPA 4CW1B 4XPTH 4E41D 5ERWB 2V9RA 3MUGA 2GCYB 1NCUA 5EBMB 5DD3L 4RFEA 1MCEA 2YN5A 4FQ2H 1LO3L 3VH8B 2VZUA 1NFIA 5KSBE 3GSUA 3O45A 4HS6A 4GW1A 3TT3H 4Q7DA 4TVSa 2BVQB 2J12B 5F72S 5HHXL 2IMNA 1BWWA 3U4BH 1TDQA 3RIAK 1Q1JL 3PHOA 3LKNB 1VACA 1RZ8A 1NCWL 2DTMH 3KXFE 2LU3A 3P4NA 4NQSB 3A67H 4J3XA 2MCPL 2OK0L 3DYPA 1AO7B 3H9SE 4HCRA 3GDBA 1DSFL 4MXWL 3ZKSD 4D9RE 1MAMH 4FXGA 4KZEH 1OAQL 4P3DA 4HH8A 3S36L 4YDKH 4HS8H 1OP9A 2WBJD 4X7CC 2AJVH 5C0AE 1JN6B 3T8XB 4FABL 5CBAB 3O2VL 3WFHA 1ZXQA 3RWEB 4RAVB 4PRNA 3I6KA 3LB6C 1M05B 3SOBH 3X13B 5CAYB 5C8JA 1NCNA 3QXWA 1YPZB 4HUMB 4NBYB 1YJDL 3MXWL 2AK1H 3GMLA 4G9FD 3DJ9A 1A3LL 1JNHA 1UVQB 1GHFH 1KJ2A 4EN3B 1LP9A 5FECA 1XGPB 1EHNA 1L7IH 1AR1C 5IQ9B 3KPMB 4OFYA 1CXIA 4OQTA 1DQML 1ORQA 4ZFGH 1KEMH 4WJ5A 3MGTA 5I66A 1M7DA 3QDMD 3GGWB 3W9EA 3KJ6H 5BVPH 2RFXA 4X6DB 1NBVL 4Z7UB 4YHOH 3T3PF 2WIIB 3NIFE 4R4ND 1JI1A 4CKVX 4X4MA 1LEIA 4BKLB 5C0JB 1G7MB 3X14A 4KDVA 4M3JA 4YUEH 3D5OF 3GI9L 1QKZH 3I9GL 1BOYA 25C8L 3X3GH 4YNYB 2VSCA 2ZOKB 1OP5K 3NCCB 4YC2B 3DX6B 5ID0A 1X5LA 1MJ8H 4GAGL 2AK4B 3N1MC 5DMGD 3RUGE 1QFHA 2YA2A 2WINB 2OL3L 4D0DB 5CIPA 1T4KA 1AHWC 4M61B 3FB8B 4P3WA 3RWJB 1J0YA 5IFAH 2P45B 2UUDH 4XPAH 3BRGC 3MRQB 4WI3A 2DRUA 5JIIA 1YMME 3PQYB 4M9PA 1I9RL 3TEUA 1VA9A 1XF1A 4JR9H 1BVKA 1JV5B 4D94A 1DQJB 3MROA 4DGYL 5FGCB 4MNQD 3CH8A 5I1JL 2DI9A 4YHYB 4GRWF 3ARBB 3OKOA 4PGCB 5D1QC 1MREL 4NCC2 1CS6A 1LDPL 3EOYG 3S8WA 2A1WL 3BWUC 3V6FB 2D7QA 3D3VE 2ICWA 2GTZB 4PJBE 5FAAA 1RUAL 3MV9E 4J6RL 2VDQL 1R3KB 1RY7B 4PJCB 1KB5A 1EERB 2V5TA 5DRXB 5C0NC 4FQCL 2KDGA 4PP2B 3M8OH 4MGXA 3BHBA 2P5WB 5KSVB 3IFOB 3G9VA 3LKQB 5FYJE 3S34H 4IRJC 1YQ2A 2WK2A 3WKNA 4YX2H 3MLTB 2HLFC 3TJHC 1IBGH 2DWDA 5I1KL 1OGAB 5IGXH 4PJXE 1JK8A 2D7PA 4AK1A 3Q6GH 3CU7A 5DMYA 3T0XA 5TDNB 3O4LD 1N3NA 2AEIT 4HH9B 1JYWA 2ARJQ 1QPPA 2V7HA 4QTHA 2VWEC 3VGHA 4PUBH 4XMLL 5BVJA 2DQDH 5GZND 3OJ2C 4Z7WB 5I1CH 4Y1AB 3UCRA 4YXKH 1A2YB 4X80H 2R0LL 2BVEA 3MR9A 5E5RB 5F96H 4HUNB 5KSAB 3PJSA 2IC2A 1KJVA 4TUKH 3QG7H 4X5LA 43CAA 1K2DB 2ZSVB 1FHGA 2Z8RA 3JTTA 4IOIA 1T20A 5HI5C 4K3EL 2VZTA 4PJDB 2ATPA 3PGCA 1AJ7H 3DIFA 2AJ3B 5F9AC 3ELAT 3BX7C 4OGYL 1EEZA 4PJIF 1FGVL 4WW2C 3QULA 2VXQL 5GGUB 2ENYA 2HFTA 1U58A 4HFWA 4HJGA 1N26A 5FYJU 4POZD 3QYCA 3BXNB 2D7TH 4JHAL 1HSBA 2HJFA 2HKFH 1MFAL 3GSRA 1P9MC 4PY8J 3HMWH 2AJZA 3FO0L 3MRRB 2IJ0C 4WI7A 3ARDB 3BDBA 5FYLL 3MXVL 2XA3A 1A6VL 2J8OA 3PWVA 1NANH 3FT4B 2H1PH 4OZIF 1YDPB 1I8KA 3C2SA 3O3UN 2PF6A 3TBYA 2I9TA 3UYOD 5C0IB 2UY6A 4KVNH 3B2UD 1FVEA 2V6HA 2UWEB 4BSWB 4ACPA 3WS6A 4X7EC 2B1HL 1SYVA 1IGIH 4LKXA 3SPVB 5J4MA 1CFVL 1JJUA 5DJ2A 1JGVL 1G7LA 4I3SH 5J1SC 4PV9B 1NEZG 1F2QA 3VWJD 4OZHA 5IBTH 4Q9RH 1LP9E 3SE9H 2LE9A 1MUJB 3QHZL 4G3YL 4HIHB 1CICB 5GRUH 1ZT1B 1RIVH 5FA3A 3KPRD 1QP1A 1QA9B 4RFOL 3AB0B 4HUKB 4OFVA 4PRBB 4PY7B 2FDBP 3MLXL 3UJIL 1X5XA 5K93A 1YNKH 4O00A 4YE4H 1GZQA 4DKAA 1ZA3B 2WWMC 4CGTA 3ULUF 1TVHA 3HNSH 3HCVA 1M4KA 4HWUA 4X4ME 3TF7C 1DBAH 5E6IC 3QCUL 4OFKA 1JZ2A 1LE5B 4AEIL 3MRDB 4JFDD 4MA8L 1OM3H 1U2CA 3IXAA 1T1WA 2IG2L 4E0RA 2VH5L 1T80A 1HEZA 4JKPH 3V4VH 4FQHB 3QEGL 1OAKL 5FHAL 1A3RH 2CDGA 1T22A 3NOIA 3WS3B 3DX7B 4WFHE 4XCYB 4UU9B 4W70A 1OHQA 2F8XC 2VE6A 4WI5A 4N0YH 3GEWB 1CTNA 4NJ9L 4Z9KB 3OZ9L 1A6UL 3PWJB 3O3DA 1VFMA 4JPVL 4F7MA 1QRNB 2V2XA 1WUNT 4AH2A 1YY9D 5EZJB 4GT7A 4M5ZH 5F9WB 3S88L 4MVBD 3NBNA 4UUJB 1KJMB 1OAUH 4QOKB 3BZ4B 5ALCL 1F58H 2P42B 1OPGL 3ZL4L 1UGNA 4NQDA 2GJZA 4P9MH 5D7KD 2OM5A 2EC9T 2O93L 3VI3E 3NA9L 2C7UA 4KI5F 1MJ7H 4NYLA 1OWWA 2Z35A 3WNKA 4FQLL 2PXYA 2JELL 1N64L 4K94H 4JY6A 1GGBL 2EO9A 4HX1A 3MUZ1 1TJIL 2Q7YA 3PGDB 1WZ1H 1IKNC 3SDXA 3OR6A 5HDQL 1NCCH 1M6OA 4XX1G 4WTZA 4U6HB 1J05A 1EZVY 2ADGB 3D69A 3O3BB 1U8LB 3QNXA 2EIZA 2VUYA 3QB7C 3HS0A 1WF5A 1UWEH 2ED8A 4U1HA 1EA9C 4U6YA 5DRNB 4Q6IA 3WEXB 4JZNB 3IS1X 4TOYH 1DP0A 3P73B 5E8DH 1LK2B 4G6FD 5AD0A 1TTFA 4R4BB 4Y5YC 4BH8B 1SMOA 1NANI 2VQ1A 4LKCA 4LVHC 4KROB 5D2LF 4CMMA 1NCTA 3MFFB 5IMOA 5BRZA 2OMBA 1ROWA 1HILB 4JFEB 4MQXD 4TUJA 5DTFA 4WU5B 3KYMB 1JNLL 3F58L 3VXSA 1U2HA 1U91B 3CFJA 2W60B 1KEGH 2J7LA 1AR2A 4U1MB 4CJ0A 5C09A 3A67L 3DLQR 4PJ9A 1A7QH 4WGVB 4D9QD 1U8NA 2JKXA 2ZCLH 1MAML 2AQ3A 4KZEL 3IDUA 1FV1A 1PKQB 2IAMD 3MV01 1JHTB 1YYLH 4HLZH 4YDKL 4PRPB 3EO1B 5CZKA 2AJVL 1XCQA 1D9KC 1L7TH 1N8ZA 3N1QC 1PQZA 4ZD3H 3FB5A 3D25B 4NN6C 5IQ7H 3BKCH 1RURH 4WO4A 1R3HB 3SOBL 2X9YA 3MRIA 1RIUH 4JM2C 5DSCB 1RIHH 1D5IH 1F5WA 5C0EB 2FHFA 2EXWC 1ZHBB 3WJLC 2AK1L 4PTTA 2KL6A 4JO4L 1FSKC 5J7CC 4JHWL 3FOLA 2OL3A 1L7IL 4QWWC 5IW3A 5CD5C 1OT2A 1JMZA 4XAKD 1KEML 5T1KB 1HHJB 5EZIL 4Z95L 5BVPL 1WWAX 2D0HA 2VERN 4XNYH 4YHOL 3K4ZA 3GMPB 1OW0C 1REIA 2QEJA 1WBXB 1JWMB 3T65B 3QI9A 4YUEL 4KKCD 3GHEL 5DJ6B 1KIUA 2CRMA 3LPWA 3X3GL 4ZFZB 2XWJA 4OD3H 4DK6A 5I1LA 2AV7B 4OZHE 4X7TA 1K4CA 2F8VA 5AEAA 5GGRY 3D39D 4JDVA 4MX7A 4P23D 2BNQD 4LASH 3SKMB 5FOJA 1MWAH 5DK2B 3DGGB 1TIUA 4NNXA 5HGDB 2I27N 3HC0B 4GRLC 4XVSL 1MCRA 1OB1A 4N8VA 5KJRH 1YEGH 4V1DA 1U95A 4QT5B 1V7ML 4ZAKB 3T4YB 2FH8A 4UILL 2EDQA 5C0FA 3VD4A 3T3MF 4F7EB 2J4WL 2EEDA 4NGHL 4L8SC 4CN1A 2MSPA 3I85A 1JWSB 2XFXB 3QXVA 4WENB 2P8PB 3DX6A 3LRSA 3K3QA 4DVRH 1K9TA 3SE4C 4ZSOA 1U41A 2AK4A 4L8CB 1B90A 2W0LA 4PJ5B 2ATKB 3KNBA 5EUOB 5D1XA 3RWJA 4R0LB 3LEYH 1RJCA 1RK1A 2H6PA 1QBLH 1C08B 1ZT7B 3M8OL 3LY6A 4N1HB 1CGWA 2FHCA 3NPSC 5DK3A 4QYOB 3S34L 4G5ZL 1OTUD 4JDTH 2Z91B 3N06B 4AQ1B 4YX2L 1DQJA 1G0XA 3SDCB 1IBGL 4LEOA 5IGXL 1ADQA 2QR0B 4NQDE 1IM9B 4LAQH 3G5VA 4GXVH 4MA1B 3TN0C 2FX9L 5E7BA 3UAJD 3UPRA 1DVFB 4Y4KA 2OTWA 3TO4A 3FT2B 1RV6X 1TCRB 1UM4H 3QQNA 1NH6A 4PUBL 2DQDL 3OF6A 5L88L 4MA7L 3SDXE 4XHQA 1ZLWK 4YXKL 1DQQA 1FFRA 4DCQA 1BD2D 5CSBA 3MLTA 5F96L 3GSVB 4L3ED 5GGVY 4TUKL 2J8UF 3QG7L 3I6LD 1Q94B 2WQRA 1NDMB 2H32B 4AL8L 2Z8WC 4LGPB 3MRBA 3MRFA 1FZOB 4KKAD 4WFFD 1TZGL 3G08B 2QKIA 4LBEB 5GGRB 5ESQA 2Q87A 1RHFA 3IYLW 1MFEL 1AJ7L 3UTSA 3EOAA 3DSFH 5BRZE 2PO6A 3QFJA 3P0VH 5IF0A 3PDGA 1WLHA 3DO3A 4Z7VB 5I8EA 1SEQH 2JLLA 5DUMH 5D70H 5D7SL 1INDL 3T0AA 2YBRA 2R2EB 3F62A 5AZEH 5KS9B 2Y07H 4L8DB 5C09E 1WICA 3EGSB 2DM7A 4ZO9A 5BCAA 3QRFM 3LKPA 1S9VB 2M1KA 5FCUL 2O5ZH 2X4RB 3F6IA 1O7VA 2HKFL 3OR7A 4TNWK 1XF4B 5C0BB 2GJ6D 4BSJA 1M7IA 2J5LC 4YHPB 4YWGL 1SBSH 2ITDA 4I18B 4M1CD 2H1PL 4QRSB 3C5SB 5HHNA 4LQFL 4I0KA 2NXYD 1U92A 4KVNL 3L6FA 1KPUB 4WW1B 4GJTB 4JQIH 3QRGH 5DVKA 4FNLH 1FH5H 1K3ZA 2BY3A 1P5VA 1TZIA 2IBZX 3RPIB 3SKNA 5E2UL 3BXNA 4OZFH 3WD5H 1AO7E 5HHVH 5IBTL 4Q9RL 3SE9L 1T7ZA 1JHLL 3ARXA 5GRUL 1NC4A 5IK3A 4HKBB 4HHAB 5A2KH 5D9SB 1U93A 4LDOB 2DLTA 2YOCA 1H3VA 3TM6A 4YK4C 3MOBH 1YNKL 1YUHA 4YE4L 4NZDA 3MCKB 1BLNB 5FDWB 3HB3D 4U1JA 3GJEB 1IAOA 3DMMD 3HNSL 3AVEA 3BISA 5F89A 3NCYS 4LNVA 3BUYB 5I1IH 5EU4A 1UWGH 2Z31B 3HE7D 4R90H 1ES0B 3QUXB 5D4QA 3BPLB 3U30B 1XAUA 4Q0XH 4WY7H 5DEGB 5DF0A 4MDIA 3GIZH 2B4CH 4JKPL 1KNOA 1TLKA 5D7IA 3E6HB 5E6YA 1Z9MA 2IQ9H 2VZVA 5IMLA 2GT9B 1HOCB 4V1DE 1I1AD 4N0YL 4X6DE 3ZKXB 3WXVH 5HI3D 4QHLB 4PRIB 2DBJA 4RISH 4NQUA 4XGZA 2BRQA 2R0WH 5CEZD 3MLPA 2MHAA 3BD4A 5MENB 2FZ3B 1F58L 5J11B 2R23B 4ZSOE 2AK4E 5E99H 1NMAL 2IADA 3SDAA 1VEPA 2P44B 1CIDA 1G7IB 1MJ7L 1N4XH 3WMSA 1QNZL 4TTGA 5IJVB 3T1FA 4UINH 3F7VB 3H42H 3DX7A 3FTGA 1AE6H 4M43L 4K94L 4OUOA 4OZGF 3HNTH 4LSQH 4C57C 1EVUA 4NO2A 3LIZL 2X4PB 2IANB 1CU4H 5J56B 4I0PA 3OG6B 3TA3B 4KI1A 4MCYA 3FFDA 5IVXB 3NZHH 1UWEL 4QOKA 4U3CA 3BZ4A 4ENED 1HXYB 2DQCH 3FB7A 2MJWA 4MXQC 4KJYA 1S5HB 3O9WD 3SY0A 1KTLB 4PJ8D 1XF5B 2GUOA 3MACL 3CPLA 4M8QA 5DWUH 5KBNC 4X5XB 3HZVA 2D3VA 5BS0A 1XGUA 3DYOA 4M7JH 2X9WA 4LDLB 5GHWH 4RMRA 1FN4A 3FRUA 3FFCD 1J1OH 4OFIA 4ODSH 2NW2A 3EYUH 3L5WB 4E9LA 1R3JB 1A7QL 3ZLQC 3F12B 4GKZA 5H35B 5IOPB 4M00A 5GSVB 2AXGB 2EDKA 2ZCLL 5AYQA 3T4AB 3EJZD 1MFCH 1EFXB 5F8QC 3WO4C 3ZDYF 5EDXA 3DHMA 5D8JH 1YYLL 4XCCH 4N5UA 4HK3N 1FDLL 1IL1B 4N1CA 3VJ6B 5HYJA 3GHBH 3UTSE 2JJVA 1CGSL 1DR9A 1WAAA 3TCLA 4ONFH 4ZD3L 4LPTA 4O5LL 1UG9A 3H0TB 5BXFA 5IQ7L 1RURL 1LK3L 3G6AA 1YEKH 1FIGH 4B41A 4JRYA 4J3WA 2YPLD 3U83A 1NKRA 2NY2D 1L6XA 4ZS7H 2XN9A 1QPXA 3SCMA 1MQKH 3T0DA 1BJ1H 1W72B 3DRQA 2FEEI 3R06B 4DKDC 3HAEH 2R29H 4Z8FH 3IAQA 3FMGL 5FF6A 3M17A 1DE4B 1C16B 3Q1SH 4NQEA 4X98A 3MYZA 4OD1H 3WIIL 1NFDA 5GS0C 2CUMA 4BUHA 2NY0D 4XNYL 3GSQA 3KLAB 2XKSA 3BP7B 4LIQE 4PJ7F 4X6EB 3ULVE 4JFFD 1P4BL 2MPAL 2A6IA 5I1EH 3KYKL 5FGBA 3LQMA 3TVMD 2X4QA 5JHLL 3TZVA 5JR1H 1U8JB 3C8KB 4QF1B 3HRZB 3QO0B 3WS6C 3S9DB 5ISZB 4X7DC 4LASL 3LKRB 5I1DA 3LS5H 4HWNA 1EHAA 4K3GA 5B22A 5KJRL 1YPZF 1AXIB 1YEGL 5D2NC 5CEYA 2D7MA 3GMRA 2HFFB 3MRHA 3QIWA 4PD4J 4XHJC 2AP2A 4XBEH 5FUCE 3QIUD 3I3EA 3VXOB 43C9A 4LHUD 3E3QC 1BZ9A 4YHLH 1S7TB 1VFBA 4F7TA 4ZDHA 4BZYA 5D7JB 5KVEL 5DJXB 3O3AA 4DVRL 3WO4B 3IXTA 3OAZH 4EUPG 1EEYB 5K9KB 4OBSA 1JGDB 4M48L 4CVXA 5GS1A 2EYTB 5T5NF 3VFSB 2P8LA 2ADJB 5EU6B 4YZFF 1DJSA 1R3LA 3HTLX 4HUXA 3C60D 4NJAH 4S0SD 2XA8H 1QBLL 3V5KB 3KHQA 3ROLB 4X5WB 4FG6D 5CEZH 3FQTA 1S9KC 5EBGA 5DMJB 2H8PA 5SWSB 5E9DD 5DZLA 4D0CB 1UM5H 3L9RA 3Q48A 2UZYB 4KPHH 3T04D 3FQNA 1NKOA 4ZFOL 2MKWA 1SY6H 2F15A 3BGAA 4LAQL 4GXVL 4F57H 3A6CH 4XCEB 3CMOH 5T3XE 3FQRA 4ORGB 1UM4L 5JO5A 3NN8B 4XPHH 1FFOA 1FL3B 2R69H 1T5WB 1R0AH 2XTJB 3W2DH 1N0XH 1ZT7A 4MJIA 4EI5D 3BGMA 2HT4D 1HHIA 1QRNE 5MEOB 2APBA 5CP7B 2FR4A 3OXSA 2C4XA 3VXUD 3TJEL 2AKRB 4PJCF 5HDBE 3DBXA 4QOKE 1DBBL 1KCSH 4EDXB 1A4JA 4KC3B 1YZZA 4NO3B 1XGYH 4HD9A 3SBWA 3O6LL 3MREA 1UQSA 5E8NA 3WNPA 4XXCA 4AMKL 1NGPH 3LEVH 4XH2A 5LQBH 5D2NB 3RQ3A 4PYHA 5AAWA 4Q6IC 1SYSA 4QRPB 3P0VL 3RWGB 3TBWA 5BS0E 3P9LA 4G9FA 2PN5A 5D70L 3WLWD 1LO2L 1CXLA 2ILLA 4MS8D 5DEZA 4CN4A 5JOEA 1P6FA 3QG6A 5AZEL 3WIFA 1OSPH 2Y07L 4QHNB 3VWKD 3T0EA 4HV8A 4RA3A 1NDGA 3SO3B 1B0WA 1NQBA 3IU3A 2O5ZL 4ODWB 1UB5B 3M1BB 3MGOB 4IIQB 4P2CG 2F53B 4PJ9C 5DYOB 5TH2A 3RI5K 3BRFA 5HYJE 1A6AB 1SBSL 4PR5A 3VD5A 2AJXH 1WAAE 2MTPA 5FCSH 2BNUB 4OZ4A 1A7OH 3UJTH 1A14H 2X70B 5DQJB 2VDMH 3KPSB 4JQIL 3QRGL 4PG9B 1FH5L 3JWOH 5KS9A 3B2VH 3KS0J 4PJDF 2M26A 2XN9E 4HBQA 1OL0A 4PJEB 4H5SB 4WO4C 4JQVC 4ZXBB 5HHVL 4U6TA 3V0VA 3RL2B 4HZLB 2ERJC 1PKQE 4B5EA 5D1ZB 3RVXD 4XNZC 4KY1H 4HDIB 2YD9A 4NQEE 4P3CL 1YECL 1NFDE 3MOBL 4QRUB 2AJSH 1B0RB 4LVNC 4JKMA 2VTFA 1NMCC 5GPRA 1U8HB 4HWBH 2A6DA 2GAZA 2XYCA 1XCTA 2DJUA 2X2YA 4NKDB 3BZEA 5A2JH 4R90L 5I30H 2AJUH 4Z18A 2Y5EA 5MEPA 3ME0A 3GK8H 4EXKA 2VNCA 1KCRH 4Q0XL 5CWSB 4WY7L 3QJHA 2P24A 4MAUH 3QO1B 1R5WB 1MFDH 2B4CL 2CSPA 2FO4B 3QI9C 3BDXA 2FEEL 3G6DH 4JKWA 3HZYB 3QQ9C 2UWEF 4RGNC 3RHWK 3MODH 1I1YB 3HZMA 4HKXB 2VQUA 4ZFFA 1YEDA 4LLYA 5T1MA 1VFUA 3WXVL 1MJUL 3GJEA 5C9JA 3F7YA 5ACZB 2B2XL 2MWCA 4XP5H 4U1GC 3U0TB 1UJTA 3BUYA 5CZXD 2BVOA 2NXZD 2R0WL 4DZBB 1QLFA 5IV2A 2IGFH 4UQ2A 5E99L 2DDQL 3G5XB 3GBLA 2HJLA 1FZJB 4ZTPH 4LLMB 1N4XL 3CCHB 3CFIC 3Q6FB 4UAOC 4UINL 1A7RH 5DS8A 5J12C 4YFDB 3H42L 3BGFB 3H7BB 2PW1A 4XNMA 1X4YA 3MV7B 3MLRH 1EO7A 1NCBH 35C8L 2B39A 2X40A 3HNTL 4LSQL 5TDOB 4OCXL 1D5BA 3EHBC 5ITBL 4J3SA 2Q8AH 2HYMA 2ITCA 5D1XC 3W9DB 1CU4L 1T1YB 5K9OB 3D48R 5B39A 5HVHC 1CG9A 1MH5B 2AJYH 3NZHL 3CVHB 4BJLA 5L6YH 2ERJB 2IFFL 3QDGD 4IRSB 1SJVA 4XNZB 1ZLUH 1N6UA 1U6AH 1G7QB 3IT8D 4H26A 3O6FB 5L8JB 2X09A 5DWUL 3VXPB 1NMCB 4MD0B 2BVPA 2VLME 4M7JL 4MJIE 5GHWL 4Y4KC 5HVWA 3TBVA 4O58H 5EOTA 3TO4C 2EDHA 1I7TB 1QSFA 1I1CA 3TT1H 3B4NA 4CAGA 3STZB 4YBHA 1CFNB 4DEPC 3EYUL 5EC1B 1M1SA 4U1LB 1YN6A 5BV7C 1WIPA 4KMLB 4N9GB 2D0GA 4CBPA 4G80A 4NO0D 3TCXA 3QDJB 4X0KB 1MFCL 5IKCA 4QTIH 1A6ZA 1YN7A 1BZ7A 4RWYH 1HXYA 4H1LB 3OGOE 3N1GC 1EFQA 2WMPA 1IGFH 3GHBL 1ULVA 3BKJH 5CINH 1GRWA 4HWZA 3L3KB 4ONFL 5FM5O 4XI5D 4GKOA 3VWJA 1XR8B 2J3SA 4ZPVB 2EDWA 4ZTOH 1ACZA 3I02B 1CD9B 5DRZB 2VLJD 1PG7X 4PP1D 4XT1C 1T0NA 2Z8VC 1IGTA 3T0EE 3KPRA 1P7HL 1S9WB 2PO6C 3DVIA 4FRWA 3S96B 4GAYA 4OM1H 3MMEB 1KGCE 4XVUC 1QEWA 3VXMB 4KVCH 1K3IA 2Q86B 3QAZB 1MQKL 3LKSA 4RSVA 3ZKMD 1U8IA 3QJFA 4RGMB 4K71C 3BOVA 1MWAA 2R29L 4Z8FL 5J89A 2FATL 3U1SL 4UT9L 4P2QB 3OXRA 1W0WB 2Z4QB 3SHSA 4OD1L 5HJ3B 3T0BA 2R1WB 5E1HB 2HH0H 5GRWA 5KVGH 1UJ3A 4ZNCD 4JFDA 5JW4Q 4NN5C 5HSFA 3F6LA 2R1XB 1KV3A 3OKDB 1GSMA 5D7LB 1GL4B 4JO2H 5EZOL 5I1EL 5GGTL 2VAAB 5KS9E 2PKDA 1KC5H 3PWNB 1QO3A 1JUFB 1VEOA 3ULVC 2A77H 3JVGA 2A6KB 2H9GB 5DUBA 2IEPA 1EJ6A 5D96C 3R06A 2KPNA 1RJLB 4X6CA 5EO1A 3JTSB 1DLHA 3LS5L 4NKOB 3GMQA 3FOMB 1DANT 4ODVH 6CGTA 3E6FB 1S7WB 3BH8B 3RVTC 1MNUH 2ZKHH 5CSZA 5EBWA 3GIVA 2D7OA 3SGJA 3ILQC 4XBEL 3BP7A 3WD5L 3DRTA 2E5EA 1JTPA 2CDFA 1RJYB 4LGRB 3ZTJG 5SWQB 3DURA 3FZUC 4UV4L 1I8IB 1T3FB 3RTQA 1S7UA 1WZMA 3D85B 4U7KA 4HT1H 3QFDA 4PYGA 5HYSG 4F9LC 5DJYA 1AGEB 3G04A 1OF2A 4FQPA 4NJAL 5BJTA 4GG8B 1QR1B 4R96B 1CLZH 3NGBC 4MSWA 2XA8L 2P5EB 4P5MB 5CEZL 3MTRA 2PYFB 1NEZB 5I8OH 4NHCL 3EIFA 5DMIH 1J87A 1Q9WB 1UM5L 1PG7W 3LOWA 4ELKA 2R4RL 2FGWL 3U9UA 4G9DB 4WV1A 5SV3A 5M94B 1SY6L 5JZ7C 4GW5B 1ZWIB 1UKTA 4PJFA 3PUCA 3CMOL 1PBYA 3HG1B 2EYTA 4LPVA 3WBDA 2XZZA 1J11A 3LEXA 5ILTL 2FIRT 4OIBA 4JGMA 4ZUUB 2DI8A 4XPHL 3QWOA 5CHNB 1I85A 3SDAC 1QFOA 4Q6YA 4XXDA 4P48A 3U6RB 3ROLA 4P4KB 4S10A 3VRJA 4XP4L 2FX8H 4PRIE 4QXTA 2IAMA 1AKJD 2RIKA 2OTUB 5EUOF 2ID5A 1ZANL 3C5ZB 1T66C 3B43A 3O2WH 3S3PA 5MENE 4C56B 2FJFA 1KCSL 5KVFH 4LCCB 1X44A 1KFAL 4HWEL 1T1XA 2P8MA 3GI8H 2AEWA 3BQUB 5KANG 3GSWB 4JM2F 2DQEH 3L3JB 3VCLA 1FRGH 1NGPL 5LQBL 5LAXB 5T1LB 5CILH 4B7LA 3L95B 2CKBH 1XF2A 3I75B 2DICA 1QSFE 4LCWD 3KVQA 1CE1H 5IHUH 2VB5A 4WFGD 4OZFA 5F7UA 1T03H 1JPTL 3NH7H 5C0GB 5ITFB 2EDDA 1LMKA 1ORSB 2P47B 4U05A 3JBG7 2FIKB 5E4IA 5A3ID 2QHRH 1ZK9A