1CICB

Idiotope-anti-idiotope fab-fab complex; d1.3-e225
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
217
Chain Sequence
QVQLQQPGSELVRPGASVKLSCKASGYTFTNYWMHWVKQRPGQGLEWIGNIYPGSGDSNYDEKFKSKATLTVDTSSSTAYMQLSGLTSEDSAVYYCARGLAFYFDHWGQGTTLTVSSALTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of an idiotope-anti-idiotope complex.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords PROTEIN (IG HEAVY CHAIN V REGIONS)
total genus 45
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1999-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cicB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cicB02
4P99A 1BEYL 2YC1A 2Q86A 2CRMA 1IEAA 3BESR 1D5ZA 2PYFB 3UJTL 4AEHL 5DJZA 1VFBA 5BOPA 1ZVSB 3HI1B 1GGCL 1I85A 3VRIB 4PJCE 2HKFL 4PV8A 5FHBH 4Y4HA 2YMXL 1U95B 4P5TA 3WSQL 1FHGA 3K2UH 1A6TB 3LS5L 2AJYH 4F9LC 4NSKA 4DN3H 5C71A 3MRNB 4HQQL 1MCPH 1JFQH 1IC4L 4FQCH 5H35A 2H2SC 1GH7A 1WCQA 1ZLVH 4MAUL 1LP9B 2Q6WB 2VZSA 5C86A 1EO8H 2OR8A 3D25A 3EAKA 1P84J 4GRWE 3LQAH 2NYYD 3FOMA 3MLXH 5I15L 2C3XA 4EIGB 5AG9A 3UPRA 3TIEA 2Z93A 1VERA 3NH7H 4EUPG 3G5YB 3JBG7 2YUVA 4MNQD 4RA3A 4LCCC 2J4WH 3OKYA 1PQZB 3O2DH 4EBQL 1NGZA 4XX1G 4AEEA 5EPMA 2OYPA 3KYOB 2DYPD 3BW9A 3MLRL 4XGZB 4WFHE 1JNHB 3W11D 2NYYC 4KY1L 4QWWC 1WQVT 2W65A 3OR6B 4X7SL 3IF1A 4GAJH 3GSOB 4I8DA 1NUNB 3HNTH 5F88B 3L3DA 5DUPH 3PHQB 3OPZH 1MOEA 3TT1H 1NLBL 5JR1L 1ONQA 5I18H 3UTTB 2X70A 3HE7B 3FRUA 3NCJL 3F12B 3VA6A 4F8QA 5LQBH 4XP6L 4XPFH 1GIGH 5IBUB 2EKJA 1FDLL 4NDMB 4PRBA 3ARPA 5DEZA 3CH1A 3QPXH 4WV1B 3LSOB 1BWWA 1C12A 3IJYB 3Q5OA 4S0SD 2LVCA 4JPIA 2NQCA 4R0LB 4U3CA 3PDOB 4P5MB 4BK4A 5D7KE 4RRPA 1WZMA 4G8EB 3R0NA 5EWIL 5EU4A 1YUHA 4NUJB 4LSRL 1F58L 4MXVE 2V2WA 4C57C 1F4WL 1ZA3B 1BFVL 4EI5B 5F3HB 5BQ7B 2Z8RA 3T4AA 1DLFH 2CRIA 1XGRA 5DTFB 3UYRH 5HHXL 5JZ7C 4P4RB 5ESAB 2CMRH 4RGOH 43CAA 3H42L 1KB5L 4NZJA 1I8LC 3KPSD 3MRGA 4WWKA 1PAMA 1IAKA 3EDKA 4AEIL 1FIGL 1VDGA 5CIPB 2AABL 5E4IA 2VDKH 4ZQKA 1EAJA 2QSCH 5HHMD 4HIXH 3ZZ1A 1JNLL 2HRPH 5L9DH 3GI9H 1PX4A 4FQIL 3BE1L 4KK6D 1HDMA 1OF2A 3BGMA 5L88H 4MCZA 4OGXL 2XZAH 4HPYL 3BZEA 3P0GB 4N0UB 4U1SA 3HG1B 4UV4H 3MYJB 1BWMA 2A6DB 4KTEL 4LMQE 2ZJSH 4MMZC 3AREA 3TYFA 4NQDB 3MCG1 4HFWB 5D70L 4OF5A 1DE4B 3RDTA 4M61B 5T1KD 3TVMB 2VDLH 4JPWH 3PJSA 3QIWC 2EDWA 3GMPB 2DTSA 4HJ0D 3O4LA 5I75C 1YEGH 1BQHB 1JV5B 1QP1A 4OD2A 2OJZH 3STLA 5E2JA 3EO9L 3FMGH 4UT7H 3H2WA 3CK0L 2EIZA 3MJ8B 1I7TB 1F3DH 3BKCL 3DMMD 1OW0C 4ZNEE 3FZUC 4ZTPL 5MERA 2AXGB 1U93A 4MD5B 1OGTA 5JNYB 2BMKA 3VDAA 3GGWB 1DUZB 4NN6B 1JYNA 4HH8A 5IMOA 3V7MA 3SQOH 2ADGB 3T2OA 4GLRI 3QB7C 3F62A 4NUGL 2EEDA 2HMIC 3L5JA 5CEZL 1KCVH 3MTRA 1T1ZB 1MCHA 2VLMD 3NCMA 3SGKA 3MV8B 5J06A 2C5DC 4IM8A 3RVVD 1F2QA 1JPFB 1Y6MR 3BI9X 1CLZH 1U36A 1X6LA 2HN7A 5DRZA 4EQ2A 2XYCA 4XNQB 1VFOA 1X5ZA 2MFNA 4MVBD 5DZNA 5IMLB 5LGKA 2OLDA 2W91A 1QR4A 4HQQH 1A22B 3EYFB 4U31A 1BFOA 3QDMD 1KPUB 1NGYA 4M8VA 4PV9B 3QQ4B 4GKOA 3ARBA 5EU6E 3QDHA 5CJOL 2ENYA 4GKNB 1TVHA 5FYJL 3QIBA 4FFYH 1MNUH 5HDBE 3A6OA 4WW2A 1XF4B 4WRLA 3WO4B 3BZFA 4P23B 2X4UB 3G5ZA 1MAML 4IRJD 1P7QA 3V6BR 2BSTB 1YPZE 4XH2B 3ZT6A 1N0XL 2Y5EA 1ADQH 4DKEL 4KDTA 2ADJB 2KQNA 4ZTOH 5DJ6B 1NAMA 1QLRA 3AVEA 1PKQB 4TVPL 4XP4L 4LLQA 2IGFH 4IRJB 4G6KH 5K9JL 4OCWH 5JHLL 1AXSA 3ULVC 1D5MA 4QRUA 1AHWA 4WI6A 1G9EA 1S8DA 1CU4L 4WFGD 1URLA 5HXMA 1KGCE 4GRMB 4PJGB 5HHPA 3B9KC 1ZHNB 3L7FA 4ELMF 1CF8L 1J0JA 4FNLH 4KZDH 2X5PA 2Q8AL 1UFUA 2DTML 3QNZA 4JJ5B 3T3MF 5FGCE 3WFDH 3V4UH 2OP4L 4TVPD 5IHUH 3HPJB 4Z7VB 3VRLF 1WCBB 1FNLA 2HMID 4JG0L 1VHPA 5EBLB 5IVNA 3RP1A 3QNXA 1J11A 5ADPL 4F7CA 5FB8A 3WN5A 1IQWL 3C09C 1SJHB 1U3HB 4LLVB 1E6JH 1JGUL 1NCAH 3MOBL 2F8VA 3DHMA 4HS3A 1N7ML 2APTA 1CGVA 5B38A 1OPGL 3L7EA 5K9QI 1CYGA 4JFFD 4M00A 1DQLH 2VE6A 1FVCB 3GBMH 2MMXA 3BQUC 3KLHC 3IDIB 5T1KA 4LNRA 3TO2A 4E41B 4GG8B 3VWJD 3QNYB 3FFCA 5HYQA 1ACZA 3MLSH 2EYTA 4XCFH 1E4KC 1A14H 1FCCA 3BKML 3C9NB 1Y0LB 3EJYD 1ZANH 5GGRB 4U1KA 3O2VL 3TBYB 5JW4M 3QG6A 5C0AD 1AGDB 1C5BL 2WP3O 3H9SA 3ARBD 1FORL 3ZDYF 3O3BA 4FQPA 1JPSL 5HHOB 2ENSA 3RPIA 4MHHI 4YFEA 1KEML 4HKXA 3GBML 2O93L 3G6JB 4OV5B 2G5BB 4IOIA 4R90H 2YR3A 2BERA 2F8OA 3HZVB 4ELMB 4EEEA 4ZXBB 1M05B 3BPLC 2ORBH 2VDNL 4PJEA 3QI9D 4JY6B 5JA9A 3O41A 4ALAH 3LEYH 4JFHE 4NNYA 1QBBA 2R0KH 5DRXA 3SDXF 2VH5L 2HAZA 5IB5B 2NLJA 3QAZC 4P2QB 3S7GA 1BJ8A 4XAKD 4GOSA 1NPUA 4XWOC 1OAUH 3V6FA 1JIBA 5INCB 2DTMH 1IM3A 4MJ5B 2VLJA 1UADC 5H2BB 4Z8FH 4YK4C 4HJJH 5SWZD 1J1XL 3MV8E 4OZHA 1XZ0B 4Z76B 2XXMB 4JFQB 3RBSA 3B8SA 5DGQA 3MBXH 1OVZA 5SV4A 3GUTA 4X9IA 5EBWA 3VMPA 5TDPA 1SYVB 1DQML 2R1YB 3BZ4A 5HGHA 5GS2H 1XCTB 1MFBL 3MRCB 1CFVL 3HKFA 4LP4A 2YBRA 4WI3A 4NN7C 3ZT7A 1X5KA 1CD8A 2Q87A 1K8IA 3RNKB 1U6AH 5C6PB 5I1HL 2IH3A 3K3QA 3L9RB 2JIXD 4ZDHB 5E9DA 2DYPA 1I8MA 1NAMH 5IEHB 3IU3A 1QYGL 2VISA 1FP5A 5LAXB 1G9NH 1YEJL 4LDEB 2W38A 3P4OB 2R2BA 4MNHB 4I0PC 3P73A 1DBAH 5SWQA 1IC1A 4G80B 5D5MF 3SKMA 3PWPB 3U9PL 4X6FB 5HGBA 3MLWL 5CEZD 3JTSA 4PG2C 4OLYL 3S5LB 1LNUA 2VIRA 2B4CH 5KW9H 4PJAA 4JB9L 5B3NA 2J8UF 4E5XB 1U41A 4QHKJ 3OJDB 3W2DL 4M62L 2GI7A 4AEFA 4I48B 2FX9L 2FEDC 2VUYA 1IKNC 4PGCB 1UH4A 2G2RB 4H26B 2JELL 3DX9A 3DVGA 3DUSA 1FNEB 4ONGH 2WBJB 4LHQB 4Y1AA 3HC0A 3T1FB 3MCLH 1LO5B 3CMGA 4JO3L 1NGPL 4DAGH 3MBXL 1QKZH 5KSAA 1FZKA 5C0GA 5EORL 3O2WH 1FE8H 4JO1H 4JHAL 1BFTA 4OZ4B 3PP3K 2PNDA 4LVOB 4LBEA 2XZQH 2H9GA 5E08L 3HR5B 1NKRA 5BVJA 5I71B 5J11B 1YY8B 1T22A 4K7PX 2GFBA 5D1XD 4EI5D 5IBLD 4PIRF 1M7DB 3QDJA 4UDTA 3R06B 4GW1A 4JDVB 2VQ1B 1RUQH 2OZ4H 1TZIB 3M17A 4GAGL 4GBXD 3G08B 4XMPL 4OD3H 1S7QA 4HMCA 1U9KA 3NTCH 4YR6B 3WCYA 1CT8B 5DHVH 3VG0H 3EJJX 5ESVA 4NC1C 3U7YL 3SGDH 2VN4A 1NC4B 3SDAB 1C8PA 2CDGA 2KH2B 3QCVL 2X4RB 3W9DA 3VGFA 5FO9A 2FX8H 3MC0A 2XA3A 1A7QL 3PABA 1RULH 5AYUH 5BZWB 1RY7B 4L29A 3LKPB 3PWVA 1MLBB 4PRID 2AJZA 2H6PB 1H5BC 5JPNB 4YDIL 1WF5A 4WCYL 2I07B 3SDYL 3OX8B 5D7JC 1WIUA 4PJ9A 3MR9B 2GKIA 4U33A 4ZYKA 1QSZA 2AJ3A 4M43L 4XCCH 5EOQL 5IMMB 3RGHA 2BOCA 4XB8A 4MD4A 4Y7MA 4O2CA 3B83A 5TF1L 3DMMA 4WEUD 5JQ6H 5GISH 3NFSL 1PZ5A 5GZNC 1SEQH 2FB4H 1S78C 3K81A 3FQTB 1MFNA 3RKDC 4AQ1B 4LKCA 3SDCC 2QQLL 4X8XA 3D87B 2BY2A 4ZSOE 3QO0A 1DSFH 4GAYB 1AY1H 5KZCD 1P7KB 2E3VA 3MLZH 2ARJA 1IKFL 1ZGLP 1UYWL 4M1CD 1E4JA 1LO2L 1WFNA 3VXTA 5GRJH 5JTWA 2ZUWA 3RWGB 3VXSE 5C0CE 3C60C 1TTGA 4L4VB 2X4PB 1E6OH 3KJ4B 4JKWA 1EEZB 1XGPA 3ZE0F 4WIQA 5MENE 1F45A 4NHCL 3VFUA 4RGNE 1IGTA 2DLEA 3BPCB 3PQYB 5F1NA 1OAYH 1W8OA 4HK3N 1OGAE 4OQTH 1A9EA 2WIMA 4YDVB 3RL1A 4IIQB 2NY1D 2W92A 1S9VB 4M5YL 4UB0H 3MUY1 3HAEG 1RK0B 4OF3A 1F6LL 4Z7VE 3RWCB 5HYSB 4CN4A 1MHPL 2ZUQB 1MHHB 1G7MA 2AK1L 1CTNA 2DD8L 3C8DA 3EHBC 2VLKE 1I9EA 2A6IA 1CDCA 2PR4L 3QIWA 3KDMB 4HIHB 4ORGB 3O6ML 3WNMA 4MA1B 5EZLB 3UC0H 4TNWK 4NBXB 1YDPA 1BQLH 2X4TA 4LLYB 4EI6B 4M6NL 3STBA 4JFPB 4YHML 4M6ML 3RIAK 3LQAC 1RZ8B 4MGXA 4JFXB 2ERJC 3OKMA 4IOFD 4ODVH 4NKDB 3WXWL 5A16A 1PFCA 2QQLH 1NMCB 3DXAB 3BE1H 3A0OA 4O2FB 2OK0L 5CKAA 3BZDA 5DD0H 4Z5RA 3ARUA 3PWLA 1IC7L 5ID1A 3WJJA 5T1DL 5EIIA 4X4ME 1BIHA 4OF0A 4MAYB 5BXFB 4JRYB 1OM3H 1AFVH 3ARVA 3CDGA 3DI2B 5DFWH 3LRSA 2A9NH 2QSTA 4DVBB 2E6QA 4LLMA 2VKXA 2PN5A 1JNJA 5MP6L 1XF2B 2HT3D 2NY4B 4LDLB 3OJVC 2AJYL 1CFQB 4U7MA 1ZLVK 3O6LL 2D9CA 2CK2A 4OM0L 3DSFL 3DRTB 1JTTA 5E8PA 5FYJU 3RAJL 1F8TH 1MCNA 3LB6D 2OJEB 4IRJC 1YEKL 3DVNB 3RVUD 5E2VH 3NAAL 2FJHB 4NN5B 4LCUB 4YXHL 3MRRB 3QCVH 1F6AA 3C2AH 4HUWA 1ZSDA 1HH9B 5AZEL 3KPQA 4M1GL 1WC7A 4WTZG 2XZAL 4KKCD 2XPGB 2ZOKA 1HYSC 3L3JA 4PREA 3K2MC 1AO7A 3AAZA 4R9HA 4FQHB 2ITCA 3C8KA 1TMCB 5T5FL 4BA8A 4NQEE 4ZAKB 5HBBA 1YECL 4K3EL 1P5VA 3RUGB 5F1SA 5JW5B 4NQXA 1A3RH 4CN6A 2ATKA 3RVVC 3WIIL 4XPGH 3NACH 1YEIH 2YWYA 3D3VB 5DRWA 1V3MA 3LQZA 5FYKU 2FNBA 4UDUB 3EFFB 1CLYL 1V7ML 3F7YA 3VXNB 3CPLB 5FYJE 3FQNB 3GBNH 2G75B 5IB2A 4U1JA 2IAMB 3BWUC 3UO1L 3ZSTA 1V5JA 1EAPB 1MRDH 1UZ8A 2HKHL 4MJ6A 1C5DB 1DVFC 3D9AH 4P59L 4YDLC 4BSVB 1T3FA 4J1UB 1WWAX 5ICZB 2F54D 1T4KA 5ALCH 4NWTL 1ED3A 4WUKH 1KTLB 4B53A 3ZYJA 5CCKH 3V79C 4XCEB 1PG7H 4CU7A 1UWGH 1X5LA 3MV7A 3VGAC 5D2LB 2JE8A 3RQ3A 1U8LB 1T5WB 1I9IH 2NX5B 1CL7I 2WANA 3MLUL 4OV6F 4NYLB 5GSVA 3SE9H 4KJWD 1T21A 1UJ3C 2JIXA 2VITA 2Y1VA 3AY4A 2Q7YB 2P5ED 1U8OA 3PF2A 3PIQA 3MJ9H 4TNVF 3HUJA 1B6DA 5EO9B 1GJIA 3U0PB 3QEQA 4I2XA 1I3RA 3UAJD 3S35H 4YDLB 1FFNA 3HCVB 2WLZA 1A1OB 4FABL 4P0DA 2C4XA 4ERSH 4PJGE 5E8NA 5KS9B 3H6JA 1V8HA 2WV3A 3I3BA 5KANG 1K4CA 2H8PA 4JQIH 3H7BB 1JWUB 4JHBA 4N1HB 3TWCL 2XT1B 3ABZA 1QLFB 4P2RD 2HFTA 4WUUA 2HJFA 3MGTA 5E8EA 1NMAL 2IMNA 3ULUL 4ZPTB 2GT9B 5I66B 3WBDA 3D85D 1AKJB 3QA3A 3HE6D 1YEIL 1CGSH 2XTJE 2Z92B 2BNUA 2EZ0D 3WFCH 2CKBA 1IZJA 1EHXA 2NW2B 1IKNA 4QGTA 2DL2A 4KV5E 4POZC 1EBAA 2YN3A 1U91B 2GEEA 4HWZA 2NY2D 1BFSA 2L4OA 2ARJQ 2Q76A 2UWEF 4NCC2 2Y23A 4NFBA 1MUJB 2KL6A 3D2UA 2VLLA 5SV3A 4ZOCA 3BHBB 4Y2DB 1E6JL 3G9VA 1S3KH 3LRHA 4A2MA 1F90L 3ARDD 1HXYB 1RI8A 4UT6L 3WE6A 3PL6B 3OKKA 4R90L 1RUML 4OZHF 3BEWB 1WBZB 2Y5TA 5EU6B 1R5IA 1LEGA 4WVRA 1U8PB 5HDQH 5L0QC 4P2OC 3FQUA 3H9SE 2AJUL 1B9ZA 3GSNL 1AGCB 1RD6A 4TUOB 1WZ1H 2YK1L 3SY0A 4UINL 5CKGA 1W8NA 2HWZL 4GW5B 2ADIA 2OQJB 5CBAB 1F3JA 3FZUD 3INUH 3OG6B 4Y5VB 4PJXB 1QQDB 1VPOL 2APBA 3CX5J 3RPKA 2DWDA 1NGXA 1IGYB 1A7PL 4Y4FD 5SX4H 4X6DA 1V05A 2BVQA 1F4XL 2R8SH 4JAMB 5J1SC 4PUBH 5IK3A 2EYRB 3IKCB 3MRLB 3IXTB 4AIZA 5H35B 3U2SB 1B88A 4RFNC 1I1CA 5CINL 3T08A 1UM4H 5FO7B 4QXUH 3IJHA 5T3XD 5EO0A 1RHFA 4HEME 3EGSA 4E41E 5H8DA 1AIFA 4D9QD 3MV7E 1UM5L 3OWEA 2QQKL 5CWSA 4XHJD 1FLRH 3EDFA 1LE5A 1G1YA 2EXYD 4NQSB 2OXGA 1PQZA 3UPAA 2GJ6E 4ZUWB 4P46A 1I4FA 3JVGA 3CCHA 5EOCL 5DS8A 3OGCB 4EDXB 4OAWB 1SJVA 3OAYK 1EBPA 4OD1H 4KKBD 1ZE3C 1XCQB 3VH8A 4HWBL 5HHOD 3HC3H 5GGVL 4EKXA 4MJIE 3HE7D 1EVTC 3O8XC 2PXYD 4WHYG 1EHNA 5F7FA 3KLSA 3D0LB 1FNAA 4CNIA 4QRTA 2B1HL 1H8NA 3HZMA 4M1DH 1NCBL 4QHNB 5TDNA 3DSNA 3WIHL 4P9MH 2IGFL 4ZS6D 5EFIB 4U6XA 3GBLA 3UROR 3JV5A 2F9BT 3QFJD 1BVLA 2IF7A 3T2NL 1D5XA 4MQTB 1J8HB 3K1DA 5ICYB 5E6ID 1MWAA 1S7TA 2X4QB 3CFKB 2GIYA 2G60L 4J3VA 3A6CL 5DJDB 1T6VN 3MRMA 4EZMA 4HKBA 4MJIA 4Y5XC 1CE6B 4Z7UB 3L5WA 1MHCB 2PXYB 3CC5A 3ARFA 4NZUL 5DVMA 5E1AA 2NY5C 4YHOH 3EYOA 3QJFA 1CDIA 4FS0A 1FFOA 3ZTNH 4KK6C 3PXJA 1HZHL 1AD9A 4X7TB 2WUBL 5A2KH 3H9HB 5CGYC 4M5ZL 1ZHLA 4ISVB 1M6OA 5D8JL 3TIDA 2ZCKL 2N7BA 4NHUB 1T7XA 1A5FH 4LSTH 2XTJB 3SDXE 4YHKL 2YPLA 5I1CL 4YHLH 1RZ7H 5CSBA 5E8OB 4YQXL 2F5BL 1MJ7H 4OIIH 2QSCL 4NM4H 1S7WA 1HQ4B 4IDJH 4ZO6A 3W9EB 5DK2A 3SKJH 4BKLB 3TYFB 3LKQA 3LN9A 4KKAC 5DYOB 3JWDH 1G7HA 3BKCH 2EE2A 4NO5A 2JCCF 4OGYL 3RWIB 4QF1B 1BQLL 3EO9H 3VXRA 5ECJE 5BS0D 1FN4B 1U0QA 4AZ8A 3MLRH 1EEYB 4I4WA 5DD0L 1PYWB 2P24B 1BZ7B 2R39A 1A0QH 2XNAB 2MWCA 2XKNB 4KI5F 4NQEB 1RZFH 2BY0A 2R4RL 3G5VA 4GG6B 1I85C 2XQBH 3MV9A 4YO0A 3VRJA 3HHRB 1EV2E 2B1HH 1KB9K 4JANB 4KHTH 4KROB 4TVSa 4OZFG 2AQ1A 3EFDH 1IGMH 5C07E 3C6LA 2QR0B 2R23A 2AW2A 3HI6L 4ZTOL 3BP6B 4OGXH 4H20H 3WUZA 2XQYK 2V17H 4DN3L 3QWQB 2GJ6A 4RRPG 3C5JA 3TYGH 1Q0YH 3HC4L 3L3IB 4PGDB 3KPSA 4GMSH 4PJDA 2O26U 4G6FD 4BZ1H 3B3IB 4HXAH 4PLJC 1P4LB 4Y19D 5DRZB 2YWZA 4DWHA 4N9OB 3OKNA 1ACYH 4FXKA 5HJ3B 4QRRD 4RFEB 2AQ2A 3IGAA 3MX0A 1JI1A 4LKXB 5MENA 3QIBD 4L4VE 5BJTA 1CFTA 4PGEB 1KLGB 2RFXA 5IQ9A 1RQ5A 4LLWB 4Q97A 5CD3B 5CP7A 2YHGA 5HYEA 3NPZB 1AGFA 3GKWL 4PUBL 5F89B 2NTFA 1FO0A 3HAEA 1YEHH 4PJ5D 1ZTXL 4LRNH 4GKZA 4D0BA 3RKDD 4J12A 1DSFL 2F54B 2W0FA 4PJIE 4PJBA 4XCYB 4PTTB 2F8XC 3O3AB 4M62H 2YD4A 3TN0B 4P9HC 4OD3L 5IW1A 3B4NA 2DWEB 4TULH 3RDTC 5C09A 1NFDA 1QLRB 1C1EL 4HUUB 4FTVE 3GHBH 4Y4FB 3BD5A 4U1NB 4NGHL 3IDXH 2YMXH 2R2EA 4ONHA 1FO0H 2R0WL 2WBKA 3GO1L 5L7XL 2X7LA 4NO2A 5HHPB 4PJFF 1BD2A 3PWUA 3PXHA 3ULSB 1KPRA 1Q0YL 1IZKA 1RZGB 1S7VA 5AYQA 3ZKMC 5K9KA 1XIWD 3ILQD 3MV9D 3IDGA 3HPJA 2DLTA 5T1DH 4GUPA 5DMGD 4F7PA 1MLCA 4UB0L 1EDQA 4JJHA 1T6WA 1XGQA 3QO1B 1WBXB 5TDOA 2MKLC 2QLVB 4F7CB 1UQSA 3V7AE 1WWWX 4P3DA 3U7WL 5EU5A 5IOPB 3MV11 2HJKA 3HRZA 4R4NC 4RWHA 5F9WB 3CDFA 4XWGL 4MD0A 3CU7A 3QEUA 3AM8C 3MLXL 3G6AB 5CBEB 5IVXB 3FFCD 3O0RH 4KK8C 1JNLH 1A6WH 2HRPL 4Q9QL 2D03L 1T80A 3VXMB 2FJFB 3S37X 3VJ6B 1MCOL 4MNQE 3MRPA 2NY6D 4HXAL 2IANA 3VDCA 1MF2H 1X7QA 1ETZB 3D3VD 4OKVB 3CU1A 3TPUA 1EGJA 5F7EL 3QUYA 3QG6B 4CMHC 3BDXA 3WFEL 2YUXA 1AGDA 4F58H 3V7AG 3WHE0 3PWJA 1KTRL 3ZDZF 4G9FE 3QRFM 3L3GA 1NFIA 5C0JB 3LS4L 3HUJE 4UBDD 2Z35A 1ZEAL 1DL7H 1YEDA 1ZGLM 1ORQA 1U8NA 2AXFB 1KJMA 4U49A 1MFBH 1YQVL 2A0LC 3IU4L 3VXSB 5I1JH 3RWJB 1YMMD 3LKRA 5DK0A 2HT2D 1U8QA 4L3EE 3NCEB 5EZIH 3TZVD 4KQ4L 4KKAD 4HULB 4XP5L 2XZCH 4JN2A 2NY7H 4YIQA 3O4OC 3GI8H 5IKCB 1OTUD 1P1ZA 4GS7B 4ZNCD 4XP6H 3MLPA 1DQDH 5DRXB 3MJ7B 4HC1H 1NL0H 4FN0A 3DUHA 1KNOA 1BREA 2I24N 3TGXA 2I60H 5DDHB 1A1MA 1WEJH 4ZUVA 2C1PB 5LXGH 2QADD 5GGTL 1JF6A 4NWTH 3L3KB 4X8JB 5FXCH 5LCVL 4UV7H 4PGBA 2BDNL 5I1DB 5FUZH 3GSVB 5E1HB 4Y4KD 4PP1D 3CFDB 4KTDL 3S36X 5EOCJ 1VESA 4JFFA 2KUTA 2P5WA 1DUYA 3AMKA 4ZOEA 3VFWA 5CLTA 1AY1L 2Q1EA 3OZ9H 5BS0A 4EBQH 3MRJB 3EO1A 1U3ZA 2CGRH 2RR3A 1EFQA 4KVCH 1UXWA 4ZFOB 3VD9A 4Y2OA 4J4PA 1JPST 3MRCA 4WW2C 1REIA 4NWUL 3T1WA 3U0WH 1FG2A 2AEWA 5F7WC 4C4KO 1F4YH 5TFSL 4WI4A 2WMPA 2QKIA 5DA0B 5IM7A 2IH3B 4YXKL 4C55A 5E6IC 1AH1A 1YEFL 3ZL4L 4C56B 4C83A 3N9GL 2M26A 3V5DB 3K2UL 1CXFA 4P3CH 3DOSA 4OCRL 1L7IH 1N4XH 4OF7A 4CVZA 2FLBT 1KTDB 3KPMA 4GBXB 2EKSB 5D2NE 1NDMB 1YPZB 3B9EA 4PJAB 1F3RB 2GITB 3VWKD 3P4LA 3UBXI 1AR1D 4ODWB 4YHYC 4K71B 3P4MA 1KJ2B 3PE9A 3VA2C 1EVUA 1MJUH 1DLHB 4M7KL 4LLDA 3U30B 4WDIB 4HWNA 3NFPB 5I1KL 1LK2A 2J5LB 5EA0L 5FA4B 4PJ5E 2OBGA 4QOKD 1OTTD 1FNEA 1K4DA 2J6EA 1J8HE 2VXSH 3VFTB 3BISA 5IVZB 5JLZA 1U92B 3KXFB 1DP0A 3S36L 4HLJA 5DUBB 4LNVA 1QYGH 1S7XA 3TA3D 1OD7A 3U1SH 2CDEB 3TO4C 4Y4HB 1FYHB 1DQDL 3FHAA 3ARGC 3R4DA 4N0FA 3VFMA 3JWOC 3HR6A 4NSKB 1HHHB 4TVPE 4PJEF 4TNWF 3KLHD 3TVMC 2HH0H 4WO4A 4OB5L 5I8CA 3QIWD 5CILH 3MNZA 1NC4D 3SDAD 1CGYA 4UOW1 1RIUH 5EC1A 3O6FB 4JFZH 4ZO8A 1F8TL 4Y5YB 3HNSH 1INQA 2L0DA 3Q6GL 4Z7UE 2VLKA 4ELKB 4BQCA 1MELA 1CLOH 2X4OA 2ZNXA 3ARED 3S6CA 3BP4B 2P8MB 5FO9B 2VQUA 4XXDA 4DEPC 4AMKH 1WFUA 2X2YA 4APQA 2ZNWA 4BQBA 1TJGL 2DQIL 4OTXL 3ZKNC 3TJEL 1NFDF 4N1EA 5JPNA 2EXWC 2MCPL 4Q9BA 3CVHA 5JIIA 1B0RB 1A6UL 3UTTA 5F70A 3RNQB 4AIXA 3F12A 1KXTB 2ZJSL 5FCUL 2JB5H 2DRUA 4WW1B 2XXCB 1T0PB 1KEGH 1OAKH 5DMJB 4LHUA 2XQBL 3MZTA 4GRLD 3GMLA 2H26A 4OUOA 3CXHJ 2BNRD 5D7LE 3DECA 2CLRB 1C5CH 4XPTH 3QFDB 4DUWA 3MRDB 4GFTB 2IPKA 1KENH 3R8BB 1S7SA 2VWEC 3QO0B 1A7OH 2DBLL 5ISZD 1MCKA 4GMTH 4RX4D 1TJHL 4ZODA 4XCNB 5H94A 4F7MB 4PJIB 3QDJD 4MQ7A 5DHXB 4QTIL 1R3KA 1MIEH 4PJDF 3DROB 4PTUA 4MLIA 3L6FA 5L8LB 1WITA 5F1IA 5DHYA 2GCYB 1OLLA 1AO7D 4RFOH 5FEBA 4MQSB 3MROB 2VLJD 2X4PA 5MI0B 2VH5H 5JOFA 5JHDD 2GSIB 3UTOA 2IFFH 4Y88A 1MCLA 4MDJA 2AKRA 1JL8A 3QR2A 3UZQA 3I75A 4MCYB 3RZCD 4E0RB 3ZDZE 4DEPB 2Q86B 3D48R 4MHHG 2IAMD 2PYFA 2NX5E 3I6GA 5CEZH 4CADA 5F9OH 1FDLH 3GJFA 4JFED 4L8CB 1WISA 2PYED 3STZB 3AREB 3CNKA 5FYJD 3MRBA 4WJ5B 1FPTH 1LILA 1MI5D 3DBXB 4MQXC 2NXYB 3TT1L 3X12B 5JPMB 4PB9L 3TVMA 3PNWA 1K3ZA 1EUTA 4TULL 1UVQA 4HKZA 4OBRA 1LO3L 3GSXB 1NMBL 1UGNA 3RGVB 1W72L 5ITBH 5ALBL 3EDEA 4PJ9C 4GXUM 1FZOA 5D2LE 5ICXB 4LVEA 3NZHH 5HHOE 2PO6A 3DARA 4XXCC 3TIEB 2AK1H 3MREA 1C08A 3MV01 1RZ7L 4X5WB 3EYUH 1EA9C 1P6AB 4H88H 3JV4A 1F2XK 5EUOA 3WDHA 8FABA 1NGZB 4WENB 1DQJA 1N0XH 2NY6C 4G3YL 1MVUB 1T83A 3DJ9A 2ICEB 3MUGA 2C1OA 1LP9F 5EOQH 4UV4L 1TVBA 2M8XA 1BLNB 4HZLB 4J3XA 3QCUL 4KK8D 3QAZB 3HZKA 4TOYL 4IHOB 4ZOAA 2NY4D 2CUMA 5ALBH 2ZUQC 5KVDH 1FO0L 2GW5A 5DR5H 1JF5A 1XF3B 4LSSH 3MV8A 3NIGF 4UIKL 2H41A 1JPFA 3AC0A 1TETH 3VI3F 1NGPH 5EO1B 2KQMA 1DQQB 1FIGH 2V5RA 1RU9L 2EDQA 4ZFOL 4OUUB 3AUVA 4L1DA 5C3TA 4Y16B 4RAHA 3C60A 4WV1A 4LIQL 3QSKB 2NCMA 5JIHA 3ZKMD 1ZK9A 2R2HA 4HPYH 1ORSA 4JPIB 4POUB 4RCAA 5I73C 1QPXA 5KVGL 2C3VB 3VMOA 3QT2A 5I1CH 1XF4A 3IFOB 5ADOH 1TJIL 2DS4A 3AS0A 3DUUA 3DIFA 1MJJB 3SKOA 4FQXB 4X6EA 3MLWH 3HMXL 3OMZA 4PRNB 3OB0K 5CJXA 3SE4A 5ENWA 4QO1A 1FG9C 4J8RA 5I15H 2K3TA 3RWFA 1T66C 3KPQB 5IIEB 4G9DB 3RX8A 4P4RA 5ESAA 3ZKQD 1KELL 1M7IB 2OX5A 4I77H 3FCTA 4JO1L 2L7UA 1NDGB 5D7JD 1F4WH 3OTTA 3UDWA 4L4TD 3LS5H 4K8RH 1J1PL 4ZQKB 1IGFH 4QHMB 2YPKA 4NQCD 2VZTA 3RWHA 2VDLL 4QTHB 2ZUUA 3V0AC 4H25A 3OXSA 4G8FB 4CVXA 3RTQB 1WBYB 2VKWA 1OF2B 2QQKH 3BGMB 3VCLA 5D7LD 5EU7C 2ILLA 4KJPC 5TE4H 1RIVL 4E9LA 3BZEB 1R0AH 1ODAA 3EFDL 3GRWA 3CPLA 3A6BL 4KRLB 4RZCA 4S1RL 4O2EA 3TN0C 2VLRB 4LPTA 2IAMA 1U8MA 1YJDC 5GJTL 3PDDA 5MEPB 5DEGB 3I9GH 4GKSB 1I7ZA 3IVKA 4PG9B 5DJ0B 3VFPA 4N0YL 5JW3L 3WEXA 5L2JB 5ICZA 2F53E 1CLCA 4U0QB 3O11B 1BQHA 3FQXB 4KAQH 2V5SA 4PJ9D 1UB6B 4RQQB 3GIVA 4ZFZA 2ICWI 5I8EA 1ERNA 4MB4A 3O3EA 4HWUA 1KN4L 1N3NA 2OXHA 3D85A 4X7SH 2CIKA 2DQCL 1GXEA 4X6DE 5KVEH 3CUPB 1TETL 1KUMA 2MOVA 1MJUL 4G8IA 4M7JL 4RGMC 3Q3GA 5L2KD 3DETC 4YAQA 3H8NA 3B5GA 1HNFA 1OQOA 3VFSA 4H20L 4P9HL 3O3BB 4FABH 3ZSSA 3MGOB 2FHCA 1CDUA 1YJDL 4UOW0 1ZS8B 5CD5C 4OKDA 2Y07L 2KPNA 4RMVA 1T20A 1TFHA 2G5BA 3QDMA 4C54A 5SX4I 4KUCF 5IT2H 5J3HC 5E2TL 1MFDH 5C0NC 4XNQA 5A43C 2JCCE 3DRQA 3EYVB 5JXAL 4YUEL 1DR9A 3KPRA 4JVUA 4R2GB 4JZNB 5EN2A 1K4CB 2H8PB 1F4YL 1MHEA 2RGSA 4QXWA 1J0IA 1CL7H 2CO6B 4AEIH 4U6YB 4K3JH 1EJOL 3ARBB 3MGTB 2DKSA 3ISWA 1KB5H 1TVHB 2A6JA 4R2GD 4M9OA 4HUKB 4QEGA 1DLFL 5L6YL 2D7OA 3MOAH 1T1YA 1QFOA 4GMSL 1IGCH 4YQXH 1CXLA 4TUJB 4JREB 5EU7E 1D6VH 1UYWH 3I84A 5DJ2B 5HVHB 5FO8A 2JB6A 1BZ9A 1FLRL 3KWWA 4R96A 1LMKA 1G7IB 2RIKA 5ABDE 3F6LA 5F9JB 4Q6YA 2AK4E 3AS1A 3WDJA 4OSUH 3BO8A 4ODHL 1K2DB 3WFDL 1AHWB 3K8MA 2FWOA 3QXAA 4O00A 2BFVH 2D7QA 4J3OC 3DYOA 5HDOA 4NT6B 2LTQC 1HHJA 2D0GA 2AJUH 4WFFE 4F37K 2QL1A 1RZFL 2NXYD 4TRPL 3DO3A 3PGFH 5CEYA 1XGTA 3VFVB 5J6GA 5E9DB 4OF6A 4QRSA 3SHSA 4JEGB 1GC1L 1HCVA 5DHVA 3SE9L 4FHBD 1VPOH 4EN3C 4XB7A 5ELIA 2R2BB 4I2XE 4MNHA 1DEEB 3FOLA 1W72H 3SY0B 3PWPA 4DCQB 4LLAA 4XNYH 5L2KA 1QFWH 1OTUC 2HFGH 4DJMA 3QJHB 1UM4L 4KJWC 1JWSA 2FD6L 1RULL 4EI5C 1U8IA 1H3GA 4Z7VF 5J6HA 1ZA6B 1TZGH 1K6QH 4MYWB 5HHNA 3C5ZB 3O6LH 1KJ2H 1LP9E 3N0PB 2YPVH 5BV7C 3ARGD 3IYLW 5KVMC 3DV4B 3TJHC 4M03A 4K3GA 3HC0B 1QRKA 1BOGB 5GRWA 3QZWB 1EO8L 5F96H 1OAXH 4DGVH 5EDXA 1LE5B 1EZVY 5EBMB 4RMQA 4ZUUA 4X6CF 2GJZB 1KXQE 3KJ6L 2I26N 5FF6B 3BKMH 5T1MA 3TJHD 2MQ3A 1L6XA 3K0WA 1AQKH 1CIDA 1YECH 4A2LA 5D1QD 3BH9A 3CCHB 3QUXC 5I19H 4BH7A 3VWJC 4G6KL 4EDXA 5K9JH 4KRPB 3WFCL 3RPIB 3CFCH 3V0VA 1RPQA 3NIFE 3V4VH 1XCQA 4KGLA 3U83A 4XNXL 4ZS7H 1FE8L 4Q6IA 3RWDA 5I8KL 4ELMA 2BFVL 4XZUB 2W9EL 2HTLD 2C3HA 5GGUA 1ZVYA 5CMAA 3VXUD 1FFRA 2VDRL 5HI3C 4AH2B 1QBMH 4HUVA 2NY0C 3AGVA 1HYSD 3FO1A 3TBVB 3VMNA 2HTKC 5D7LA 2CDGB 1JGDB 2O5YL 3G6JF 4OLZH 2YA0A 1EEUA 1MI5B 1FL3B 5DD6B 1T7YA 5J89A 5GGQH 4Z7NE 1S7TB 4K3DH 5MEOB 3ILQC 2ZUXA 1BP3B 3QXWA 3LKPA 4KZDL 4WEMB 1UWGL 4NC0B 4HS8L 1FGVL 4JRYD 3E6HB 3FN9A 4RBPH 2X1WL 1H0DB 4Z76A 1LE9B 1F5WA 4UTAL 1IEHA 5KS9F 3HUJF 1JHLH 2C9AA 1GAFL 3QUKA 1U3YA 5EG6C 2OI9B 1RUMH 4EJ1C 3O6KL 4LCCA 1XCTA 5L0QB 5B8CB 4JQXA 5JHDB 1I9IL 2EIEA 4O51A 1FFOB 1T1XA 2ORBL 3QQ3A 3PL6D 4ODVL 4X7TA 35C8L 1VADB 4NQDD 4Y5XB 1OGAA 5BRZE 1VCAA 2ZOLA 3HNSL 4CDGC 1GSMA 3C6LD 3TIDB 3UTQA 4GS7C 3WLBB 4ZMAT 5DJAB 3NAAH 1FCGA 5F6IC 4U6VH 3S4SG 1H9VA 1OB1B 1NH6A 2H3NA 1QR1A 4ZO9A 5C6TH 4Q2ZA 2R56L 4JM4L 4Q0XH 2YD2A 4IOFC 5ISZB 2GJ6D 3MXVL 3I6LE 5CJBA 1SJEA 1RHHB 3SKMB 4P5TC 1FYTB 2UWEB 3SKNB 5J1TC 3QEQD 1Q9KB 5E9DD 1U8KA 2DOCA 3PWNA 3QIUB 4M6AA 1KN4H 1W0WB 3OJDA 3RWGA 2KDGA 5D1XB 3DX6A 2DD8H 5C0ND 1YNKL 1Q1JH 1UACH 1IGML 2EYSB 2APXA 2HT2C 4PJCA 3SJVE 3MNVA 4MDIB 5JXED 1RSFA 5I1LA 4FZ8H 3TBWA 1BBJA 3GSNB 2A0LD 1EEYA 4I4WB 4JFYB 4LK4A 2CJUL 4QYOA 5EUOF 2PTUA 1O7VA 4QLRA 3LKOB 3WS3B 1YNLH 1IAOA 4G8GD 4GRWH 3AXLA 5DRNA 4DOHB 4TUKH 5JR1H 4XBPA 4KTDH 3QUXA 5DUPL 2QR0A 3ULUF 3P11H 4OZ4A 4OM1H 4LBEB 5HHVH 5LCVH 5GJSL 3MUHL 4YWGL 5BVJB 1MHHA 1QFPA 2X09A 1B4JL 5LXGL 3TLRA 3BQUD 1TQBC 4IRSB 3D25B 3K74B 4PJ7B 3IFLH 4GW1B 4JDVA 3WD5H 4S1QH 5F6HI 3OAZH 4I77L 4UIMA 3RGVD 1KT2A 4U4BA 3GNML 1U58A 4NRXA 3OG4B 4PFEA 2PYEA 1AGBB 5IVXE 2AJXL 1CXEA 5CGMA 5EOTB 3W9DB 3N1MC 3U6RB 2P8PB 1SY6H 1XIWC 1BMGA 1CGXA 1IAII 1OARL 2XKSA 2BNRE 4KMQA 3L3DB 3OKEB 3A67H 5KVFL 1HILA 5E08H 2F53D 4G6AD 1EXUA 3PG2A 1I3GL 2QBWA 1VA9A 5FYJH 5EIIB 4U1IB 1CQKA 5I17B 5EBGA 4G7YH 1OWWA 1Y18A 3H42H 1MH5A 2XWJA 3SE3C 2P5WE 3FQWA 1E6OL 4JRYA 4JFOB 1SYSA 3VGGA 3P9MA 2VDMH 3MOQA 4PY7A 1A6VH 3HNVL 3QDGA 3FO2A 2D03H 6CGTA 4NO0B 4FNLL 4YHZH 1L9NA 4V2CB 4B7IA 5IJKA 2FBOJ 5A3IC 1YY9C 3O6FD 4L8SA 3FTGA 1I75A 3X11A 4G8EA 5J0BA 1Z2KA 2VLRD 3FRPG 2XRAL 4Y8DC 2HA1A 3PV6A 5C08A 1QRNE 5E03A 5KBNC 5DD5L 2VQTA 1XF5B 4IS6A 4OLEA 5BMFH 2DM7A 3D9AL 3TCLA 1FNFA 3HE6B 3T4YA 1DBKH 1WBXA 5TDOB 2MTPA 1IM9B 4MAYD 2ITDA 4MZ2A 5JORB 5SX5H 2CR3A 4CMMA 1ZMYA 4MJ2A 5DJCA 4M48L 2HRLA 1VKXB 1Z0MA 1D9KA 2QEJA 3MLZL 5DA4A 4QRRA 3SBWA 1FL6A 3QWRD 4L4TB 5F7EH 5MP6H 5GZOD 2LQRA 2NY4C 1WIPA 1UM6H 1AXIB 1OM3L 3W0WD 2DICA 5I2IA 1TXKA 4TNVK 4J23A 4KY1H 3MCLL 4PGZA 3RWEB 5HYFA 3VJ6A 3ULVE 3RL2A 1S9XA 4NRYA 1CXIA 5J13C 3MYJA 4KRNA 3E8UH 5HGDA 3MA9L 1LGVA 2GY7B 1J8HD 4P9ML 2QSQA 2Y4SA 4WI7A 3L5XL 3AY4C 4MAYC 3WFZA 3D39D 1EAPA 1UZ8B 2BNQA 2V5TA 3KS0H 4MJ6B 3S3JA 3NTCL 4YHPA 2EH8H 1HHKB 5FUCC 2P48B 1ORQB 1U8NB 1CDHA 5C9JA 3BXNA 3TBTB 4YDIH 1BJ1J 5J12B 3QIWB 4YDJB 4BFEA 2OZ4L 5AAMA 4YHIB 5C07B 4EUPA 3H3BC 3SE8H 3BQUA 3G6JE 5C6WH 4ODTL 2P49B 3Q0HA 2NX5A 3S37H 1BBDH 4Z77B 2L7JA 5BW7C 1Z6JT 4P57A 5INDB 5I76A 4DOHE 5C0AE 2NY1C 1BFVH 1IQDB 3TP4A 1Q9OB 5GPRA 4GMTL 3SDYH 3VXMD 1KNOB 4PJHB 2BVTA 1U8HA 5IMOB 2AGJL 4U0RB 3P2TA 3U0PA 4HK3J 5CFHA 4NRZB 4XNUH 5C2BH 5CINH 3BT2L 4XPTL 5D70H 5ADOL 1K9TA 3WIFB 3O45A 4Z5RB 1FFNB 1T5XA 1VFUA 2EDJA 1G7LB 1LVEA 2HT4C 2PW1B 3UBXG 2BJMH 4NQTA 1YNKH 3WXWH 5JZ7D 1DVFA 1UB5B 1WK0A 4G43B 5FM5M 4XBGB 3T0EB 1T66D 2W07A 5GQBA 1BFOB 5D72L 2R4RH 5IBUG 2UY6A 2F53B 2VAJA 2X9YA 2YA2A 1OP5H 3F7RA 2J8UB 3BIAX 2JJSA 3RVWD 2CLVB 3SDDC 4OCSH 3H9SD 4ZSOA 1B4JH 4P2QD 3RFZC 5J9PA 3BP7B 4JM2D 4LSSL 5HHXH 2VLJE 2W59A 1DDHB 2VABB 3O2WL 5DJ6A 3VG0L 3Q6GH 3SOBL 1IQWH 1WC7B 4XMKH 1J05B 1NSNH 3B6SA 5GRVL 6FABH 2A6KB 3I02B 3TZVA 4R3SA 2ITCB 4JG0H 4HIEB 4HMEA 3HI6H 3T0EC 1MPAL 1HE7A 2VZVA 1U42A 5F7LB 1MY7A 3WYRA 2C7UB 1KJ2A 4FTVB 1I7UA 1NL0L 4JO4H 3O2DA 2HFEB 2OTUB 3MCKB 1R5IB 1QNZL 1NCTA 2B2XL 2MPAH 2WWKO 4PLOB 5DJ8B 3SJVA 4P49A 2XACC 2VZUA 1Q9WA 4YEEA 4X6BA 1TNNA 2PO6C 4DAGL 1I7RA 3LH2H 3GMQA 4G5ZL 4FG6D 1KG0B 1NANH 1RUAL 4KDWA 3BD4A 4LLVA 3CXDH 3LHPH 3QXVA 3IJSB 1R5WB 1KV3A 2IG2L 3MJ9A 3AFLA 1J5OH 1MEXH 3L3HA 4MA1C 3IDMA 1CD1B 3FFCE 5IVXF 3OXRA 3UEZA 1IGCL 4X98A 5T1KB 3TVMD 4LAJH 4KRMB 3OKOB 3IDJA 3HG1E 1MAKA 5FO7A 2LU4A 3WIHH 4U6HB 1DJSA 3L95A 3WUWA 3W81A 3ZYZA 1T21B 4UMGA 3FB7A 2CIIA 2F5AH 5ID0A 5J1AB 3V4UL 4G5ZH 2C3GA 3WKMH 4YK4B 3PL6C 3U48A 1WGOA 4NQSA 2AEPH 1P4IH 1JK8B 1JHTB 1JFQL 2ATPB 3RVTD 1BHGA 2BVPB 1A6AB 1J0ZA 4XXDB 1FYTE 4F33A 5FK9A 1JBJA 4FXLA 1JTPA 4IMKC 1ZHKB 2GSGB 2PW2B 1HSAB 1T0MA 2V9RA 4BJLA 3SQOL 12E8L 2CXGA 3LPWA 4P2CG 3AB0B 1JPGA 2YD5A 3ECBA 1MPAH 4WHTB 5GJSH 1RJLA 5E8NB 4X6CA 5JOEA 1I8IB 3O41B 1FVDB 5LKNA 4QRTB 1QFWL 3V4PL 1CDYA 4QXUL 3NCBB 1G6RL 2FIKB 2Y6SD 3V2AR 4H1LB 1CR9H 3FQRB 4RMUA 1Q9LA 4Y19B 4WNQB 1NCBH 1BBDL 2CLRA 3Q2CA 4FMFA 4UV7L 5EH1A 1TCRB 1GZQA 2Y06H 3S3PA 3WIIH 3X3GH 2APWA 3MA7A 3LB6C 2EC9T 4I0CC 2IQAA 4MA7H 3KPLA 4L3CA 1U91A 5I1GH 2B8OT 4AMKL 3HLAB 2FO1A 2E9WA 4AM0A 4YNYA 3VE0A 2IADB 1GVIA 2R1YA 2R0ZL 2FL5B 2ZG3A 1I1RA 3RHWF 4JR9L 3LEVL 4KQ4H 5L88L 1HIMH 1MIML 3Q48A 5F1IB 4LFHG 4HIIA 4R7DB 4KK9C 3GI9L 4P4KC 4JQVC 1W0VA 4YX2L 1DQMH 2FD6H 1N8ZA 2RCSH 4OB5H 4MDJB 2DYPB 3BPNB 3SGEH 5JA8B 1FORH 4QRPE 1YN6A 1HQRA 4XWOD 2DLGA 3N9GH 2C4FT 3ALPA 1GGIH 5IHLB 2NY3D 1A7NH 2FZ3A 4W6XB 5FV2A 5HI5D 4GW5A 3GDBA 1S7WB 4ETQB 3BYTA 2I9TB 4D8PA 3IDXL 2SEBB 5IWLA 3B5TA 3U0WL 1VEOA 1T0NB 4JRYE 4UTBL 2HWZH 2NY3C 2PO6D 1IC7H 4YGVB 1HXMB 1QEWB 1UA6H 4LEOB 5A40E 4MA3A 2FHFA 1CICB 3HG1D 4NCDA 4YHNA 2EIDA 4YE4L 2DLFH 3IFNL 4K9EC 4JQIL 3ARBC 5C0AB 2ADFH 5K9OB 3T1FA 4GH7B 2JJVA 3U46B 4XC1H 3KPOA 1UZ6E 2D7NA 3JV4B 3EJZD 2CRZA 4JY4B 4RAUB 4DUXA 4FP8L 4Z7WF 3CSPA 4XVTH 5DS8B 2JK5B 4PYHA 3QZWG 5L6YH 3HR5A 2VDML 1VACA 2ZSVB 5DI8B 1A3QA 4QKXB 1ZGLA 2QJDA 5JXEC 1E4XI 3REVB 5C0DB 5EZJB 2UVEA 5E0QA 5J11C 3HZKB 1MAJA 2FJGA 4M4PA 4PGDA 1WTGT 3PGDA 1IGJB 4OQTA 3V6OA 4NNXA 4NGHH 4QNPF 3I6KB 5GXBB 4NKOB 3GHBL 5E94B 1D6EA 4FFWD 1CGSL 4WI9A 3OKNB 3VXPA 3I9GL 3QFJB 3CFJA 3ES6B 4OUUA 3D3VE 2VYRE 3FONB 4Z7WA 3RVWC 4BSWA 1QFHA 1CFTB 5AUMB 2Y7QA 2A74B 4H0IA 3MRIB 4KHTL 3PABB 5F8QC 1QVOA 3ARDB 2JCCA 1FO0B 3HAEB 5IB3A 3RVUC 4W4OC 2LV4A 5TQ0L 4EVNA 4W70A 4N8CL 3MUJA 1DZBA 1SQ2N 2OTWA 1MCOH 3UO1H 1J1PH 1JUFB 1CE6A 2DQEH 1MHCA 2LFGA 1UXSB 4CJ0A 3S96A 2X44D 1X5JA 1EEQA 1PLGH 5LJYH 1FAKT 1VFAB 2WINB 3P9LB 4HFUL 2LU7A 4BQ6A 5GRJL 2I5YH 3ARQA 1VFBB 1CBVL 2CQVA 1E27A 4G9DA 2ZZUT 1AI1H 4O2CB 4KXZI 4MJID 2QHRL 1KIPB 3IS0X 1PKOA 3FT3B 5DC0A 3HMXH 4IDJL 2R2EB 4ONHB 3KGRA 4G6ML 5D1ZD 4K3EH 1LEKA 1Q94B 4APQD 4OIIL 1IBGL 4P4KA 5D72H 3ET9F 4TTDC 5CEXA 4FQIH 2V17L 3WJLC 3ARRA 4Y2DC 5E2TH 3CLFL 1U2CA 1DQLL 2ESVD 2ZCKH 4LRIC 2HFFA 1IILE 3S4SB 5IESL 3LV3A 3MOBH 3DVIA 3LQMA 3KHOA 4F2MA 4P59H 1EHLL 1B6UA 5DEFA 2AAVA 4YHOL 1AJ7H 2F58L 3WEXB 3D18A 5F8RC 3RVXC 1C1EH 2X9XA 3F7VB 5DR5L 4LCIH 2P42B 1CDBA 4KFZC 2J8UE 2VXUL 1FGNL 4ONGL 2BC4B 2LAGB 1N59B 4BK5A 4IIQA 3BPOC 4WTXA 3REWB 3QDGD 1OAKL 1TQCC 3C5SA 1ZTXH 1TIUA 2OS7A 4FQXC 4HUXB 3T2NH 5FDWA 5T5FH 5HYJE 2E7CA 3BD3A 5FGSA 2WBJC 3EOBB 2OK0H 2BOBA 5KVGH 5C0JA 5C8JA 2Z35B 1ZT4B 4ZUTB 1C12B 2DJUA 2WLYA 3IJYA 4H5SA 4ZPVA 3U0TA 4PJDB 1G7JB 3GB7B 1AI1L 4CU6A 4Z0XB 1P4LA 5DO2D 3QQNA 4HFUH 3FT4B 3ZKXC 1AKJD 2P7TB 3DRQB 1YDPB 3EYVA 4LSQL 3SDDD 3JVGC 5ACZA 3WNPA 1FQ9C 4CW1B 3PP4L 5C0RH 2E6JA 5C07D 4C59B 4PGEA 3TPKA 3ZT5A 4PRIA 5D7IA 3V95A 5GGRY 3UPCA 2VXQL 1JZ5A 3OL2A 3MRHA 3SO3B 5IESH 3FL7A 3DXAA 2UYLB 3B9KA 3QPXL 4BH8A 4PTTA 1J87A 4FQ1H 4HK0A 4JFEA 5DD5H 2BRRL 1IL1B 2AV7B 3NCYS 1QSVA 4NCC1 2A83B 2P5WD 1BQHG 4MX7A 1RFDL 5CIPH 3VD3A 4Q9RH 5I1IL 2BNQD 1BD2D 4L8DA 3X3FL 4DW2L 3HG1A 3LEXB 1JRHI 2G5RA 4RDQF 4ZFFB 5CSGA 1ACYL 3BVNA 1GGCH 3P0VL 5CJ8A 4XAWH 5F96L 3KLAA 4E42B 1KACB 3JWDL 2XWTB 2OR9H 2EH7L 3PWUB 1NAML 5E95B 1G7QB 2BHUA 1CK0H 2Y9RT 4CVUA 5C0IB 2X4NA 5FGCB 4LSVL 1YEGL 5HYJA 4UIKH 1JV5A 1C16B 1DBMH 3MBEA 3UTZA 2X1OA 1MCWW 1MLCB 1VFMA 4KKLC 5AZ2H 3WUWG 2Z4QB 5GGSY 1RUPL 3J7HA 1NEUA 3MJ8A 5FYLH 1Q72H 4TSCL 3ZKSD 3QUMA 1S9WA 1INDL 5L2KB 1S9KC 5IOPA 2VTFA 3DX8A 4M5ZH 1KN2L 2PETA 4JRXD 1F13A 2J6EH 4M5YH 1VEMA 4LHUD 4HJJL 4ODSH 5F9WC 4K23H 5CJQH 4CMHB 1TJGH 1KCKA 4YXLL 4JFDB 2NZIA 5D1XC 3D3VA 4Z7WE 3Q6FA 5DGRA 5C0BD 1RK1A 4KU1A 3C5ZA 3KPNB 1CFSA 2DQJL 3WDIA 1P7QD 2B5IB 1G7PA 5LBSH 4ZD3L 5JUEH 3Q1SL 5FA3A 1BOGA 5FYKL 3QUYB 3S34H 5HYIA 2VO5A 4BZ2H 1FZMB 3LKNB 2B1AH 3H3PL 1NCDL 2O61A 1RIUL 5F1KC 3NOIA 3FO9A 1C5CL 4KROC 2FX8L 3H0TB 3QQ4A 2IAND 4QCIB 3F7PC 2CKNA 3T0DA 3V0VB 4QHUA 3P4NA 4PRDB 4TOYH 1NAKH 2X40A 3ZYIA 2H32A 1IM9D 3T0BA 1IEBA 3LDBB 4WW2B 2XY1A 3GK8H 4OGAC 4XTRD 1DBBH 4Z6AT 3B5HA 5DVKA 1Q1JL 5GGSA 3TN0D 1BGXL 2JTDA 5GSRB 2EDRA 5D7JB 3RI5K 5GISL 4MA7L 1R3LA 2NTSP 4OTXH 4XVUC 3BDYL 3X3GL 5I1AB 3JWOH 1EUUA 1A1MB 5DUML 5SX5K 1QSEE 4Q9CA 2X4SB 2HVJB 5HHQA 5T1LD 4NZTH 1MI5A 5DD6A 3VGHA 1NC2A 2D0HA 5I30L 1UH3A 4NJAL 5CJQL 3V8OA 2DM3A 3KNBA 1F90H 1A6PA 2CDFB 3ARTA 4HV8A 2VZ3A 3WXVH 1ZLWH 4DKEH 2WW8A 2NY0B 4J4PD 3QNZB 4JJ5A 1H3VA 3DXAD 2GK0B 4AG4H 4PD4K 4HGMA 2EDXA 2ZPKH 35C8H 2Q7NA 1NFKA 1L0XA 1Q72L 1H15A 4TSCH 1YMHA 1EX0A 3CVHL 1MRFL 3ULVD 1RUPH 1OSZB 3QNXB 5ADPH 1O5DT 4ERSL 4A6YA 1JYWA 1FV1B 1SJHA 1V7NH 2IH1B 3H3KA 3MO1B 4NPYB 4S0TD 5IBTH 3LOWA 5FM8A 2EICA 2GTZA 4GT7A 2JB5L 3OKDB 2Z92A 4XMLL 4N0CC 2J7LA 4B50A 3DURA 4LPVA 1W2KT 1A6WL 1YMMB 3EUUA 2VE6B 4Y4HC 3BP5A 5EZOL 3ULUH 4JE4B 3C5ZD 4WTZA 4OLYH 4LNRB 4WFHD 1A9BA 3GSNH 2BCKB 3VFOB 1NEZG 1ES0A 4GG8A 3QULB 5ISZA 5FECA 3FFCB 5CP3A 2UWEA 4PJXE 3SKNA 3SPVA 2IALA 2V7NB 2G9HB 3CDYA 5FUOL 3F5WA 5IEKA 3TA3C 4D0DB 5JXEA 1JF1A 2NW3B 3D69A 5DHYB 2FGZA 3X17A 1PY4A 1HXYA 5IMKB 2AEQL 1WBZA 1LHZA 2DAVA 4L9LC 2HJLA 3TBWB 3KPRD 3WXVL 3V6ZA 3V5KA 4HWEL 2VXQH 1K8DA 3RZCA 2IBZX 1E4KA 5C0BA 3WS3A 1Z3GL 1KEGL 2D7TL 4ZXBA 4B41A 5EC2B 3U4EB 1M05A 3QBTB 4PJAF 4XC3L 1I1AB 3BRGC 1CGUA 4NJAH 5IHBA 1GGBH 4A6YH 1DN0A 2EIBA 2YC1B 2NY7L 1G6RB 1NGXB 2V5MA 1S9YB 4LSUL 3VGDA 5IB5A 5E5MA 5HI5C 4Y5VC 1U8JB 4L3AA 1OSPH 2ZG1A 3WFHB 3IKCA 3MRLA 1V3KA 4ODHH 4L3EA 3K8KA 1RJYA 3TWCH 3U2SA 2YSSA 3RGVA 4OT1L 3I2CH 4B5EA 2IPTH 5JDSB 4W81A 1QBAA 4PJ7A 1A6TA 1AHWC 4MJ5A 2BSSA 2P47B 1W72A 2YKLH 5DQDH 2DQHH 5E99L 2BY3A 3BUYA 4I0PA 4WO4C 3O6FA 3Q5YA 4LAQL 4NRXB 4R4BB 3ZDXF 1AGBA 1HHIA 1PY9A 3ZHKA 1DQJB 2IAMC 3EW3B 5T33H 5KANI 1M1SA 1MRFH 1MCEA 4X4XB 4LSPH 2HLAB 3DX7B 3L3OA 3G5YA 2YBRB 5LBSL 3OB0H 2XFXA 4K94C 3QUYC 2ARWA 1A2YB 3EYSH 3KYOA 1WSST 3UC0L 4OZFB 1LDPH 4NKMA 1HILB 3CVHB 5T3XL 5MEQB 3OR6A 3T2QA 5LAXA 4LQ1A 2EEBA 1RV6X 4LF3A 5F88A 4HGWB 1SYSB 2NY2C 4ACPA 3MRKB 1VGKA 4NWUH 3QDGB 4HBCL 1X5IA 1FIEA 3MODL 1A3LH 5ACMA 3QXDB 1KB5A 3NABH 4MSWA 2GJJA 4LOUD 4D0CA 2XG5A 5IR1A 3MLTB 4PRHA 3BJLA 1ZLSH 4F9PC 1MNUL 3MRMB 1NGQL 3L1OH 2AABH 4QHLA 2FDBP 1CLYH 3D39E 3GO1H 3PV6B 5C08B 2P43B 1FFPB 4JDZA 4QOKB 2CMRL 1N2RB 4ODBD 3SKJL 3SE8L 1IM9A 1X44A 2YS4A 1CG9B 2R1WB 3VRIA 1OLZA 3RU8H 1B4RA 4QHKI 4K9EL 1UKTA 3W0WA 5D1QB 2I25N 1CI5A 3C6SA 1CU4H 5KJRL 3RIFK 5BRZD 5I1IH 4OIBA 3FB6A 5IGXL 1P7HL 4LL9A 1P69B 5D7KD 3MRGB 4Z7UF 1IAKB 3R06A 2NY0D 5T1LA 1QFUH 4F7TB 1MRDL 2HKHH 4O2EB 1YJDH 5C09D 3DO7B 4GQPH 4YR6A 3DV6B 1DCLA 3DBXA 5EU3B 2VXTH 4JDTL 2W1NA 4HC1A 3DMMC 5ERWB 2ICWJ 3T8XB 4PRAA 4QTIH 1C7SA 5FHBL 3THMH 2YZ1A 4YZFF 4LFHD 1FZJA 4NN7B 1T04A 5FUZL 1OWRM 3EYQD 3RKPA 4DGYH 3ZLQC 4U7SA 1MHPH 5D1QC 3GIZH 2ICWB 2RQ8A 1I1AC 1C08B 3TO4D 3PJSB 1BZQK 1YYLL 3OX8A 3GMRA 3R1GH 4OFDA 2E7HA 4L1HA 4ODXA 3FRUB 1HINL 2R23B 2VNCA 4P57B 3QIUD 1T1WB 1LQSR 2W9DL 5DLMH 3MRFB 1CD0A 1F00I 4ETYA 2AJ3B 5IMMA 4I1NB 2C1OB 3MUGB 4N5UA 3T0AA 4GG6E 1N5YH 2W0PA 4PR5B 4AK1A 2GJ6B 5FCUH 3ZE0E 3MGOA 4Z95L 4M6MH 4YBQD 5F21B 3GMOA 2D0FA 1PZ5B 4I13B 3ZE2F 1W0YT 4OBSA 4LOUC 5I0ZA 2ZUVA 3QDMB 5F7YC 1H3PL 1Z0NA 3VXRE 3C60D 1QFWM 4K3HA 3WFEH 1NBYA 3LMJH 3DVFA 1JMZA 4LCIL 4MB3A 32C2B 5E2WL 4NNPH 5BZDA 1N5AB 4F15B 1G9MC 1L0YA 4U6YA 5SWZE 1K5NA 1AGFB 4P5KA 4F9PA 43CAB 2WIIA 3KXFE 2FYYB 4LRIA 1NCWH 5CJ5A 2GHWB 4NN6C 1EEZA 1XGPB 3MGAA 5E4EC 2M2DA 2BVOA 3FHQA 3MFFB 1KBGH 2Z8WC 3QIBB 5ANMA 3DXAE 3QDAA 4LRNL 5C09B 5IB4A 2JB6B 4J8RB 4JM2F 5F6IB 3G5ZB 1J05A 4OI9A 5IJKC 3VXUA 4EOWH 5DURD 5C0EA 4I9WE 4PJ7F 4F7EB 3U7AA 1RU9H 5D2NB 1HH6A 1YZZA 4NIKB 4JVWA 1PKQA 4EUPH 1DE4A 1RAMA 1YYML 3MMEB 4S10A 4PJAE 1BD2B 4FFZH 1OT2A 2YPKB 3VXME 1RIHH 2R9HC 4R7NB 2RBLA 1G9NL 1YEJH 3GMPA 1ZT1B 4MNGA 2XZQL 1WBYA 3PP3H 5EIQA 5J6GB 3HN3A 2WWMD 2Z9TA 5DVOA 3BN3B 2NMSA 3QHZH 1YNLL 2HT4D 3K80A 3VXOA 3WMSA 4AENA 3MRQA 4DCQA 5DEGA 2E9IA 4MS8D 5EU5B 2IANE 4HH9B 2DM4A 1PGRB 3QEGL 4MNQA 1A4JA 4XGZA 5CZXD 3L3HB 4X5LA 1U3HA 1XR8B 4JFFE 3W5NA 3VG9B 3VWJA 1BX2A 2QSVA 3HC3L 3T77A 4X5XA 2DQUL 3ALXA 5TGBB 4HJGB 4BQ9A 4Z78B 4I5BA 5B38B 2PYEE 1KTKE 4I9WD 5DO2C 2CIKB 1P4IL 4WCYH 3RHWK 1HHGB 3M1BA 3IDIA 2HN7B 1OAUL 1Q8MA 1XT5A 5HGAA 3OPZL 4WU5A 2BSRB 5HHVL 3VFSB 5D7IE 1RJZB 1KPUA 5D96C 1Y0LA 2A1WL 2FGWH 3S3SA 3CD4A 3QUMH 3NFNA 4S11A 4L5FL 4WU7B 5DQJA 1CXHA 4S1DD 1KYOK 5KAQG 2CUIA 3LKRB 3PHSA 2CKBH 5IQ7L 5TQ0H 2ZCHH 3RY6C 3T0XA 3NABL 4Y16C 4YBLB 4P23A 1UKSA 4FQQB 4HXBL 1JHLL 3GSUA 2ED8A 1D9KD 1JZ8A 3QHTC 2Z31B 1FL5A 2YOCA 2ZOKB 2FIKA 4UTBH 2A9ML 2A6JB 4RFOL 4PJEB 1AXSB 3ULVL 4Z8FL 4WWKB 5FOBA 1GGIL 2EDLA 1YEEH 5CIPA 2YEZB 4PG2A 5HPMB 1PSKH 4HDIA 3KPTA 1FH5H 1KLUA 2NR6C 4P2RE 2F19L 4PJ8A 2P8LB 4YX2H 3CIQA 3WHXB 1YQVH 3IU4H 1LE9A 3U36A 3ESUF 4UDUA 5IHZB 4MCZB 5IF0A 4XPAL 3MLYH 4PJFA 1A47A 5EBLA 4N8VA 4FP8H 3VE0B 5IV2B 5M95B 3O6FC 1DTUA 1WT5C 3WN5B 4EXPX 4XP1L 2DI9A 2Z91A 3RDTB 1N5YL 3U4BL 1VADA 4LEXL 1UCBH 4Y5XA 2ADFL 1EH9A 5GS0L 3CFEA 4UILH 2R0ZH 2W9DH 3O4LB 4FZ8L 4GAFB 1BM3L 4L4TE 4X4YB 2UZIH 3WLBA 3E1F1 1KTLA 1VGEH 4PRPB 4QRSB 5DHVB 2DQHL 1CQYA 5KOMC 3HTLX 2NR6D 3B2VL 2Q8AH 1JGEA 3LN4B 1OD9A 4GSDL 3I2CL 4QRQB 1DFBL 3UTTD 3C9NA 2FECI 3LN5A 3IU3B 1ZLUK 2HVKB 2EC9U 4OLZL 5GGRA 4RA0C 2DDQH 3QJHA 5EZIL 3QI9C 5GS1B 3BH8A 3DGCR 4MD5A 1OGTB 4TPRH 3P4MB 1X6NA 1B0GB 4U1HA 4LGSB 1WAAF 1XMWA 4YLQT 1UM5H 1FSKB 3UJTH 3RZCC 4AEHH 1OPGH 2R15A 5IJVB 1JPTH 4OZGE 4KDTC 3BKYL 4QYOB 4AT6A 4LGPB 1JGUH 5GS0C 12E8H 5HDLA 5KZCB 4ELME 4WI5A 3GSRA 3CFCL 1XGYH 4XNMA 1XR9B 5KS9A 3VWKC 1FAIH 3DUSB 4JG1H 4RAUA 3WNOA 3NA4A 5HYSG 1NEZA 1QLFA 1PBYA 1SEBB 3GSQB 3TNMB 3VFMB 2OL3A 1GHFL 4DGVL 1HHHA 3FN0L 2WSKA 2XWBA 2GAZB 5EZOH 2FATH 2FJGB 2BNUB 5FYLD 4WUKL 2X4UA 3PGDB 4HLZH 1R5VB 3EO0B 3BAEL 2K9UA 3ARSA 3NBNA 4ZFGH 2EDNA 5C70A 5J7CC 1H5BB 1ADQL 3NIDE 4BSWB 1R3JB 2N7AA 2VOTA 4DVRL 1J5OL 4ENED 1JVKA 3P0YL 2FSEA 2VL5B 2ESVE 4UNUA 1L7IL 4PJGA 2B2XH 4KI5D 3W5MA 4TSBL 5F3BA 1JZ3A 3CLEH 4DKFL 4OZGB 1KF9B 2DQJH 4UQ2A 1E4XH 1EXUB 2H32H 1KJ3L 3SO3C 1B0RA 2MPAL 3WS6C 5DT1H 4L29B 3RTQC 3NVQA 4YXLH 3FQUB 1QSFE 1BOYA 4GSDH 2E27H 1IJ9A 4DFIA 1OOAA 5KSBF 4XBEH 2AV1B 4UINH 5DUMH 4P4KD 1EMTL 5IG7B 3ILPB 3V9FA 3OF6A 1N7MH 2P44B 2J3SA 1CZ8L 2BRQA 3L7EB 1ZHBB 3O9WB 4X6DB 5E2VL 3PUCA 5I6XB 4P48A 4OLUH 2IPKB 3GJFH 5IFAL 4Q74A 4QT5A 4JHWL 3SDXB 2IBZY 4H1LH 2BVYA 1JHKH 4HIXL 3VXUE 4HIJB 2WBJD 5IHUL 1FYTA 4RNRA 4XNYL 5KG9A 1QRND 1U8KB 3TCLB 3FO0H 4U1KB 3FB5B 3O81A 3S34L 1E28A 4M6OL 5H37G 1JE6A 3NIFF 2NXZD 3MZGB 2B1AL 1FNSL 3H3PH 5LGHL 3OKLB 1AP2A 4LVOC 2PCPA 3DYMA 3JTTA 1I1AD 1QLEL 1Z9OA 3CVIH 3T4AB 4X99B 2V5YA 4OZIF 3F7VA 3F58L 1BBJB 1JRHH 5BRZB 1UCTA 2C4FU 2XZCL 1SY6L 2A9MH 5SWZA 3UAJC 5D7IF 2GFBB 4KK5D 5IT2L 4XNUL 2ZSWA 3FFDA 4O9HL 4DKDC 2YN5A 4I3RH 4LQFL 4XHJC 1OAQH 1T7ZA 3RL2B 1A4KB 1NUFA 3JV0A 3STZA 5C2BL 1D5IL 4J7RA 4MAUH 1ZEAH 3X13A 3RJDA 5HY9B 3X12A 2BX5A 1NC4A 3SDAA 4GQ9H 2CSPA 4PV8B 1MCJA 4ZO7A 1G1CA 3UYOD 4BFIA 4EN3D 1BVLB 3O6MH 4M7JH 1HHKA 2DF3A 4WHYH 4TTDD 4PLKD 4UU9A 3BXNB 5I74C 3TBTA 4JGUA 4H5SB 3U0TB 3VW3H 1SJXA 3GZKA 5D1ZC 2EH7H 4BZYA 5LGJB 4RGND 4D3CL 4OCYH 2R29H 3LKSA 5T3ZL 1IAIL 1QBLL 5KSVA 4P2OB 4MXVF 4R4FL 4MJIB 3SGJA 4OD2B 1P9MC 3JUZA 4IDLA 4PBVC 4OFKA 4DZ8A 2HT3C 2EIZB 1HK6A 3AS3A 1MSPA 1N26A 3OJ2C 2AERT 1QD0A 1ZHLB 3NN8B 4PS4L 3ARDC 5JNYA 1JNHA 2BMKB 4FG6C 1XF3A 2AK4D 5TE4L 4YXHH 4HCRL 3IF1B 3VFGH 3ARGB 4NKDA 2Q20A 4PRPD 1MRCL 2DMBA 2H1PL 4GRLB 3VI4E 4GAYA 4OQ1A 1ITBB 1T2JA 1UM6L 1X3DA 1P7KA 3P73B 2PF6A 4X6FA 5HGBB 3GHEL 1ONQB 5TQ2H 2FO4B 3HAEH 3DPBA 3QIBC 4E5XA 1WUNT 5FKPA 3AU1A 3T65B 5CJXC 2EZ0C 3T09A 2C3VA 3MBED 4HT1L 8CGTA 4RMRA 1DBKL 3CH1B 2AXJA 4PS4H 3QUYD 4KUZH 2K1MA 2GYSA 3LSOA 4YFLF 3SCMC 4GKNA 4M02A 3EKCA 4L9DA 1PYWA 3BPCA 2NNAA 2R1XB 3CX5K 4F15C 3QEQE 1QO3A 5KN5A 3LAFA 5ENWB 5EU4B 3T4YB 4JRXA 4FFVD 3RL1B 4PGJA 1TITA 4MXWH 5KSAB 2X6MA 1J18A 4KZEH 1FYTD 2PUQT 5C0GB 2CLZB 1R0AL 2QHRH 1U95A 4P5TB 3RWCA 5D6DA 4L4TA 3RJQB 2DKUA 3DTXB 2H9GB 4QHMA 3HNVH 3U82B 3MRNA 5TH2A 4J2XA 5K93A 4OD1L 4FQHA 1JP5A 1S5IH 1SBSH 4CVXB 4OCYL 3MCKA 1M7DA 3FOMB 2EE6A 4K8RL 1L7TL 3O2DL 3CZJA 4NQXB 4RZCB 3HC4H 4WEBL 1EK3A 1GYAA 1HDMB 3GRWH 5ESVB 4PJ8C 1FZMA 3PV7A 3RVTC 1EHLH 2AJXH 3TH3T 2XA8L 1N0LA 5EPMB 2M1KA 4JN1H 4BELD 5BMFL 2A6DA 2WWKT 1U3HC 3LQAL 1KLGA 2MQCA 3BN9D 3HI5L 5IROC 1H8SA 2F15A 4H8WC 3ZTNL 5CD3A 1R3IL 1ULVA 1WT5A 5KSBA 4HS3B 2NXYC 3IDNA 1BF8A 5JO5B 2CO7B 3O3EB 1AQKL 1I1YA 3FB8A 4PJBB 5BVPL 1ED3B 4X80H 3O3AA 1P2CB 2HKFH 5BS0E 4Z77A 4XCEA 1M4KA 2Y36L 2BZDA 4EIZC 3P30L 3B2UD 3UTSA 3QNYA 1NMAH 3K1KC 4JVPA 4P2YA 5AAWA 2KZWA 5DF0A 2OR9L 3ZYOA 1FBIH 5KVDL 3TCXA 1RVFL 4PJHE 4JM2C 1EPFA 3KNBB 3HUJB 2PW2A 1A5FL 4KRPD 5JW4Q 1I9JH 1HWHB 4HAGA 3GM8A 5IFHL 3VRLE 4H8WL 1S7VB 1CZ8H 3KJ4C 1YUHB 4NUJA 1QFUL 5DVLA 4X6CB 5GGTA 4FQ2H 2PTVA 3QUZD 4GUPB 2V2WB 4OT1H 3MV8D 1A6ZA 5JQ6L 1ZSDB 1HOCB 3JV6A 4POYA 2XPGA 4O9HH 3CMOL 1HEZA 4NZUH 1X5XA 4X4MA 4WV1C 2YRPA 3H7BA 4ZXBD 1LD9B 3C8KB 1N6QL 4MWFB 3SDDB 3ULVF 1NGYB 4PV9A 2MNUA 1TQCB 3AROA 4WNQA 2APFA 4GBXC 4WHCA 5F9AC 1MCQA 4R8WL 3OAYH 1TJHH 1YMMA 4TUJA 2MCG1 1UG9A 1QA9B 4N5EC 1RZKH 2IQAB 3KS0J 2R0LH 4KKBC 3BRDA 3VG9C 1FPTL 4EN3A 1A9EB 1CFVH 4YDVA 5CSZB 2RCSL 1BJMA 3B6SB 4IJ3B 3BDBA 3M07A 2IADA 3I02A 4RISL 1FC2D 1TZHB 1H8OA 5F9OL 5HD8D 5HYSA 2H2PD 4HFWA 5IWLC 2RAMA 3UZEA 3IFNH 2X41A 4HIIB 1GCFA 4BSVA 1RURH 4K7FB 3BEVB 5SWSD 1YEDB 3MFGB 5CEYB 2OTUA 1ZT7B 2HP4A 2ZCLL 3V6ZB 3RWJA 1JZ6A 1IC4H 3IT8D 5F7NC 1UACL 4Y0GA 1CXKA 2VR4A 1I7RB 3M8OL 2LU3A 3U4EA 5E00B 5GSVB 4LLYA 2WUCL 1CWVA 2VISB 1CR9L 4JFPA 3QXTA 2EE9A 3P4OA 2EDYA 5D1ZB 5MERB 3OR7B 5SWQB 2V2TA 4XVUD 5E5MB 1T0NA 1KENL 2ADGA 4I2XB 4Y5VA 4PJ8D 1QBML 4G9FA 4PJBF 5ALCL 5JDSA 2OZ4A 5CILL 5I1DA 3PGCB 4Q6IC 4U6HA 4XNZB 3B9VA 1NCNA 2CD0A 1RZKL 2EYRA 1D5BA 3GKZA 2JJUA 4MAYA 2BNRA 5J1AA 1TLKA 3CSYB 3LEVH 4PGCA 5ID0B 3VH8G 2IPUK 5B39A 2N4IA 4XT1C 1OP3H 3DVGB 3LVEA 1CFNA 4P2RB 1JWUA 1RZJH 4Y1AB 1LK3L 4U1GB 3KXFD 2QQNL 3DX7A 1ADQA 3L3OB 4DZBB 1CFQA 3WKML 4S1SH 5I66A 5K9QG 1JI2A 1FG2B 1HSAA 1T0MB 4HS8H 4NO3A 4NKQB 5F7KC 5DSCB 2AJSH 4LSUH 1R24B 4V1DA 3ROOB 2QKIB 2HG5A 4U05A 4XMLH 2VN7A 3F8UB 1DBBL 2XN9A 5KSUB 3CJJA 3I6KA 5C1MB 4C83B 4I3SL 1D6EB 4ZTPH 1Q38A 3ULUD 3VXQA 4ZG1A 2VQ1A 2CPCA 4CVZB 5CUSL 3MRKA 2MHAA 1IMHC 3D0LA 4CNIB 4F57L 1OW0A 1CT8A 3MRIA 1RUAH 4I3RL 4PJEE 1Z5LB 4Y2DA 4BYHA 3AMLA 5I1EH 3LY6A 2I60L 1A8JH 4J6RL 3TH4T 4OM0H 4HGKC 1WJ3A 3WE6B 4U3XA 4OFPA 2WWMC 5CGYD 4F8TA 4TRPH 1QSEA 4WDIA 2P1YA 3GJFK 4NQVA 4AJ0A 3HLAA 1U8PA 4YXKH 5FA4A 2Q3ZA 4YNYB 4K2UH 1K4DB 1QLEH 1MQKH 3CVIL 1KCLA 3P9LA 5JLZB 4N9GB 4OZHB 2P5EA 3IDUA 3U4AA 3MJ6A 3E6FB 1WLHA 3S36H 3U9PH 2AS5M 4TVPH 4XP4H 1CG9A 1OAXL 4WW2F 2VLME 3MJGX 4WI2A 3UP1A 4LCYA 1RZIA 4PJGF 4L8BA 3EJYC 2ZOLB 1AD0A 3VGEA 5JQHC 3SDAC 5I1KH 2BOCB 3SE3A 1CD9B 2IJ0C 2H3NB 1QR1B 3GBNL 3IXTA 4AIZB 5M94B 1S5HA 1J7VR 4S2SB 2DLHA 1G0YR 4G6AC 1XFPA 3O3UN 1A64A 4RGNC 3LHPL 3EOTL 5I9QB 4AY0A 2JIXB 1I1FA 2IG2H 4PLKC 1N4XL 4HSQA 4QRPD 3O8XD 5EU3A 4X7CC 4NOFA 1CF8H 3MJ9L 4XPHH 4CKVX 2P4AB 3S9DB 3TC9A 2BSED 1MFEH 4MZ3A 4P2OD 4WFFD 1F11A 3G6JA 4OV5A 1AE6L 4G8GE 4IOIB 1ZAGA 4APQB 4QY8A 2NZ9C 2R2CA 3BKJH 2OMNA 1OAZL 5FOJA 5I1JL 2F54E 3KYAA 3KPOB 3GMRB 4PJHF 4U3HA 1NGWB 3I50H 4ODXB 2CGRL 3QDGE 4NNYB 3LS4H 5E70A 3QHFL 3NCFB 3OZ9L 4ZNEA 4U6XB 3BWAA 4Z7OE 1FZKB 1CE1H 2GT9A 2XKUA 4Y2DD 3V6FB 1ZT4A 5C0DA 2FEDD 1OP3K 1IC5L 1JCKA 3N1GC 4JR9H 5INCA 4JZOB 3SDCA 1SM3H 3U9UA 2X10A 2X4QA 3SJVD 2DQCH 1IGJA 1G7MB 3QI9B 5GS1C 1YYMH 5KTEL 3V52L 2AJVH 3VFNB 4B7LA 5I1GL 5IW6A 5FYKH 15C8L 1XF1A 5T3ZE 4JFQA 4L4VD 4N68A 3QFJA 1EJOH 4FFZL 1WAAE 4J3WA 3GUTB 3BSZH 2J4WL 1KCUH 5EOTA 2EE3A 2DL9A 1SYVA 1KIUA 2A74A 3EYOB 3QJFB 5GS0H 1FNGA 4RGNB 2UZYB 4I18C 3BHBA 4M93C 4EI6A 3HZYB 2CK0L 3ZKND 2WIIB 3MRHB 3WL9A 3RUGE 1K8IB 3RNKA 4PP1C 1YN7A 3A6BH 4P5TD 1KN2H 3UMTA 4LLWA 1X5GA 1JPTL 2IEPA 2Y5TB 2Q8BL 2VR9A 1RIVH 4RFNB 1INDH 4MA8L 4UUJA 1MAMH 5I75B 5IEHA 2D7PA 2VSCA 1UXSA 2AV7A 4TYUA 2YPLB 1A1NB 1FGNH 2WINA 3HFML 1KELH 2X70B 4KK9D 3TN0A 4LP5A 4KI5C 5DK2B 1J1OL 3UBXB 2A9NL 4PB0L 1F97A 4ZYKB 2DQTH 4U1MA 3GEWB 3HMXA 4PYGA 5KS9E 3MMEA 3NZ8B 4HHAA 1KIRB 1R3HB 3ARXA 3HB3D 4H0GA 4Y4FA 1GGYA 1PW3A 3TH2T 1A7BA 4JY5H 1MFCL 1KGCD 1P53A 1ZT1A 1HI6B 2FEEL 2KBGA 3KLDA 5HYJB 4R0LA 5DWUL 5GS3A 1RUKL 3VI3E 5EO0B 2IFGA 3RY4A 3LD8C 1FVEA 4N0YH 5JW3H 2WP3T 2Z4QA 1KIQB 5DLML 2EH8L 5ISZE 3K46A 4PJBE 4AENB 4LASL 3VXRD 5F6HJ 1S9WB 1OP9A 8FABB 2ESVA 2ARJB 3MNWA 3DX8B 1ZA3A 2DQGL 1XGRB 1KOAA 2DQFB 5JIPA 3BP6A 1KULA 3CZFB 2FIRT 3RRQA 2EDBA 3R1GL 1T22B 3CXDL 1PDKA 3WO4C 3VWJB 2NY5H 2HJKB 3HRZB 3V52H 1EO5A 4JM2A 4UDTB 1N59A 3TZVC 2I9LA 3KPPA 3REWA 3AB0C 4NRYB 5DD1L 3ARZA 4KK5C 1XH3A 3K4DA 4R4ND 4HD9A 3KYMB 1PJ9A 2DQUH 5MHSD 4JPKH 5BJTB 1RJZA 2FRGP 2RFXB 3FO9B 1KFAL 3TPUB 4G3YH 3TNNB 1JGVL 1QACA 4UQ3A 3GB7A 4QHUB 5C07A 3PWVB 4NUGH 5E6IA 1P5UA 1LEIA 1IEBB 2WZPD 1MCSA 4MLSA 3BQUB 1GIGL 5DJDA 2VRAA 5A2FA 2CRYA 5FM5O 5C09E 1QFWI 3DIFB 4O02H 3MV9E 3STLB 4PJ9B 5IROA 1S7UB 5IW1B 5GSRA 1XGUA 4Y4HD 1IQDA 3VD7A 1A7QH 3HNTL 4KI5E 5AYUL 4XRCA 1B2WL 2I5YL 2OI9C 3RU8L 5ILTH 3H7LA 2IPUG 1PLGL 3C09B 5K33A 3FCTB 4EDWL 2ZKHH 4PB0H 4ISVA 3A67L 4JFXA 2YEZA 3K7UA 4LASH 4TSAL 4HDIB 3VGAB 5EO9A 4OLUL 5T3ZD 1OARH 1KPRB 1IL1A 3THML 5A16B 1NGQH 3L1OL 4NBYB 2FR4A 3BOVA 4RMTA 2P8LA 4G43A 1T1ZA 3O4LD 2XTJC 5JDJA 3HCVA 3LDBC 5D6DC 1GC1C 4AIOA 4L8DB 1YMHB 2F53A 3GSWB 3QEGH 3AS2A 1SEQL 2FB4L 3CLFH 4BKLA 4HW6A 3VFRA 2NXZC 3IDYC 2J88L 1I7ZB 3IVKB 1IRAY 1MJ8H 3F58H 5D71H 3ZL4H 3FRPA 1IBGH 2Z31C 3EO1B 4QF1A 3QHZL 1KJVB 4KPHH 2YD7A 3H9ZA 5LQBL 2LAAA 1A7OL 2UV3A 3C8HA 2HJFB 1YPZF 1XGYL 3V5HA 3G6AA 3MACL 3MXVH 4PRIE 5CD5D 4ZPTA 5LVEA 1A9BB 1LO3H 4XPHL 5E8PB 3QA3B 5GRXG 4UBDC 3MV9B 2OJEA 4OCLC 3BPLB 3BZFB 4PLNC 4LIQE 3DGGA 1WAAA 4X0KA 4XVTL 2IALB 5DFVC 5BV7L 4MVBC 2G9HA 4KMLB 1YNTB 1RK0A 4NM4L 3PHOB 5CHNB 1JZ4A 5KSAD 4OM1L 1S7RA 2F74B 3KYKH 3BAEH 3TBSA 1CGTA 2YA1A 4R26L 4YPGB 5EWIH 3AAZB 4CJ1A 1NDMA 1D5MB 1YPZA 4QRUB 4X6DF 1QSFB 3OHXB 1S8DB 2VLLB 2D4DA 5GRYA 1CFSB 2IFFL 5DQDL 5E99H 3RIAF 5DJ8A 5DD3L 2ATKB 3UTPD 2FLRT 4OCNC 1AGEA 4YZFE 3BEWA 5M7QA 4M7ZB 2UZIL 5KOVC 4NM8H