1CICA

Idiotope-anti-idiotope fab-fab complex; d1.3-e225
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
DIVMTQSHKFMSTSVGDRVSITCKASQDVRIAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQHCGSYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IG HEAVY CHAIN V REGIONS)
publication title Three-dimensional structure of an idiotope-anti-idiotope complex.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1999-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cicA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cicA01
4RWYL 5IGXH 4WFHE 5F1KC 5KN5A 1JPGB 5DMKA 4EDXB 2R2BB 4NKMB 4L9LC 3FONB 1JUFB 4M1GL 1KGCE 1SM3H 2QL1A 3ECBB 4M61B 3WO4B 3U9UA 2DMCA 4WCYH 3WFHA 4P5KA 4HIXH 3MC0A 3RA7L 1P6FA 3PP4H 1J05A 2X1QA 3RU8H 4Y5YB 4LVHC 2UUDH 5E1AA 3BN3B 1OAZL 2QSVA 3BFOA 3ULSB 4ZUUA 4ZDHB 5I66A 5EO9B 3BP4A 3B8SA 1D5MB 1P69B 3QFJE 1HCFX 3PUCA 4L9LB 4PJCF 3S3SA 3UPRB 2ATKB 3D85A 5GGSA 4GW4B 3QG7L 3HAEB 4KK5C 3G5YB 4PLJD 2XZQL 4GQPH 4QRRA 4HS3A 3BKMH 3VDCA 1MF2H 4U1GC 1PG7W 5HJ3A 3QCUH 4HUXB 5I1AA 5DHVB 5D1XC 2F53E 1PVHA 2FBJH 4PJAE 1D5XB 1JHTA 4LAQH 4WHYH 2VDPH 1MRDL 2OQJB 2YC1A 4MJIB 1CGTA 1YA5A 2IQ9H 3IB4A 2DMKA 3PDGA 2XPGA 2DTMH 1K6QH 1P2CA 3EUUA 3UBXG 5T1KD 5GZOC 4JGUA 5EC1A 4I0PA 2FO4B 2VC2H 5KBNC 3C6SA 4U1LB 5D1QC 3HKFA 1A1NA 2P42B 4JE4B 2FD6L 3EDKA 4TPRL 5I73C 1HZHH 2WNGA 4ONOA 2J5LC 3OB0H 5HPMB 1J8HD 5HBBA 4U6VL 5F21B 3W81A 1CICA 1J0JA 2ZUUA 1UM6H 3CMGA 4QRQA 4R90L 4JR9L 3KG5A 4ODHH 5F9DC 3TBYB 7CGTA 3C5ZD 3D2UD 2YKLL 4EIZC 1K8IB 2BVPA 3CFBB 5D1QB 4N8CH 4MAYC 1KELH 5FB8B 5HGHB 4DFIA 3I3EA 2EXWC 1JGUH 2CIKA 2GTWA 4JAMB 3VD5A 4EUPH 1F3DH 1I7ZB 1FZJA 4OJFL 2RB8A 1T83C 2HMIC 1MCWM 1NGQH 4LHUG 3JSSA 5GRYA 3MJ8B 4QRTA 2NQCA 1C12B 1EVUA 5F96L 5IBLD 5DMIH 5F70A 2DIJA 1LDPL 3FB5A 1N5AA 1HH9A 3U79A 1NAMH 5AWNL 4P2CG 1QSZA 2AXJA 1OY3B 4MJ6B 5FYKD 4PUBH 4X5LA 3CGTA 3FN3A 5GSVB 2CDGB 4JO2L 5CFHA 3EYUH 2BHYA 4RAHA 3RDTA 3IU4H 3ZSTA 3MCKA 4FQQA 1MAML 3GK8H 5LVEA 3D87B 1UYWH 1XF4A 3S34H 5GJTL 1X44A 1NGYB 2O5XL 3J8F7 4HHAA 1ERNA 1S3KL 4L8CB 1S7QA 2GK0A 2GJJA 2X40A 4TQEL 3MACH 4M43H 1Q94B 3VJ6B 2J1KA 3DYPA 1F5WA 2WUBH 4JFDA 5EO0A 1IKNA 1JIBA 1AGCA 2E9WA 1NLBH 3QEQA 4XPAH 5L8KB 5BJTA 1WFTA 3B3IA 5FOBA 1LP9E 3WE6A 5DJCB 1BQHG 2IGFH 1OCWL 4JM2C 5E8PB 5C6TH 1G7JA 3EFFA 3ULVH 1GOHA 2EC9U 4D9RE 5INDB 1FO0A 4RMSA 3VXQA 2AS5M 3GEWB 4CU6A 4HUWB 2V5RA 2KZ1B 4ORGA 4TSAH 1NGZA 4FMFA 1JGDA 3MUZ1 4M3KB 1VACA 1PDKA 1WFNA 5DF0A 3QDJB 4HIJA 3BZEB 5GIRB 1G7QA 5EB9A 2ZUSA 4JFPA 4HC1A 2B4CC 1RUMH 1ND0A 3KPMA 4X6EA 3QDGB 2YEZA 5EIIB 3BGAA 1UWXK 4JM2B 3HNTL 3FHAA 4PV9A 3QP3A 1TQCB 5GRJH 4CAGA 2NY4B 3QRGL 5D1ZA 5F7EH 3I6KA 4P4RA 3RUGA 4X7FC 3FO2A 5JPNA 4DKAA 2BSRA 3BZ4B 4WHTA 3WS6C 2VXSL 5D70L 4CNIB 5DJ2B 3WIIL 1AGDB 4L8DB 4AG4L 4AT6A 4I18A 3CUPA 3Q6FB 5E2UH 1FE8L 4FP8H 4J4PA 3IU3A 3A0OA 5C09A 4Z7OE 4ZFOB 1LGVA 4X98A 3RGVC 1A6TB 1KEGL 1KFAH 4D9QE 1RK1A 2NLJA 2YUWA 4LGRB 1GIGL 3CD4A 4NOFA 3RKDD 1INEL 3T3MF 4UILH 1YEEL 4RGND 1JCKA 5E5RB 2XA8L 2XN9A 4G7VH 4IJ3B 2FGWH 5T5FL 2A77H 4MWFB 3DV6A 3FO1B 1JJUA 1VADA 4XI5C 4X7SH 5I1LB 4FQIH 4AEIL 2M8XA 2C3VA 2XKNA 3DV4A 3T4AB 5DK2B 1PKQE 3CSBA 5E8NB 4AL8H 3HHRB 4U1MB 2DICA 1MCOL 3HC4H 3MUY1 2W60B 1CFVH 3RGVB 4BUGA 5J06A 4IBLT 3QHFL 3MA7A 4K3EH 2YPVL 2P24A 1DBJH 2NTFB 5D6CB 2ZUWA 4YR6A 4CJ1A 3SDDC 1A3RH 2I5YH 5TF1L 4QY8B 1DBKH 3QZWA 1BJMA 3HNVL 4OLYH 3LKPB 2IMNA 3BP6A 3N0PB 1DE4B 3L3KA 3AMLA 3INUL 3U4EB 3V95A 3RWCA 1YYML 4KMTH 1OAXH 4XNUH 3N9GH 3V9FA 1BOGB 4PJIF 1A64A 1DLFH 2GSGA 5DEGB 4HK0A 4LLDB 2H2SC 3HZYA 4RZCA 4LIQL 1PKOA 5CJQH 1PSKH 4JKKA 2J3SA 4JGJA 5F8QC 3UEZA 3S88L 4HIIB 4F15C 3GUTA 3FMGL 1MHHB 4OLZL 4P4KA 1AY1L 1D6VL 2V2XA 2YRLA 5HD8C 4LSPH 2P5WB 4LLAA 3MFFA 5TF0A 3JVGC 3VXUD 4IIQC 1WCBB 4PJHE 1K4CB 5ACZB 3BT2H 1J0IA 1MWAA 3ZE0E 4ELMA 1Q72H 1VFOA 3CFKA 1Y18A 1BF2A 4PY7B 4YIQB 2R69H 1KPRA 4KZEH 3BH9B 1MVUB 4F15B 5D9SA 1HWHB 2VLRB 2YD7A 1F3RB 2C7UB 3GMQB 4P23C 2BNRE 2VDML 2CKNA 2VKWA 1P7KB 2V5MA 3CDFA 1IQDB 4Y19E 5AEAA 5JDSA 2H9GB 3MRKA 4HQQH 4ODXB 2FLRT 4O51A 2AJVL 3CCHB 2IBBA 1HINL 1N6VA 2WINB 5FEBA 1QBBA 2ZNWA 2JIXD 3RI5F 1JPTH 4Q9BA 2R0LH 1OGAD 3LS4L 1FC1A 1CVSC 4Y2OA 5I74B 2XNAB 1EUUA 3ZTNL 4FQLH 1R5WA 3DROB 3HLAB 3BMVA 4Y8DC 1AR1D 1MOEA 3H9SA 3TZVA 4RAUB 1AJ7H 3DXAB 3AREC 4PJBF 4E0RA 2R8SL 3HZVB 4J3WA 1CQKA 3LKRB 1C7TA 2IPUK 4X99B 4HGWB 4TRPL 5F89B 3QULA 4GG6E 1NCNA 4OB5H 1NGPH 3LRSB 1IQWH 2R56H 1DN2A 3QNYA 3TNNB 4ALAL 3BD3A 1INQA 1R24B 3S35X 5JW4M 4M5ZH 5ESVB 2LQRA 4S1RH 3P77A 1TCRA 3TC9A 1CD1B 3RQ3A 4FABL 4TN9A 1M7DB 4D9LL 3UPAA 1HN1A 2XOTA 1ORQA 1RIUL 5FUCC 2OJZH 1HDMB 3VXRA 2R2CA 4FFZL 3AREB 4FTVA 5EBLA 4R4NC 1CFSA 3C8KB 3P11L 5HHXL 3GMNA 3TV3L 3O6LL 5KSBA 1RVFH 2AV7A 3ZL4H 4JDZA 5K59E 2BSTA 4QTHB 4YDVA 2YSSB 1HHGB 4BH7A 5A40E 3O0RL 4NO0B 2EYTA 2IPTL 4UQ3B 3CX2A 3ZE1E 5AUMB 2FR4A 4X8XA 3MRCB 2RHEA 2EC9T 4J12A 4YDIL 3X3FL 3IF1B 3ZT6A 1XGPB 2WIIB 3ZSSA 2YWYA 2ZOKB 4XWOC 5TQ0L 1RZGA 2VLJB 5E6YA 4UV7H 4F7CA 1E6OH 3MCG1 4MXQD 5B38A 2P47B 1U58A 2CLZB 1BREA 2ZG3A 1RUAH 3SDYH 4LSQH 1QPXA 3UJJL 1NCUA 1KB5H 1I1AB 3IFLH 3IETA 4NZRL 5HYFA 4UV4H 1LO4H 3BP5A 4Q74A 2ESVD 2R4RL 3U9PH 3N1QC 3RNQA 4P57A 3WFCL 3OR6B 4LCCB 2DI8A 12E8H 1H8NA 3WJLA 3QNZA 1N0XL 4XTRD 1HXMB 4J8RB 5JOEA 3I85A 1UZ6F 1FIEA 2ICWA 2NY6D 2P45B 4PRID 4RGOL 5CILL 1E0OB 2VLME 2VR9A 5HDQH 4KDVA 4QXUH 1J88A 3RI5K 4DGIH 4HD9A 2X4OA 4NZTL 5HYSB 1N2RB 4EUPA 3EJJX 2E9BA 3HI1B 4TSCH 4UDUA 5HHVH 4X6DA 4PJFB 2X4UB 4ETQB 2X9WA 4FXKA 4NGHL 3EJYD 3LOWA 4JLRA 2P43B 4XMLL 1OTSC 2IG2L 4FZEH 4PRPB 3RVTC 1WCQA 1NAMA 1YY8B 4LPCA 3VFVA 5DJZB 5IHZA 4KGJA 5LGHL 2NX5B 2Z8RA 4K07A 3HI5L 1XGQB 4XPBL 4W70A 1T2QH 5EBGA 1XT5A 2KUTA 3D3VA 2JJSA 5GHWH 3VRIA 4YDKH 3PIQB 1QSEA 4J1UA 4Y1AB 5SWSB 3NPZB 4GBXC 2H32H 2CKBB 1A7RH 3HTLX 3V0VA 3PDDA 3VU2A 4PTTB 4P2QE 1GJIA 1PBYA 1UWGL 2F5AH 2GK2A 4YO0A 5T5NG 2W65A 3VRLF 5AYUL 1NMAL 3LEYL 5E08H 1J8KA 3GI9H 5BS0B 1NLDH 4XAWL 2DQTH 2PXYA 1LQSR 4IRJD 2XWJB 1S9XA 5DMGC 5CJXA 2N7AA 1R3IH 2XWTB 4GBXB 5EFIB 1OARL 1ZV5A 3N85L 2ATPB 5DJAB 3SKNB 4Z7VE 3QFJB 4AM0A 3QUZD 2Y06H 4OQ1A 4NQEB 5BW7A 4WDIA 4UIKH 3ZE2E 3SDXF 5FGBA 1X5AA 4YHKH 3FFCD 3ILPA 4WW1B 1HYSC 4F33B 1F6FB 1OB1A 3PGCA 2AJZB 3QO0B 4PLKD 4M7JL 3DVIA 1MLBA 1KLUA 5J56B 1H5BC 1KPVA 4EI5B 3WUWB 2DWEA 4NBZB 3RJDA 4XVTL 4FQXD 4KTDH 4X5XA 4KTEL 1PLGH 5C0IB 4K8RC 3U2SB 1GC1H 4MNHB 2P4AB 4HKZA 3F7RA 2BVYA 1A1MB 2XFXB 1XF1A 3SE4A 5CD5C 1A7OH 4HV8A 5IBTL 2PR4L 4U6XB 3P0GB 4YC2C 1YEIH 6FABH 3GJFK 3VMPA 2MNUA 1IL1A 1G9NC 1TXKA 4IRSB 3SKJL 5DQJB 4HEME 1OT1A 2Q76A 1H5BB 2Q7YA 3JWNC 3HAEH 5FA4A 3E3QE 1T04A 1WIOA 1TTFA 2APXA 3W0WA 2P8MB 1TMCB 3E1F1 5ITBL 5DHVH 3HA0A 1I3VA 2ZCHL 1I7TB 1KJVB 1NKOA 2EKSA 1NGWB 3CX5K 4CVXB 4YC2B 2ARJA 4WU7A 2UVFA 1DUYA 1Q0XL 2OJEA 2E7LA 1U8IB 3BQUC 3W39A 1U8NB 1FNLA 3U0WH 1IM3A 1CXEA 3BDYL 4MXWL 1Y0LB 2BVUA 5ISZA 1WJ3A 1MJJB 5L2JA 5DD5H 2NXYC 4JG0L 4OZIE 2H45A 3QO1A 3S6CA 3TYFA 3FCTB 4HAGA 2MQ0A 4LNVA 1FNEA 1XF5A 5BCAA 3HE7A 2YPLD 1CI5A 1F4WH 3MV9B 1TJHH 4N8VA 2EE6A 4XBEL 3D25B 4U1IA 3KYOA 1I9RL 1MEXH 3W5NA 2YUZA 4JO3H 3BQUB 4XP4H 3WNPA 4G5ZH 2VDLH 3CFDA 3GBNH 3S36X 1HQRB 2N7BA 3T3ME 1P5UA 5D2NC 4PJXB 1PX3A 3LDBC 2GT9B 1EFXA 4LBEB 3TYGL 4G8IB 1FRGL 2OSLA 4Y16B 4DZBB 2N1KA 5DD6B 1G9ML 4DN3H 1RK0A 1QYGH 1GL4B 2PO6C 3CZFB 3C87A 2NMSA 5L9DL 5IK3A 2O5ZH 4ZO6A 2NY0D 1D5BA 4AJ0A 2XZZA 3OZ9L 2D0HA 2FO1A 1MFDL 5DEFB 5DS8B 3ZYIA 1JF5A 4FQ2H 3STLA 3V5HB 5FO8A 1VDGA 3FO9A 4C57C 5IB5B 2WAHA 5C08D 4HS6B 3PQYD 3QIWD 3REVB 1RIHH 3DYOA 2BC4A 5D2NB 3JWDC 3KPSE 1IGYB 4L4VB 4CMMB 4M7ZC 4U2YA 3WS3B 3UJIL 5C71A 4EI6B 5EO1A 4R96A 4X6CA 3MPCA 2PO6B 4X6BA 3LY6A 5EUOA 4UOW1 4FFWC 4FQ1L 5MEQB 5CJ5A 2V5YA 4C56B 1LO5B 3FZUC 2IC2A 1JN6A 2NY3B 3MUJA 1EZVY 3IXAA 5HHMD 3DUSA 2J8UF 3RPIA 1I8MB 3B9KC 2J2ZA 4C55A 3ZYZA 3EYVB 2DQUH 3GSQA 2PCPA 5DFWH 4HUUB 3WLBB 3CH1B 4JPWL 3TCXA 1RUKH 4AMKL 5EZIH 1NBZA 2BNUB 2VQ1A 4J3VA 5EZLA 2B1HL 1FORL 1FL6A 4NZUL 3LRGA 5JZ7D 1M05A 4JRXA 3X12B 4XB7A 5D7LB 5HGBB 1GZQA 4PJGB 4D3CL 1IC1A 5GGTA 4GLRH 5AAMA 4N90D 3SDCC 3CFJB 4G8GD 3UZVB 3TM6A 1U6AH 1PKQB 4OV6F 2VXUH 3QHZH 3B9KB 4P5TC 3EBAA 3F8UB 2XICA 3TPUB 3MRQB 1VFMA 1XZ0B 2YD1A 2RAMA 3QEGL 1F13A 2CQVA 4YHYC 2YUVA 5C9JA 4LQFH 1QFOA 4WNQA 1DSFH 3SQBA 3QPXL 1Z5LA 4DKEH 4HJ0C 5DD1L 1IZJA 1GAFH 5B22A 2B4CH 3JZ7A 2VDRL 2FBOJ 4JPIB 1V3MA 3MJ9L 3IJHA 5EC2B 1UJ3A 4HH8A 2VXQH 1GGTA 4CRPA 5LXGL 1XH3A 1OOAA 4NJ9H 3BUYA 5HVGB 1DEEA 3EDJA 2C4FU 5DMYA 1FFNA 4WHCA 1KCSH 4ODVH 4BQ9A 2JTDA 2NY5L 4JKWA 3VXMB 2P48B 3WNOA 3DMMD 4PJBE 4L8SA 4LCWE 4OIIH 1NPUA 1AGEB 1KB5A 5IV2B 4MD0B 4LLYB 2DQGH 1Q9LB 4G9FB 1WEJH 5CEZD 1MELA 1DDHA 1BM3L 1MPAL 4Q2ZA 4PTUA 1MUJB 1PYWA 4HX1A 2UYLB 1OAUH 1YJDC 2I9TA 1U8QB 3SJVE 5TJWK 4JO4L 3MODH 4LMQE 4ERSH 2YXFA 1QA9A 3HPJA 4NQXB 2ZSVB 4YX2H 1RULH 3O3BA 2X05A 4GKSA 3O3AA 1XFPA 3NFNB 1BFOB 4G42A 4ZAKB 3BW9B 4F57H 4JM4L 3VRJB 2APTA 5BV7C 3K1KC 4HH9B 3LH2H 3RWJA 3WUZA 4YE4H 1JNNH 3KPNB 2R2HB 3HZMA 3RVVD 1H15B 3VXPA 5DHYA 5E94A 4QOKD 3KXFD 1T5WB 5I15H 3S5LB 3ARQA 5I76B 3E2HB 3F58L 3GSUB 3ROLA 3OKLA 32C2A 2A83A 2JK5A 4ISVA 3GSNA 3VWJA 2VR5A 3VXTA 4QHKI 5T1KB 3L9RA 1R3KA 4MD4A 4XX1G 1A9EA 3C5ZC 1WWCA 2EH8H 3OGCB 5C0AA 4JPKH 1FBIL 5LQBL 5FYLD 3DSNA 5HYEA 4YEEA 4JN1H 5BV7B 1XGRA 3VFNA 1OAYH 5ILTH 5H35A 2H32A 4Q9RH 3MRPA 3MO1B 1AO7D 3QXDA 1DQJA 4MNGA 3TBVB 5EBWA 5IR1A 5JA8B 1J8HB 2F54A 3DUHA 3ELAT 3MTRA 1OP9A 3H7BA 2A6KB 1DVFD 4IMKA 4LKXA 3WD5H 3LZFL 1T03H 5C0CB 1AXSB 3THMH 3ZHLA 2LVCA 2UZIH 3C5ZB 3D2UB 1RHHA 5DC0A 2DD8L 3MRIA 5EBMB 3MNZB 1WFOA 2A2QT 2COQA 2EDFA 4FQCH 5TE7L 3UCRA 1NFDB 2G9HB 2ITCA 2FYYA 1TZGH 5MEOB 5CMAA 1JWUB 4NNYB 2J4WL 3T0EA 4LHJB 1JMZA 1I7RB 1CE1L 1KIQB 4CVZB 5D93B 3PL6A 1RJLB 5EU5B 1ZHBA 4DVRL 1RZJC 4J3TA 3HZKB 1SJVA 4NQTA 5D5MB 1U93B 3CK0L 1W0WA 3V4PL 1CT8A 1AHWA 1B88A 3QDMA 4JFEA 3VXSA 4TSBH 2P5EA 4WI9A 3TH2T 5J11C 1J9CT 1F2QA 4DKDC 5J8OA 3IVKB 5KJRH 4YK4B 4APQD 1JPGA 1NEZA 1QACA 4KUCD 3FONA 1P7QA 4PS4H 1JUFA 1KIRA 4GFTB 3L3JB 1OWWA 3ECBA 1GZPB 4M61A 3TT3L 3WHXB 3WXWL 2VLLA 4OI8A 1IC4L 4DUXA 5IIEA 2VZUA 1B0GA 3DOSA 2AJUL 1IM9D 4Y5YA 4HXAH 2JELH 2XG5A 3D39A 3OJ2C 1A6VH 2XY1A 3GMLB 3VRLE 3TBSB 4IOIB 3QNXA 4TUKL 4RFEB 4JDTH 1C5BL 3ARSA 4M6NL 4ZDHA 1ADQA 1D5MA 1YMME 3DGCR 1MY5A 4L9LA 3UPRA 1JV5B 2ZJSH 3GDBA 4GW4A 3HAEA 3G5YA 4KPHL 3DTXB 2JJVA 5BZWB 1GRWA 4KI1A 4GAJH 1ZHNB 4I48B 1G6RB 4NCC2 1QLRA 4HUXA 5DHVA 4PJ7F 4PJCB 3HRZB 3ULUD 1LEGB 1A8JH 3DNKA 1D5XA 2OQJA 2V9RA 3SDXE 5CSBA 4XRCB 3P0YL 2AK1L 2E27H 4OFKA 4I0PD 3RKDC 4BZ1H 4HG4J 1E4KC 1EO7A 5AZ2L 3NCYP 3MRMB 4NN7C 2FO4A 3Q3GA 4U1LA 1TVBB 4MA7L 1JNJA 4PJ9C 5BMFL 4P2OD 1IT9L 5INCB 1NCWH 3FB6B 1KTKE 1YEGL 3OF6A 2YRZA 2OI9C 5GGQH 1DQDH 5D1XA 5EPMB 1T7VA 2VITB 2DQIH 1I7UB 1SJXA 3DHJA 2BRRH 1YMHA 4WV1C 4U49A 1Y6MR 1NFKA 5HPMA 1CICD 1EA9C 2R29H 4OLUL 4PJEF 3TBYA 1HSAA 1A4KB 5HSFA 5FYJE 4OZGE 1K8IA 4QTIH 3CFBA 2DQEH 3O9WD 4G7YL 5D1QA 3W9EA 4OZIA 5FB8A 1RUQH 1QVOB 4PJ9B 2VQTA 2YD4A 2Z91B 1AP2B 4WEBL 2C4FT 5FV2A 4JPVH 1INDL 3V4VL 4DKFL 2QADB 2HVKB 3O6FD 3KPRA 4P2RD 1M4KA 4MDJB 4WV1B 4YHNB 4HKJA 3P9LB 1CLYL 2XT1B 4MJ6A 4NFBA 3O3EB 2YK1H 2X7LB 2CDGA 1NUDA 3RFZC 1TJIH 3RBGA 4P9HH 1AGFA 4U0QB 2QQNH 4MAYA 1OGTA 5B8CC 3V52L 1NGYA 4UTBH 1T83A 2ENSA 2CKBH 1JWSA 3MMEB 4L8CA 2JB5L 4PJDF 3VJ6A 3NPSB 3GKZA 3U4BL 2VJXA 5DR5H 4LPWA 3OAYK 1ZHKB 2C5DC 1ED3B 2QQLH 4ACPA 2Q1EA 2EIZB 3GO1H 5DJCA 4PRNB 3QCVL 4JFQB 4JHAL 3HUJF 5E8PA 1E6JL 2CK2A 1I9JH 4U3XA 5B8CB 1SY6L 3KLHD 1QO3B 2X4SB 4CMHC 5T3ZE 1I9EA 3O11B 5INDA 1X4XA 5BQ7B 2GIYA 4WI3A 3T77B 3KJ4C 1J1XL 1NC4B 4WI7A 5IBUG 1VB9A 3DUUB 4MGXA 1PY4A 4Q0XL 1UH3A 4WTZA 3B2VH 5GIRA 1EEYB 1FCCA 3VFMB 3UJTL 2HJKA 3VFSA 5I18L 5EIIA 4JRYD 3SGJC 3REWB 4JM2A 4LDOB 1AQKH 4PGDB 2XTJE 1J5OL 4Q9QH 3B4NA 4YEFA 43C9B 4CMHB 1XGYH 1TNMA 1YEJH 4HXBL 5F7LB 1X7QB 4EVNB 5IMOB 3KJ4B 2BMKA 3S35L 5DJ2A 4Z7NE 2HN7A 3QA3B 4L8DA 5SWZE 1F4YH 2C3WA 1QBAA 4JFFB 3C8HA 5EU6E 2DL2A 3TPKA 4Q6YA 1E27A 3X11B 4ZFOA 1EPFA 1A6TA 1GOGA 3GMRB 5EA0L 3S7GA 5DI8B 4YXHL 3ESUF 3K2MC 3R1GL 2XN9D 4PB9L 1P4IL 1DQML 4L3EE 3I9GL 2EEBA 4Z77B 4XMPL 4E41B 4OTXH 2BVOB 3WS6A 5GRVL 1Q9KB 3FO1A 4NZDA 5I1LA 4Z5RA 1QFWH 4U1NB 5L8LB 3T4AA 3GNMH 4POUB 5E8NA 1HH6A 4U1MA 4ZYKB 4EOWL 2ED8A 2W60A 3RGVA 2MCPL 1DQLH 3BWAB 2BFVH 5F1IA 4RWHA 1G9NH 4UT7H 1MFCH 5K9OB 4Y8AA 1CGYA 1HKLL 2R23B 1JI2A 2W92A 2NTFA 5D6CA 3F5WB 1WZ1H 2CUIA 3T08A 3CZJA 4MXQC 1IGIL 4NHUB 3GSRB 3ARDD 2V17L 4QY8A 5B38G 4XC3L 4JCMA 3MV11 3LKPA 2HFEA 4C4KT 1DE4A 3ULUL 2KL6A 1ZVHA 4DW2L 3MCLH 4ZFFA 1TZHB 4UAOC 1VSCA 5HYJD 1BOGA 4K7PY 5DEGA 4OD2B 5E2VH 4LLDA 2ERJC 4PRAB 1U3HD 4WI4A 4JHBA 4P4KD 5KW9L 4HIIA 3SDDA 1KJ3H 3MLXH 4XTRC 4YHML 4PJIB 1AKJD 1K8DB 4MD5B 4JJ5B 2NY6C 2P5WA 4YDLC 2YPKB 2YBRB 4OGXH 1OM3H 1WCBA 3P0VL 4UAOB 2YN5A 1K4CA 3U48A 2ESVB 1JTTA 5TPWL 1XAUA 1OD9A 5EORH 3SO5A 1RJCA 4NQCD 3GSXB 2DQDH 3RNKB 2ADFL 2ERJB 4JZJB 2YR3A 4PY7A 1A4JA 4YIQA 3PXHA 1OLZA 5DEZA 3BH9A 1MVUA 1F90L 2X4PA 2PW2B 1L0YA 4LLQB 2CLVB 1YEHH 2VLRA 3MUGA 4XC1L 1JGVL 2C7UA 5FGRA 3DRQA 1MCEA 3WL9B 4AYFA 4KMLB 3WDIA 1ZAGA 2AEQL 2BY0A 4YDLB 3QIBD 1A02N 2Y07H 1IQDA 3JVGA 1FG2B 3X13A 1REIA 2H9GA 3EO9L 3NA9H 3QUXD 4IIQA 4ODXA 4NUGH 3CCHA 4AZ8A 2WINA 4F3FA 5MENB 4MS8D 3AXLB 4XCCH 1S5HB 1CXLA 2PYEE 3HNSH 3A6BL 5KVEH 2XNAA 1Z3GH 5DVKA 1ZS8B 2ZWLT 2EDLA 4NQDE 3DROA 1BMGA 3HLAA 3S4SA 1KCVH 2Z4QB 4NHCH 1WWBX 2KH2B 2UUDK 4P23A 2DLFL 4YPJA 4KRPD 4MNQD 1QRNE 4RAUA 1VFAB 3DXAA 1IE5A 2E7CA 3HZVA 4WFFD 4IRJC 2ORBL 1RJZB 3DVFA 3LKRA 5F7YC 4XVSH 1QNZH 4HGWA 2Q8AL 1R3HB 5F89A 1DL7H 3LRSA 3ZMRA 5I1CL 4MDIB 3OBAA 3TNNA 3QUZC 4PJBB 3LMJL 4QRUB 2Z35B 1M7DA 4XP5H 3P4NA 3WFDH 1EIBA 5GGVY 2UV3A 5CWSA 3UO1H 2CIIB 4TULH 3VXNB 4FTVD 3WIFB 1FO0L 2X1WL 5MERB 1FH5H 3VMNA 3AREA 1D3CA 1IRAY 3IDUA 5CBAA 3C8KA 4IRJB 4Z7WB 4WI6A 2EDEA 2E7HA 1MCBA 4PLKC 5M7QA 3KJ6H 4XVUC 4HC1L 4HGMA 2LVEA 2HT2D 4I0KA 4L4JA 4U1KB 1HHGA 1XIWD 4NO0A 1CE6A 1S78D 2ADGA 2ZPKL 5AUMA 3AC0A 5BOPA 1YYLH 4KDTC 1QHOA 4FQXC 4QGYA 1WBYA 1OPGL 3IF1A 2WIIA 1XGTB 3OB0K 4K55A 1CXIA 3FFCB 1QBLL 4JG1L 4NRZB 1ONQB 2VLJA 5EU7E 3WIHH 4QWWC 2BOCB 1FNFA 2OM5A 3ZDZE 1QUNA 1R0AL 5E9DD 1AXTH 1UB6B 4KI5F 3L1OH 3B43A 4RBPH 4J3OC 4WUUD 2FWOA 4OM1H 2HVJB 4KJQD 2RQ8A 5IVXE 2G5BA 4GKZB 3A67L 2CRMA 1RJYB 2GCYB 4L4TE 5MEPB 4NSKB 1N26A 3AS2A 2BVEA 4K9EC 4MCZB 2JJWA 1XF2B 3ZLQC 3OR6A 2LV4A 1FGVL 2NY2D 4R8WH 5GS0L 1HXMA 1NDGB 4J8RA 2AK4A 1SEQH 4YQXL 1IEAB 4OZ4B 1IGTB 4Z7UB 4ZFZB 1QSFE 5GGUA 5D6DC 2ZUXA 2HRPL 3M8OL 5HYSA 1RPQA 1N2RA 4LIQE 2XKUA 4QO1A 3HI1A 1ZGLB 4ETQA 4S1SL 2X4UA 3DECA 1C1EH 2EEDA 4GRWF 3RX8A 2Z31D 1CXFA 1WZKA 1YJDH 3G6JE 4PRPA 2NZ9C 2N4IA 3GJFB 1YY8A 1QLFB 4RDQF 5ETUA 3VFTB 5DJZA 4OZGA 4PJ7E 2CRYA 2NX5A 4PG9B 5IB4B 2C3HA 4DEPC 3NCCB 1QSED 3G5VB 4N8VG 2HWZL 4M6ML 2AI0H 1FNAA 1SYSB 2HRLA 3PIQA 1BWWA 1CR9L 5DT1H 4Y1AA 3TJHD 1I1FB 1OQXA 5SWSA 4OZHF 5BV7H 4ZPVB 2CKBA 2MQCA 3MLWL 5CINH 1KNOA 4YBHA 2HTKD 4PTTA 5C07E 1V3KA 1S8DB 2PUQT 4H5SB 4LLMB 15C8H 4UNUA 1MRCL 5DRZB 1UJTA 5J12B 3WDJA 4PREB 4GG8B 2NY0C 2PXYD 1BAFL 4DEPB 5BS0A 3D18B 4HPOL 4I77H 4JO1H 2MFNA 1CL7L 5FYKE 4K23L 5FKAB 2XWJA 3ULVD 3QIWC 4TTDD 3NIGF 5DJXA 4PJEE 1YNLH 3PWJB 1MWAL 2XWTA 4GBXA 1EHAA 4HKBA 4NQSA 5EFIA 5EOCL 5IHUL 1JRHI 1PZUB 1G6VK 5DJAA 3SKNA 5LWYL 2Z8SA 4R7NB 1YEKL 1YMMB 2LFGA 3D48R 4NQEA 2A0LC 4O5LH 1NAKH 3K8MA 3DBXB 4FXGB 2NY0B 1WT5C 3O2DA 4WW1A 3UTZB 3TIEB 4OT1H 2OL3H 3P4OB 2E5EA 4N5UA 3GHEH 3H8NA 2AJZA 4HWBH 4X7DC 4I3RL 1QQDB 4S1QH 1HIML 5KZCB 1S9VB 4PIRF 1KTDA 3KGRA 1CG9B 1RZJH 3WUWA 2A74B 1A1OB 4LSTH 1EEZB 4NWUH 3U2SA 4MNHA 4ELKB 4DWHA 4PJDE 2XFXA 4QGTA 4XBPB 3RWDB 3E0GA 5IGXL 4U6XA 1AE6L 4G6FB 3V6OE 5SX5K 3EOBA 3T04D 4V1DE 4H8WH 3TA3D 1BPVA 4XPGH 1H5BA 2JCCF 3HUJE 4X4MA 4KVNL 3LEXB 1JRHH 5D7IE 1T5XA 3RTQB 1JZ2A 1OTTD 2NYYD 3PP4L 4AQOA 1G6RH 2AEPL 4K2UH 5D8JH 3HI6H 1I7TA 1KJVA 3A6OA 5TQ2H 4LVOC 3NOIA 1NGWA 5JQ6L 3MRJB 4CVXA 2Q86A 5DXWA 4U1JB 3IS1X 2BY2A 3NTCL 4I9WD 4NDMB 1FFRA 3GM8A 1A7NH 5KS9F 1U8IA 3AU1B 2X41A 1NCDH 1X3DA 3UC0H 1YN6B 3KWWB 3FQNB 3PABB 1Y0LA 4HMDA 1MJJA 1AIFB 3BKML 3MGAA 2GJ6A 1D9KD 1RV6X 4RGNE 2VN7A 3RWGB 5T5NF 1RZIB 3QCUL 2OX5A 2G60H 4U7MA 5JTWA 3FCTA 3DI3B 3CDGB 3P30H 3GFUA 3U82B 4OF0A 1T6VN 2VDPL 1UWXH 4KHTH 1T7WA 2J6EL 5JW3H 4LVOB 2VUOA 2HJFA 4M93C 3MV9A 1EXUB 4X0KB 3SPVB 3D25A 3ZKMD 3GIZH 4F7TB 3BQUA 4P59H 3GSWA 2ID5A 3OGOE 2RFXB 5C2UB 1EFXD 1HQRA 3C6LC 3CVHA 4N0UE 1MI5B 2VO5A 4PJXA 5DWUL 2GT9A 3NIFF 3BKYH 1DLHB 4LBEA 4G8IA 3I02B 5KOVC 2HT4C 5DD6A 5TH2B 3H42H 3IDMB 3MFGB 1L7TL 5E56A 4ZXBB 3OAUH 2OXHA 4MX7B 4Y4FD 4KK6D 4LCIH 1UM6L 1DUZB 4TYUA 5CGMA 1A14H 2CJUL 2Y6SD 4FQJL 5DEFA 2IANB 5F7WC 3RVVC 1LMKA 4N8CL 4PGEB 3V5HA 4JKPL 1Q9WB 5IB5A 3NGBC 1RZ8A 4HS6A 4PP2B 5J1AA 5CBEB 3C6LB 4JDVB 3L95B 3RRQA 1NGQL 1FLTX 5D2NA 4LU5L 4L4VA 1G7PA 3PE9A 3FQRB 3FKUS 2DQJH 4N0RA 2CGRH 3P9MB 2XTJB 2NTSP 2I9LB 2QSCL 4DZ8B 4EI6A 2QQKL 1NEUA 1NAML 1RIVL 4MSWB 3PV7A 2PO6A 2RCSH 4PUBL 5I19L 5FUOL 1E4XI 1Z9LA 3PWVB 3EYUL 3ULSA 1CFNB 4XAKD 4C56A 1LO5A 3ZTJH 1EVTC 3EYSH 4NWTH 4QOKB 1UYWL 2J88H 3KXFB 3S34L 3NZ8A 1I8MA 5IG7B 3EYVA 4UINL 5C0DB 5KTEH 4HUUA 3CH1A 4G6KL 1JVKA 3MACL 3BAEL 2BNUA 2WUBL 3EHBD 4E42B 3JTSB 1U3JA 1IJ9A 2Y7QB 4ODWB 2J8UB 1JHKL 4L3EB 2Y4SA 4HSQA 3WFBH 4LLWA 3X12A 5D7LA 5HGBA 1UQSB 4PJGA 1BLNB 3CNKA 1C7SA 1JZ6A 1W8NA 4U0RC 3PHOA 1MVFA 1MCJA 4GMTL 3UTSD 1DFBH 1G1YA 1QRNA 3B9KA 2VTFA 4OLVL 3SCMC 3DVGB 2PN5A 3TPUA 1OGAE 2BP3A 3MRQA 1R3LB 2ITDB 1XZ0A 4HF5H 1FIGH 1VESA 2PF6A 3ETBF 4OLXH 3C08L 4APQC 2VZVA 5E5UB 5JIHA 3ARFB 3OV6A 5D7JD 1RUML 2ZKHH 3ARBC 1E4XH 1GPOH 4RAVB 1NEZG 3SDCA 4KVCH 1RURH 1B2WH 2VZOA 4KC3B 4U0RB 5IFAL 8FABB 1AFVL 2VXTH 1PEWA 5FECA 3RKPA 4P5TA 5ELIA 3BMWA 3SCMB 1JZ8A 1BIHA 4MXVF 4HUMB 1S5IL 4UZGA 3VFGL 5JOFB 2BDNH 3VXMA 2B7DT 1HKFA 5ANME 2L4OA 35C8H 2G75B 4FMKA 4HMEA 1J10A 1TTGA 3ARBB 4OKDA 3WV0A 4NO5B 4HK3N 4DVBB 5IV2A 1KFAL 4MD0A 4LLYA 4G9FA 1Q9LA 3HAEG 3IFNH 3RAJL 1R6VA 4WRLA 2W91A 3P40A 1MUJA 3IT8D 4LAJH 2UYLA 1BBDH 3PGDB 7FABH 4G6JH 1U8QA 2K7QA 4X6FB 3HMWL 5JDJA 4F80A 2FGWL 5ICXB 2QEJA 4XP6H 3QAZB 1ES0B 1MIEH 5TFSL 1M1SA 4X7SL 1N0LA 4NQXA 3CMOL 3LD8B 1CXKA 4XXCC 3QQ9C 1DBBH 4OZFA 2D0GA 3NFNA 4P2OC 2P8PB 3BW9A 3VRJA 1K3IA 2R2HA 4Z0BH 2IFFH 4KJYB 3BEWA 3UTTB 1J1OH 2VYRE 3OKNA 1T5WA 3LN9A 4H88L 5I76A 3VWJD 3GSUA 1A3RL 2YA1A 4KY1H 3WXVH 3HMXL 1T2XA 3SKOA 1DBKL 4NUJB 5T1KA 1YN7B 1FC2D 1LK3L 1HWGB 3OGCA 3O9WC 4NRYA 1NFIA 5C0BE 5KAQG 4KI5E 4P2OB 1OAXL 4PRIE 1XCQA 4H1LH 1IEHA 1DLFL 1F42A 1JWMA 4Z7QF 3MO1A 3OG6B 2VLKD 3O6FC 5CJQL 1GGUA 4BSWB 2OMBA 1IAMA 4L8BA 5DZNA 4GKOA 3K4ZA 1J8HA 3DX6B 4N1EA 2A6KA 2V6HA 4JRWA 4W6WB 5C0CA 1AXSA 5F7FA 4LSPL 5HVWA 3BKJL 1F6AA 1KOAA 3C5ZA 3D2UA 5EBMA 1EGJA 3MNZA 4OAWA 3MLUH 4HDIB 3T0ED 1KN4L 1NFDA 3BT2L 3BDBA 3PWLB 3G5ZB 1P5VA 3PL6D 5MEOA 1JWUA 4NNYA 1Q72L 1SJHB 1KLGB 4R2GB 4CVZA 3L5XH 1RJLA 5T1MA 3O6FB 3HZKA 3VXSD 1I85C 2P5ED 5D5MA 4Z8FH 1U93A 5EU4B 1ZE3C 2F9BT 1FLRH 3MV8E 3MZTA 4TUOB 2E6PA 5DQ9B 3IVKA 3CFCL 2CPCA 1JTOA 3MRBB 3KLHC 1KBGH 1KTLB 3AB0C 4JY6B 2D0FA 3L3JA 1AI1H 1JPTL 1GZPA 3WHXA 2R0LL 4HWNA 1BD2D 4PJ8C 5CSZB 2O5YH 2DQHL 3LEVH 2NXZD 5IT2H 5IP4A 4OCXH 4WTZG 2QLVB 4I2XE 3GMLA 4S2SB 3TBSA 4IOIA 4RFEA 2FEDD 3W5MA 3UYRH 3PGFL 4N0FB 3AROA 1NH6A 4W68A 3AB0B 5I1KL 1I1YB 5GGTL 1WC7A 4OB5L 1JV5A 3TGXA 2R56L 3BPLB 1T1XB 3SO3B 3CC5B 4XMKH 4M1CD 3DTXA 1NMBH 4PJ8B 3WLWC 5L2KD 3QIUB 3KLAB 3QJFB 1ZHNA 2DJSA 2D7TH 2FEEI 2FL5A 1EJOH 5DUMH 3DWTA 3B9VA 2OJZL 1FVCB 3EGSB 4MJID 1WBXB 4PJCA 4XCYB 5GGRA 1LEGA 3HC3L 3TT1H 3STZA 3BGFC 3D0LB 4DOHB 1RVFL 4XRCA 1S7TB 3FOMB 3L3GB 2F19H 1TDQA 3ARRA 4LARH 1EHXA 4LLVB 3NFSL 5DGRA 1TVBA 4BKLB 4O2CB 3ZKSD 5DD0L 3EOYG 3PG2A 3OF6D 4HFUL 5INCA 1IVLA 1KG0B 3LN4A 4ZO7A 3TCLB 1A6PA 1YECL 5KG9B 5EPMA 2VITA 1I7UA 1WLHA 2DBLL 4GXVL 3BGFB 5DDHA 2X70B 5C07B 5GZOD 5IROC 3VFUB 2JE8A 1E4KA 4LSQL 5D1QD 3B9EA 1ULVA 4ZD3L 1A4KA 1X4YA 3FQUB 4NBXB 5E2JA 4PJ9A 4UV4L 2R4SL 5IM7B 4KXZH 3T1FB 3U9PL 1AP2A 1WK0A 5C8JB 1KEMH 3ARDC 5K9KB 5DFVC 4PJEB 4XBGA 4IS6B 4K9EH 1KYOK 3VI4F 3MRGB 1IILE 2HVKA 1F3JB 1NCBH 1U8HB 2QQQA 4WV1A 4YHNA 4A6YB 4ZMAT 3GJFH 1P53A 3MRRB 5E1HB 1QBMH 3O3EA 5ALCH 2X7LA 1K4DA 1MCHA 4M62H 4DGVH 2YPLE 2X09A 5E6IC 3I84A 2V7NB 4QXUL 3H3PL 4DGIL 1BFVH 3BGMA 1U3HC 2I25N 2DQFA 3JV5A 3T2QA 4OLEA 3MMEA 2PTVA 1EAJA 2AW2A 4JFZH 4NT6B 3U1SL 3TN0C 3GBML 3BUTA 1JFQH 2XZAH 4MZ2A 3GSNL 4P5MB 5ERWB 2EIZA 5HYJB 3LS5L 1LE9A 2XV6B 1T2QL 1H8OA 2A38A 5E6IB 4YHPA 3LSOB 4JFQA 3QT2A 1TETH 1R5IB 4LEOB 1OAKH 1CGVA 4L5FH 4PG2C 1U3HB 5B8CA 4X9HA 5FUZL 3OJDA 1QO3A 1P4BH 5C08E 3O11A 5EUKA 4Z78B 4HCRH 1HXYB 2ADIB 4V1DB 1F97A 2E8ZA 5BQ7A 2F5AL 4BZ2L 3QIBC 2X44D 3HUJB 3QDJD 3NIFE 2YS4A 1NC4A 3TN0B 3VXUA 3QUXC 2WW8A 3MXWL 5I8EB 3ARGB 1NBYB 3GRWH 3IDNB 2CLRB 3QDGD 1EEYA 3GI9L 1Q9OB 3VFMA 4EDWL 4HPYL 4HUVB 4MHHG 4NQCB 1K5NB 2HFTA 3RZCD 5DO2D 2NY4D 3MBED 4YUEL 1RFDL 1R3IL 2BRQA 4PGDA 2HP4A 1JF1B 3K7UA 1CD0A 3OKKA 3UBXB 2HG5B 43C9A 5HHME 3S4SG 4KRPC 1G1CA 1JTPA 4J3XA 1JGLL 4UIMB 5IMOA 5SWQA 1UA6L 1MJ7L 4KZDH 3KNBB 1YNKH 3QA3A 1AGBB 4JFFA 4YHKL 3LQAL 1N4XL 2F5BL 4YDJB 3X11A 2AKRB 3SGJA 4ZSOE 3MRHA 3GMRA 4ODUB 3HS0B 3D9AL 2XG4A 5DI8A 4G8GE 5A2IH 5A2KH 1BZ7B 3G6DH 2HH0H 5IFJA 4J7RA 2P8LB 2CD0A 4E41A 2BVOA 3KPLA 1B4JH 1GC1L 2VABB 1Q9KA 3KS0J 2YOCA 1FVEA 3BPCA 4M1DH 5I1HL 4U1NA 2F8VA 4WWKD 5JUEH 1IGFH 1O7VA 3RGVD 1XIWC 4ZYKA 5B3JE 1ADQL 1YEIL 1GGIL 3BWAA 3L3IB 5HHOE 4L3CB 2ZUTA 5TE6H 5F9OH 2OBGA 3L5JA 1A22B 4NFCA 5K9OA 2R23A 5I17B 5FYJU 4JQVA 1UXWB 4KKBD 4XI5D 2VERN 3GSRA 3DURB 5DJ6A 3HG1E 4N1CA 4IRZH 2EH7L 2J8OA 1HHKB 1FYHB 5EZJB 4W81A 3B2UD 1G7MA 5LAXB 4ELMF 1TZHA 1CIDA 3PHQA 8CGTA 1FPTH 3ARUA 2HJLA 4OD2A 2WQ8A 2B0SH 4PRAA 3BIBX 1BQHB 1CVRA 3G04B 3NN8B 5DD5L 1MNUL 5E9DB 2P5WD 4PJIA 1K8DA 3OPZH 3CIQA 4MD5A 4RSVA 5D71H 1JBJA 4JJ5A 3TO2B 1FNSH 4P3DB 5KVDH 3EZJB 4LRNH 4BFEA 1BVKB 3IAGC 4ZNEE 1T7XA 2YBRA 4NNXB 2NY7H 5C70A 5IB2B 1F4WL 4X4YB 5E95B 2ESVA 4N9GB 2J7LA 4O02L 2GAZB 1MJ8H 1MEXL 1U3YA 2Z31C 4XHJC 5CUSH 4Z0XB 2I07B 4XP4L 4G5ZL 2VDLL 3GSXA 3N1MC 4QYOB 4RWYH 5D7KD 4LKCA 3RNKA 4JGMA 4ORZC 4NC1C 1FCGA 1SVCP 1YPZF 2QBWA 2X10A 4XCEA 2OTWB 4M1GH 2PW2A 5HD8D 2CLVA 1VKXB 1E4WH 1SVZA 1OSZB 3WL9A 4PRIA 4RIRA 1UWEH 1QYGL 1FG2A 3O4LD 3TJHC 1W0VB 2GUOB 4HZLB 1J11A 2FHBA 5MENA 5H37G 3AXLA 5FDWB 2Z31B 2A6IB 1BQUA 43CAB 1OAZH 3GSVA 4FQ2L 1S5HA 5HTSA 1RIHL 2DIAA 4QHLA 1LO3L 3WFEL 1F2XK 1ZS8A 2HAZA 4QCIB 1AO7E 4QEGA 3AAZB 2Z4QA 3DXAD 2APVA 3QG7H 4KHXH 1VCAA 2PXYC 4M9OA 5DUBA 3BN9C 3JV0A 5ESQB 4ODTL 4MYWB 2PKDA 4HMCA 1RJZA 3QQ3B 3UAJC 2HLAB 4TTDC 3ULVC 5IF0B 2P49B 1R3HA 1MRDH 5ANMB 3MA9L 4CUCA 3DO7B 1QEWA 1NUNB 1U95B 4HLJA 3OX8B 5DJDA 3DSFH 2Z35A 4QRPD 4N5ED 3V7MA 4LSRL 3VXNA 3KYAA 5F7MC 4M7LT 5FK9B 5K93A 3TVMC 5JNYB 5MERA 4RISL 4TPRH 3P2TA 2YZ1A 1U42A 4IRJA 4Z7WA 4PJ5B 5BRZE 4KRLB 5LCVH 4GS7C 1XMWA 4NO0D 5EOQL 1G9MC 3LKOB 1MREL 3O45B 3WMSA 2HT3C 2NZIA 4PJAF 2VXVL 3QUZA 4K3JL 5GGSY 3E6HB 3IAQA 1I8LC 4R4BB 2WSKA 2VLJD 5FO7B 1U9KA 1XGTA 2H3NB 3TVMB 3FFCA 4ODSL 4LSSH 4BFGA 2XIDA 3C2AL 1QFPA 2BOCA 4DKEL 3RL1A 2FDBP 2ICES 3PWPB 3O3UN 4GS7B 4MA3A 1Q1JL 1T1WA 2B4CL 1LDPH 3TA3C 1I1AD 1N5YL 4X6DF 5AWNH 4ZFOL 2X4QA 4HJGA 2VXQL 4JO2H 4KDTA 2C4XA 3ARTA 4GKZA 4WEUD 4FQXA 3WNNA 2NYYC 5DFTA 1YEDB 4QRRE 1V5JA 5C0BB 1DBML 2GCYA 5GZNC 1M7IB 4NJ9L 4NSKA 1MAMH 3QXUA 4MCZA 1KCSL 1XF2A 4KH2A 3KYMB 3L7EB 5GJTH 3O4OB 1RHFA 5C3TA 3NABL 3GHBL 3RWIA 3ULUE 4TQEH 1A6AB 3PV6B 1NCAL 1NDGA 2O61B 3PF2A 4YGAB 3BZFB 1IEAA 3TA3B 4OZ4A 1IGTA 4Z7UA 1JZ7A 2DQGL 3NIDE 1IGJB 1WEJL 1D9KC 3DO3A 1CQYA 1T3FB 3FO0H 3CSYA 4WI8A 1OCWH 2AABL 4PRPD 1JI1A 3BDXA 2W9EL 5B39B 3GJEB 3MRLB 3GJFA 5HGAB 2DKSA 1QLFA 1L7IL 3VFTA 4YX2L 4GRWB 1RULL 5IB4A 2I24N 4XX1E 5FO9B 3TP4A 3G5VA 4Y1AD 4KKAC 1SYSA 5D6DA 5GRWA 2BOBA 1I1FA 1ZOXA 4NKQB 2CMRH 4R26L 4ZPVA 1C08A 1D9KB 1JNNL 3JXAA 4CJ0A 5JORA 1OTSD 3MLRL 1LP9F 1A5FH 2BSSB 3LB6D 3BRDA 1KGCD 3HNTH 2C1OB 2LU4A 1TCMA 1VGKB 2ZUYA 4H5SA 4LLMA 3QRGH 4LP4A 4S1DD 4ZNCD 4Y4FC 4KK6C 1X5HA 4OZHB 5BS0D 2VSCA 1UVQB 3D18A 2D9QB 2EH8L 1HHHB 5D70H 1MLCB 1JNHB 4UQ2A 3WIIH 1K2DA 3MZGB 5H94B 4JN1L 1FE8H 5ILTL 3K0WA 3EFDH 3QFJD 1CLZH 4NQED 4HCRA 1GIGH 3OKMB 2A9ML 4JFDE 2B1AL 2XQYK 3OKDA 1YEEH 3GMPB 2KKQA 2A73B 3VI4E 2XA8H 3DBXA 1R3JA 3GRWA 3QEQE 3JWOC 2UZIL 2F53D 3UTZA 5JMOC 4O9HL 2DM7A 3P4OA 3HFMH 5ENWB 4JQXC 3PQYA 3QIWA 1N6QL 3MRNB 1T22B 4S10A 1WQVT 4EI5D 4OIBA 1MCOH 3KHOA 1CG9A 1PG7H 2LAAA 2KBGA 3EHBC 3T4YB 3EOAB 5C92A 1A1OA 2V5SA 3SY0B 4Z7OF 3NFPA 4TUJB 1EEZA 5C3LD 2DF3A 2YD8A 4M48L 4ELKA 4TSBL 1HYSD 2JKXA 2FX7H 4AH2B 2DYPD 4OFIA 5JHDB 5JXAL 4XBPA 4PGJA 4AENB 3RWDA 4AY0A 2DLGA 5TF1H 4IRSD 3VI3F 3HNVH 2D2OA 4M7LL 2Z93B 2R0KH 5ID1B 3K4AA 3L5WB 1GYAA 4LCUB 1B0WA 3SDAB 1P84J 3RUGE 3OAYH 1F6LL 1DQTA 2X1XR 1BX2B 5CD5D 5DRXA 2AJ3B 2JELL 5D7JC 4BSVB 4M8QB 2JCCB 1UJ3C 3S88H 3IDGB 1A6VL 5C0GB 4X7CC 1IAIL 3FMGH 4KJWC 1CFTB 4L1DA 3MRJA 1AY1H 1D6VH 5C09E 1EBAA 2VAJA 5ADPL 4U1JA 1IEBA 3VG9C 2EE9A 2WZPD 4AIZB 1OT2A 3AU1A 3T0XA 1KXTB 4Y5XB 5J89A 3RWEA 1ZLVK 1YN6A 3KWWA 3PABA 2XN9E 3RWGA 3OJVC 1RZIA 5FOJA 1T4KB 3OQ3B 3V6FB 5KS9B 4CW1B 1F02I 5D7JB 3CDGA 3UTOA 4A2MA 4I3SH 1D5IH 4NRXB 1A3LL 3SE9L 3CDYA 1HQ4B 4NIKB 3PNWB 1KUMA 5I1EH 1KENL 3BQUD 4X0KA 4ZOAA 5DZLA 3SPVA 1DP0A 3K4DA 1MIMH 3QISA 4F7TA 1VPOL 4W6XB 1MFBL 2AJVH 2RFXA 5CHNB 4BK4A 3DX8B 1MI5A 2CDFB 5HGGS 2F58H 3QWOA 4PJHF 4Y16D 5SX4I 5IESH 1DLHA 3N1GC 4X6CF 3ZE0F 2DQIL 3LS4H 4D9RD 5TH2A 2JJUA 5EUOF 3ZTNH 4A6YH 5HHPB 2IH1B 4K3DL 4MX7A 5E2WL 4OZFG 1U41A 5D72L 2R8SH 4KKNA 2IANA 4QTIL 3C5SB 4LEXL 1JYXA 3IDYC 1Q9WA 4L4VD 5E5MB 4PP2A 5CBEA 5FYKU 3C6LA 4JDVA 4TRPH 1T0NB 3UBXI 3O6KL 1VEMA 2HKHL 3HRPA 3OXRB 3FQRA 2PETA 3FT4B 4ALAH 3P9MA 4PGZA 4FABH 2VRAA 4TVPH 3B83A 1BBJB 1FZKB 1RIUH 5FYJL 2FATL 4C56D 3LHPH 2D03H 3EJZC 5FKPB 2YK1L 3PWVA 2QJDA 2NY3D 2UWEA 3LKQB 5HYQB 2OS7A 4ELME 3U30B 3IDYB 4QOKA 4DCQB 1KN2H 2EE2A 3KXFA 4UB0L 5DA4A 4UTBL 4D9QD 4YHOL 1DQQB 3L5HA 3N1FC 3QUKB 2GHWB 3RZWA 2CKBL 2WWMD 4LASL 4ZSOB 1RD6A 4GAGL 4GG6F 5SX4H 1N8ZA 1WAAA 4E42A 2VNCA 1G7IB 4XCFL 4YDIH 2Y7QA 3P73B 2V7HB 2J8UA 4ODWA 3UYPA 2QQLL 5TQ0H 3FZUD 1F11B 5IEKB 5EZOH 1UQSA 1BLNA 5J6HA 1N6UA 2DDQL 3B9KD 1I9JL 3RVUC 4LVNC 3UJJH 1T0MB 3DVGA 2AXFB 4HS8L 5GJSL 1R3LA 5FM5M 2ITDA 4WI2A 1ZWIB 3ZE1F 3H9SE 4X7TA 1TVHB 2R4RH 1FNHA 2AQ1A 1HHIA 2FHCA 3ARFA 1TNNA 3O2DL 4YWGL 4RAVA 4Y4KD 3WO4C 3LQZA 4R7DB 5I8CA 5L88H 2Q6WA 2BXYA 3FQWB 4G8EA 8FABA 4RGOH 5CILH 4LVNB 3SCMA 3W2DH 2NXZC 4F8QA 2XRAL 1HCVA 3VXRE 1CZ8L 3VXMD 1N64L 5JOPE 5F44A 4HJ0D 4NGHH 5ICYB 4FTVE 2GKIA 3KPOA 2FEDC 4APQA 4XMLH 2IG2H 2LU7A 5KSBE 3ARBA 4G9FD 4I13B 4DVBA 5I1GL 4WO4C 2BY1A 1A47A 1BD2B 4M1CC 4KMQA 5I0ZA 3LV3B 4PD4J 5LGHH 3IRZA 3HI5H 4XPBH 4X9GA 3KPTA 3I75B 4ZPTB 1KXQE 1QLEL 1IM9A 2NXZB 3R06A 3UDWC 3PGDA 4R0LC 5JO5A 4X6FA 4E9LA 2AV1B 1A7PL 4K8RL 3CPLB 5T33L 1QFWL 2QKIA 3GNML 1HNGA 2GITB 1SBSH 4ZAKD 5FA3B 5AYUH 4I5BB 4WO4B 1FYTB 2VWEC 3LEYH 4Y19D 5TDNB 2P8PA 3C9NB 1MCPL 2BFVL 4LK4A 5L2KB 1G9NL 4Y89A 4CU7A 4QHMB 4XAWH 3MOQA 5F97E 1H3XA 4KJYA 4R0LB 3UTTA 2WLZA 3ARZA 4P46B 1YUHA 1OARH 2ICWJ 3H3KA 4KFZC 4OGYH 5AD0A 3N85H 1H0DB 5A16B 5AZEH 3NZHL 4K7FA 4XXCA 4KQ4H 1JZ4A 4F7MA 2EZ0D 1SYVA 4P2OA 3ILQD 2ILLA 3H0TB 4Y7MA 3T2PA 4X6DE 3GMMB 3V0WL 1BZ9B 1WZMA 1RMFH 4BSWA 3CVHL 2D7OA 5C6PB 4WTWA 3S37H 5KSAB 1KJ3L 5C0CD 4K71B 4KQ3L 5B4MD 5I1IH 2LE9A 3MLXL 2ADJB 4P3CH 5CLWA 1NUGA 3L6FB 4G3YL 1BEYH 1S7SB 2R1XB 5IMMB 4BM7A 3RWFB 3IGAB 2ZP0T 4XVTH 4Z7VF 5ABDE 5ALBH 1OM3L 4KTEH 3D3VE 3O9WA 4OGXL 4UU9B 4HDIA 3ZE2F 1QSEE 5DYOA 5I8KH 3G5ZA 2CH8A 1S7XB 5BRZB 5EORL 1SJHA 3FT2A 5IBTH 1ITBB 1KLGA 2DQDL 3K1DA 2PR4H 5A2LH 1KCRL 5KN5B 3O6FA 4E5XB 4P2RA 3MBXH 5IQ7H 3SKJH 4XH2B 3NBNA 5EU4A 3KLSA 4Z95H 5E00B 4F2MB 4TUOA 2FSEB 3U9UB 1U3ZA 3BVNB 4MVBD 5DQ9A 1MH5B 4K7PL 1WZLA 2Y07L 3DARA 3PDOB 1I4FB 1AR2A 3NA9L 3ZTJG 5ITBH 4NUGL 1N7ML 3MRBA 2P7TB 4JY6A 4P99A 5E8EB 4KRNA 4U05A 3U46B 1QP1A 4ZUUB 4RMUA 3HNSL 5ECJE 5CSZA 2IAMC 3TFKD 4HBCL 3JWDL 1I85A 3D85B 4QXTB 5B21A 4JKLA 3BDYH 4MXWH 4QRRB 4MQSB 2MPAH 2VMFA 1TQCC 5HJ3B 4S2SA 3RZCC 5DO2C 2NY4C 3MBEC 5I1JL 1QOKA 3ET9F 4UT6L 3VGBA 1G0XA 1QNZL 1OVZA 4N0FA 4NKDB 3U0PB 2YC1B 3K81A 1I1YA 1A2YB 2GW5A 4OLWL 5HI5C 2XPGB 2VLMD 2EDDA 1T1XA 1MJUL 2N56A 4PJ8A 2JB6B 2EE3A 2IAMB 4XP5L 2HFGH 4XBEH 5EC1B 3KLAA 1I8KA 3DRTB 1I9RH 4HWEL 3UO1L 2BNQB 4OBRA 1CS6A 1G7HB 5LGKA 3VE0B 1WBXA 4XCYA 1RI8A 1FH5L 5F8RC 5FCUH 5L7XL 5F3BB 4JRYA 3RZCB 1ZSDB 1FRGH 3MBEB 2DLEA 1S7TA 3L3GA 5KAQF 4OZIF 4D94A 2NY1C 1G9MH 3TWCL 2D9CA 5HVHC 1UXSB 1NKRA 4IJ3C 4O2CA 5L9DH 3U7YH 4A2LA 4NCC1 1YYLL 1KG0A 1MFDH 4DGYH 3TCLA 1GHFH 2FB4L 3W0WE 4FQHB 2CIKB 2GTWB 5KG9A 4WWKC 3VG0L 1AXIB 5F1SA 3MQIA 2L7UA 5K9JH 4BA8A 2DWDB 4YBLC 3L1OL 2NY1B 4EBQH 1JMXA 2AP2A 4PJ9D 5HVHB 3QWQB 1GGBL 1UH4A 3SQOH 5GGVL 3FQUA 3VI3E 4YXLL 4I9WE 4GAYB 1V7NL 4FQ1H 2EICA 4POYA 4KKBC 5IM7A 3RDTB 5C8JA 3T1FA 2R15A 3UROR 5ISZE 2QADD 4NM8H 4FQQB 5K9KA 5IFHH 2IPUG 4IS6A 3MRGA 4WWKB 1F3JA 5IJKC 1KSRA 4YFLI 1U8HA 3B2UC 4A6YA 4ONHB 5SX5H 2GK0B 1VGEL 4OM0H 4AMKH 2JJTC 3MRRA 3PWNB 4YBLB 5IROA 1M6OA 3VFRA 4LOUD 5IQ9B 1PX4A 4GRWH 1SMAA 2Q8BH 2B1HH 1DBAH 1AGCB 1H3WM 1LDSA 4F7PB 4NZUH 1OSPH 1R5VA 1VEOA 3VH8B 5DTFA 3JV6B 3T09A 2C9AA 3WE6B 1C1EL 1X5YA 5JW4Q 3PJSB 3ARDA 2BVQB 2GTZB 5T3XH 4NT6A 3IXTB 1JE6A 3T3PE 2R0WH 1KB9J 2ZOLB 2PYFA 2QSQA 4PLNC 5ERWA 4UUJA 4ZG1A 4DK3A 4JM2F 3LIZL 5HYJA 1JGDB 2M2DA 5F6HI 4AEFA 5E6IA 3LSOA 4B50A 3QPXH 4LEOA 2MCG1 5DD1H 4MB5A 4LHQB 3LKSB 4JFPB 1U3HA 4NNPH 4HKXA 4GUPB 5BV7L 1ND0B 2X4TB 4OFDA 2VDRH 2H6PB 3FQXA 4JZNA 4PRHB 3MJ9H 4B5EA 4CDGC 1AKJA 1H3TA 4Z78A 3CFIC 5GQBA 1HXYA 1NC4D 1T2JA 2ADIA 2EO1A 3O81A 1YNTA 15C8L 5LXGH 2AGJH 3TN0A 4OFYD 5D1ZB 5I8EA 3Q5OA 4GJTB 1MFEH 4X6CE 1HSBB 1C16B 1JZ3A 3FO2B 3IDNA 3K8LA 4CN4A 5EUOE 2DLIA 4HUVA 4NPYA 1EGJL 3SGEI 4NQCA 5I74C 5JHLL 4D2NA 3SKMA 3MV7B 4ENED 3QXWA 4PG2A 4XAKE 1MQKL 1YNLL 5EULV 3KYKL 2EDXA 3UBXA 3FN0H 5BOZG 4TNWF 2BZDA 3QIBA 4H20L 4UDTB 4UIMA 3EYQD 1MPAH 4JFFD 1NAKL 3QUXA 3O4LB 1KT2B 5FYKL 3KNBA 3TBWB 4DAGH 4I4WB 4JZOB 1AGBA 1XR9B 3ZKXB 1IAOA 3JWOH 3I6LD 1I75A 4JO4H 4JRXE 4OT1L 4YDJA 5E70A 3RVWD 2FECL 2NPLX 4ODUA 3HS0A 4S1QL 5DA0B 1EHLL 5F88B 1MRFL 2VSDA 4N5EC 2AJSL 3H3BC 2WV3A 1BZ7A 3UTSE 4E41D 1RZJL 4MNQA 4XPHL 4JM4H 2AJYH 5K9QG 2P8LA 2BJMH 3MA7B 2F15A 5IVNA 2P24B 4YR6B 3WSQH 3BPOB 2GI7A 1ACYL 1LE5B 3SGEH 4NZJA 3CU7A 1QD0A 4CVWA 3L3IA 4QRPB 2CK0H 4XPGL 3RBSA 1FBIH 1MAJA 5LQBH 4UT9L 5I30L 2FJFB 1UXWA 5EOTA 1D5ZB 3MLTB 2QHLA 4LGPB 2OZ4L 3DURA 3I50L 3QDAA 2AXGB 2W38A 3HI6L 1I1AC 1HHKA 4XVJL 1XIWA 5EZJA 3RHWF 5LAXA 5DUPH 3JUZA 3KR3L 3IJSA 2B2XH 3F7YA 2DD8H 5HHNA 4LCCC 1NCDL 5TE7H 1KCUL 2CXGA 1A6ZB 2YA0A 2R1YB 1FFPA 3BKCL 3G04A 1CK0L 4XXDB 2EDYA 2J4WH 4ELMB 2BVTA 4JN2B 4OSUL 4ONFL 1CE1H 1HILB 5E9DA 3CFKB 4KKCC 4DVRH 4FOMA 4HT1H 4MJ4A 1CTNA 5D2LA 2R0ZH 2K3TA 4FHBD 1KPRB 4IOFD 4WUUA 3TO2A 1CIUA 2D4DA 4KHTL 4ZUTA 3V4PH 1BVKA 3AS1A 3CK0H 4NNXA 5IB2A 3U7AA 4X4YA 4FNLL 4GSDH 4N9GA 5IBUB 4RQQB 1A21A 1TQBC 3TO4B 4ZTPL 1KPUA 4Z0XA 2I07A 4QYOA 3D0VA 1YQVL 4RA0C 4F58H 3EDFA 2OK0L 2OTWA 3BKYL 5JW5A 3LVEA 4P9HC 3CVIL 3NACL 5C0JA 1VKXA 3L3HA 2APWA 1IC4H 3MGTA 1OSZA 4XPTL 1Z6JT 4Q58C 4OCYL 1IFHH 3OAUL 2UZXB 5C0AE 2AJUH 1NBVL 5MEND 5I6XB 1W0VA 1YPZB 4W6YB 2YUXA 2GUOA 3TZVB 3HC0B 1TQBB 2Z31A 5T1LB 3LB6C 4TUKH 4FXLA 3UZQA 2KZWA 2CR3A 3O2VH 4AIXA 4MNGE 4ZUVA 3BD5A 3QG6B 4S1DC 2Q20A 3SGKC 2DQJL 3QNYB 2CGRL 2F54E 3AAZA 3WKMH 2R39A 4JB9H 3BXNB 1CDUA 2VE6A 3P77B 4MJ2A 1ORQB 3ZHKA 3F12B 4M8VA 5HGDB 5EWIH 5ESQA 3DIFB 3QQ3A 4NC2B 3RX7A 4JY5L 4LPYA 2VZTA 5IF0A 4S11A 4AQ1B 3I2CH 5L6YH 1NC2B 1X5ZA 2ZUVA 4W4NA 4AEHL 3EYSL 3T0EE 2H1PH 4NWTL 3MGOB 4LSVH 3P0YH 4S0TD 4JDZB 1U95A 1CGSL 3OX8A 5AZ2H 4YDVB 4BH7B 3KS0H 5KTEL 2AQ2A 3BHBA 4RMWA 4YLQT 2FR4B 3QDME 4JFEE 5JNYA 1BFSA 2B20A 1IT9H 3VXSE 2P5EE 4BFIB 3SJVD 3L3OB 1YEGH 5GRUH 4PJ5A 3X14B 3EW3B 3WFBL 3CLEL 1PG7X 2GSIA 4EI5C 4B41A 4F7CB 3O45A 1U58B 1DFBL 4L29A 4OLUH 4R4BA 4ZUWB 4YFEA 4C4KO 1CU4L 4G7YH 3HB3D 4YHLL 3L7FA 3IETB 1FNGB 5FO7A 4HF5L 1DR9A 1FIGL 2H3NA 3HE6C 3TVMA 1CBVH 2F53B 4PJAB 1LO2H 3D39E 4XVUD 2V2TB 3EYOB 3L5IA 4OLXL 3PWPA 4IRSC 4DKFH 1B0RA 3RVXD 2ZKHL 1UCTA 1P4LB 1ZANL 1I3GH 1FAKT 2ICWB 2VXTL 1I8LA 3ISWA 2QR0B 5DC4B 1UCBH 1FHGA 1M7IA 2X4OB 1NCCL 4QWWD 2DYPB 3QUYB 4UDUB 3HE6B 3KYMA 3L7EA 4OZGF 4X6DB 4XPFL 3V52H 1F8TH 4ZOEA 4JJHA 4YHZH 1MFNA 2BDNL 3R8BB 4FFYL 1A6AA 3PV6A 2JB5H 2EYRB 3SOBL 3BZFA 1UM5L 3TA3A 2CDEA 5IHZB 3QR2A 4HBQA 1T1ZA 1RY7B 2X4RB 4IDLA 3VRIB 3GB7A 4YAQA 4JHAH 1BBDL 1BIIB 3HCVB 3MOAL 4J1UB 4J6RH 1E6JH 2I27N 3WBDA 2C1PB 1BZQK 4XP6L 1F4XL 5B39A 4ZUSB 1S7VB 3GJEA 1MIEL 3MRLA 5HGAA 2XZCH 3GZKA 4C58B 3GSOA 2H8PB 1J1XH 4Z76B 1J7VR 1MCIA 4MQ7B 1WWWX 4MCYA 3UJTH 3EDEA 1QSVA 5I18H 1D9KA 2MOVA 4MQTB 4Y16C 4Z0BL 2BSSA 1S9XB 1Y6KR 2NZ9D 3QPQD 1LVEA 3QYCA 4DTGH 2C1OA 4PRBB 1VGKA 3KPRE 5ADOL 3QQNA 2FX9H 3C5JA 4OZHA 4FQPA 1AD0B 4HXBH 3EYFB 4Q6IC 1JNLL 1LP9B 4HFWB 1ZXQA 2EYSB 4LRIC 1JNHA 1I3RB 1NQBA 4GMSH 5DSCB 1ORSB 5JIKA 5J0BA 4N9OB 2BK8A 3ILPB 4ZTOL 4CL7A 1YMMD 3MYJB 3PGCB 1XGUA 1JF6A 5HDLA 1UH2A 5EA0H 3G08B 4YXHH 3WN5C 3R1GH 1KPVB 3GMPA 4Y4FA 4PB9H 2A73A 4HG4K 4KJPC 5CZXD 2IADB 3I9GH 4Q6IB 2NY3C 1II4E 4XMPH 4TOYL 3RWHB 4NKIL 4HKZB 5ENWA 5KZCD 3N1PC 2VIRA 1TJGL 3KYNA 3MRNA 4Z7NF 1T22A 2WWMC 3WHE0 4EOWH 4X9IA 3O41B 3QXAB 3U7WL 2MCPH 3C09C 3T4YA 2A0LD 1IL1B 3EOAA 4TVSa 4XP9L 5ESAA 3SY0A 1UEMA 1XCTA 4TUJA 2Q76B 1S7UB 2FH8A 3WN5B 4JVUA 1FLRL 4JQIH 4U6YB 5F9JB 4OKVB 5JHDA 1CCZA 1TVDA 4AENA 1MFAL 3W0WB 1U8JA 3L3DB 4G6FD 1N59B 5CEXB 1ZGLM 2FX8L 3W11D 4JQXA 4M6OL 1KBGL 5JXEC 4O2FA 2Z93A 1OQOA 1KV3A 3IDIA 1AI1L 3L5WA 4DW2H 3RTQD 3C09B 1DUYB 5FF6B 3H9HB 4QHUB 3TBTB 3W39B 1YQ2A 1BX2A 3FOLB 4JHWL 1IM3B 5CJBA 2VH5L 2AJ3A 4OCXL 4M8QA 5ISZB 2JCCA 4OV5B 4Y4KC 4RNRA 5KW9H 1JYWA 4ZOCA 5C0GA 3JTTA 2EEAA 4YHMH 4RGMB 4U1SB 3VFWA 4OF5A 3AM8C 3KDMA 3UTSA 3IJYA 1MCLA 1QKZH 4R9HA 4D0DB 5IKCB 2OR8A 4Y5XA 3P0VH 2X1OA 2Y5EA 4N8VB 5KANI 1PZ5B 5TPWH 1Q8MA 2D7TL 1EJOL 1FZOB 3GMOB 1T4KA 3V6FA 5KS9A 4CW1A 5D7JA 5F9WC 4Y4KB 4NRXA 5DQDL 4N0YH 1HQ4A 4XC1H 1BFTA 3PNWA 3IFOB 2F19L 4LARL 4D0BA 1EO5A 4KGLA 3MNWB 3EOTH 1MI5D 5IK3B 4HLZH 3Q1SH 3OB8A 3DX8A 2CDFA 4XNYL 4OD1L 4HWZB 1JPFA 3STLB 5FO8B 3V7AE 4ZXBD 4HIHA 3OXSB 5F9WB 4ZAKC 5HHPA 3RIAF 2IH1A 5C0FB 1MCNA 3LKNB 4PJHB 2DLFH 2IAND 4ODBD 5EO1B 4BH8B 3OTTA 4R96B 1A7BA 4X6CB 3JUYA 1T21A 3MROB 4OCNC 3C6LD 2ORBH 3E2HC 1RZFL 4X6BB 5EUOB 4MAUL 5C7XL 4F37F 4EN3B 1T0NA 2XTJD 5I1CH 2HT4D 1JN6B 1NL0H 5C2BL 4DN4L 5SV4A 3ALXA 3IXAB 3QFDB 2BNRB 1KIPB 1NCBL 3LMJH 3MRFB 5IB1B 1FZKA 4OF7A 2P5WE 2EZ0C 4Y19B 2MHAB 3ILQC 1IGMH 1KXVC 5ALCL 1NBZB 4DGVL 5HHQB 2R9HC 5BVJB 3LKQA 5EU6D 3S37X 5F71A 1BFVL 2A1WH 5KVMC 3G5XB 1NGXB 4QLRA 4O2EB 5B4MC 4Y4HB 2VLRE 3SHSA 1KJ2B 1G7IA 4L3ED 2XZAL 1OPGH 4LP5A 2V7HA 2NNAA 3B9AA 3QQ4B 2AJXL 4D8PB 1F11A 4JG1H 5GRZA 5D93C 5C9JB 5JW4N 3V79C 4GG6B 1TETL 4YGVB 2VLKA 1R0AH 5GS2H 4XNZB 4L5FL 2F74B 3DYMA 1FVDB 1T0MA 1S9WB 2Q3ZA 2DLHA 1EERB 4HCRL 4ZO9A 5E8OB 4MVBC 4YK4C 3NCJH 3A67H 1TVHA 1MCCA 1ZTXL 1HK6A 3DXAE 5J9PB 3ARFD 2XQBL 1FAIL 1SEBB 1FFNB 2DN7A 3T1WA 1EEQA 4R7DA 5GS0H 3G6AB 3FQWA 1YY9C 3SCMD 3ZDZF 3TFKC 4X80L 4CDHA 3O3DB 4G43B 2HRPH 1IGCH 2OL3B 2R1WA 4S1SH 1DDHB 5IVXF 4PTUB 2ZCKL 1PYWB 4HX1B 2R2BA 3I6GB 5F7KC 5GISL 1YNKL 3RIAK 4EDXA 1IKFL 4NKMA 3UTQB 4H8WC 1TTUA 3ARBD 1J12A 4X7EC 2MQ3A 4M7KL 2B8OT 4YH6A 3VDAA 2A6DB 2FJHB 1BD2A 3BSZH 1OP3H 3LV3A 1DN0B 4F37K 1EUTA 2E6JA 3O2WH 3FAXA 4GKSB 4U4BA 4G42B 5FUCE 3G6DL 5I8OL 5TDPB 2VKXA 3RWJB 2AV1A 4PGBB 5EO9A 2VLJE 3CPLA 2WM0A 2AXHA 5HI3D 3WO3B 2ATKA 5JUEL 3G6JF 1KCKA 1MRCH 3MV01 1YDPB 5FA3A 2A83B 2JK5B 1FYTA 4I5BA 4ISVB 4WO4A 5TDNA 4WFGD 4MZ3A 1V3JA 3C9NA 1BAFH 5L2KA 4QHMA 5F9OL 5C0AB 1KACB 3UTTD 3AGVA 5BO1H 4LSUH 2XACC 4M5YH 2B5IB 4MJIA 4R0LA 3SKUD 3UDWA 2C3XA 3VFNB 4RFNB 3TJEL 4DQOL 1NSNH 3MLZL 4Y2DC 1GGCH 5EOCH 5EIQA 5IHUH 3QXDB 4NQDD 3T2NL 5A16A 2V2WB 5C0RH 4OF3A 3QQ9D 5F1OB 2DM2A 2AK4E 3X3GH 1H3PH 4CADB 5J6GB 1RUPH 2ARWA 4LKXB 1CLOH 3MRIB 3H0TA 5MP6L 2QADC 4MQXC 2HLFD 2B0SL 1VFBB 1UACL 3VXOB 2R2EB 1BZ9A 3MLPA 3QUML 4I3RH 4P2QB 2X4NB 1HIMH 3MREB 4Y2DB 5TDOB 4PRPE 1RU9L 1QRKA 1QFHA 1ZHBB 1MCFA 3L6FA 4LOUC 2SEBB 4PBWD 4LPTA 2R1XA 1FNSL 4YXKL 5IMMA 3DJ9A 2NX5E 5HGHA 3RWFA 3IGAA 4LRNL 1W0WB 4JAMA 2YMXL 4OF8A 1I7ZA 4UU9A 4JFEB 3QBTB 4ZFGL 3MJ8A 4Y1AE 5CEZL 4R2GD 2DQCL 3VD9A 5SWSE 1C12A 1MJ8L 3TF7C 1S7XA 2AAVA 3NPSC 3QZWG 1DCLA 1AE6H 2P44B 5J57B 4Z7VB 4E5XA 1UG9A 4F7EB 1NEZB 4OBSA 1P7QB 4XH2A 1KIRB 5GSVA 3QCTH 2VLLB 1E4WL 5E00A 4F2MA 4KVNH 2EDKA 5IIEB 4HGKC 2FSEA 3BVNA 4R97B 1B0GB 1CDYA 1MH5A 1UWEL 5BS0E 1ZLUK 2WANA 1I4FA 3PDOA 2AEPH 1I1RA 2P7TA 4PBXA 3D39B 5E03A 5E8EA 3V5KB 3FJTA 3U46A 1Q94A 4JFYB 3QNXB 1ZLSH 4J3UA 3V8CA 5JQ6H 3A6CH 2ICWI 5F93C 3TESA 3E3QC 3NTCH 4ONGL 3DETD 4NQEE 3KAAA 4LPVA 4QXTA 5E2TH 4KHXL 4O58H 4L4TD 1JPST 4WENB 1JK8B 1C5CL 5FYLL 5D7IF 1QLRB 4ENEC 4LVHB 1ZT4B 4NKDA 1IC7L 4H0GA 3U0PA 5IVOA 4M4PA 2J6EH 1A2YA 4PJ8D 2W0FB 4HUWA 3QIUD 5I0DA 1G0YR 1QSFD 3RY4A 4BUHA 3DSFL 4DK6A 2OR7A 2JB6A 4HEPG 2IAMA 3SE8L 3N50A 3QDJA 3EYQC 3BZEA 3DRTA 2OYPA 3ZZ1A 3Q3GB 2BNQA 1G7HA 4MA1C 4F9LC 3VE0A 3QDGA 3BI9X 2W9DL 5F3BA 2Y36H 4U1GB 5DWUH 3RVWC 1U0QA 5LCVL 3RZCA 1ZSDA 4BQCA 1NDMB 3MBEA 5D1XB 3LN5B 1YMHB 1L7TH 2VISB 1OTUC 1UXSA 3WLWD 3BZ4A 3QEHB 4X4ME 4CNIA 5CIPB 1AGDA 1HSAB 4POZD 1A9BB 2CJUH 3Q6FA 4FQJH 3W9EB 4OZIB 1J1PH 4MA1B 4FQHA 4JKPH 4Z9KB 4PB0L 4LSSL 1X5FA 5C07D 3FRUB 3HN3A 5I73B 4LU5H 2WBJD 4BQ8A 2J5LB 2DWDA 3GGWB 3KPRB 2QSCH 1QFUH 2QQKH 1GXEA 4HKJB 5A43C 1CDJA 2E7MA 1RIVH 4JQVC 5I19H 4MWFA 4G6MH 5FUOH 4GAYA 5DLMH 1ZEAL 1EMTL 2IJ0C 3C8DA 5D7SL 4M03A 1AGFB 3GM0A 2GJ6E 5DK2A 4MAYB 1OGTB 1TFHA 2WLYA 3ZDXE 4WWKA 1JHLL 4WW2F 2FLBT 1A6UH 1JWSB 4QT5B 4ONHA 4UINH 4JVPA 5J1SC 4G6KH 3PWNA 4PP1D 5CJOL 3BAEH 5IQ9A 3MV9E 5JW4R 4F7PA 4X5WB 1JHKH 3VH8A 4WHYG 1O7SA 3JV6A 4J3SA 5DFVD 3FO0L 3GI8L 1AC0A 3KPSB 4PJXE 4TVPD 3PJSA 3CLFL 1MCQA 3KLDA 2BVQA 5GPRA 4IOFC 2GTZA 4YBQC 1ZHLB 3U4EA 5IJKA 3BPNC 4GMTH 1YZZA 3BJ91 3U0TB 1L0QA 3IXTA 5DJ0B 4OLVH 3EO1B 2EDRA 2ZOLA 2JJTA 1A6WH 1RZKL 2OTUB 5E6ID 1JP5A 4K3HA 2YHGA 1BQLH 4JZJC 3EDDA 1ZLVH 3C08H 1O0VA 1OLLA 4XT1C 3LKSA 2CMRL 1MHHA 1LO0H 4GUPA 2HJKB 1U8OB 3VFSB 2X4TA 5EN2B 2H6PA 4V1DD 5D2NE 3UX9B 1A5FL 4L4VE 4PRHA 4JFHD 3TN0D 5IFAH 3ARGD 3BPNB 1AFVH 5T1DL 5DVLA 5ACZA 2D31B 3TNMB 1WUNT 2FRGP 2DB8A 4H1LB 4EUPG 1HSBA 1C16A 1S5IH 1UKTA 3F65A 3Q0HA 4OFPA 1WBZB 2BMKB 4P9MH 1W0YT 4C56E 3VFGH 4UMGA 2HN7B 2P1YA 3MV7A 4QHNB 5E8DH 3VGGA 1YC8A 3EFDL 3GMQA 5D96C 1E27B 5FHBH 5E99L 1CLZL 1P7KA 3T8XB 3WNMA 1PGRB 5FGCE 3E8UH 3RAJH 1S7RB 4UDTA 3O4LA 1KT2A 3TBWA 5FHAL 4I4WA 4JZOA 4UNTA 5JR1L 1XR9A 3HMWH 4FZ8L 4XNQB 4U1HB 5D7LE 5A3IC 4PJGE 3HFML 5TFSH 4DUVA 4Z5RB 4U3CA 1I3UA 1OAQH 1GGYA 1JPSL 3CMOH 5F88A 3V6BR 5D96B 1HH6B 1FJ1B 3CFEB 3CXDL 3IAPA 1PG7L 1I8IB 4OI9A 3Q5TA 3H6JA 5F1IB 1MHCB 4N0CC 4X99A 4OGZA 4LHUD 4X4ZA 3T0AA 4BQ6A 4NJAL 2FX7L 2VDKH 2ZSWB 4H88H 1R24A 4DJMA 4LCWB 1Q0YH 5ESVA 1LE5A 2ZUQC 3IKCB 2WWKO 1CD1A 1CXHA 3KPQB 3HMXH 5CZVL 2D3VA 2VDOL 2R0KL 3MSPA 2HFEB 5DVNA 1KCLA 1ZA3B 1HDMA 4QRPA 1LK3H 1L9NA 4NM4H 3T0BA 3HB3C 4ZFFB 5BZDB 2JF1A 2FJFA 5HYIA 3SJVB 2WP3T 2VDNH 4PY8J 2F8XC 4D0CB 1D5ZA 3MLTA 4QTHA 4XP1L 4DUWA 2YSSA 3VXME 3RVXC 2BCKB 4KUZL 2AXGA 4UQ3A 4U31A 3MLSL 3SDDB 3K2UL 3MRCA 2ZUQB 4KDWA 4R4FH 3BP7B 1XGPA 3BKJH 2ZOKA 4G9FE 4U6TA 3GKWL 4K94C 3ALPA 3VMOA 4P2YA 1A6ZA 4LNRB 3BRFA 1KN4H 2R1YA 2CLZA 5AYQA 4XXDA 3U36B 1WIUA 4JN2A 1GOFA 3DX9B 1HILA 1W72B 2DS4A 2KQNA 4YJZL 1A4JB 1J18A 4I3SL 1D5IL 1I1AA 2X4PB 3MLVH 5F7HA 3NCEB 3MUGB 5I1EL 3NH7H 5I71C 3PP3H 3CXHK 3DRQB 4KAQL 2PTTB 1V8HA 4RQQA 3TO4A 3BO8B 1MIML 1J86A 1MHPL 1OF2B 3X13B 3CFCH 4IIQB 4LCCA 3VWKC 2MSPA 5E6ZA 4KV5E 3DGGB 4ZS6D 5FCSH 4F3FB 2F58L 1S7WB 4TNVF 1SJEB 1I9IL 3BEVB 5IESL 5B39G 3DVNB 4ETYA 4UTAL 5LBSL 1XR8B 3OKYA 2D7PA 4JANB 4A6YL 3Q6GL 3ESVF 3S4SB 2DQHH 4PJFA 1JZ5A 4KK8C 1YPZA 3BYYA 4OCWL 2HKFL 4P23B 4XHJD 4WY7H 5I71B 3HC0A 4GW5B 3VW3L 5T1LA 4RDQG 3BIKB 3VWKB 3QPQC 1CF8L 1FL3B 1KC5L 3S36L 9CGTA 3PGFH 4IHOB 5I1KH 5J12C 3TIDB 1WSST 3QG6A 5GGTH 3STBA 1XGQA 1J8HE 2HA1A 4Z7WF 3BXNA 4TVPL 2I60H 1KJ2H 3WNKA 5C0CE 3P4NB 2E7BA 3F12A 1FP5A 5HGDA 5CWSB 4L3AA 4PR5B 3DIFA 4BZYA 3LHPL 2D03L 1GCFA 3O6MH 4H26B 1MCDA 4GQ9L 1NFDE 3HC3H 1NC2A 5CBAB 1IBGL 4GRLC 3MGOA 1KN2L 1RSFA 3C2SA 3TH4T 4Z18A 3M17B 3SGKA 1FN4B 3FT3B 5DK3A 3NFSH 1CE6B 2ADGB 5D5ME 5M95B 5CZXC 3BN9D 5DD0H 4HFUH 4BFIA 4PJ5D 3UAJD 5CD3B 4YFLF 3L3OA 1UC6A 1WBYB 1YECH 3X14A 2ATPA 5EZOL 1T7ZA 3QFJA 2DBLH 4GXVH 2J6EA 3RL2B 4HJJL 3FFDB 3VDBA 4GRLB 5JMRA 4NN6C 1A7QL 3V4UH 1MY7A 5CAYB 1JYNA 2QHRH 2FWOB 4ZD3H 4ZUWA 3TVMD 4XWGH 2ZG1A 2G5BB 4F33A 3U6RB 1FNGA 2IMMA 2NW3B 2F53A 2R4SH 3DI2B 3PWPD 4PJAA 5GGRY 5IW3A 3QO0A 5DD3H 3W11C 3SDXB 2V2TA 3EYOA 2B39A 4XNXL 4XZUB 4Z7UF 1T20B 2HT3D 5E24E 4EI5A 1N3NB 3RTQC 1P4LA 4NN6B 5L88L 1AD9B 5C0BD 2AK4B