1CICA

Idiotope-anti-idiotope fab-fab complex; d1.3-e225
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
DIVMTQSHKFMSTSVGDRVSITCKASQDVRIAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQHCGSYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of an idiotope-anti-idiotope complex.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords PROTEIN (IG HEAVY CHAIN V REGIONS)
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1999-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cicA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cicA01
1VPOH 1FGNL 3H9HB 5KSBB 3VRJA 5BVPH 1BZ7A 3AS1A 2JIXB 3VWKB 4QRPA 3P11L 4PJHF 4WHDA 5D7JA 4PJCF 4Y8AA 5E70A 3EZ8A 1F58L 3FN3A 5C09E 3UYRH 1Z3GH 3MLUH 5JOPD 4PJGF 2VDPL 4ERSL 2BXYA 1U8PB 3KPRE 3CNKA 2A9NL 1YEDB 5DK2A 4LLVB 4R4ND 5TE4H 3B9DA 2XWTA 4J1UA 2YXMA 4Y2DD 2G2RA 4UDTA 3V6FA 5IVOA 3GJEA 1OSZB 3EHBC 3P11H 3GSVB 1KJMA 1RAMA 1M71A 4Z7NE 1RIUL 5DK3A 1WJ3A 2VL5B 3OJDB 4WU7B 4LCWE 3ARGA 3C2AL 1DUZA 3OKDB 5GGQL 4GMSH 2VB5A 3FT3B 1B4JL 2YPLB 4JKWA 3WV0A 3PIQB 1CDCA 5I8OH 3B4NA 2FB4L 1H15B 3KDMB 4K7PH 4JRYD 1AGCB 3OKMA 1FN4A 1UWEL 2ENYA 4ZUSA 1DE4B 4JHBA 4LSTL 5D96B 2C7UA 1SJVA 4CJ1A 4M8QA 5CBAB 3ULVD 1T22A 1C08A 3PL6C 5DJCB 3K2MC 3NABH 2OXHA 3E6HA 3MRCB 1CIDA 5ANME 3RJQB 4G6ML 1CXFA 1D5IL 1WBXA 4LLYB 3TPKA 2OTPA 4MD5B 4CADB 5IW1B 3V95A 4X6CE 2EO1A 1MLCA 1UH2A 1EO5A 1G9NC 2NY0C 4KUZH 3CU7A 1AXTH 1E4XH 2OJZH 1GAFL 4Z18A 4PJ9B 4DK3A 3QUMB 3DXAA 4KROB 1YNKL 3TBSA 1N8ZB 1T04B 2R2BB 2ICEB 4PB9L 4XMPH 3K2UL 4JDVB 2MQCA 2J1KA 3MNWB 1AR1C 4DKFH 4X4YA 1DQDH 1I1RA 2KPNA 3ECBB 3MJ8A 1YYMH 3O8XB 1M1SA 4ONFH 3GNMH 2XQYG 2PKDA 2PR4H 2XTJC 4S1QL 3OKLB 4AQ1B 1KJ2L 2IAND 2V9QA 2OTUA 1GAFH 4F58L 4HKBB 1FLRH 5FA3A 5I1KL 1TJGL 4MCZB 5IHUH 4ZTOL 3VFMA 4DVBB 3VMNA 3ULUL 3L3IA 1IFHH 1OSPH 1PEWA 4NT6B 4OZHF 3B5TA 2AGJH 4ZXBB 5CP3H 3DX7A 3X3FL 2FEEL 5TDOA 5FUZH 5EZLB 3CSBA 5C09B 1MCJA 1F2XK 2CLZB 4QYOA 3V52L 1MCLA 5MEPA 3P2TA 5TFSH 3HAEG 3AFLA 2EKJA 3BGMB 4ZNEE 1A47A 5FYJU 2MQ3A 2A6DB 4OD2B 3WDJA 2NX5A 2GAZA 4LSPH 2ZNXA 5HVWA 3BP7B 1F90H 2MTPA 1GGTA 1R0AL 3C2AH 5TDOB 4XAKD 3HE7D 3VRIB 2V2WB 4RGOH 2XY1A 4MD4A 2IGFL 4OM0H 1S7UB 1M6OB 3QZWB 5C6TL 1OVZA 3IU3B 1MCBA 1Q0YH 3SDXB 3V8CA 1E6OL 4NHCL 2J88L 4Y5VA 5KS9B 1UXWB 4S1RH 3B6SB 5LGJB 3EJYC 4ODTH 4P5TC 2FGWL 1FORL 1A3RL 3MLVL 3QEHA 4G9FA 3LEXB 3DUHA 5GQBA 4PJEB 1B0GA 4FN0A 1F3RB 3S37H 3N85L 2XI9A 1S3KL 1JF1B 4JN2A 4NHCH 5CP3A 2HFFA 2P1YA 3K80A 4L8DB 1HHHA 5CMAA 4JDZA 5DD5L 3W11C 2V17H 3C87A 4WUUA 4KK6C 4ODTL 5IM7B 5KAQF 1J05B 3P9MB 4R4NC 2NLJB 4JM2C 1E6OH 4I4WB 4H1LA 4JM4L 3EDEA 4HPYL 4QY8A 2PYEA 3OHXA 1CL7L 2W0LA 4NRYA 4JM2D 4CADA 3BGFB 4FRWA 2MKLC 5EFIB 1BIIA 3MV8A 4YHYC 3ARDD 4GAJH 4IRJA 3GMLA 3MA9L 4FFWC 5IOPB 3EOAA 2R1XB 4DN4L 3RY6A 4M1GH 1VACA 2GITA 4EUPH 2GTZB 3DHMA 3OAZK 4NJ9H 1V3MA 4NRXA 4MHHI 1NFIA 2VLKD 5DJ2B 1TDQA 4HCRH 4R0LA 3STZA 4CVZB 1BECA 4R3SA 2AJYH 2UZXB 2VUYA 4M93C 1RK1A 4MWFA 1I3UA 4F2MA 5MEQA 3DV6B 1L6XA 3L3HB 4FQ1L 3FT3A 3PNWA 2C1OB 1P4LA 3LPWA 3H3BC 1P6FA 1AGFA 1I7RA 2W9DH 2VLJE 4JY6A 4WEBH 2F53B 5LXGH 3N1PC 1OF2A 4PJ8C 2AJ3A 4LLDA 1YN6B 3BIKA 3W11D 4XNZC 5EZLA 2GW5A 3QUZB 1HHKB 2Z8SA 1QQDB 3MRHA 4OCRH 2YD3A 5K9JH 4WUKH 3PG2A 4UZGA 3IDNB 4JDVA 3ZZ1A 1J8KA 1YNKH 4IS6B 2WWMD 3RVXD 4K23L 1KCKA 3NCYP 3VFVB 1CG9A 1HXMA 3BEVB 3MFFA 2OR7A 3BO8A 5I66A 5T3ZH 4M48L 5ERWB 4LNRA 2WWMC 3CFBB 3RVXC 4CVXA 5JORB 2ZCKH 3QUZD 4PJDE 2D4FA 5FHAL 4HWUA 2AK1H 4KJPC 3VFNA 1NAMB 3F7QA 3PQYE 3CSYB 4QRSA 5F97E 3KYNB 1G0XA 4XT1C 4L4TD 1G7MA 2RB8A 3BKJH 3EYSL 4OUUA 1LNUB 4WV1C 5ICXA 1BWWA 4XPTH 3WO4C 1DUYA 1FG9C 5DJ0B 1QLRA 5K93A 5IBTL 3VFOA 3VE0A 5EUOB 3BP5B 3KJ6H 1AO7D 3CVHL 5I1CH 1S7XA 1U8JB 1AHWC 5F6IC 2VLJD 1OTTD 4D8PA 3D18A 3UAJD 4CW1A 2CXKA 4HGMA 5EIQA 5HHXH 2FJHA 4Y7MA 5E5UB 5EH1A 3ZE1E 4U1HA 3FO2A 1WZKA 3KAAA 5IK3B 2ADJA 1AE6H 4HIJB 2O5ZL 2R4RH 1AGBB 3S36X 2XA8H 5E4EC 2V17L 1FFOB 1RSFA 3KR3H 1EAPB 2DBLH 4ERSH 1A22B 4K7FA 3O2VL 1CFQB 1YQ2A 1XF4B 4WGWB 2V5SA 4R96A 1DN0A 2L0DA 5KAQG 3DLQR 3H7BB 2ZSWB 4LAQL 5DRZA 3O3DA 2VR4A 2VZ3A 4KUCD 4GMTH 4OF3A 5J3HD 1FVDB 5BZDB 1FH5L 4IDJL 1P84J 2YA2A 2CIKB 2VN7A 1H5BC 5DMIH 3AREC 3O8XC 2ZOKA 1S5IH 5I6XC 4HAFA 1VESA 1TLKA 1GGIL 3S8WA 1FVCA 2GJ6D 4FQ2L 4HGKC 4JDTH 4LIQL 4BQ6A 1JFQH 4JM2F 4Y1AD 2R29L 5T3XD 3N9GL 4BFBD 4JFFE 1CF8L 1V05A 2ZCLL 3DNKA 1N6VA 1EEYA 1LVEA 3Q1SH 2JCCB 5D1XC 1MVUB 1DQLL 4JFED 3WXVH 3STLA 4IRSA 4L3EB 5FYKL 4Y16C 1Q9LA 5I19L 3RAJH 3MRIB 2EDJA 1MREH 3HPJA 4BK4A 3QXDA 4H20L 4J3WA 4G5ZL 1Q0XL 5JORA 4JREB 4N0UE 1ZKAA 4RMRA 1DZBA 1KIUA 4NQCA 5DJ2A 1S78C 2VLJA 4CN6A 4MMXC 1HCFX 3VMPA 4WO4A 1IZJA 4LU5L 2D0GA 3I6GA 2ESVD 5DRXA 2GFBB 3QXAA 1FRGL 3GSNL 1XH3A 2V5MA 2DQGH 1SY6A 1JZ6A 4O02L 2HT2D 4LLWA 5EC1A 1DLFH 5DQ9B 3MLSH 2C1PB 2DI9A 2P8LA 3HAEH 3ES6B 3VFWA 5JXEC 1Q1JL 3ZHLA 5I17A 4PJHE 5BXFA 1Z2KA 1KCUH 3AROA 1KXVC 3T2OA 3QI9B 5CFHA 1CFVL 2DIAA 2DQUL 2VLMD 4HIXH 3IF1A 1W0VB 5HVHC 3DHJA 4H5SA 3INUL 4IM8A 4HWNA 5A43C 1AC0A 2X4UA 4OI8A 1NGPH 4GLRH 2K7PA 5DGRA 1U8QA 1KNOA 5MENB 2VXSH 5SX4I 4X80H 2FLBT 5C2UB 1CDGA 2Y4SA 3OKYA 5GGVY 4ZO9A 4UDTB 3IFOB 3BXNA 1GIGL 3PHOA 4GMSL 4JPKH 2ESVE 3FFDA 3ZTNH 3V6ZB 4W4OC 4NYLB 4F37K 5DQDH 3ZSTA 1KG0B 2XRAH 3RWHA 1EUUA 4WHTA 4RAVA 3K0WA 3OAUH 2QR0A 5FO7B 4K8RH 1T66D 4H88L 1SEQH 1NL0L 1F6AA 1I3GL 3BPOB 4DOHE 4P2OA 5LG1A 1G9ML 4Z7UE 3FQRA 1FG2A 2DS4A 1T6WA 1RFDH 1FYTE 2AK4B 4NKOB 4KK9D 3X14B 1A6WL 3RDTB 2F54E 1FYTA 4FZEL 3QG7L 4G9FB 5L6YH 4U1SB 2DOCA 3RWHB 3LSOA 4WGVB 1I3VA 2GTZA 3QNZB 1OM3L 2MOVA 4D0DA 1HHGA 2FGZA 3LS5H 2I27N 1JYVA 4XC1H 2DKSA 4U1HB 5DYOB 1K4DA 4FTVA 1F3DJ 4EBQH 2AABL 2CQVA 1BBJB 1WBZA 4PV9B 5D4QA 1ZVHA 4YC2B 5HVHB 3QXUA 1KCVH 4TUJA 4Y4KA 3PGFH 1A6WH 4P2QD 2NTFB 4YPGA 4R26H 5EU6E 5EUKA 2B2XL 5ADOH 2QADD 2HVKB 2JIXD 1QZ1A 3DPBA 4KJPD 4PJXA 1T04A 1I7RB 2R2BA 4W6YB 2QHRH 3V0VB 5EPMA 1D5XB 4FZ8H 1A3RH 3O2WH 1KTLA 4OLYL 5FIEA 5GGSY 1G7PA 1XGRA 4P5KB 1AE6L 2X4PB 5F89B 2O93L 1BD2A 3BI9X 4PYGA 3EFFB 4YHYB 4D9LL 5BS0D 5MERA 4E0RA 1FYTD 3V4VH 1S7QB 5DHYB 3V6OC 4OM0L 2DD8H 3ARWA 5DQ9A 2APVA 3GJFA 4QXGH 3LH2H 4NQVB 1T2QL 3BEVA 3MFFB 2E6JA 3QIWD 4KTEH 4I0PC 1OB1B 4XRCA 4HXAH 1UM6H 3CXDL 4RFOH 5INCB 3F6LA 3MRIA 3MV11 4QNPE 4TNVK 4JPIA 2YD1A 2GQHA 4ODHH 5JOFB 4FABH 3B9EA 4HWBH 3NIDE 4IMLB 2F53A 4N5EC 2VITA 3WNOA 1JZ2A 4MNQA 1Z0NA 1QFOA 1QSVA 3G5YA 1CICB 1MCSA 4I18A 3QIUC 1IM3B 4U7SA 3F58L 1MFEL 3K4AA 3PV6B 5BOZG 1BJ1J 4OZHA 4JG0L 3NFNA 4JB9L 4I48A 2R69H 4LPCA 3WSQH 2Z4QB 3CX2A 2HT4D 2BVTA 1JYWA 5BRZE 2GFBA 4FQJH 3SDXF 2D9CA 4LIQE 3I75B 5EDXA 1QFUH 3JZ7A 4PV8A 1A9BB 3HE6B 4O58H 4B50A 3NH7L 4BQBA 4H25A 3DRQB 3UO1H 3TJHC 3CMGA 1ZT4A 2EIEA 4DEPB 4P4KD 4D9LH 4WWID 1G0DA 4DKDC 4ZOAA 1S9VA 4WU7A 3PDDA 3MV8D 4HKZA 1KJMB 4MVBC 1SJXA 1IM9B 2IANB 3L3KB 3T0AA 2AV1B 5BOPA 1C5DA 3DXAD 3WNLA 5J11C 4GQ9L 3ZT5A 1YEFL 1LE5A 4KUCF 1YEDA 5SX4H 1IC7H 5IW6A 4AY0A 4F7TB 3DTXB 5FO9B 1U8LB 3RKPA 1JHKL 1FH5H 4IOIB 1BQSA 1LO4H 4ZPVA 3BZDA 5EORH 5JHDB 5F96L 1ZSDA 3LS5L 3RU8L 3VXQB 1QOKA 1UVQB 4HIHA 1EJOL 1XGQA 5E9DD 1SVCP 5DO2D 8FABA 2E3VA 3P4OB 4JRXB 3P0GB 1DBAH 2PXYD 1JGLL 3C8HA 1WV7T 1YEIH 1Q9KA 2DQTH 4JO2L 1INQB 4NJAH 3VFUB 3BPLB 4TNWF 4U6XB 1D6EB 2ZUQB 2UWEA 3L5XL 2BNQB 2VLKE 4PJDA 5J1AB 4U6VL 2OSLA 3HMWL 3MV9A 3BUYA 2LQRA 5F7YC 3MV8E 2CDGA 4X6CF 4HUKB 5E0QA 3ARSA 2H2SD 1G7JB 3IJYB 4P2RD 1JNLH 4KZEH 1UB6B 3EO0A 4RMUA 1MF2L 4K8RL 3RL1A 2K7QA 3M1BB 4ORGB 3DX6B 3IXTA 1RUPL 5IKCB 5B39G 3S88H 1AGEB 1CICA 4U2YA 2X1QA 5D9SA 5HGGS 1MJUL 4OZFG 3ARRA 2D7QA 4JKLA 4LCUA 4PRDB 2EDRA 4ODSL 5I1AA 2QEJA 3X17A 1FC1A 2ZUSA 4HXBL 4NZUH 5DRWB 3U1SH 4PRNB 3QPQD 4G43A 1UJTA 1LO0H 1GZPB 3EW3B 4OZIA 4MWFB 1K8DB 3KVQA 3GMMA 5D9SB 4GW4B 1FE8L 5I18H 5C0RL 5GIRB 3QEUA 5FCUL 4UIKH 4JREC 4LVNB 2YRZA 1E28A 2B20A 1R3HA 2ZSVB 4ELMB 1OPGL 2ERJC 4YBHA 3E1F1 4IIQB 1EH9A 3FQUA 5E2VL 4GRMA 2PR4L 3E3QE 1WFOA 3HI1B 3T1FB 5GGSA 1YQVL 4PLJD 4L4TA 2XG5A 5HYJE 1ONQB 3D3VE 5JDJA 5KSVB 2HKHH 3B9KA 4NUGH 1YJDH 5HDBF 4FFZL 5GIRA 2YN3A 4WI3A 4FABL 2YD7A 4ZD3H 2DQIH 4LPVA 2NR6C 4WUKL 2QTEA 3EJZD 1NFDF 1MJJA 5DA0B 2GCYA 2FX8L 1OW0A 5HDQL 4RFEB 3HZYB 3FOLB 1A5FH 2FIKA 3L3DB 4YHZH 2P5EB 2WQ8A 5IGXH 4YAQB 3KHQA 1JWMA 2QKIB 3DTXA 2NXZC 5TJWK 3HNTL 3PHOB 5GHWL 1OSZA 3MV9D 4XHJD 2J2ZA 5IW3A 3EOTH 3FOMB 3RX7A 2N56A 4PJHB 3H3PL 4WFFE 2D3VA 5E8EB 3UYPA 4AENB 1U8OA 5D7KD 4HH9A 5ADOL 5C9KA 2NTFA 4EXPX 2DWDB 2YD6A 5C2BL 1KIPA 3CVHA 2YS4A 1BVLA 5IV2A 2EDDA 1KLFA 5D7IE 4BH7B 1XCQB 4GW1B 1MWAH 5E8PA 1MRFH 4YHOH 4DOHB 3GI8L 3EBAA 4MQSB 3SJVB 5BCAA 3RFZC 2JTDA 5CAYB 2NYYC 5B3JE 5IB3A 1IGYA 2OZ4A 3UBXG 4ESKA 1FFNA 3CUPA 4XPBL 2F8XC 1VFOA 3UROR 4R4FH 1QFPA 2R15A 1AO7A 3MV9E 2FJGA 3KJ4C 1WT5C 3AS2A 3SJVA 4ALAL 3QCTH 2C3WA 2Z8WC 2JELL 4Y4FA 1JGEA 3EYUL 5ETUA 4XPAL 4L5FH 3ZL4H 4MNQB 5SV4A 1I1AD 1DVFB 4FQLL 3P9LB 5JMOC 4DKAA 1M7IA 2NY6B 3DX6A 3UO1L 2F5AL 3W82A 4LSSL 5CJOH 4YBQC 1BOGB 4J3OC 4EDXB 3D39E 5IF0A 1IZKA 4BZ1L 3GRWH 2R0LL 5IBTH 2OK0H 4WI7A 3BDXA 4XZUA 1JP5A 3WMSA 3H9SE 4FA8A 4PJAE 5C08E 4YHLH 2K9UA 1WTLA 1XH3B 4R2GB 4LVNC 3WLBB 4JGMA 2HFGL 2VZTA 2YBRA 5GSRB 5E7FA 2BOCA 4FQQB 1U8HB 1ED3B 2HVJB 2Q87A 2DRUA 4N0FB 5D2NC 4BA8A 3VXOB 3QH3B 1DP0A 4X4XA 4FNLL 1NCNA 1ULVA 2Z93A 1T3FB 1TJGH 1F3DH 2FECL 2NCMA 1J86A 5T3ZL 3F7VA 4J4PA 3BH9A 3HTLX 1D5ZB 1T7VA 5DTFB 5M7QA 1CGUA 1BD2D 1MJ8H 1I1YB 2R39A 1NLBH 4RWYL 1EXUB 5D70H 4X6EB 5KSVA 4MD0B 4YX2H 3O6ML 5CD5D 2NXYD 4YWGH 2HTKD 1ACYH 2VLKA 2AJUL 3LD8B 3BJLA 1DBJL 3U0PA 4BFEA 3SKNB 4BQ9A 1NCWL 2VN4A 1NANH 4ZFZB 3W0WB 3QDJA 4I2XA 2R56H 4LGSB 3TO4C 1HSAA 4LARH 4LRNH 2AERT 5SWQA 1HZHH 3WXVL 3ZDZF 1TNMA 2A6KA 4LCCC 2NY1D 3EYFB 3LV3A 5JIHA 1CE6B 1P84K 4MQ7A 5I1IL 3RUGE 4M6OL 3KWWB 2W9EL 5CSZA 1JCKA 2IADB 3MRNB 2JIXA 3BGFC 4PJ5E 1YY8A 2NY1C 5FHBL 5EBLB 3EYOA 1YY9D 1CDIA 2BVOA 4PJAA 5C08A 2OL3H 1AFVL 4KVNH 3LRSB 4RZCB 2K3TA 5EIIB 4KK5D 4WUUD 4P2RA 1A6VH 2UWEB 4UAOB 4HDIB 5J1TC 1I85C 3ARGC 3FFCA 3P4MA 4K7PL 1GSMA 1A1NB 4Y89A 4K8RC 3L6FA 3QAZB 3RDTC 4JM4H 1MF2H 3DO3A 1YMME 4LRIC 3FCTA 5EU7C 4Z7QF 1N64L 1NDGB 1ETZB 1U8NB 4OFVA 2R8SH 2VUOA 3QG7H 4FZEH 4KDTC 4ZMAT 3L5WB 4QHMB 4XAKE 2V6HA 2V2XB 5IESL 4PJXF 4KC3B 3HPJB 3KNBA 4K2UH 5D1ZA 2VDPH 3U0WL 2GUOA 4EN3A 1BOGA 3CGTA 1ZTXL 4NQCE 4LDEB 2DTML 4PRNA 1N4XL 3LN9A 3V7MA 4F80A 5BMFL 3HI6H 4IOFC 4NN5B 5HHNB 3SDDD 3VFSA 2FGWH 4MQTB 3MLZL 1AD9B 3CVIH 1H3TA 2BMKB 3EO9H 4LVOB 5BS0E 3BP6B 1I8MA 4HFWA 2FH8A 1G6RL 4EI6B 3HRPA 3TH3T 4YGVB 1CLCA 4UMGA 4I3SL 1BVKB 3I3DA 1FC2D 5FA4A 3RZCA 3TESA 2E7BA 2NYYD 1MWAL 2ADGA 1VB9A 5TE6L 3ESVF 2VL5A 4XPFH 2IAMA 1N59B 1S9WA 7FABH 4PBVC 5DWUL 4XP9L 3U9PL 3G6AB 1XAUA 2NXZD 4G6FB 1I1AC 5J89A 1KUMA 4TN9A 3IFNH 4CDHA 1AFVH 1SBSH 5DMKA 1YMMD 3ARUA 3N1MC 4QO1A 5JHDE 4AEIH 3FQWB 3WUZA 3SKJL 1RVFH 2X1WL 1KCSL 5IR1A 5C71A 4NIKB 4JAMB 4WV1A 3Q6GL 4GG8A 3G5YB 4HV8B 1IEAA 2EEDA 1C1EL 2DLTA 5FHAH 3BPCA 1QG3A 3RUGF 3O9WC 4QRTB 4XBPA 5KSAA 3UTOA 2XKNB 2APFA 3G9VA 1OL0A 5IMLA 4PGBA 3VXUE 1FSKB 3VFVA 3BJ91 4YX2L 5E6ID 1W72L 2NY2C 3ALPA 1T80A 3ES6A 1NCUA 1Y18A 5EWIL 3CPLB 5JPNA 5K9JL 1MCPL 5LGHH 2XPGA 1MJ8L 2Q6WA 3GI9H 1J5OL 4KROD 5DJAA 4NWTL 5HVGB 1RULL 3ARFB 4NO3A 2YPVH 3TYGH 2IFGA 3VG0H 1T5WA 3RUGB 3AUVA 2Y1VA 2X4OA 1PZUB 4HS8L 4GAYB 4N0CC 3ZDYE 2VERN 1ZLWH 2ESVB 5FYLH 5SWZA 4NP4L 5IEHB 1J0YA 1QLRB 3ULUC 4LFHG 5F1IA 3QFDA 5B4MC 4G6MH 2FIKB 1T7YA 2OX5A 3L3DA 5DJZB 1UXSA 2NY4C 5D2NE 4FNLH 4MD4B 3U79A 4BH7A 3VWJD 5JHLL 2MHAB 4XP1L 3QIBA 1RUAH 2CLRB 3F5WB 4G7YH 2X9YA 2Z8RA 3MJ7B 2RFXA 4NOFA 1OCWL 3RKDC 3QI9D 5B39A 1UA6H 4NQTA 5K59E 5IOPA 2V2XA 1OAZH 5L2KE 4EQ3A 1EVTC 1SHMA 5CWSA 1K5NA 2BSTA 4XVSH 2E7LA 4LSUH 3LKNB 4U05A 5ITFB 3GM0A 4TSAH 1H9VA 3FKUS 1AO7B 3MBEB 4MSWA 1ND0B 4X7CC 3EFFA 3LKSB 4X7TB 5A2IH 1LEIB 5CSGA 1EFXB 2JELH 3BWUC 5DJDA 3RVVD 4HS6A 4XPBH 4N1EA 3RDTD 4QRUB 1H3WM 1Q8MA 2EYTA 1NAKH 2FECI 3MLWH 1F58H 4NC1C 2L7UA 3D9AH 2AJ3B 1XGPA 1FZJB 3VXSA 1JYXA 4ETQA 6CGTA 2YZ1A 4JM2B 2YA0A 3L95A 5F21B 4G8GA 4RGND 2D7OA 2DMCA 3DV4A 5TPWH 4JY5H 1J05A 5HYFA 3DV6A 3LN4A 1EPFA 3MZGB 5F89A 4HWEH 5L9DH 3SGKC 2UYLA 4RMTA 3UJTL 1BVKA 4KTDL 4LL9A 5H37H 1J1XH 2EDKA 5D2LB 3WFBL 4OSUL 1AGDB 3H3PH 3ZT6A 1T83C 5I15H 1RUML 4CJ0A 3KPPB 4A6YL 4WU5B 2Y72A 2ZCHH 4BELD 1VFBB 4M62L 4BSWA 1VCAA 2F5BH 4GAGH 2P24B 4JZJC 2ID5A 2FLRT 1JNNH 2OL3A 4XNMB 1RUQL 4NKMB 3O6FD 3LN5B 1ZVSA 5BVJA 3VXME 3TVMB 3FONB 4DZBA 2ORBH 4LCCA 5HYQA 4A6YA 2VQTA 1BVZA 4N1CA 3UDWC 1RZ7H 4BFGA 4NKIL 3TIEA 1RURH 4M6NH 4P48A 2A73A 5FKAB 3SDCA 5E08L 4YFEA 3ARYA 3O0RH 2XWJB 1GRWA 3IF1B 1MHCB 2QHLA 4NFDA 5DMJB 5F9OH 2RFXB 2VO5A 2Z31B 2ED9A 5KSUB 1UWXH 3MJ9A 4N8PA 4PJAB 4X5XA 5C08B 1TFHA 5IG7B 5JIIA 4PJ9D 5D71L 5KJRH 2NNAA 5IROA 1F4WL 4HUXB 2EDYA 1NC2D 3DMMC 4GRLC 1OD7A 4H25B 4NP4H 2LVCA 5JLZB 2PYED 5C3LD 2QSCL 2VDRH 2CRZA 4LHUD 1II4E 4MA3B 1X5JA 4O5LH 4EKXA 3TBWB 3L3JA 1S9XA 5JO5B 2CSPA 3G6JE 3WO4B 2X4TA 3PWNA 1NBZB 2JCCE 4ODUB 3EJZC 4HS6B 4K71B 3B6SA 5LGJA 1LO3L 3NTCL 3JWOH 2YR3A 7FABL 4XVJH 1MQKH 5IFAL 43CAA 2VLME 1EHNA 5DEFA 1CL7H 2IANE 2F74A 4JFQB 1PBYA 2ZSWA 5DRZB 3B2VH 5JA8B 3QG6B 4RBPK 4CVWA 2FD6L 1EEYB 4PJ8D 1XR8A 4LSVL 4EIZC 1QSEE 1I8MB 2A2QT 4U7MA 1KCSH 3OKEB 5DD5H 3HMWH 3MRMA 4I4WA 25C8H 1FQ9C 1YEEL 1OTSD 5F9JA 3KPMA 4O4YL 4UB0L 2WWKO 3BD3A 2L7JA 1U8PA 2DQTL 4WHYG 5IMOB 1IM9D 4JVUA 1DTUA 5HHOA 3O9WB 4WWKB 4MA8H 2P47B 3HUJF 5GS2H 1N26A 3TIDA 4Z8FL 3UPRA 4HBQA 2VZ1A 1UB6A 3BUTA 4TUKL 2W60A 1UGNA 4NNXB 3LMJL 1MVUA 3FTGA 2F54D 2W38A 4MAYA 4PLKD 4YQXH 1VDGA 3O9WA 1Z5LB 3CSGA 5C0EB 4UIMA 1F11B 2IMMA 4PG2C 2LTQC 4XB8A 2OZ4L 1IAIM 3N85H 4M43L 1OTTC 4NQXB 1WCBB 4XNQB 5HY9B 5L0QC 5T3ZE 3ULVL 3RPIB 1FL6A 1ONQA 4M7LL 2XZAL 3GSWB 4CRPA 3T3PE 4MJIA 4QCIA 2A6JA 2J88H 5I0DA 3GBLA 1ZA6A 5LWYL 5D1XD 3HAEA 1K3IA 3V4PH 4HIIB 1S7VB 5KW9H 3PJSA 3QEUB 4UINL 3WIIH 2X89A 4X80L 1R0AH 3OPZH 4XZUB 4N0YL 2I60H 2X4NB 1MRCH 1TZHA 1KCRL 2Q7YB 4ELME 4YEEA 2NY0B 4LLQA 3N06B 4OLUH 1S9XB 5D8JH 1B6DA 4BSWB 1EAPA 3QIBB 3ZKXB 1YECH 3HG1D 3RX8A 2F9BT 3EGSA 3WJLA 2C26A 4D9QE 5E4IA 1QVOA 4FTVE 1I4FB 2R69L 3HC0A 3WFZA 1C5BH 5DHVA 1RZJL 3LQAH 5I74C 2ATKA 4JLRA 3RVVC 1IC4H 3IDMB 4DAGH 5IG7A 1JI2A 4JO3L 4QHLB 4XP4H 4X4ME 4MA1C 5C8JA 5T1KD 2FH6A 3SE9L 5FYKU 2YPVL 4J3UA 3NCCB 3TYGL 5A2KH 3MRKB 4PJXE 3VW3H 2YWYA 5ICYB 5GJTL 5JIPA 4YXKH 3TCXA 4Q2ZB 3HRZA 3T0WA 3T4YB 4RA0C 3G04B 4L3AA 1A2YB 1BFVH 2A0LD 3C5ZD 4RFNB 4B41A 2ADIA 4EI5A 1B4JH 2YPKA 1CDBA 4PJGA 4X8JA 5GGTA 1S8DA 4L5FL 3P4MB 3BVNA 4RAUA 1MLBB 2BCKB 1JK8B 1X5HA 1RU9H 3O4LB 4AYFA 1K5NB 3G04A 5FYJL 4OZ4B 3EHBD 1MFDL 5DD1H 4AL8L 2VH5H 5DMYA 5FO9A 3ARGB 2AAVA 1KXTB 2F5BL 4JZJA 4W70A 1QPPA 4JDTL 4MDJB 4K7PX 1BJ1H 2W65A 4IMKC 5E56A 3C5JB 1YN7A 1WZMA 3T0XA 3G5ZB 2AJVL 2EYRB 3WFEL 5ID1B 4X6DF 1T83A 5L2JA 4AEFA 1A6ZB 2IH3A 1DBAL 5DQJB 4K3DL 4U1SA 3IETB 5E5MB 4JR9L 3B2UD 1G7HA 3MMEB 2FJGB 4JY4A 1CTOA 4TUKH 3F7YB 1F4YH 2ERJB 2F19L 4P3DB 5IWLA 4XP6H 2VE6A 1UYWL 4UV7L 1S5HA 5ID1A 4PGEA 1CCZA 3ARBD 3DROB 1A4KA 2BFVL 5HHMD 3MNVB 2VDMH 1NL0H 5D7SL 1FNSL 2P5WD 4UB0H 4M9PA 4YDVB 1YEJH 1TQBB 4P46C 1A6UH 5H94B 2KZ1B 3RNKB 5H35A 1MFBL 1QD0A 4R7NB 1XIWD 1CGVA 3LS4L 4OF7A 4PJIE 1HEZB 4TSAL 5GS0C 2EC9U 4Y5XC 3G9AB 3DIFA 4FXGB 4D3CL 4P59H 2Q8AH 4WI2A 1KENH 3IDGB 1F11A 4KAQH 5IMLB 3KLSA 5DMKB 3EO1B 2F8VA 2NX5B 4JG1L 3QIWB 5I71C 5ADPL 3IAGC 4QTIH 3NPSB 5IBLD 1CFVH 3PHSA 2DQUH 4WI4A 2XZCL 5GS0H 1UM5H 3GMOA 1FV1B 1JGVH 1WZ1H 4N5UA 5HI4C 4B7LA 1A4JB 4QTHA 1RUAL 1NFDB 2AGJL 1TITA 4HIXL 2HWZH 1MCRA 2BHUA 5HHME 5D7JB 3D18B 5EOQH 1RHHB 4B53A 2WW8A 4NKDA 5F1OB 1DBJH 4OLZL 5EBMB 3C5SA 3WBDA 4NGHH 2W91A 3C8DA 4YDIL 5HI5D 5KBNC 3AB0C 1UM5L 1U3YA 2EE2A 1OAUH 1RK0A 5F71A 4A2MA 3ILQC 1MCPH 1VFAB 3VG9B 4KROC 3UDWA 4JRXE 3KYOA 4PUBH 3KPSD 2H9GA 4NWTH 1CFQA 3OGCB 5L2KD 4PP1C 3TM6A 3VFGH 5CJBA 3IJHA 4YHPA 3D3VD 1RZGA 5FYKH 2DJSA 4G5ZH 4EN3B 3HE6D 1CR9L 4Z7WE 1LQSR 4TPRH 1P7KA 2MMXA 3Q6GH 4MB3A 3T08A 2QQLH 1DN2A 4IOIA 4ONGH 4ZPVB 1QNZH 2A9ML 4PFEA 1ZHKB 3OXRB 1HHGB 3VWJC 1OAXH 1UKSA 3O3BA 2FATL 4Q6IC 5TDNA 4YHML 1WF5A 1A14L 3VXMA 3WHE1 2IH1A 4PRHB 2NY1B 2B4CH 4P23C 5CJXA 1ZHNA 4UIMB 1D6EA 3VFRB 2WIIB 4XXCC 3T04D 4LHQB 1KB9J 2C3VA 3W81A 3V7AG 4LP4A 4NZDA 4HHAA 1RHFA 5D2LE 3O3DB 4RGNE 3BKMH 1FVEB 2LAAA 2CLVB 3K8LA 1A6ZA 4PJFE 1RZKC 1WK0A 2M2DA 4NN6C 4U1KA 4N0FA 2YC1B 3ZKXC 5IJVA 3IDXL 3PJSB 1KTDB 3MLRL 2WZPD 5GZOC 3OAYH 2EYSA 3MLYH 3HMXA 2J7LA 1ZS8A 3QFJD 3RJDA 1QKZL 2BNQD 5F9WB 2HN7B 4AEHL 2LU4A 5ICZA 5B8CA 5TF0A 3MRFB 5DQDL 4XXDA 1VPOL 3D87B 4UI2A 5T1LA 3PHQB 4JFYA 4X5LA 1UJ3A 2Y5TA 5JXAL 1BLNA 5MHSE 3SO3B 1XGTB 4Q6IB 5ABDE 1KF9B 3BO8B 2X44D 4QHNB 3WLWC 2DIJA 3HR5B 5I66B 1ZS8B 4KI1A 4GRWE 2IPTH 2IQ9H 1IKFL 4YHNB 1LO3H 4HAGA 4X0KB 4DK6A 2WWKT 1RZ8A 3MJ7A 3ZKSD 1EVUA 1EMTH 4U49A 1CGTA 5D7IA 2R0ZH 2BRRH 2JJWA 1J11A 3MREA 3WL9B 2VDRL 4ZFOB 3CSPA 1QNZL 2ATPB 3H7LA 1UKQA 4AIZB 4I0KA 1O0VA 3EGSB 2NNAB 4OGYH 1NGQH 4TNWK 4N0UB 1XEDA 4K9EH 2CKNA 4XX1G 4R7DA 4JLRB 4W6XB 1HQRA 1KJ2H 1NGWB 3MV7D 1QEWB 4GKNA 5CIPA 5I1EL 3DMMB 5EZJB 5SWSE 4KFZC 4P5TB 3K2UH 4KV5F 1EFXA 3STZB 1G7QA 2VZVA 4LKXA 2XQYK 3OKOB 3SCMB 5EOCJ 3VDBA 2VDLH 3GSRB 1G9NL 5C7XL 3S5LG 5K9QG 1P9MA 4PJFF 4F7EA 1T1YB 1C16B 3HNSH 3MV9B 4OZGA 3X3GL 2HKFH 1BQLL 1FL3B 4H1LG 4FQIL 3HUJB 1OY3B 1UEYA 5IV2B 1JNNL 4MSWB 4S10A 1H5BA 4O51A 3OKOA 4NCC1 3SCMA 5DHVH 3P9MA 1TVHB 1XGQB 5A2FA 3FMGL 2AEWA 4PP1D 4WFGE 3ZE2E 43CAB 5DRNB 1WWCA 4QWWD 4PJXB 3L9RA 5HY9A 3U48A 4D9RE 3OAZH 5IWLC 2APTA 2BNRD 2EH7H 1KYOJ 2XYCA 1CLOH 2X4PA 4XMKH 5FYKE 2LABA 3MACH 4FTVB 5FGSA 3L95B 2CJUH 5CZXC 1ZTXH 3KLHC 1UJ3B 3BKCH 3QDGE 2XZAH 1KPVA 1LILA 4OCYH 4GKZB 4NQUA 4ISVB 3TVMA 4MNGE 3DXAE 4XCYA 3MUY1 3GHBL 1IGYB 4NZTH 4RCAA 5HI5C 1IRAY 3OGOE 3U4BL 1RV6X 4MNQD 4ZOBA 4WW1B 3SDAA 3V4UL 3MLRH 3CDGA 4XP6L 1QFWH 3WXWH 5BXFB 4L9LC 2PYFB 3OAYK 4NWUL 2GTWA 3SGDH 5C09A 2CDFA 2VQUA 4RGOL 1YNTB 1J10A 3RU8H 4I18B 4RQQA 1D9KA 12E8H 1NMCC 3MO1A 4V2BA 1XF2B 5FGCB 4XCFH 3BGMA 1K4CA 1UZ6F 3BH8B 4ODVL 2X4RA 3NACL 2XTJD 4UT9H 2XTLA 2HLAA 4KHXL 2OL3B 3ULSA 2OQJA 1LO5B 3O4LE 3QJHA 4YR6B 4ONHB 1HWHB 5EU5B 5DD6B 4JKPH 1FZOA 5C6PB 4RIRB 5BS0A 3P3YA 3WS6C 3UTSD 2HJFA 4K94L 2X4UB 3QO0B 3QUXA 3V52H 2FRGP 2A77H 4ZYKA 1TXKA 3FFDB 4PTUB 3VWKA 1T03H 2P5WA 2IBBA 3BQUA 4YIQB 3PHQA 1QVOB 4R2GD 1U0QA 4HKJB 1I8IB 4NM8H 4G6JH 4GXVL 3TA3C 2P5EA 3W0WA 1IGCH 3PE9A 3D69B 2DI8A 1DQDL 1FZMB 3TA3D 3QUXB 3AMKA 4M7JL 1Y0LA 3ARFD 1T0MB 2KDGA 3MUHL 1X5YA 4J1UB 4KQ3H 1NC4A 1RMFL 5SX5K 5D7JC 5I1LB 5JQ6L 3TBWA 2OJZL 4JCLA 1WBYB 1Q72H 4KUZL 2EIBA 1YJDL 3KPMB 2LTQB 2VISA 3CC5B 4JFOA 1H3GA 3PWVA 4FP8H 2R0KL 4GXVH 4TULH 2YPLA 4U1JB 2HFGH 3S6CA 4HT1H 5I30H 4XVUC 1OARL 5EUKB 2Z31D 1C1EH 1T2XA 2R1YA 3QG6A 3O8XD 1T1XB 5F9AC 3VGFA 3MTRA 1M71B 2KZWA 3MNWA 3UTTD 4OZFA 2Q76A 1S7SB 4Y4HD 1WBZB 2G9HB 5EZOH 3Q5TA 3TJHD 1ORQB 2P5ED 4MAYB 4NCDA 5J6HB 4HKXB 1WZLA 5TDNB 4FQXA 5T5FL 4HZLB 3EYOB 3HE7A 2P46B 3FO0H 2FYYA 1A7PH 2N1KA 4L3EA 1JF6A 5IW1A 4L4VD 4AM0B 4Y16D 5GS1B 4JY5L 3I2CH 3DX9A 3RAJL 2HFTA 3DRTB 4PRPD 4EUPB 5BW7C 4AEHH 3ALXA 2MPAH 3GIVB 1AKJA 1YEKL 2DKUA 1N0LA 3RWJA 1I9JH 1GYAA 3FJTA 1BBDH 3ZYJA 5B3NA 5D6CA 3O2WL 4OLYH 4PGCB 4X5WA 2O5XH 3OX8A 5TQ2L 4WFFD 5L2JB 4G8EA 1NMAH 5CJQH 3DUSB 3PP3K 4U6XA 3MLYL 1MY7A 1I3RA 4C56A 2B2XH 4MNGA 4CMHB 2IBGA 4JPIB 3JVGA 4YDVA 1RJZB 2CGRL 3T3MF 2RIKA 5HHMB 4JO2H 2DTSA 1WWBX 3BIBX 2HJLA 2MPAL 4DVBA 5DDHB 1B0RB 2F19H 4FS0A 1WTGT 4PGEB 1NCCH 5A16A 4S0SD 4PJ5A 5FGRA 3BN9D 1S7RB 4MNGB 3VXOA 4YHIA 5GS2D 3WEXB 3MRRB 2GT9A 1SM3L 2P24A 2XA3A 5BZWA 3VGAC 3MUZ1 4LSPL 3X14A 3JTTA 3BPNB 5J6GA 4UUJB 1BEYL 5DA4A 3TO2A 4JANA 3PGDB 4V1DD 3BH9B 3SDAB 4HUVA 3MJ9L 4G6FD 1EV2E 1J1OH 1DBBH 2PTUA 2H9GB 4WFHD 4OUUB 4ZS7L 4HPOH 1A2YA 3N1FC 4KK5C 3BOVA 4TVSa 3P73B 2H41A 4Y1AA 4Z7VF 4GAFB 1UB5B 1OARH 1KG0A 5FUCC 4BQ8A 3UTQB 4XHJC 4N8VB 1GHFH 3E6FA 1QA9A 2MQ0A 4JZOB 1T20B 1F45A 1AKJD 3FAWA 3X3GH 4NKDB 5ERWA 3I02A 3DI3B 3QFDB 4XH2A 4CU8A 5DHVB 3VGBA 4DGIH 3ZKMD 3LQAC 3AY4C 1MCNA 2BCKA 3T65A 2ZG3A 5T5FH 2XZQL 3UTPE 3ZTJG 4YDKL 1S7SA 4KJQD 3H9SD 5D72L 5GSVA 3O41A 4G6KH 2Q6WB 4P2OB 5C0IB 4YDIH 2Q8BL 2ZUUA 3RNQB 5AUMB 4Z5RA 3UTTA 4HJJL 1QLEL 5D5ME 3QEQB 4GAYA 3VDAA 4S2SA 3LSOB 1HHKA 3MRHB 5EO1B 2YN5A 5BV7B 1PYWB 2O5YH 3QCVL 4LPYA 3ROOB 4KVCL 1M7DB 5D72H 1BFOB 5TDPB 4OFYD 1ES0A 1L7IH 1T1ZB 2UYLB 4JPVL 5KVMC 4JG1H 3GSXA 2HMIC 3PGCB 4PJEE 3O8XA 4LHUG 5C0JB 2PYEE 1GZQB 3WS6A 4KHXH 1MJUH 2EECA 2C5DC 2DQHH 1F4HA 5HPMA 4YGAB 1NGYA 1PYWA 4LCUB 1C12B 3RWFB 1ODAA 5CUSH 5HI3C 1CE1L 4OBSA 3MZTA 3KPRB 5DUBB 3TVMC 4XPAH 4R3SB 5A2LH 4XPGL 5I1HL 5IVZA 3TN0C 3MBXL 1G7HB 3CVIL 2BVPA 4N8CL 5D6DC 3UEZA 3CJJA 1DQJB 4ZDHA 1GCFA 1T03L 3RGVB 4YGVA 4YFDB 1FNSH 4FZ8L 2MNUA 1G7LB 1F02I 1EX0A 1JN6B 1YEGL 2FEDD 3FZUC 5EZIH 3NIGE 1MOEA 2UY6A 3TA3A 1UENA 2GSGA 4NJAL 3MLXL 3O3EB 4PJ7B 3V5HB 1J9CT 2CPCA 1MRDL 2I24N 4KRPD 1QRNA 1A7OH 3AMLA 2HA1A 1AXIB 1RZFL 1PFCA 2BNQE 1GJIA 3O3UN 3K3QA 2P42B 2FSEB 3SDYL 2BC4B 3MXWL 4LSQL 5FA3B 4DW2H 2R0WL 1N6QH 5C6TH 1KTKE 3BESR 3FQTB 3RWJB 4H0IA 3SDXA 5CCKH 1VGEH 4M5ZL 4OZIF 4J4PC 3GSWA 3KYNA 2PF6A 1IEAB 1MIML 32C2A 3TV3L 2I07B 3G5VA 3FB7B 1A6VL 2XACC 4OV6F 3SDYH 3WFDL 1MFCL 1P7HL 2DN7A 5E99L 5F7LB 1PG7W 5ACZA 5EU3A 1A6AA 4KMTH 3THML 1A7OL 2ZKHH 2HN7A 3GGWB 1XGUA 4QT5B 2VDQL 1TVDA 1WITA 3TYFA 5IQ9A 1Y0LB 2CUIA 2MKWA 3PQYA 4RAVB 1YJDC 1I9JL 4IEFB 5C0AE 3IDYC 4HF5L 4K9EC 2EDTA 5HHXL 4AIXA 4C57C 4JJHA 4Y1AB 1FHGA 1JRHH 4LPUA 4NQEE 5I0ZA 3ZO0A 4TTGA 1IGIL 4NRZA 4N1HB 1A7PL 1RZGB 5C9JB 5GRUL 5D2NB 4G9DA 5HDOA 3MV7E 1Z9SA 1UWGH 1KTRL 2P49B 4O58L 1UA6L 1L0YA 2YEZA 4M93B 5DTFA 4YO0A 4XVJL 1BX2B 3DOSA 1B6UA 4NZRL 1YMHA 4LVHC 2B0SL 4J6RL 4FFZH 3RL2B 1XCQA 4JB9H 2ADFH 4OGAC 3MOAL 4PJFA 5JHDA 1RK0B 2XKUA 4K7FB 2CR6A 4JO3H 3CZFB 5D5MB 1DUZB 1KCUL 2C9AA 2XOTA 5C0CB 1AGEA 4P2YA 1P7QB 4WTZG 1NDMB 1T1YA 2D31A 3P4OA 4HH9B 3SCMD 4XP4L 4LARL 4LRNL 4Q9RL 1MFEH 4JO4H 4JGUA 3TIDB 1T1WA 3C2SA 3L6FB 1PW3A 2Z8VC 3LKNA 1A7NL 5FUOH 5E8PB 2DM3A 4UDUB 2B0SH 1RJLB 4J6RH 3GBML 1G9NH 1DBKH 5C7XH 4ENEC 4NZRH 5FOBA 4U3CA 4K71C 1NMBL 2XZCH 2A83B 3C60A 3GI9L 5D1QD 3BZ4A 3KXFB 5A40E 1J5OH 1T1XA 4GG6B 1J1PL 3RVUC 3PWUB 2XICA 1UQSA 3L3JB 4ISVA 2IQ9L 3OX8B 4NPYB 4PGCA 1GOFA 4X5WB 1KCRH 4M7JH 3AVEA 1MPAH 2A74A 2ORBL 4L3EE 2I9TA 1H8NA 1E4XL 5KVGL 4UDUA 2E7MA 1AD9A 5LAXA 2C1OA 5E00B 3T0EE 1MWAA 5CILH 2EDQA 3ILPA 5AAMA 3EOYG 1KEGH 4NBZB 4BH8A 1X5LA 4X98A 1DE4A 4QOKE 1LO2L 1IE5A 3NFPB 1DANU 2CIIA 3JV6B 1JFQL 2IJ0C 1ZVSB 3JV4A 1OGTA 5E2JA 3UTZA 3IAQA 5FF6A 4LDLB 1V3KA 3DO7A 4YDLC 4NHUB 4W81A 5IB2B 6FABH 3ALWA 2Z92B 2X1OA 3L5IA 3QQ3A 4LLUB 1P1ZB 4OIIH 4PJ9C 1FNLA 1FIGH 3DGGA 4NDMA 3MNZA 4DCQB 1ZGLP 3CFEA 1O7VA 1JGUH 2FX7H 4MCZA 1J1XL 3TF7C 3QZWG 1A7BA 1JMZA 2HTLD 3C9NA 4JQVA 4PS4L 5DUBA 1MQ8A 2V9RA 1JZ5A 1U36A 3MXWH 3T1FA 3W39A 3Q48A 4QYOB 5JOEA 3BKML 3PDOB 4PLJC 4POZC 4UILL 3AS3A 4JO1H 1E4JA 4LPTA 2R0WH 1N6QL 4LVOC 3HI6L 2FL5B 3RVUD 4AIZA 2YD8A 4KJQC 3BHBA 5C07E 3ULSB 5AG9A 4OZHE 1NAKL 3RZCC 3U4EB 4P2OC 2LE9A 3L1OH 1MHPH 5H37G 4U6YB 3V6FB 1KIPB 4M00A 4U1NB 4RIRA 2UWEE 1MHHB 1BP3B 3C08H 1QEWA 15C8L 4KGJA 1PLGH 3PWNB 4HQQH 4LSVH 3NBNA 4X7SH 1JWMB 2CKBH 3MXVL 4MXQD 4AMKL 3QI9C 1DDHA 3S96B 3RVWC 1DQTA 1P4BL 3RX5A 1RU9L 5KG9A 1F5WA 1X4XA 1ZT4B 1GL4B 3HC0B 1OAKH 4KQ4H 4NM4H 4XPHL 3O45A 3IDIB 3EOBB 4KDTA 4OZGB 4ZUSB 3TO4D 2VKXA 1U8OB 5DD0L 4P4KC 3OKKB 5T5NG 1V3JA 4OIAA 4J8RA 3QEGL 5EOCH 5KANG 3HLAB 4JZJB 2WP3T 4DN3L 2KQNA 5E9DE 2KKQA 1IGFL 1YYLH 3NOIA 5C3TA 4KMLB 4F15C 1BFOA 5D96C 5TDPA 3MCG1 1I85A 3QJFB 4M3JA 3GJFB 5DUPH 4YZFF 5IB5B 3D25A 1H3XA 2AK4E 4RDQF 3IKKA 1HKFA 3DVFA 1ADQL 3QPXH 2Y07L 5E2WH 4WCYH 1NCWH 3KPTA 3UJIH 1KELH 3WIFA 5ISZD 2C4FU 1ACZA 3RWFA 3KPNB 3WN5B 5IF0B 2B4CC 4G42A 1YYLL 1HYRC 5E08H 5ILTH 2BVPB 1A0QH 5B38A 4Y4KB 4P46B 4RGNC 5HGHB 3HC3H 3KLAA 5C0EA 1TMCB 3WIFB 1JGEB 1AI1H 1SY6H 3U46A 4LCWA 1IAIH 2OI9C 5DI8A 4PRPE 3ESUF 3ARPA 1OPGH 5HGAB 3KPQB 2Q3AA 3WD5H 2ZCHL 2IPKB 3LIZL 1B88A 3O3AA 5C92A 5I16B 1A6UL 2BRRL 4EI6A 2ICWB 2G5BA 2QSQA 4NNPL 3MJGX 2A6DA 4OD2A 4YE4H 1A6TA 1R24A 5E6YA 2AJYL 4QHUB 1KPRB 3PXHA 4YH6A 1J1OL 1DBBL 4AEIL 2WLYA 1JMXA 2VWEE 3TBVA 5CZVH 4R26L 1BOYA 3NZ8B 2FB4H 3T0EB 1HQ4B 2BNQA 4PJDB 5J1AA 1P5VA 4JO1L 3KNBB 5D1ZB 2ARWA 3BQUD 3JXAA 1B0WA 4ZFOL 4IMLA 4F37F 2R23B 4X4MA 4U3HA 4CU7A 4URTB 3MPCA 1D7FA 1BPVA 4NWUH 4QNPF 1QA9B 4JZOA 4J3SA 1M05B 2HTLC 3V4UH 4CNIB 1E28B 2FWOB 1JTPA 5C86A 1A3QA 4HQQL 5DJAB 1XZ0A 1P4IH 5E8NB 3E2HC 1CDUA 3MCKA 1BLNB 3CPLA 1OTUC 1N59A 4WNQA 3ET9F 1VGKB 3VGEA 5HYJA 2NY6D 2LU7A 4QGTA 1ZWIB 1YEGH 2FNBA 4GJTB 1EGJH 4U1LA 5F6HI 3V7AE 3C5ZC 1JGLH 3B8SA 3IU3A 2VLRE 3MR9B 4YHIB 3SDAD 4YK4B 1LD9B 1W8NA 4MB4A 1FNGB 1QR1B 4PJAF 1U9KA 5F96H 4Z76B 3VXNA 1A7QH 4WTZA 5JW5A 4RISL 2XQBL 5F7WC 2DLFH 4JCMA 1WCQA 4ZFZA 2GUOB 2NZIA 1QFUL 1Z9MA 1BFVL 1DBMH 4S0TD 3UTPD 1OAZL 2DQFA 4MJ5B 3WJJC 3LKRB 4LCWD 5DLMH 1V7ML 4KKBD 1CFNB 5IBLC 5K9OA 3VW3L 4L4JA 3FMGH 1PJ9A 2AJSH 3M07A 4O2FA 4FFYL 3UJJL 2CIKA 3C6LA 3W2DL 3MRGB 1I9RH 2C3VB 5E8DH 3GSQB 4LCYA 2V7HB 2HKFL 1CQYA 1FN4B 5AAWA 5E95B 1OW0C 2I9TB 4HUXA 3ULVE 3SE3A 5J13C 4OFYA 3DRTA 3MRQB 4L8CA 3N50A 4AJ0A 3BAEL 3BMWA 3H9ZA 4G6KL 2QSVA 2VL4A 3UMTA 1T7XA 2F8OA 4OLUL 5GZNC 1DR9A 2H8PB 1HXYB 1I8LC 4NO2A 5IJVB 1U8KA 2BVQA 1W72H 4APQB 3K74B 3DMMD 3TZVD 1GPOH 1TTGA 1AR1D 1X4ZA 5E6ZA 5I1EH 1WAAE 1X5ZA 1KLGB 3LN4B 2BJML 4M1CD 1AXSA 5JW4Q 1MCHA 1HINH 3G5XA 5DJ6B 1X5IA 4O2CB 5TQ0H 2RQ8A 4M1CC 1E4KC 1FIEA 2ZP0T 5IBUG 5MEOA 1KIQB 4I1NB 1T0NA 3QNXB 1U95B 4PRAA 3S4SG 5DURB 2VDQH 1FZKA 4KI5F 4R0LB 3TT3H 1NH6A 4HCRL 1EUTA 3QDMB 3KPOA 4HD9A 3VXMB 4HWBA 2OK0L 5EA0L 5GRXG 1A4KB 3DROA 4HH8A 2EC9T 3L5HA 2H32A 3MA9H 2Q86B 3MODL 1S7TB 4LQ1A 4X6DE 4XPFL 1JPGA 2YMXL 3VFNB 4FXKA 3QQ4A 4KJYA 4EDWH 4Q74A 1UKTA 3SGEH 3QXWA 4PTTB 2VLJB 3ZL4L 5BMFH 1C5CH 4Z95L 1QRND 4DQOH 4G8GB 3T4AA 3SDDB 2CMRH 2PYFA 3EUUA 3BQUB 2EC8A 5M95B 2Y7QA 1QR1A 1DUYB 3X11B 5GRYA 5HDBE 1MRDH 1DN0B 2PTVA 5JDSA 4UT7L 5IP4A 1S3KH 1FAIH 3MGOA 3MGAA 3JTTB 5BV7C 3D1MC 3SEPA 2DBLL 3Q3GB 2VIRB 4YR6A 3NPZB 2BHZA 1CGSH 4NFCA 5C0AD 4WJ5B 5B4MD 1EJOH 2M26A 2BY1A 2GEEA 2HJFB 5CCKL 4OI9A 3LKOA 1GGCH 1BMGA 5MI0C 4XMKL 2ZOKB 4Z8FH 2FX9L 4RX4A 3QEQA 4N8VA 2E27L 5CZVL 2H1PL 3BP7A 4ZUWB 2AJZA 5EUOA 5IHZA 2E8ZA 3ROOA 5FHBH 6FABL 1TZHB 1G0YR 2P44B 4I0PB 5GRWA 3F62A 4X9FA 4EI5D 1I3GH 2XTJE 1W0YT 4F9PC 4P9HC 2ITDB 4OFIA 5TQ0L 2EIDA 5EFIA 4Z7UA 4PV9A 5CILL 4EI5C 3PABA 1UVQA 4HIHB 3IFLL 3FO1A 3RY5A 2GJ6A 1U41A 4PJEA 4YHZL 3LPFA 1I1FB 1MJ7H 3BQUC 3VH8G 3H9SA 4K3GA 1J7VR 4Y4HA 3BN3B 3S34L 2WBJC 3GSNH 3MBEA 4P9HL 5IB1A 1TIUA 4F7MB 4OCRL 2A1WL 4OI7A 5ISZB 1MFNA 3F7RA 2KL6A 1D5BA 3ORJA 5MERB 3GJFH 4JRWA 4IRSB 3HG1A 3FTGB 1NLDL 3QULB 3PWLA 4ZAKC 5IJKC 2OJEB 4UTAH 1MCKA 4Q9RH 4YEFA 4R90L 5FOBB 3BP6A 3QUYA 3O4LA 5GGSB 3D2UA 3CFKA 3MV01 4I9WD 3B3IB 1X6NA 1NGYB 4Y4FB 2X09A 3GMRB 1BFTA 4QGYA 3ZE1F 1V7MH 4AG4L 5FYJD 3S36H 1RVFL 5GS0L 3KG5A 2VABA 4RMQA 1B0RA 3E6HB 1H5BB 4O51B 5A3ID 1QP1A 1T22B 3I84A 1NCBL 4OF8A 4UTBH 4B5EA 4P4KA 3QRFM 5F7FA 4OZGE 5KN5B 4LHUA 3CFBA 1S7RA 4CVXB 2G5BB 1HCVA 5FV2A 2D03L 1WFUA 3U9PH 3PQYD 5J06A 2R1WB 1YPZF 3I9GL 3WIIL 3D0LA 5ENWA 3BE1H 4C58B 5AD0A 1VADA 3V4PL 2IMNA 1MREL 2EE6A 3S96A 1KJVA 1I7TB 2WK2A 4PB0L 5IR1B 3RBGA 4N68A 3ZDZE 3DURB 5DVNA 1AO7E 4QCIB 3MJ6A 1Y6KR 3ZSSA 1FJ1B 3FQRB 4S1SH 4C56D 3VRLE 3C08L 1K6QL 4U4BA 4L4VE 3QA3A 5KSAC 1LEGB 1JNLL 2CKBL 4OJFL 2BFVH 1MHCA 3VXUA 1BEYH 3ZKQD 1AQKH 1NCDL 4YPJA 1QRKA 2GT9B 3I50H 5J4MA 4YHNA 3WYRA 2X4NA 3DWTA 2A73B 5FKAA 5IVXA 4QT5A 3WDHA 4X7EC 1FFOA 1HWGB 2EEBA 5MI0B 5DEGB 1FL6B 1X7QA 2A38A 5IT2H 2NY5C 1WEJL 3NZHL 4QKXB 4DW2L 2HJKB 2DL2A 4LPXA 4OCXH 5GZND 2QADB 4HKJA 4OLEA 4P4RB 4XCCL 4U1GC 4OKDA 5HD8D 4BKLB 5ESQA 4JKMA 3TZVC 5T33L 1U8LA 1QSFB 2YEZB 1EBAA 3LDBC 3O2VH 3D48R 4XWGL 4YUEH 3TO4B 4JFFB 5A2JH 3C6LD 2NY5L 2NZ9D 1MIEL 4YXLL 5HYIA 2VC2H 4QWWC 4MXQC 2XA8L 1NC4B 2E9WA 5JO5A 1MFDH 2EZ0D 5DD1L 4ZXBC 5C07A 1XR8B 4B7IA 4LSRH 4J3XA 3WDIA 2VISB 3L5WA 3TFKC 3CCHA 3P4NA 3VGGA 2Y25A 1CU4H 5E5RB 2YUWA 5HGAA 1XF3B 3GB7A 5FDYA 4JFFD 5H2BA 3WUWA 1TVBA 3HC3L 5GGVL 5D93B 3T09A 2WINA 4HK3J 3KXFE 1A5FL 4C55A 4WHCA 1AI1L 4XNQA 3RDTA 1MPAL 2CDEB 2EICA 3QB7C 1FZMA 2XWTB 3E8UH 2VITB 4L8DA 1L7IL 4JPVH 5CMAB 5DSCA 4DUWA 1RJLA 2DQIL 1S7WB 1CZ8H 2AP2A 5GZOD 3MLTB 5CP7A 4OCLC 3WUWB 3PWUA 4KI5C 5GXBB 4RRPG 5HSFA 4HK0B 1MLCB 1Q1JH 3VWJA 4HT1L 4XRCB 4P5TD 2NXYB 3SY0A 5IUSA 1NLDH 2CRIA 2EDOA 1NFIB 5I8EA 1VACB 2GITB 4MA1B 5D8JL 1UZ6E 1VFBA 4NN5C 4F9LC 1DL7H 2WBJA 2D7TH 2C7UB 3B9AA 2NW3B 1FBIL 4AZ8A 1FDLL 3WLWD 3G6JA 4O00A 3CFJB 4ODHL 3ULUF 5EU6B 3QEGH 5EOCL 1AGDA 3IXAA 3WFHA 1U8IB 3EDJA 1IT9L 1K85A 4P4KB 1LMKA 3QCUL 4XCYB 3BPCB 2HRLA 4U1LB 1FFQA 1R6VA 4ODSH 4KAQL 4QRSB 5BJTA 4XCEB 4P46D 1T2QH 4KTEL 1TPXC 2BSSB 2OMBA 5AD0B 3F7VB 3T2PA 3EO9L 3PQYB 1X5KA 1QFWL 4V2CB 1JZ7A 4R7NA 4HF5H 3MC0A 4OKVA 3SE8H 4QRPE 2D7NA 3QNYA 1A4JA 2ZWLT 4XP5H 4A6YB 2VNCA 3IDNA 5ID0B 4OCSL 4OSUH 3ECBA 2HLAB 3MJ8B 2R4SH 4G8GD 5D2LA 1MUJB 5F7EL 1RQ5A 2EE9A 4N0RA 1JWUA 1ZXQA 2CMRL 3PL6A 5CGMA 4UT9L 3QUKB 2QLVB 2V2WA 4OZHB 4GUPB 2VLRD 3QHTC 3P9WB 4L9LA 1F6AB 3ARBB 1U6AH 5ESAA 3U6RB 3TT1L 2E9BA 4P3WA 2LAGB 5F44A 3FN0L 3DSFL 3IU4L 3U83A 5FEBA 1MNUL 3RQ3A 3CZFA 1J8HB 4OT1H 2QQQA 1UM4H 4DGVH 5CBEA 4LSQH 4PREB 5MEPB 4WI6A 2PO6A 3QDGA 2EIZB 1QO3A 5DFTA 3FB5B 4U1MA 2V7NA 2PXYB 2NY6C 1ZK9A 4Z78A 3T65B 2YRLA 3OR6A 4XXCA 1QSED 3AAZA 3EOAB 1JHLH 4XWOD 1WSST 1CLYH 5LBSH 1TQBC 1CD0A 2VZSA 5CJ5A 4NN7B 4CVUA 1RD6A 2H3NA 4TRPH 2VTFA 2CO6B 1D6VH 1CE1H 1RZKL 3MACL 4KY1L 4DUVA 3OHXB 2YOCA 3RWDB 1JHTA 3MLTA 2NZ9C 5CP7B 3IGAA 4KTYA 2EYTB 3MRLB 5T1KA 4OV5B 1RPQA 3RZWA 1G1CA 3KYAA 3JWDL 4GRWB 3D5OF 3GIVA 5M94B 3IYLW 4GKNB 3EYVB 2ED8A 2EYRA 1NMBH 1TVHA 2WAHA 1BVLB 5C0CD 2CH8A 1M7DA 4XNXL 3UTSE 3DBXB 1R3JA 1AIFB 3SGDI 1HHIA 3UAJC 3QQ9C 4OGZA 4NSKB 4PG9A 4MMZC 5CLWA 3SDXE 1KN2H 4K3EH 1H8SA 3PWJB 4Y2DA 1QLEH 3QUXC 2Y23A 5FKPB 2NY0D 3KPSB 5T3ZD 4MJ4A 1ZT7B 1XCTA 4M1DL 4ODWA 4UIKL 2M1KA 3C5ZB 4HIEA 3W0WD 2R1XA 1MEXH 1FNFA 1KB5B 1JGVL 1CLZL 3BUYB 4UNTA 1H0DB 4Y88A 5AZEH 3ETBF 4HZAA 1JN6A 2ZUXA 3L3OA 1VKXA 4NQCD 3ARQA 2X42A 5J12B 1CS6A 3JV4B 5FF6B 3I6LD 5GGRA 3FQNA 1SJHA 1C8PA 3MLPA 4KZDH 2DJ4A 5GGVH 4G6JL 1RUQH 2FHBA 4H20H 1ERNA 1QRNE 1LD9A 4M03A 3LDBB 1FPTH 1RZ8B 1KNOB 1T20A 3VCLA 4YHLL 4X99B 3VFTA 3V79C 3A6OA 4L29B 3RGVD 3T0ED 3U7YH 2VDNL 2EZ0C 4XCCH 3IDXH 2E7CA 3IDIA 3HR5A 3VFPA 1AC6A 3MCKB 2Q7YA 5ACZB 2E27H 5C0GA 1S7UA 3QZWA 3TZVA 5E8NA 5I1JL 4P23D 2A6KB 1WEJH 3DVGA 1BGXH 5E4EB 3T4AB 3JWNC 3L7EB 3JUZA 4K3JL 5FDWA 2CGRH 1CIUA 4ZFOA 3I6LE 3CUPB 4Y0GA 5C0BA 1A9BA 3HE6A 5EUOF 1FVDA 5BZDA 2VR9A 4LBEB 3DX8B 3ROLA 2J8UA 3IJHB 4K2UL 4MA3A 1KN4H 2J8UE 2WQRA 5E2UH 1P4IL 4OCYL 4HUUB 4X8XA 3CLFL 4GRLB 1WIUA 4Z7UF 1ADQA 2FD6H 1WT5A 2XY2A 1VFAA 4KPHL 4GO6B 4ZODA 3OAUL 4I0PD 4Q9QH 1T89A 2SEBB 1A1MA 4MS8D 4TVPL 2YMXH 3C6LB 2P7TB 3C6SA 5EU4A 1I8LA 1IT9H 5LAXB 4O2FB 4LMQE 1DCLA 1GIGH 4BUGA 1AXSB 3X13A 4P5MB 3KPSA 4LCWB 5FM8A 2WNGA 3SO3C 3VFGL 3WHXA 3QUMA 2B8OT 5IB1B 2G9HA 3CH1B 3S3PA 1I7UA 4XAWL 3ARXA 3GMPA 3MOBL 1Z9OA 1ED3A 2HVJA 1P5UA 1HXYA 2A83A 3C60B 3RVTD 1KEMH 5I74B 2O5YL 3K1KC 3P9LA 2VKWA 4AG4H 2H32B 4KKCD 5HHOB 4HC1L 3MQIA 1AGFB 1TJIL 2BSED 4OF6A 4W4OA 2BJMH 1QLFA 1NDMA 1S78D 2D31B 2C3GA 4K3EL 4QF1B 4XCEA 3GSUA 2R1YB 1ZGLB 2YD2A 1IC1A 1OP9A 1CZ8L 1I8KA 2Z31C 2HTKC 2YWZA 5KTEL 2YSSA 4PUBL 5J12C 1CG9B 2GJ6E 3ARVA 5JW3L 2JCCF 5ANMB 1RJCA 4LHUB 2VXVL 5IMKA 1UCTA 4LCIL 3O4OB 4P23A 5CJXC 4YHKL 3NIGF 43C9A 1EIBA 4OLXL 4QHUA 1KB5H 1Z0MA 4OQTL 3UC0L 4JY6B 1ZHBA 1X5AA 4NM8L 1WWWX 2PW1B 2IPUG 4PGDA 1ZLWK 1GGBL 4LQFL 1DJSA 1FV1A 1PLGL 3GMOB 2P4AB 1XIWC 1QQDA 3BSZH 5HXMA 1IQWL 1EZVY 3FRPA 5EIIA 5T33H 2EXYC 3ULVH 4PJCB 5E6IA 4G9DB 3HNVH 2NY2B 3AC0A 2V5YA 4NJ9L 3LVEA 1G9EA 4U6YA 5IVXF 4I3RH 5DMIL 1F4YL 4C54A 1ZAGA 1J87A 1MNUH 1HI6B 1X4YA 1JWSA 1UXWA 3HN3A 3EIFA 5D7KE 4KRNA 4IRSC 3QAZC 2NQCA 12E8L 4ALAH 3GMNA 2HLFD 3W9EA 4NRYB 4RFEA 3WFEH 5E9DB 2ITCA 4X6EA 3MO1B 5BO1L 3QHZH 4KHTL 3I50L 2YPKB 4OD1H 3GMLB 3VXNB 4YAQA 1V3LA 5IM7A 2YD4A 1G84A 1JPFA 3B9VA 3PWPD 1H15A 3KDMA 1T5XB 3GFUA 2YKLL 4RA3A 1BREA 4RAUB 2OLDA 4OCMC 5KSBF 1VERA 5DYOA 1DEDA 3LD8C 4G80A 5JIKA 2XFXB 1L9MA 1K2DB 2EEAA 3R0MA 4JHWL 5DI8B 1BQHG 5ALBH 4RNRA 5E00A 2W9LA 5FKPA 2L4OA 2IG2H 2W65B 3LKPB 2EDHA 3NPSC 4KVNL 1HH6B 1NCBH 4UTBL 2AJVH 3CVHH 3A67H 2VQ1A 5SV3A 2Y6SD 4DZ8B 1F97A 4WI9A 3RTQA 3MOQA 5D93C 5EO0B 3I6KB 1JF5A 3BZ4B 3H8NA 3KXFA 2XWBA 3G08B 2DLEA 1FFPB 3WD5L 4M6AA 4R97C 2VH5L 3D39D 4S11A 4JKKA 1QSEA 4PBWD 3RIFF 1FLRL 5I1KH 1HQ4A 4WIQA 1I9EA 4NC1E 1CD9B 1OAYL 5GGRB 3ULUH 3R06A 2AEQH 3MCLH 5C08D 4ZNCD 5DHXB 1BFSA 1YYML 3P0VH 5FECA 1VADB 4KKAD 3OXRA 3IT8D 2R9HD 1SYVA 3O3AB 1RZIB 4EVNA 2WBJB 3Q5OA 1YEHL 5KTEH 1QACA 4NO0B 3DX7B 1UCBL 3BEWB 5F6HJ 4RFOL 4ZSOE 2VLRA 5I17B 1Q0XH 4UV4H 4OM1L 1BD2E 3GIZH 5I1AB 3QXDB 2BXZA 2JE8A 3V4VL 5LWYH 1ZLUH 1W0VA 1PGRB 1RZKH 4KY1H 4E5XA 4MAYD 2GSIA 3P4LA 4LSRL 5I2IA 2ARJA 2HFEB 2VIRA 4JHAL 3CFCL 5J6GB 1DDHB 4XBGB 3GRWA 2ICES 3QXVA 2CO7B 2BNUA 2X41A 1WISA 1X7QB 1QBBA 1PX3A 2FCBA 5DJXB 4LLQB 3NIFE 3A67L 2ATPA 3CD4A 4NO5A 5EC1B 1QBMH 4PRPA 3SDDA 2KBGA 3U1SL 3O6LH 1R3HB 2ZSVA 1F00I 1OLLA 1NSNL 1JZ3A 3U4EA 4UU9A 4LBEA 3QEHB 1XF5A 3HUJE 5JUEL 3B83A 3VXUB 3MRJB 3FO2B 3QISA 1FNHA 4JFZH 1MSPA 4OGAD 4CGTA 3IDUA 2PETA 4CL7A 3NFNB 2NY3B 4KPHH 3FZUD 4WUUE 5FGCE 5T3XL 7CGTA 1IM9A 2V7HA 4QOKD 2VXTH 1JHLL 2GY7B 3N1QC 4Z7VA 5D7LA 2AQ3A 5H8DA 4N0CD 4W4NA 3RVTC 2NXYC 3O45B 2Z31A 4OCSH 5KSUA 4PJ8B 4ZSOA 4O4YH 5HHPB 2ITCB 2WMPA 4GXUM 4BKLA 4KI5E 2CDEA 3U36B 2NY4D 5GS1A 3LKRA 3QXTA 5D1QC 2VXTL 2APBA 4OUOA 1KJ2B 4P2QA 4RGMB 1HILB 4JQIL 4WFGD 1CFSB 4M5YL 1QR4A 3VA2C 5EORL 4MCYA 3MYJB 1DEEB 1G7IB 2DWEB 3S3SA 5IMOA 3I9GH 4ZNEA 4MA8L 1F90L 4M3KB 1KJ3H 3JTSA 1PZ5B 2XN9B 2FJFA 5ALCL 5I6XB 4Z9KB 5DRWA 1J8HD 4HGWB 3QDAA 5JHLH 4TSCL 2A9MH 5FUZL 2X1PA 4F7MA 3HB3D 5IMMB 3GM8A 5F88A 3LY6A 2QL1A 4BZ2L 1CT8A 3K46A 2F58L 1FL3A 4MNQE 1MCFA 4FXKB 2FDBP 4HS8H 5KS9E 2A6IA 4PYHA 4H0GA 3PDGA 2BP3A 4WW1A 3O0RL 2CIIB 3JV6A 1HHJA 3MNVA 3QYCA 4NSKA 4PG9B 4WRLA 5GRVK 4PY8I 1JE6A 1G1YA 2HAZA 4M61B 1NCTA 5T1MB 4AH2A 3LRGA 4OAWB 3O3EA 3QA3B 2W9DL 4NKMA 3VFWB 2HKHL 1V5JA 1SVZA 5ETUB 1ZT7A 1LNUA 2ZUYA 2DB8A 2H26A 1RHHA 5I76A 3QPXL 3TNNA 1OB1A 1G6RA 1YPZB 5FGBA 2VSCA 2VXQH 3I02B 1WFTA 3WS3A 1L7TH 4L1HA 5JPMB 5ISZE 5C0RH 2FSEA 1PKQA 4ZAKA 5DJ6A 3W2DH 3V6ZA 4MX7B 1LDPH 2ZNWA 2ZUWA 4Z7WA 3IDYB 3LKOB 4NO3B 3F7PC 4HEPG 4PTUA 1JNJA 2I5YL 2FR4A 2YUZA 4XAWH 5EU5A 1A6AB 4KTDH 1A8JH 4WO4D 3UTTB 2EIZA 1NCAL 2QQKH 4U6TA 4Z5RB 1S9KC 3LN5A 5JTWA 4QXGL 1JRHL 5I2IB 4I48B 1IGJB 2IF7A 1IBGH 1QYGL 3QO1B 2E5EA 2H3NB 4FMFA 3BDBA 5CGYC 1FL5B 1URLA 1JNHA 1BX2A 4G80B 3MRGA 4M4RA 4LAQH 4UBDC 3U6RA 5DFVC 4JHZA 3MRDA 4U3XA 3NA9L 4HPOL 1U8QB 1NPUA 2N7BA 2X4OB 1WIOA 1F8TH 4LKXB 5IEKA 3GMNB 3TLRA 4FQ2H 3N0PB 1FO0L 1ZLVK 5E99H 1WC7A 2AJZB 4U6VH 3BXNB 2EDNA 4HS3B 2P8MA 1K6QH 4DGVL 3BKCL 3MGTB 4CAGA 1JUFA 4QOKB 4C56E 4Z77A 3BW9B 4NRXB 3WIHA 3ZKNC 1BBJA 3MRDB 3P0YH 3NZHH 4I8DA 4JRYA 4FQCL 4MDIB 2DDQH 4Y2DB 4I3RL 4PS4H 1CLOL 2EDXA 5KG9B 4E0RB 2ICCA 1GC1C 4GT7A 1QSFD 4QY8B 3G5ZA 5I1CL 5ESVA 1KTLB 5IVXE 1ZHNB 4Q7DA 3KPSE 2BX5A 5IHLB 3CLEH 4YK4C 3CH1A 2BDNL 4OJFH 3I3BA 1HH6A 2FO4B 1SEQL 1LEIA 2BSRA 4AL8H 1KEGL 1VSCA 1BAFH 1TQCB 3BEWA 1HZHL 2GY5A 4G8IA 2ITDA 5A1AA 1HNGA 4ZUTB 3TJEH 4MAUL 4MVBD 3OQ3B 1I3RB 3HNSL 2EH8L 1B2WH 4ZG1A 1IAKB 2OMNA 2J8OA 4ETQB 4U6HA 3REWB 1UCBH 3JWOC 3GSNA 4ODXB 4NUGL 3TNMB 4G7VL 5IVZB 2IFFH 2APXA 2YSSB 3TWCL 4X6FA 3V5KA 3CAFA 1J1PH 3TBSB 1CI5A 2EDBA 4XBPB 5SWZE 5ECJE 1INEL 1IGCL 3NN8B 4Z0BH 4N8VG 2A0LC 1KC5H 4FFVD 3D85B 5DVMA 1NGQL 4PRHE 3BDYL 3K4ZA 4V1DE 3HG1B 2IAMB 5DUPL 3MRKA 3OWEA 3KPQA 3BP4A 1C5BL 1TZGH 2OI9B 3O6KL 5L7XH 1Q72L 1XGUB 2W92A 2XPGB 4OF0A 2ZZUT 3GMMB 1DLHB 1K8DA 1LWRA 1NFDE 3KPRD 4Z7WB 3BHBB 1OLZA 2DQJH 5A3IC 5MP6H 4P9HH 4YFLI 4CKVX 3QDHA 3JWDC 3QFJE 4TTDD 4OCNC 5GS1C 2BVOB 1UEMA 4PBXA 1T5XA 4QRTA 4KQ4L 4NM4L 4UINH 3SDCB 5DT1L 3EYFA 4F57H 1RUPH 5LBSL 5DDHA 1CGSL 2FHCA 3LQMA 1HILA 3W9DA 5DEGA 3U30B 4MJ6A 1CF8H 2VDML 3WUWG 4YXHH 4XWGH 1G6VK 2H45A 4NCC2 1HKLH 2DLHA 4JPWH 2VJXA 1OT1A 3OJ2C 4S1DC 3ARGD 1YEIL 2AXJA 1MHPL 2J8UB 2YUVA 1J0HA 1TZIA 3AU1A 3TV3H 5CBAA 4XNYH 3OKKA 4X9HA 1J18A 2VLLA 2DQEL 3FRUA 1R3KB 1LP9A 3ARDA 3HZKB 8FABB 4MXWL 4WWKD 4GQPH 3MR9A 4O2EB 1CD1B 1G9MC 4KKNA 4M5ZH 2FX7L 5HYEA 4ZFFA 3FO9B 3T8XA 1KCLA 3H2WA 2JJTA 3VFRA 3O2DH 2UWEF 2X5PA 4XNYL 1FO0H 4FQXB 4HZLA 3UPRB 4PLOB 1G7IA 4Y19E 2Y06L 1F8TL 2A6IB 4E41D 2JLLA 4JM2A 3V2AR 1IQDA 1HDMA 3OF6A 1U8KB 3V6OA 2LFGA 5TF1H 5GJSH 3JVGC 4HFUH 1R3LB 3L7FB 4DQOL 1MELA 1WBXB 1N6UA 5FA4B 4V1DB 5F9JB 4Z7OF 5ACMA 4RWHA 5ENWB 3NH7H 2NY7L 2H26B 5I76B 2WUBL 1TJHH 3UP1A 2AI0L 1NCAH 4LKCB 1JRHI 1MI5E 5CINH 3S35L 3OTTA 3GSUB 4K07A 5BS0B 1QLFB 1D9KD 1CLZH 3ZYOA 4RWYH 2B1AH 4X4ZA 3PP4H 4JQXC 5DUML 3DVNA 3FB8B 3TT3L 2VABB 2AKRA 1NC2B 1JI1A 4LLDB 3TA3B 1W0WA 5C0DB 5KANI 8CGTA 2VAAA 1DBKL 3H3KA 2E9IA 5IROC 1A3LH 3C5SB 3OKLA 1RI8A 4E9LA 1S7XB 4G8FA 3MLSL 5K9KB 2GK2A 2Y36H 2R23A 4OD3H 1INEH 4Z0BL 3QUZC 3QIWA 3KPRA 4TQEL 4CW1B 4D9QD 1ZHLA 2QSTA 2Q8BH 3VDCA 4ONFL 3WE6A 4NFBA 3NAAL 3PGDA 3T2NL 4N0YH 1YEHH 2FWOA 3M8OH 1NUFA 1LEGA 4FXLA 3VD4A 4NNYB 3OB0H 3UZVB 2VR5A 1A7QL 4PRIE 4HXAL 3RKDD 4Y4FD 3HS0B 3IB4A 5E94A 3K81A 4I3GA 2Q8AL 3GUTB 3AREB 4PRBB 3T0BA 1BHGA 3CMOH 3QNZA 4M6MH 4MLSA 1OTSC 3FAXA 4P49A 4I9WE 3VXRB 1MFBH 3SDAC 1G7QB 3ULVC 3D2UD 3O4LD 3MJ9H 4PJIF 2R0ZL 15C8H 5F3BB 4ZOCA 1RUMH 2H2PD 3IJSA 2NY3C 2PTTB 2GKIA 1MIEH 1J0KA 5FDWB 3FOLA 3BZEA 3HCVA 4ZQKB 3PIQA 4GW5A 5EBWB 4HUMB 4UQ3B 3FB5A 1QO3B 3CH8A 1BZ9B 4PP2B 5CSBA 4DZ8A 1U58B 2G5RA 3LAFA 4LLMB 2DDQL 4P9MH 5TPWL 2CK2A 4EUPA 3D39A 4X6CB 4XTRC 3NGBB 4EOWH 4EZMA 3GJEB 2BHYA 2ICWJ 5I16A 2E7LC 4D0CA 3UXFA 4N90E 4IHOA 1G7JA 1N7MH 5EBGA 3OKNB 4OLWL 2BNRB 4ELKA 4MD5A 5B38B 3GBNH 1BZ9A 3HNVL 3L9RB 4KDVA 1PKQE 2MCG1 3VMOA 2WIIA 3VRLF 1N8ZA 1NQBA 3NA9H 2AXGB 5IBUB 4QRRE 2O5ZH 4JY4B 2D2OA 3AGVA 1CL7I 1GGBH 3GMQA 4LQFH 2HRPL 3CFDA 1U92B 3ZDXF 5I1DA 1WICA 1N5YH 1CXEA 1PY9A 4ONGL 4N8CH 3LRHA 3A6BL 1BZQK 1UACL 3IXAB 1DFBL 5I1HH 3PABB 2Q3ZA 5E24E 4LLYA 5CEZL 3EDDA 2KUTA 4O2CA 4K7PY 1F4AA 3DGGB 3GKWL 4JE4B 5EA0H 1FDLH 4MA7L 5T1LD 3RIAF 5JQHC 1NANI 1SMAA 3QIBC 1BJMA 2ARJQ 1FP5A 4H8WC 3WNMA 1RZIA 4EVNB 5KSAD 1TCRA 1T0NB 1I7ZA 1E0OB 1SYVB 3R8BB 1I8KB 3IVKB 2AK1L 2I5YH 1S9YB 5DD3L 5E6IB 3E6FB 5HI4D 2ZCKL 3K1DA 2Y5TB 4HUNB 4GBXB 4MNHA 5IB4A 5FYLL 4U1KB 4X83A 4R97B 3UC0H 3BGAA 5F9OL 3HC4H 5IFHH 3SJVE 1M6OA 2C1PA 4U1NA 1AR2A 5JW4N 1DQMH 2IWGA 3VRIA 1PQZA 1B90A 4WWKC 3CXHJ 5T1MA 1D5MA 1P2CA 4UUJA 4K23H 1N5AB 2IALB 3EFDL 5D70L 4WHTB 5FO7A 4XWOC 5D7IB 2IAMD 4BFIA 2GJJA 4NKIH 1LO0L 1YNLH 4WEBL 5ADPH 4PGDB 4IRJC 4TVPD 3S34H 3ILQD 3QNYB 4TOYH 1CU4L 5LCVL 2LV4A 1XF2A 3GGWA 4ELMF 3RTQD 5DEZA 1AD0B 1AQDB 1UACH 5E2WL 4DZBB 1P4BH 1A1NA 4JN1L 1KJVB 1IC5L 3VXMD 3K7UA 5E94B 3FB6B 2VC2L 2DM2A 1D5IH 5HTSA 4EN3D 4PLNC 4LGPB 3B9KC 2SEBA 5KVFH 3CU1A 4P5TA 2HP4A 5D1ZD 2DM4A 1DQQA 1PAMA 1CD1A 5I71B 1YEJL 1FE8H 3SPVB 1SBSL 5E2UL 4MJ2A 2JKXA 4L8SB 2VXUH 3NFSH 3ZE0F 3T3PF 1B4RA 1OQOA 2CK0L 2HT3C 4Y1AE 3VI3E 3SJVD 3IFNL 5FFLA 3DX8A 4M1GL 5E9DA 1WVZA 3TN0B 2FJHB 1VFMA 4KRMB 4UILH 4GBXC 3AREA 1SM3H 1UXSB 1HSBB 4PRHD 3QIUD 5AZ2L 4E41A 1MCOL 3T0DA 3IJYA 1NBYB 4HKZB 1JPSL 3FRUB 5DZLA 5F7DB 4HKXA 3RZCB 5IMMA 4H8WH 4YFLF 4NZTL 3S37X 4QXWA 3S37L 4QRPD 2BVQB 3VGHA 1FZJA 3VXSB 3X13B 5TQ2H 1KN4L 4HLJA 4G6AD 1Q9KB 3EJYD 1QSZA 5DS8B 4F33B 4PJ9A 3S7GA 2FJFB 5EO9A 1MCWM 4U1GB 4APQC 1AGCA 1RIVH 1IGTA 4ZPTB 3RA7H 1JPSH 1WGOA 1ZSDB 2UUDK 2BVUA 5F7UA 3KYMA 1HK6A 2VAAB 2OBGA 4PB0H 3SKOA 3FO0L 1NAML 4ORGA 4GSDL 4ZAKD 5GISL 2B1HH 1P1ZA 3QIWC 3T3ME 1X5XA 2X40A 3U2SA 2Z92A 2ED7A 2X7LA 3RWGB 3REWA 4UT6L 4EEEA 2AXGA 2RAMA 3O6FA 1A6TB 3T0EC 2D7TL 4NNPH 4YE4L 5MHSD 3BKJL 3EYSH 1IGMH 4O5LL 3FHQA 5GHWH 1I1YA 1OAXL 5K9QI 1MAML 1QFWI 2AQ2A 5I8KL 3C09B 4E42A 2AV7B 4LF3A 4KK8D 2I26N 4WFED 4ZUUB 2R56L 2FBJL 3LZFH 1IFHL 1OSPL 3CFCH 4XI5D 2R1WA 3VG0L 3WN5C 4LNRB 4CBPA 4WTWA 2YHGA 1YDPB 2F53D 4M48H 1GPOL 5E1AB 4NQCB 2WBJD 1GGYA 1IL1B 2OJEA 1JYNA 4W6WB 4O02H 2X4SB 4X6FB 3V5KB 2X9WA 2YBRB 5GSRA 3TWCH 5B22A 1DLHA 2IFFL 4PB9H 3EYQC 3P73A 3O4OC 3GMRA 2XZQH 2EDLA 5J9PA 5ICXB 2AV1A 3ULVF 1T4KA 2LU3A 4FQHB 3SBWA 1OGAE 5GRJH 1GH7A 4JJ5A 2VLLB 3IDGA 3F58H 3O81A 5LQBL 1HHHB 5C0FA 1VEOA 4L4TB 4HDIA 2PNDA 4U33A 4RBPH 3GUTA 2YZ8A 5TE7H 3RTQC 3NABL 3LQZA 3VU2A 4Q2ZA 4TSCH 1A9EB 4WFEE 3F12B 2RGSA 5D5MF 1H3PH 4K94H 2Z91A 4ELKB 3OKNA 1YPZE 1HN1A 1NBVH 5KS9A 3LCYA 3NACH 5D1ZC 5K59F 2V7NB 1UWGL 4PJEF 1KJ3L 3QIUA 4MZ2A 2VZOA 4X6BA 4Z0XA 5I8CB 5C0ND 1LP9F 1OP5H 4FTVD 5FO8A 4KK9C 2DLGA 2IG2L 1OAKL 1NGWA 3QUYB 4PP2A 3V0AC 4OIBA 1N5YL 5I1DB 1D6VL 1U92A 4D9RD 3GSXB 4F2MB 5MEQB 1DVFA 3E2HB 3MLZH 4LMQI 4AQOA 3RA7L 3GZKA 5GSVB 2J6EL 1IAOA 1CXIA 2MJWA 5CZXD 3MLWL 4YPGB 3GKZA 3EAKA 5FYKD 3SGJA 4NQDB 3GSNB 3HFML 4H8WL 4Z78B 1T0PB 3IS0X