1CICC

Idiotope-anti-idiotope fab-fab complex; d1.3-e225
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYYTTTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPRTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IG HEAVY CHAIN V REGIONS)
molecule tags Immunoglobulin
publication title Three-dimensional structure of an idiotope-anti-idiotope complex.
pubmed doi rcsb
total genus 54
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1999-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cicC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cicC01
1RMFH 3FN0H 5EIQA 3KPSE 3E8UL 2P43B 2VXSL 3SGDI 4DGIL 2AI0L 2P8MA 2R4RL 1CBVH 3C2SA 1WEJL 3ULVF 4TVSa 3OKDA 3T65B 2XN9B 3BIKA 4UV4H 4DJMA 4ZQKB 2E6JA 5C07B 1IC5H 3QNXB 2Z8RA 1A9BB 1RJCA 3GFUA 1XGUB 3GKZA 1ZLUH 3GUTB 1AR1C 4KUZH 2VERN 4E41E 1LE5A 1U8KB 1H9VA 2Q20A 3MX0A 3U30C 3RWHA 2QSVA 1U8QB 5EZOH 4P3CL 1H3UA 4GFTB 2ZSVB 2XG5A 2VXUH 4BFEA 1G7PB 1IC5L 1TPXC 5GHWL 4YWGH 3QHFL 4LRIA 4CKVX 1OGTB 1I9RL 1F4HA 4N1HB 4KY1H 1WBZB 1QNZH 3QBTB 4QXGH 5FOBB 1S7XB 3DIFB 2AI0H 4PJBB 5GGQL 2WBJC 1UQSA 3T2NL 2CSPA 3GJEB 2KUTA 1ZSDB 4ODSL 2LAAA 1OQOA 3PGDB 4ZODA 5L88L 3QT2A 3F7PC 3HZVA 1NGWA 5JPMA 2G5RA 5ACLA 3WXWH 1JGDB 1S7RA 4NN7B 1QKZH 4FHBD 4AQ1B 3L3KB 1JTOA 2C4XA 1U91A 2C3GA 1ROWA 4UBDD 2VUOA 3HLAA 5D5MB 1NANI 4I2XB 1FVDB 2AJSH 3O8XA 4NFDA 4JO1H 4KTEL 1MREH 1NUFA 2YBRB 5TE7L 4NWTH 1CFQB 4KK8C 2VIRA 3RAJL 3TJHD 1URLA 1N3NA 1NMAL 5EWIH 3D85D 4KJQC 1C5CL 5KSUA 2BNRA 1MFCL 3FFDA 2NQCA 2QADB 2YN5A 1NBVL 3A6CL 1I8LA 3B43A 4K7PY 4L4TD 1RZIA 2HWZH 1OSZA 3TBVA 3JV4A 4F9LC 4JPWH 5D5MF 3NACL 1T2JA 3CDCA 1S7TA 4NQSA 2V7HA 3BESR 5IB1A 4BH7A 5F1NB 2EZ0D 3VFOB 2GEEA 4IDJL 4UNTA 3QDJA 3U1SH 2F5BL 4JCLA 1HHJA 4MA7L 4U05A 3VD5A 4YZFE 2J8OA 1KCSL 4OZFB 5I16A 3OXSB 2IEPA 2FLRT 2CLRB 4LSVH 3E2HC 1U3HC 1KTDB 3BE1L 3MREA 1TDQA 3DUUA 1TZIA 4KK9D 4DW2H 3WSQL 4F7MB 3LEXB 2B0SL 3WFEH 2NX5B 1CFVL 4L4JA 4UILH 2VLKE 2FBOJ 4XPAL 1ZHLA 2DM7A 1GGIH 3QG6B 1GAFL 4UU9A 1M7XA 3QQ4B 5HYJB 2EYSB 4KKAC 4MQXC 1ZLWH 3LEYH 2LFGA 4CVWA 3OSKA 3VI3E 3ARBA 2AKRB 2D7MA 4TVPE 1BPVA 4M02A 1NEZB 3KPPB 1FGVH 4Y19B 5GS2D 3TVMD 1X3DA 2DWDA 4Z7NF 4JDVA 2VZSA 5C0BA 1TJIL 3UXFA 1YYLH 4XP1H 2LVEA 4J3OC 3MOBL 2WINA 3OGCA 1YJDC 5FA4B 2HYMA 1IAIM 1BOGB 1AKJD 4QHUA 5CZVH 4L8SB 5HJ3B 1JF5A 3SDCB 1ZHKA 2X1OA 3MV9D 3PWPB 5IJKA 3K1KC 4JFHE 3C6SB 4OD2B 3O0RH 5JW4N 4GXVL 4XZUB 4L4TE 1K4DB 3IVKA 5H94B 2FR4B 4I0PB 1I3GL 4QNPF 1B0GA 1PG7X 3A6BH 5BVJA 1WZ1H 2EYTB 5HYSA 3MPCA 3W9EB 5B4MD 4GKZB 5J6HB 5DRNA 2VDNL 3WD5H 2WBJD 4LARH 3MOAH 1KFAL 5DSCB 4XMKH 1ZT1A 4HLJA 4S10A 2IAND 3O4LB 4LVOB 1QLEL 3IDIB 5JA8B 1U3ZA 4LLUB 3BP6A 1F6AA 4P3CH 4RNRA 5DVNA 5IV2A 2FBJL 5IQ7H 2K3TA 1Q9KA 4G6AC 5J0BA 5F7UA 1CXIA 3RGVA 1IC7L 5D2NB 4O2CA 3STZA 5BS0B 1AGEA 1ZKAA 5J1SC 1FAIL 4PRBB 1AXSA 2AAVA 2DIAA 4NQCB 4UDUA 1BBJB 4JFFE 3P4NB 1WVZA 5SWSD 3F8UB 4JR9H 2PTTA 1QFWI 3QXTA 1RJZA 4KJQD 4WFFE 1X4YA 5K9OA 4G8GA 2JK5A 4L8DB 4AJ0A 1KCLA 3LAFA 3SCMC 3WNNA 5E8DH 1G7JA 5CGTA 1DVFD 1S9VA 3V6FA 1NEUA 4P4KD 4NHUB 5T3ZL 4XBGB 4OKVA 1A1MB 5FGBA 3HE7A 3S4SG 2EH7H 5E70A 4W4OA 1CL7L 5DHVA 5I75C 1NGWB 3PJSA 5JPMB 1QBMH 4TUJA 2X70A 4LPVA 4LU5H 3VWJC 2J6EA 1S7RB 5C92A 2YPVH 4NGHL 4XAKE 3BJ91 4PB9H 1P9MC 3VMOA 1R24A 2XYCA 4E41B 1EJOH 3BWAA 1YEGH 1JGEB 3ES6B 5T3XE 4NZDA 4OCXL 4QLRA 1QQDB 2XA3A 1X5AA 4S2SA 4DKFH 3TZVB 2A9NH 2N7AA 3BP4A 2JB6A 1FZMA 2HRLA 3V7MA 5E2UL 4Y16C 1ZGLB 4X8XA 1LMKA 3GI9L 4U6TA 2ZZUT 2DI9A 2YD2A 2ITDB 3LB6D 3QI9B 4YXKH 2VDPH 3FO2A 3SKMB 4DN3L 4UT6H 3TH2T 4AM0A 3I50H 4XH2B 5EU4A 1CR9H 1NBZA 2VXVL 1OSPH 3OKKA 3ULUF 1R5WA 1I1AB 2DKUA 5E8EA 4F3FA 2JCCA 2W59A 4JB9H 5FK9A 3UYRH 3DYOA 1X5HA 1W8NA 3TLRA 3MACL 3EFDL 2ITCA 5M95B 2CRYA 4QHMA 2ORBH 2BNUB 3QHZL 4EUPG 1ACYH 4B50A 1Y0LB 3Q0HA 1UB6A 1KGCD 1JGUH 3UJIH 3JTSB 3VFVA 4RMWA 3S5LA 1ZS8A 4NSKA 3MLRH 5D1XA 4IHOA 2E6QA 2IG2L 2PXYB 3NFNA 1MRCH 4ZAKB 3FB8A 4QRQB 3EZ8A 4JGUA 3MR9A 2F8XC 4Y2DC 4YHYB 3MROB 4OD3L 4GSDL 5E5UB 3TBTB 1DQTA 3KPRD 1RZKC 3GIVA 5LGJB 5LVEA 4G6AD 1DLHB 1KCVL 2A83B 3ZLQC 4LVHC 2WINB 4YDKL 2UUDH 4HUWA 4PJDE 5FA4A 4PGBB 3S98A 3ULVD 4IS6B 5IFAL 1WTGT 3OKLB 5J11C 1RZFH 2EKSB 5JW4R 3C6SA 5EB9A 5HHXH 2R1XB 1PKOA 1D9KA 3GSUB 1INDH 5LQBH 3GM8A 4ZFZA 5IOPB 1OAQL 4MWFA 5DJDA 4NO5A 3G5YA 3PL6D 3C60A 2IJ0C 1CFSA 3IAGC 3B6SA 4ZDHA 1GOFA 3QQ9D 1IM9A 3PP4L 2ADGA 2EDQA 3GSVA 4IOFD 3QUYB 4WWKB 1NEZG 5EFIA 3VXSE 1BP3B 1NGQH 3MRCB 1NLBL 5D71H 2YD9A 5KZCB 3QPXH 4YXHH 5ID1B 4TPRH 3ECBB 2NYYD 3PP3H 1A6UL 2FEDC 1TVDA 1TZHB 1OARH 1MRDH 1Q9OA 4Q2ZA 5T1LD 4JFEE 1K6QL 4O2CB 3STZB 2C7UA 5JUEL 2QHLA 1KGCE 5I1EL 3D85A 1CDBA 4HW6A 5E4IA 4PJFB 4HBQA 4XWGL 3WE6A 5TE4L 5ICYB 4RMVA 4KRMB 5AYUH 4XP5H 2YPLB 1G9NC 1FL3A 4NBYB 1PKQE 4N8CL 3O6FC 4Q9QL 4JM4L 1XGPB 2X1QA 2HLAA 1BD2B 3GMRA 3D0VA 1S9VB 3V6FB 4NKOA 3SE4C 3D39E 3HMWH 3KR3H 4LNRA 1C8PA 4N0YL 4NFCA 4OM0H 3QNYA 2Z92B 3EDJA 5J9PB 1HZHL 2BJMH 3QEGL 2JIXA 2APFA 3O6ML 4MXVE 3QIWD 3MJ8B 4YK4B 5D2LB 5GS2H 1MF2L 1PYWA 4FQCL 4U1HA 5JNYA 4ZD3L 5FO9A 5DJZA 3BPNB 1RZJC 3CFEA 1E4WL 2JCCF 5EO9B 1IC4L 3SKOA 3LQAL 1D5XA 5LGHL 3U0WL 1R24B 2F5BH 1CF8H 3DTXB 4EBQL 2Y72A 3ES6A 1RIVL 3ZE0E 1U3YA 1XF5A 4NQCE 3LS4H 4JFFB 2A6KB 3KYNA 4HIHB 5JHLH 2V2TB 1TCRB 3UDWC 4JPWL 4P59L 4ODBD 2ZPKL 2ED7A 2XG4A 5IW3A 3X12B 3O2WL 1AD0A 3CDFA 3EFFB 3TV3H 3N50A 3T77B 2ITDA 1FNLA 7FABH 1LWRA 1KJMA 5DD0H 3LZFH 1WBZA 5L8JB 4M5ZL 1F4YL 3INUH 3SDAB 1NBZB 3CK0L 3PXHA 3DETC 3O6KL 5F7DA 5KSAB 3P40A 1T4KB 5FK9B 1G7HA 4QTHB 1VENA 4ONGH 1UWEH 4JVPA 5BCAA 4XCYB 1QSED 5E99L 3CGTA 1MCRA 3D2UA 1G9ML 4NZJA 4ZNEA 5HHVH 2AVGA 1U3HB 1R3JB 1P6AB 1JGDA 3ZT5A 5I1AA 5IM7B 1T03H 2UYLA 4PJAA 1IGIL 1MJJB 3F58L 1A1OA 1QSFD 5FV2A 4PJ5D 1RIUL 4R26H 3JTSA 3VFVB 5JXAH 3OKYA 5C9KA 1CXEA 3MCG1 4JPKH 3GSXA 1XR9B 4NSKB 4DKAA 1MWAH 2ESVB 1BVKB 3V5HB 3QA3A 2IPUG 1TNNA 5KSUB 4YX2H 5HTSA 4N0RA 4HAGA 1J12A 4YHMH 3IDGB 4PJ7A 1YMMD 5I6XC 4G6KH 3WIFB 3S8WA 2P8PA 3O3DB 1HSAA 4BSVB 2DLTA 2IAMA 4YO0B 3EHBD 2DQJH 1LO3H 3H2WA 3VFOA 3UTSE 5C7XL 2VLMD 4U6YA 4Z7WF 1HHJB 4XBEH 4JQIH 1OTTD 2CPCA 2IBZY 2XQBL 1J1XL 3ZO0A 1KELL 2OSLB 4GOSA 1LEIB 5F6HI 5FKAB 4Y16B 1GOHA 2RFXB 3VD9A 4XAWL 1U93A 4C83A 3QCVH 5DRXB 1OTUC 2FSEB 2D03H 2M26A 3AREA 5D1QA 2CIIB 4WCYL 4S1QL 2HMID 3EYFA 2H32A 3M8OH 4WWKA 3PDGA 3VFPB 5B39B 1NAMA 4I18A 3QQ4A 2F8VA 3MRCA 2BP3A 1P7KB 5EU6E 3MUHL 5KW9L 4XT1C 1CD0A 3M17A 3B9VA 3ARBC 3RKDD 4MQ7A 1DP0A 2NY6D 5C6TL 2UWEF 4R7NA 1TJHL 4NUGL 5I8CA 4LQFL 1XF4A 2HJKB 3GI8L 4XHJD 1HHHB 4Q7DA 1LNUB 1VHPA 3KR3L 1BFOA 1RZGA 3FT3B 3MGTA 4UTAL 4DK6A 1Q72L 1WCQA 4FFYH 5AG8A 1OP5K 2I07B 1QFUL 4NQXA 2AK4D 3NABH 3U4EB 4WGWB 5E2JA 1MUJB 1T2QL 2HJFA 3QFJD 1IEAB 2ZG3A 4OD1L 1ZVSA 4OZIA 2JKXA 3PWPA 3TPUA 2XKUA 5IROC 3QRGH 3MJ9L 3RWDA 1K4DA 3IVKB 1SYVA 3RWIB 2HVKA 4MDIA 5ENWA 3DXAD 3UP1A 4LASH 5T5FH 4N0YH 5FYLL 1F4WH 1U8JB 1IGYB 3SDXB 1RSFA 1CU4H 1JI1A 4GMTH 5F21B 3VW3L 4M7KH 1GXEA 3EDFA 2EDRA 5BOPA 4J7RA 4RNRB 1DN2A 2QHRL 3GSNL 2VXQL 3RDTC 1GC1L 1YEDB 3G6JA 3ROOA 1GGCL 4PRPE 2DMKA 4NRZA 3I3DA 4WV1A 2BCKB 4Y1AA 3VXPA 3C8KB 4P2RE 1Z6JT 3DROA 1BD2D 2H9GA 1EO5A 4KGJA 5DEFB 3EYQC 1J1OH 5DJ6B 1AD0B 3VXMB 4HWNA 2CXGA 4CMMA 5EU6D 5AZEL 1AP2A 3GSNB 3NZ8A 3OKNB 3EOYG 1LP9E 1T5XA 3HZMB 3S36H 4OQTA 4N0FA 3HUJA 1J88A 4ZNCD 1Z5LB 1H3TA 4OFPA 4PYGA 3OWEA 3E0GA 3SDAA 2AV7B 2CDEA 3VXRD 1M6OB 5C9JA 4JHAH 1QLFB 5D7IE 4PJGA 3HE7B 3MV7D 1R5VB 1IEHA 1NFKA 3NCFB 3JWNC 4OFVA 2W60A 1I1RA 5DUMH 3MLUL 4M3KB 1D6EB 3HR5A 1I1FB 4YDIH 1MWAB 3GBLA 5GSVA 4LHUD 4NFBA 4CVXB 4KGLA 3W0WB 3PWLB 1HHKA 1VGKB 1CD1B 4OJFH 1CLZH 5F9JA 1JF1B 4MAYB 4X6EA 3WNLA 3C08H 3MNZB 1JHKH 3ARVA 4JRXD 1HNFA 3LKQB 4HX1B 4NQDE 1AY1L 4PRAA 2OXGA 4XC3L 1OLLA 1BVKA 2DRUA 2ORBL 1YNTA 2FJFA 4OCRL 2XY2A 2A9MH 2VDOH 3GMLA 1FZMB 4MAYC 5JXED 1RUAH 3ZYOA 1JP5A 2NY2D 5GGSA 5IBTL 3RBGA 2VL5A 2WW8A 4JRYE 3BQUD 1U8IB 4PJ7B 5GSRA 3AY4C 2OZ4H 4PGCB 2V9TA 4ZUTB 4XXCC 3IETB 1HYSD 1ZTXL 4P2RA 1K4CA 2JCCE 2FX7H 2J8UF 3LQAC 4NPYA 4MDJB 4MQSB 1IEBA 4KXZH 4HKJA 3KPOB 3L7FA 4Z9KB 4J3SA 4PJCB 1OT1A 4HEPG 2G5BA 4R0LB 4R4FH 1OAUL 1A6ZA 1Y0LA 4C83B 2ADIA 5GZND 2GITA 4RX4A 4ZTOH 1DUZB 2E3VA 2F54D 5JZ7D 5EC2A 1R5IB 2HFFB 2ESVE 1T1WA 2IPTH 3CLFL 1MCLA 4KQ4H 2DQCH 1Z9SA 4XPBL 4QHNA 4YHPB 3WIHA 2UZIH 4XI5D 3HE6B 3NFNB 1IAOA 3GI9H 2OR9L 2YWZA 5GJSH 5FECB 3PWPE 2PO6C 4I0PC 2PO6B 1CLYL 5EBLA 3MNWB 2H3NA 1U8LA 3GIVB 5LGJA 3TFKD 4XNXL 2DQHH 1OTUD 3N06B 3FHAA 5DJ2B 4OF8A 4WWID 4M8QA 4PY7A 5D6DC 5E56A 5FIEA 1V7MH 2CUMA 3VFRA 4PRDB 5D7SH 3C60C 1QFWL 2DQGH 2ICWA 4R4NC 2F5AL 1YC7A 3ILQD 5EORH 1MFDH 2CK0H 3DNKA 5SV4A 1NLDH 4JFEA 1NGZB 2P46B 1V3JA 1PD6A 2PR4L 2H32H 3RIFK 4QOKB 1CIUA 3K74B 3X3GL 3M1BA 2V9RA 4ZFFB 5IJVA 2EC8A 1XCTB 1ZV5A 5C0RH 4MA1B 4HQQH 5DXWA 5DZLA 4WENB 1YY8A 3FOLA 3PHSA 2PNDA 5GXBB 2R9HD 2XPGA 1EHLH 3V79C 2XZCL 4C56E 3AB0C 1A6TB 5HGAB 3OXRB 5ALCL 5T33H 1QYGH 1QR1B 4MA8H 3KHQA 1T21A 5FV1L 4PPTA 2R0WL 1G7MB 5EULV 4XPHH 1YMMA 4CNIB 2QQNH 1ZEAH 2YPLA 3LHPH 4Y4HA 5CILL 4OLZH 5CFHA 1BFTA 3NZHL 1HKLL 3TIDB 1Z5LA 3B9KD 4LDLB 1FLRL 3Q5OA 5TGBB 4KUCD 3BISA 4R7DA 5CUSL 3MLXH 3SPVB 4KROD 2JJUA 3RZCC 2DBJA 4WUUD 1C1EL 1X7QA 1K9TA 2YEZB 1TQCC 3BUYB 2NY1D 4K7PL 1A8JH 1TQCB 2ICEA 1KLGB 3IKCA 4M1DH 4J4PC 4P46C 3SE3A 3PWLA 5DD5H 5A2KH 5IW6A 2H26A 1D5XB 1N7ML 2YMXH 3R06B 1A4KA 3QDMB 3MLSL 4KJPC 1I1CA 4XMPL 3RA7L 3PGDA 5DLMH 5EA0L 1WWAX 1BEYL 4O2EB 4XPGH 2YUXA 1SMOA 4X6DE 5E5RB 1FH5L 2DI7A 4GAGH 3WLBA 2B0SH 1AXTL 2ARWA 3BSZH 3TYGH 3RTQD 5TF1L 4RBPH 3A67H 1YNTB 3GSWA 5T1LB 5BRZD 3MRBA 2G60H 3GMLB 4M6OL 5BVPL 3P4OB 4XXCA 3LSOB 3V6ZB 5GGSY 4MJIE 1UG9A 4XVTL 1S5HA 1RIHH 5CJQL 1RZ7H 3EO9H 3N1MC 1ITCA 1HQRA 3NN8A 4PD4K 5TE6L 4EXPX 1V7NL 3MQIA 1RUPL 2QEJA 4G6JH 2P5EB 3IETA 1U8PB 4FTVE 4XPAH 1MJ8L 1EGJA 1AI1L 1T4KA 1KEML 1UM5H 1P4LB 4PJ8D 2C1PB 1I75A 3L5IA 4JM2D 3PWJB 3CH1B 1EFXD 4JFDB 1T04A 5IM7A 4LRNH 3DV4A 2DQDL 5IF0B 1MQKH 1P6FA 1B90A 5GGTL 5ETUA 2FDBP 4JFPB 5MENA 2FHBA 1FVCB 1U41A 4H8WL 5HGHB 2J8UB 5SWZB 1Q94B 4YHZH 3RVTC 1ED3B 4D8PB 1ORQA 3I02A 4XCCL 4XNUL 4OLVH 1T7WA 4TYUA 1AXTH 3BZEB 2XWJB 4X7TB 3QEUB 3QXAB 1A02N 1RQ5A 3C5ZB 4JY5H 2ZP0T 5IB4A 4EDWL 4JRYB 4TSBL 3S88L 5LXGL 1Q0XL 1ZHLB 3F6LA 2NX5E 3KJ4C 3QG6A 4JKMA 2VLKB 3SE8L 3P0YL 3UCRA 2J4WL 1LO3L 2IAMD 3WIHL 4Y5VC 5FUCC 4GAJH 4GBXD 5TE7H 3CPLA 4LEXL 2X44D 4KI1A 5C86A 3O6FA 4KTDH 3VFRB 4DVBB 4PRDA 1J10A 3KPPA 5C0CA 1T22B 2RJMA 2XNAA 2AQ2A 3PG2A 2VXUL 3OJMB 3WNMA 4XVSL 5EDXA 5CKGA 2H1PL 3O9WD 4M4PA 1KV3A 5CILH 4I18C 3HS0B 4BZ1H 3OB0H 3AGVA 1PDKA 3KPLB 4ZPTB 3Q48A 3I75A 3TM6A 1AGDB 5DVOA 1TTUA 1BZ9B 1HINL 5IFJA 5JR1L 3EYFB 5A2JH 1IGIH 1KCRL 1OB1B 4H1LH 3G6DL 1QYGL 3MUY1 2M2DA 4NC2B 4ZUUA 1OM3L 3TNNB 1R0AH 5T1MA 4OI8A 4I18B 1DANU 3NAAL 3AM8A 2BC4A 1RVFL 1JUFA 3HN3A 4AMKH 2YPLE 4JG1H 2NY1C 5GHWH 2VYRE 1OM3H 3TFKC 4U1LB 4YHOH 5DSCA 1UB5B 2ARJB 5I1HH 3WL9B 4P99A 2VDKL 4KDWA 4PJDA 1HILA 1S78D 1F13A 3BP6B 4H0HB 2YUZA 3KPRB 1DN0A 1KB5B 3FFCA 1Q9KB 3GRWL 3WFDH 1E4KC 2EXYD 2WIIA 1YMMB 3WYRA 2P8LA 1I7ZA 3KS0H 5DMKA 2APXA 2PCPA 1J8KA 2Z31A 4Y4HB 1HSBB 3EUUA 4G8FA 4Q58C 5CCKL 2XRAL 5E4EB 3TIDA 2YOCA 3P4NA 5IROA 1VGEH 4IOSD 4K7FB 2GHWB 2HP4A 4Y1AE 3GMPB 4OZFH 1RJZB 1SYVB 5HHMB 3RWIA 1CXHA 2R4RH 1CBVL 4OZIF 4KZDL 3SPVA 1ZSDA 3PL6B 3OAYH 2JK5B 4K9EH 4UNUA 5JHDE 2E5EA 3KYAA 1LVEA 4XNXH 3IKCB 2HLFD 2PUQT 1CGSH 3SDDB 3U6RB 3FQNA 2W9EH 4NZUL 1U91B 4OT1L 2B1AH 3ULUE 4G9DB 5C0GA 4G42A 1U92A 3RVWC 1X4XA 1FORL 1MHCB 3JZ7A 3G6JB 1NBYA 3ROOB 3PJSB 2BJML 1FE8L 5DUBA 5DVMA 5DLML 5EA0H 1VFUA 1EV2E 3B8SA 1UJ3A 2E9WA 4R3SB 5C09D 2W07A 3WKNA 2DQFA 3TA3A 2CDGB 2MJWA 3Q6GL 3C8KA 4WY7H 4FFVC 2JELL 4KJWD 3FO9B 3BDYL 5IQ9A 4HZAA 2EDYA 4UQ3A 5EBGA 1KJ2B 3VXMA 4HJGB 4KV5E 4QRTB 4BYHA 1MIMH 3GSNA 3T04D 5F9OL 2G9HA 4TULH 4KJPD 1U8PA 1LDPH 4A2MA 3M07A 2PW2B 1P2CA 3TESA 1NMBH 2E8YA 4RGNC 4PJGB 3CD4A 3JV5A 3QFJE 4YR6A 5HDQL 1YNKL 6FABL 1TMCB 2ATKA 5K9JH 1BGXL 4TPRL 3MLVL 1EEYB 4LGRB 1Z9LA 4XH2A 1WZKA 3PXJA 4M6OH 3DUUB 3NCMA 1ZLVH 3LRGA 2GSIA 4PJIA 5D1ZD 4F3FB 3CVHL 2WUCH 4NQDA 1CWVA 2IANA 4NN6B 3CC5A 3VWJB 4ZUWA 3QJHA 5B3JF 3QIUD 3MCLL 4GKSA 3STLA 5HYJA 5EN2A 4XMPH 4V1DD 2BNRD 2GTZA 3RVXD 5J12C 3QRFM 1CQYA 1JHKL 1ITBB 3BO8A 2AKRA 3O3AA 2B5IB 3RGVD 2CRZA 2CIKB 3FB6A 1NEZA 4Y19A 1RZFL 4PJFE 1U8IA 3AB0B 3BH8B 1QPXA 3T4YB 3IU3B 5J1AA 1TQBB 4PGCA 5HHOB 1XGTA 1NAML 4HGMA 2QSCL 2HFEA 3L1OH 3O11B 4DVBA 4TQEH 3MRKA 3ESVF 2FD6H 1FNSL 1YDPB 4D2NA 3RL1B 2VC2L 5IBLD 5DQ9B 1UKSA 2F5AH 5IVXA 3FO0L 1XF2B 1I8KA 1NGYA 3FJTA 2G5BB 1G6VK 3EAKA 4EDXA 1K8DA 1AHWC 3D39A 1DUZA 2FO4A 4I5BA 1HWHB 4LGSB 2NXYD 4TVPL 3QZWA 1D9KB 4Z7UE 3B6SB 2BC4B 4EJ1C 4RWYH 2C1OA 1M71B 4KKLC 2C3WA 4Z7UF 3FQXA 2QADC 4HG4J 2ADGB 3WFCL 3GKWH 4CJ0A 2WNGA 5D2NA 4A6YH 1LK2B 4EI5C 2H3NB 4U1SA 1WQVT 3G6AA 9CGTA 4KH2A 1AXSB 4NQCA 2DD8L 4YBQC 2MCG1 5C08E 2GK0A 1UKTA 1Q9OB 3GO1H 2PTTB 4HF5H 4Y4FC 3WIIH 4YHLH 3I3BA 3OF6A 4KQ3H 5F7NC 5FA3B 5FCUL 3SGKC 3QUMH 2WUBH 2HJLB 4FP8L 3EYVB 3P9LB 4PJXB 4G8FB 5INDA 4JFEB 4G80A 2R1WA 3T1FB 4PJHF 4S0SD 1YA5A 2I24N 2XIDA 1R3HA 5DMGD 4K3JL 5ANMA 4ZFFA 3OHXA 3QUXD 4NNPH 4OZGA 5F71A 5HYSG 5I17A 1BLNB 4UOW1 4N5EC 5DO2C 2BRRH 1KPUB 4X5XB 1MCDA 1T20A 2Z93A 1UCBL 4I4WA 3U9UA 1IGFL 3OKEB 1Q1JH 2V5SA 4WTWA 1J0JA 3OQ3B 4F80A 4OLWH 1FL5B 2Y07H 2DQCL 4MNGE 3QDJE 3RNQA 4IRJB 2YA2A 3VH8B 1NCAH 1LP9B 4MXWH 1JGEA 1M4KA 1NUNB 3PE9A 4PP1D 3O3UN 3T09A 3QXUA 1M05A 2FL5A 2ESVD 4TUKL 2HT3C 4R3SA 3N1QC 3I9GH 5JDSA 1U8HA 3CVHB 4LLWB 2G75A 4Z7VF 5GRUH 4LSUH 3PHOA 2L7JA 2YA1A 3GMOB 1A3RL 3VRJB 1XF5B 4QRTA 3PDOB 2E27L 3FONB 4LFHD 1FFOB 3OAYK 3C09B 4ODVH 4YBLC 5HD8D 4FTVD 3HG1E 4O9HH 4AG4L 3UBXB 3X12A 4IRSC 2FJGB 2IANE 1HINH 2EDEA 1FO0B 6CGTA 4MD4A 5IHZB 4RA3A 5T1DL 1AFVH 4NCC2 5FGSA 3F62A 3KYKH 5AZEH 1KJMB 5CSZA 4GMSL 2XZQL 2XKNA 5HDQH 3BD4A 3IJHB 4J2XA 3PV6A 2ICEB 2ZCKH 1OD9A 4ODWA 4LSRH 4K3DH 5DTFB 3SE3C 3DMMD 4E5XB 1MCEA 3HNSH 4GUPB 2HVJA 4XHJC 1IKFH 4R8WL 3ARGA 1ZAGA 5HPMA 5JLZB 1YN6A 1IGJB 5IB2B 2R2BA 2FH8A 4KHXL 2X6MA 2VDQL 3U2SA 1R3LA 1EHXA 2KQNA 3CUPB 3H42L 2EH8L 4NQTA 3SKNA 1S8DB 4ZFOA 3SE8H 3MRBB 3VXNA 3NIDE 2PYFB 4MB5A 3I6LE 4YXLH 1PEZA 3T4YA 2R29L 4DKDC 4ZSOA 3PQYB 5HPOA 1N0XL 3F7RA 4JREB 1EEZA 4WDIA 3MRKB 3A6OA 2B1AL 4AZ8A 4O5LL 4ZS7H 4MB3A 2ZUYA 1CDHA 3LEVL 1ZLSL 1KTLA 1CGXA 4M5ZH 3KPNB 2AJYH 1SMAA 3WN5C 1EFXA 2C1PA 4MWFB 5DJDB 4Y2DA 1I8MB 1DL7H 4LCYB 4F7EB 4KROB 1J0HA 2MPAH 4JFDA 1IBGL 1K8DB 4XCEB 4KDTA 1J0ZA 5GRZA 1G7QA 2W65B 2WLYA 1TJHH 4NUGH 2B1HH 2J8UA 5SWZA 5CINL 2X7LA 1EX0A 3L3OA 4LCCA 3TEUA 3IGAA 4EI5A 4KKCC 5DRXA 4BUHA 3W11D 5F7EL 4PRPB 1WF5A 3QXAA 1RZ7L 5C2BL 1I9IH 2P42B 2H32B 3X17A 5FB8B 2VDLL 3T3PE 4MJ5A 4CDGC 1SVZA 5C0FA 3WE6B 4PP1C 1MPAL 3M17B 3BSZL 2OZ4A 5E6IC 3DARA 3RWFB 3C8HA 4WW2B 1Y6NR 4G8GE 2AXHA 4C55A 2I9LA 5E08H 5EO1B 5I73B 4ZUSB 1CXFA 1AJ7H 1S5IH 3MRQB 5I18L 2FNBA 2EO9A 4I2XE 3BH9A 3DHMA 1UXWB 1LO4L 4KKLD 5I1GL 1O7SA 2BNQD 2HAZA 1T5WB 5EO0A 3UPAA 4KKBC 4ORGA 2Q3ZA 4QRRB 4YQXH 1HEZA 3KPLA 4ZPTA 1WZLA 4JFYB 5SX5H 3VXTA 3QHTC 1IKFL 1AGDA 1BLNA 1QO3A 4NRYB 4X5XA 1A7PH 5BXFB 3LV3B 1UZ8B 4BSWA 5KN5B 4M48L 3SCMD 4MD5A 1IFHH 3N85H 5IJKC 3SE9L 4MAYD 2X4NB 5JXEC 5TDPA 2EDDA 3WIHH 5GIRB 3P3YA 1X5LA 1FDLH 4V1DA 3W2DH 3HUJE 1ZT4B 4WCYH 1BQHA 1U2HA 1KXTB 4WU7A 4Y4FD 4JE4B 3LH2H 1Q0XH 3VCLA 5JDSB 4O5LH 2X4QB 2AXGB 2R15A 1MJUH 5DJXB 4Y2OA 3UTZB 2WIIB 4WI3A 3VRJA 1N2RB 1ETZA 4HHAA 1UXSB 4C4KO 5DC4B 2H8PB 4YXLL 2XFXB 3G6JF 2VAAB 4OF5A 4NO0A 5HDBF 4OV5A 1OGAE 4CDHA 3SGDH 3QUZA 2DQDH 4QOKD 3EYQD 5H35B 1YPZA 3QQ9C 2O61A 4DCQB 4RQQB 2X89D 2UZXB 2BVQB 3REVB 3VG9C 2XTJC 4XNZC 4ZO8A 3MTRA 1JNJA 3O9WB 3S34L 5TQ2H 3K80A 1QTYT 1T0NA 4WI4A 4PJ9D 3VXME 5KG9B 1KEMH 1UM5L 2XKNB 1GIGH 5MHSD 1UJ3C 2UUDK 3R8QA 2WWMD 2DLFL 2ZCHH 5D7KE 3HC4H 2HVJB 3T3ME 1QD0A 3SJVD 3GSXB 1D6EA 2Q86A 3IXAB 5L2KB 1RIUH 4PG2A 1V7ML 3OL2A 2MSPA 3FMGH 3HE6D 3VFGL 1T1YB 3DBXB 3TA3B 1KN2L 4BQ9A 4L8BA 4KMLB 4OUUA 1GZQA 4NKDB 5DEGA 2X05A 1T1ZB 3MNZA 3MODL 5JDJA 3ALXA 5CP7A 1KULA 3V4PL 2OR9H 4MD0B 5KSBF 1H8OA 3BXNB 3WDHA 2DYPD 2A2QT 2AJZB 1AQKH 2HTKC 2VDLH 1WJ3A 1MCWM 3BZDA 4WDIB 3HMXA 4CADB 2BVOA 3IKKA 4ZSOE 3QFJA 4YHYC 2V2WA 1FBIL 3KXFB 4N8CH 3CFIC 5DD0L 5I8KH 3QIWC 1LILA 3T0WA 4YR6B 4MXWL 3QISA 1PQZA 3BEWB 3KPNA 2MTPA 3QPQD 5AYUL 3DVGB 2JJSC 4UT7H 4LBEA 4HCRA 5I8EB 5J56B 4XRCA 5C0AE 2EE9A 4D94A 1IGFH 5ISZB 1FLRH 1OGAD 4GRLA 1UCBH 5HY9B 2VXTL 3UBXI 5T1KA 1YNLH 5ADPL 2CDFB 2I9TB 2VQUA 5JHDD 4ZG1A 4XB8A 5IESH 2OTWA 2EDKA 1WFUA 4N9GB 4POZC 4Y4KB 1A6ZB 4Z7WA 3WFZA 3STLB 4H25B 2GITB 1GRWA 2WAHA 5BZWB 1X5JA 3LKRB 4V2BA 2ZNXA 1R5IA 4LAJH 1D5MB 3E6FA 4PB9L 1WIOA 3FB6B 4PJ7F 3L6FB 1T1WB 1XF4B 4TTDC 5IMOA 1IE5A 1FH5H 4YHNA 4KQ3L 5FCUH 4XPGL 5C0DB 5HHOA 5E8OB 3IFNH 1JN6B 4O02H 4XNQA 1G1YA 4JAMB 5C0ND 2JB5L 4K9EC 3MNWA 1JRHH 5EO1A 1LEGB 4LK4A 3T0AA 3RU8L 3QNZA 1UXWA 3TZVC 5JQ6H 4M8QB 4PY7B 1H0DA 3RVUD 4PJAF 1T5WA 3RWDB 1BWMA 1RJLA 4P2RD 4BKLB 1BD2E 5MEQA 3D39B 2BVUA 1CYGA 2EECA 1ZA3B 2ZCKL 4BQBA 4NRYA 4XP9L 4Z7QF 2C3XA 4JHAL 5HYEA 2VMFA 3U7AA 3C6LA 4BSWB 5KN5A 2XN9A 3MGAA 3M1BB 5D2LE 1T66C 4JGMA 1A1NA 4P2OC 4ZQKA 5C3TA 5DA4A 4DN4H 5TH2B 5TDPB 4UBDC 1A6VH 1N6QH 5JW3H 1QACA 2ATPB 3VFWB 3V8OA 2IC2A 4OFKA 3UJIL 5L0QB 5L2JB 3MRFA 1MJ7L 1CLYH 2BCKA 3JV6B 4U1SB 4Y1AB 4Y5VA 4V1DE 2BNQB 4LHUB 1OT2A 1P69B 3FOMA 5DK3A 5ID0B 3U79A 4PRID 3QFDA 4M7ZB 1JNHA 4OCNC 5D96B 4ZFGL 3O2DL 1MIML 5F6HJ 2ZG2A 4JPVH 1CS6A 2XFXA 4LDEB 4QXWA 4EI6B 4GW1B 3DX9B 5FYKE 3ZDYF 3DUSA 1FBIH 3BDXA 4WUKL 4ZTOL 3LKOB 4Y5YB 4M9PA 2AV7A 2CDEB 1M6OA 1K3IA 2CO7B 3P9WB 3ZE2F 4H0GA 1BM3H 1DCLA 3UJTL 1EPFA 3K2UL 2VR9A 1PKQA 3T3PF 1MWAA 1AXIB 3KJ6H 3O2VH 3O3EA 5MI0C 3S37H 3NPSC 2I60H 1ZTXH 4OGYH 1FG9C 1CD1A 1ZVYA 2CUHA 1PEWA 1T2QH 1MHHB 3U0TB 5HI5C 3QCUL 1YNKH 1D6VL 1CFNA 3IXAA 2Q86B 2YHGA 4OCWH 3O8XD 5EU3A 1CFQA 5AZ2L 1J05B 5IBTH 3SHSA 3ZMRA 1GGIL 3QUKA 4J4PD 3U48A 3MV11 2ZOLB 2X1XR 3U4BL 1GZQB 1NSNH 3IF1A 5DEGB 4L5FL 2G75B 4Q97A 5F9OH 3LPGA 4PYHA 2NZIA 4K55A 4X0KB 1CL7H 1T6WA 3GSQA 5TQ2L 1FZKA 2OLDA 1CZ8L 1ADQL 5DHVH 4H20L 3UBXA 2QKIA 2ED9A 4WY7L 1CXLA 3EO0A 1BZ7B 2ICWJ 1C16B 2MOVA 1F11A 1OAUH 4ZFGH 5IHZA 3UTSB 2NYYC 4OZFA 5I16B 4U6VL 1KYOK 1MNUL 3SJVB 3ZKMD 4QEGA 5ERWA 2OTPA 4LBEB 3VWKC 1JK8B 3W81A 3U7YH 5GGUA 2ADIB 3DMMA 5I2IA 5LWYH 5ISZA 3VGHA 5FYKD 3RGHA 5AG9A 2RAMA 3D48R 2GJZA 5T3ZD 5EOCH 1G9NL 3U7WH 1VERA 3IXTB 3FO1B 3OAUH 5DC9B 1CGTA 3REWB 4MAUH 1HDMB 3KLDA 4UU9B 2J6EH 2R2BB 2OI9C 3TJEH 2AJUH 4P23D 3LKRA 4JFPA 4PJEF 2X4TB 4JFDE 4U3XA 3KXFD 2EC9T 2OR7A 4XC3H 4M93B 3C5JB 1NAMH 3I02B 2DWDB 2P48B 3SGKA 3I6GA 1U8LB 4JDVB 5DMJB 4YHNB 4R90H 3SKJH 4ZSOB 3MRRB 1F90L 5T3ZH 3RDTA 3MSPA 1ZHNB 3GSNH 4YDJA 3WLWD 4Y4HD 4KDTC 1T3FB 1IL1A 2AJXH 5HJ3A 5I1GH 3LIZL 4HUUB 4FQXD 3ARQA 1IT9H 4LP4A 5F9WC 3ARFB 2D2OA 1AJ7L 1LO0H 1SVCP 1CICD 4Y4KD 4NQED 4KKBD 2VTFA 2BOCB 2WUCL 1A5FL 3MBEC 3L5WB 4JG0H 2QQKL 4PB0L 3O6KH 3R0MA 2QQQA 3S3SA 1YY8B 4JFQB 3O4LA 1EBAA 5MERA 3VWJD 1RZ8A 5I1DA 4HUKB 3MLTA 2NTSP 5JTWA 3QIUB 4EI5B 2NY5C 5C2BH 5IESL 1WAAE 5IV2B 4PRPA 1D5ZB 2O5XL 4DZBA 4PJXE 1QLEH 5T3XD 2E7CA 4M7LT 4UTAH 4GW4A 3VFWA 2MKLC 1A14H 3CFJA 1A7PL 2V5MA 4TULL 3MRFB 1N64L 1N6UA 4F7PB 5MEOB 2WMPA 4QKXB 3RRQA 1DFBH 1MCPL 2SEBB 4GG6F 4U1LA 5KW9H 4GAJL 3ALPA 1JZ2A 3NIGE 2J4WH 3B3IB 3BDYH 1I3VA 3HNTH 2DYPA 5D6CA 2B39A 5K9OB 4JFZL 3VFSB 4BQ6A 1ZHBA 2F54E 5I74B 3FFCB 2V17L 3DUSB 3UAJC 5BRZB 4Y5YA 1W0VB 2AK4B 2D03L 4NT6A 1A47A 2EXYC 1FORH 4MQXD 5F44A 1U2CA 4QRRA 3VXMD 3VXTB 4KTYA 1CGSL 2NTFA 3JWOC 1DQDH 4U2ZA 1NC4A 1PZ5B 3RA7H 4JQIL 4OD1H 4PUBH 4NJ9H 2NXZB 2F53D 5CJOL 1LO5B 3KG5A 4QY8B 4EN3B 2Y4SA 3CIQA 3KYOA 4KTEH 3BEVB 5HGDA 1X5YA 3DO7A 4V1DB 3I84A 5FGBC 1I3UA 1FRGH 4LCWB 4DEPB 1T2XA 4A6YB 1JYNA 1C5DA 1QKZL 2OQJB 2ZOLA 4EUPB 2X4SA 5KAQF 3UTZA 3LSOA 2XY1A 5IBLC 1KNOB 1I7UB 5K9QI 1MRDL 1JZ4A 1T89A 4I9WD 2AQ1A 4PRHB 5IGXH 2IBBA 1L7TH 4DQOH 1P7QB 3JUYA 3ULVE 4U6HA 5SWQB 1GSMA 3H9ZA 4UT9H 1JWMA 5FO8A 5E8PB 3QUZC 5EU6B 4UQ3B 5TF1H 5EU4B 1N8ZB 3JBG7 4C59B 4NN7C 1NFDF 4HJGA 4FG6C 1LD9A 1B4JH 2JCCB 43CAA 3RWGA 4FXGA 5F7LB 1JNLL 3GK8H 5KSBB 5D7IF 2PW2A 2AABH 1INDL 1KC5L 1J8HB 3SQOL 1CICC 4NOBA 3UEZA 4CAGA 5IG7B 4Q0XH 2J3SA 5CHNB 5HGHA 4MLIA 1HDMA 3LS5L 1DBMH 5BZDA 4R90L 4S1DC 5ACZA 5D1XB 4LSTH 2E6PA 3WNKA 3TBSA 2XXCB 4XAKD 1T1YA 3X3GH 2XWJA 4X7TA 1YMHB 2W9DL 2ED8A 1MHEB 5E6IA 4JZJB 2JJWA 1F5WA 3RVVD 4LSSL 4G5ZL 4NBXB 1JIBA 4HIJA 1RZJL 1JNNH 3MLRL 1ERNA 4CADA 3V4VL 5A43C 3NA9L 3NVQA 2V2WB 1T3FA 5DK2A 4XPFH 4JZJC 4RISL 3EYOA 3W11C 4XCCH 4JEGB 2WUBL 3QUML 1MNUH 4ZFZB 1JWSA 1RURH 4NUJB 2VLJA 4QOKE 5HHOE 1CFSB 1FFNB 5LAXB 4PJ9B 3CVIH 4V2CB 1FV1B 1IM9B 3T0ED 4ERSH 1QBAA 4NC1C 1Z2KA 4HC1H 2A38A 2HRPH 2OL3L 5EFIB 1DE4A 1JZ8A 3A0OA 3S3PA 4MZ2A 5D1ZA 5ESAA 2VZ1A 3HHRB 1BFSA 2HH0H 1UB5A 1D5MA 2ARJA 5DJ8A 1HNGA 1NGXA 1WEJH 3DSFL 4J4PA 4OM1L 3ARFD 1D3CA 2VE6A 1BX2A 5IB5A 5C0DA 4QRRE 2IFGA 4WW1B 5CEZD 4XVTH 3BW9B 3LY6A 5C0CD 3ARUA 3AMLA 4Y5YC 1DQLH 1IMHC 4HWEL 2ZSWA 1LEGA 1SJXA 3LQZA 3AM8C 1U8QA 1I8IB 2A1WH 1ACZA 1H0DB 4FP8H 43C9B 3ZKXB 3GMPA 3QQNA 3T4AA 3QEQB 1JZ5A 4F8TA 1QLRA 1LGVA 5GJTL 1YEIL 5LQBL 4RWHA 2NY2C 3BMWA 4RAUA 4WHYG 4ZOCA 4H8WC 3WNPA 4LF3A 4HSQA 5CMAA 2E7MA 5E8DL 5EO9A 2YRPA 3OB8A 5I17B 3V8CA 4R4FL 5D7LB 5DUML 4D0BA 5TH2A 1Z0NA 2EC9U 3QG7H 1PG7W 4X8JB 3ZZ1A 4YDLC 3VDAA 3DGGB 5HYJD 4D0DA 3V6BR 1J0YA 1NANH 4QO1A 2A6KA 1YUHA 3KYNB 4HIHA 2DQFB 3JV6A 2CDGA 3MCKA 5JW3L 5IVNA 3VGBA 1L0QA 4EUPA 2HG5A 3FO9A 4Y19D 1Z9MA 2LU7A 1C5BH 4UUJB 5T1DH 3UO1H 1KJ2A 4OZHE 1V05A 5K9JL 3UC0H 2P47B 5IQ7L 2YWYA 2VN7A 3R0NA 3PQYD 3MA7A 1YN7A 5ALCH 4HFWA 5D7IA 5D7JC 3RTQB 3FFDB 1OP3K 2NCMA 2R2HA 5M94B 2WBKA 1TCMA 4IIQC 1XEDA 3V2AR 5CJXC 3WO4C 3NTCL 1OAQH 4I48B 2VDML 4APQD 3MRPB 3JVGA 2D31A 5F1NA 2EIZB 3GGWB 5IEKA 3ZTJH 1X6LA 1PBYA 4EVNB 1ORSA 1MCHA 3D39D 5CWSB 1QOKA 1T83C 3O0RL 4AY0A 1FO0A 4LSPH 2NW3A 4Z95L 3MLUH 4FABH 4HZLB 2R4SH 1N4XH 35C8H 4TN9A 2IANB 3O4LD 1MHHA 1NFDB 1KTDA 2P45B 2WSKA 4P5KA 1EHAA 1QP1A 2HTLD 5ELIA 5IHUH 3MOBH 3LEXA 3RKPA 5CEYA 4JFDD 1GYAA 3O6FD 3VDBA 2D7PA 3H3PH 4NCC1 1W72H 1DBKL 4HWEH 3IF1B 2F19H 1MHEA 3BGFB 3QULB 2BZDA 3NFPA 1A7QH 3IDGA 1AE6H 4LNVA 3D69A 5C6WH 1S9WA 5J1AB 5K33A 1S8DA 2H45A 4ZFOB 1DQQB 4YO0A 4ELMB 1OCWH 2UV3A 2IBZX 3MMEB 3SDCD 4ZFOL 4YNYA 5GS1B 4CBPA 1AHWB 4UT7L 1V8HA 3CLFH 1NGYB 4G7YL 3IDYC 5ERWB 5E0QA 4CRPA 1J5OH 1WISA 2ZUSA 5GGUB 3PQYE 4KRNA 2B8OT 4TTDD 3EYUL 3FT2A 3U36A 4XZUA 3T0BA 4HFUH 3IXTA 3DHJA 2FB4H 5C07E 4LASL 3FZUC 3UPRA 1DUYA 1WFOA 5DRNB 4QHLA 4WO4D 1MAKA 3MRJA 2XQBH 4WU5A 5GRVL 1JZ7A 5JR1H 2Z8VC 5BQ7B 2GJ6D 3ARGD 4HH9B 3TT1L 4P5TB 1AO7E 2FIKB 1BX2B 3I3EA 5IB5B 4LSSH 3ZHDA 4WWKC 1WT5C 1QSFB 1JMZA 1PY4A 4P4RB 3GZKA 3S35X 1IGCL 1VGEL 2GJJA 5JW5B 2R0LL 2ZSWB 3EYVA 3P9LA 4PJXA 5INDB 1YMME 5E00A 5I66B 3MJ6A 3AMKA 4L9LA 4PRBA 5C6TH 4PJBE 5EU5A 1MEXL 2NY5L 2Y36H 3ZSTA 4CVUA 1R3HB 3SDYL 3RWFA 3KDMB 5JOPD 3CMOL 4K2UL 5DMIH 1CLZL 3QEQA 4R2GD 4N0CC 3HCVB 2V5YA 4LEXH 5C8JA 4HCRH 5TFSH 5H37G 5HHME 5F7HA 3DXAA 3BH9B 3MBEA 1JHTB 4HXAH 1RU9L 1DJSA 1U8JA 1WIPA 1G7JB 2GFBB 3VA2C 1XF3A 3D9AH 3CU7A 5GS3A 4X4ME 3OKEA 5JMRA 2JLLA 1JYWA 4JY5L 1FGNL 3HG1D 1RHHB 2QBWA 2KQMA 2YK1L 4OLVL 3BPOC 4Y0GA 5L2KE 4NZTH 3V0WH 5E8NA 4CMHC 4X9BA 1FAIH 2X70B 4FFWD 1UZ8A 3DVFA 3CU1A 3DYMA 1RZKH 2FHFA 3LN9A 4P9HL 2VLRB 1NCCH 1G0XA 3BKYH 4MSWB 2HG5B 3P4LA 3T0DA 4RMTA 2CQVA 2HTLC 3LEYL 4AENA 2IH1B 4KJYA 3DO3A 1XZ0A 2AP2A 2F8OA 1YEHL 2DYPB 1KPVB 3OZ9H 3TZVA 1KN4L 1NDMB 2VNCA 2YD8A 1JZ3A 2JB6B 3PUCA 4WHTB 3RTQA 4R96A 1FRGL 3RWCA 3HUJB 2OMNA 1U8NB 4UV4L 5IMKB 3BVNB 4KK8D 4O2FA 1MFEH 4WW2C 1B4JL 3B83A 4J12A 4KTDL 25C8L 1MIEH 4HD9A 2Q8AH 3MRPA 2ZUQC 5FHBL 4NO0B 1IILE 1NC4D 4HK3N 5I1CH 5F1SA 2QV2A 5KS9B 3DIFA 4PJBA 1VFAA 3LQAH 4XPTL 2NY4B 4P4KC 2B7DT 3G08B 1R5WB 2YD1A 4RZCA 5CIPH 3QXDB 4EDWH 4RQQA 2NW3B 2WQRA 5DT1H 4OTXL 3FRPG 1CDJA 1CGUA 4E5XA 2X09A 3NIGF 4GUPA 1JYVA 3AS0A 2ZUXA 2B20A 2BNUA 2X1WL 3QR2A 4POZD 3SDDD 4BJLA 5JLZA 1IGJA 5IB2A 3K8LA 2PXYD 4XXDA 5D1XC 3HMWL 4NCDA 4XI5C 2FX9L 4X6DF 4OGZA 5C0EA 3O9WC 3DVIA 2Z4QB 4M1DL 3BP5A 4J1UB 7FABL 4JCMA 1Q72H 4PJHA 4ONHB 2BSRA 3RZCB 4NJAH 2VLLB 4LHUG 3NOIA 4QRQA 3TPKA 5HHQA 1EEZB 3BIBX 3IDNB 4OFIA 1RZIB 4NN6C 3WSQH 3ARTA 1Z3GL 1N8ZA 1F8TH 2ENSA 3K4DA 3QO1B 4PBWD 1DLHA 4HKZB 4FXGB 1EH9A 3QDJD 1FZOB 1K5NA 1KCSH 3X13A 3QPXL 4YXHL 1G1CA 3VXRE 2Y7QB 4PR5B 2GK2A 4X7EC 5B38G 1D5IL 4JG0L 3WJJA 1BOYA 5GGQH 1NBQA 2OJEA 4Z7UA 2RHEA 2W65A 5EC2B 1A7NL 25C8H 3PABB 3L7EA 4WFFD 1PFCA 3V7AG 1KELH 3EOTL 3MXVH 2FWOB 1IAOB 3PWUA 5T1KB 5C0AB 4U1JA 4PBVC 3D25B 3MRJB 3QWOB 5AAMA 3LKSA 1RAMA 2OTWB 2J88H 4HS6B 5BQ7A 5J4MA 1GH7A 2XN9D 2EYSA 4F33B 3ULVH 5CEZE 1E6JH 4L9LC 4P9HH 4BFBD 3MLXL 3FN9A 4N68A 4Q2ZB 1QFPA 3H6JA 2MFNA 1UM4L 2IPUK 2HLFC 3ZKXC 3L6FA 3MRQA 3ZTJG 3KLHC 2B2XH 1TETH 3E6HA 1MFDL 2CK0L 5E8OA 2MWCA 5F7MC 3EGSB 3P0YH 3SE4A 3QUMA 4R26L 5F72S 2VLJB 5GGVH 5A2FA 1HEZB 3B9DA 1RMFL 4QRPA 4PJ9A 3QNZB 1B3JA 5FO7A 4F2MB 5IMLB 5DMIL 1U3HD 3P30L 3DYPA 3GMRB 1P7HL 1NC2B 3D3VB 4ZOAA 3EJYD 5IP4A 4NKIL 1RJLB 4IMLB 1B0GB 1Q0YH 2QJDA 3WHE1 2Z92A 5J9PA 4P46D 3QHZH 4HEME 3OR6B 2JIXB 4FZEH 3QUXB 4WNQB 1NL0H 1IGCH 1FCGA 5DJ8B 1HH6A 4JB9L 4X83A 1JF6A 3CFEB 4NKMB 4FTVA 3OAUL 4YFEA 1DR9A 1EA9C 1T21B 4LCIH 3RX7A 3WKML 3UDWA 4G6MH 1P4BL 2Y07L 5KOVC 5D8JL 1AGEB 3AS2A 1J1PL 4ONOA 3WMSA 4Q6IC 1HCVA 3RWCB 3TA3D 1IZKA 4DFIA 3QFDB 1JNHB 3DSNA 4LPTA 2VXSH 1RULH 2APBA 4R7DB 4OGXL 1TIUA 4C4KT 2BVQA 3JWDL 4MCZB 4GW1A 1DZBA 4OIBA 1UZ6F 5HVHC 3S37L 2GT9B 1FFRA 1CE1H 1GVIA 5GQBA 4WJ5B 5F7DB 1Z0MA 5IW6B 3TWCL 4I3RH 1FN4A 5F96H 3MO1B 3V4UH 4KQ4L 4X8JA 4OLUL 2P44B 4RIRB 4OIIH 5HHNB 1YUHB 1EBPA 5FYKL 1T0MA 4LLDB 3BWAB 1S5HB 2AGJH 1DBKH 1LEKB 4NO0D 5E95B 3BHBB 1QQDA 2YN3A 4XNYH 3MA7B 4JKPL 2H6PB 4JR9L 2UWEA 3UTTB 3RJQB 4O00A 3ZKSD 1DSFL 1WBXA 3IDNA 5J3HC 2BVOB 4JDTH 4KV5F 2VR5A 4FN0A 4G6ML 1A6UH 4CW1A 3GSQB 4POUB 4IDLA 1CLOH 1IC7H 5KS9E 1EJOL 3QI9A 3BMVA 5IIEA 5CLWA 1QFOA 3X13B 4OCMC 3ULUC 5T33L 4PJDF 2BY2A 1DANT 3EO0B 5FGRA 4XP9H 5T3XL 3O2DH 4OSUL 3CZJA 3UTSA 5ETUB 2AQ3A 5HVGB 5HY9A 1HN1A 1X5KA 1OF2A 4WFHE 1LEIA 4FNLH 3SJVA 1FVCA 3PHQA 3NH7H 2ITCB 3TCLB 2I9TA 1NFDA 4NN5B 4P5KB 1B6DA 2IALA 5MEND 3RY5A 4N9GA 3B9KB 5IKCB 1SHMA 2FGZA 4I0PD 1PVHA 4U0RC 1NH6A 2ICCA 1WWBX 1AGFB 2DJSA 3DI2B 2DQEL 5C0RL 3LKSB 5FAAA 2GJ6E 2R0ZH 3B5TA 5SV3A 2JJSA 4K71B 1RJYA 1DQJB 1F4WL 4KRPB 1P7KA 4XCNA 5D9SB 1SEBA 4Y5XA 5DRWB 1EMTL 4MA3A 2WV3A 1U6AL 5KVFH 4PRPD 4J3XA 4R7NB 5I8CB 3C5JA 2HKFL 1NJ9A 4PLKC 4RSVA 5FHAH 2Q6WB 1LNUA 5IEHA 3F65A 3TVMB 1UYWL 4AK1A 1INQA 4YPGB 3UTOA 4NQCD 1EGJH 4P2QA 4KC3B 3EJZD 4QRPB 5ANME 2JB5H 3FT2B 5FO7B 4F2MA 5A2LH 3LKNB 4X6CE 1GGTA 4XVJL 3VI4F 15C8H 1J86A 4P48A 3TNNA 4ZDHB 1MOEA 3BP7A 4G3YH 4GS7C 3QUXA 2VLME 4WNQA 3H0TB 1U8MA 2VXVH 1KIUA 3I6KA 3Q6GH 4Q74A 5DHYB 3K0WA 4LCWD 3BZ4B 3QIUA 5L2JA 4KHTL 1RULL 4GG6A 2FZ3A 4WV1C 3VXUE 4HWUA 4FQQB 3L3GB 2EDBA 4P23A 3P11L 3TN0C 2HH0L 3ROLA 2FX8L 5JIKA 3PNWA 3THMH 1INEH 2IGFH 4KMTH 4NWUL 3VXPB 4F7PA 1P4BH 4OCXH 2AXFA 4OLXH 4HJJH 3FMGL 2EE2A 2B4CH 3QWRD 1C5CH 3CDGB 4B41A 3B2UD 3KDMA 1UWGH 1BJ1H 5C8JB 3K81A 3NZ8B 3S96A 4FS0A 3WS3A 3RUGE 1HKFA 1I85A 4J8RA 5IBUG 4HPYL 4BUGA 1JE6A 3N1FC 4TRPH 4QRSB 4WJ5A 4NT6B 1ADQA 1FAKT 3FFCE 3P4MB 5DURB 4NKIH 3NCCB 1RHHA 3BE1H 3C08L 2AK4E 2Z9TA 5I74C 1KN2H 2H41A 2CKBA 2VLRA 2VDKH 1CD8A 4E41D 5ILTH 1XIWD 5EUOB 5I1HL 4EN3A 1T0MB 1S9XB 5INCA 3LQMA 3VWKB 4HK3J 4YWGL 4A2LA 2W9DH 1TPXB 2D0FA 2P1YA 2WIMA 3UYPA 1JPFB 3EOBA 5FGCE 1WSST 5K9KA 1DBBL 5KSAC 1TCRA 3P77A 5F3BA 1C5DB 2OQJA 3VXSA 4M6NL 2VZVA 5EZOL 2FLBT 3ZSSA 4LCWE 1SBBA 3RY4A 4GT7A 3PP3K 2VH5H 2X4OB 2WP3T 2AJ3A 5HI4D 2EXWC 1P7QA 3V5DA 1H3XA 3FN3A 4HAFA 5KS9A 4TVPD 4AL8L 4NOFA 1KUMA 3KHOA 2VDNH 3G08A 4RZCB 5I73C 4P59H 4AEIH 4YX2L 3F5WB 4GXUM 2HKHH 4HJ0C 4XBPA 4JDZB 2CLZA 1B0RA 4YQXL 4PRNA 1FJ1B 1GPOH 1IGTA 3FO1A 3REWA 4R0LA 4DGIH 2MKWA 4ELME 3ARRA 3WDJA 2FO1A 1NMCB 2QLVB 5CBAA 1FDLL 4EKXA 1KIPB 1TVHB 3HZKB 4J3WA 3ZYIA 1EVUA 5I1LA 4RFOL 3CMOH 1I9RH 1BVLB 4PLOB 3QHFH 2BVTA 5TPWH 5BZDB 2PN5A 2K9UA 1XR9A 1G9MH 3G04B 4Z7VB 2Q1EA 1YYLL 1BIHA 5GGRB 5C09E 2ESVA 1FYTE 4HUMB 4MA3B 3MJ9H 5AWNL 4X4ZA 3TGXA 2VLLA 1S7UA 4WW2F 1UH3A 1E6JL 1PAMA 4HLZH 1NJ9B 2IQ9H 3RL1A 4Q9QH 1L7IL 1R3IH 4KK9C 4CU7A 5HI3C 4FFYL 5F89A 2AJVH 1INQB 3ARFA 1HSAB 1XR8B 3TV3L 2IQ9L 2XWTA 3FT4A 3UZEA 4YFDB 4RGOH 1I1YB 1I3RA 2JE8A 5A1AA 2XT1B 4K8RL 3AREC 5D1QC 2BY0A 4XMLL 3L5WA 1MFAH 2OJEB 3LKNA 1JWUA 2NY1B 2X1PA 1U95A 4KRLB 1MSPA 3CZFA 3TO4D 3U4AA 3LVEA 4P0DA 3KJ4B 4PGDA 3N1GC 2AJYL 1UA6L 3H0TA 1D5ZA 4U1JB 4IRZH 4ZTPH 5FYJU 3A67L 3ZDZE 3EOAA 3E1F1 4P57A 2C9AA 3CCHA 2NXZD 4GG6B 4GRLC 4R2GC 4F57L 5KVEH 4FQQA 4X9HA 2A77H 4K94L 4G8IB 3MRLA 1VSCA 3OZ9L 4Z7NE 4LHQB 5DD5L 1A6TA 1MFCH 5F97E 4WFGD 2VE6B 1RZGB 2DQJL 3FT3A 3L3HA 3MGTB 4MVBD 1RV6X 3E6HB 2VH5L 4KHXH 1AE6L 3CFKA 3SY0A 4QRPE 4PG9B 5ANMB 4M6NH 2I07A 4M43H 4YHKL 2YR3A 1FYTD 5TE4H 4OZGB 3ZHKA 4D3CL 1II4E 4OZIB 4JZOA 1I8IA 4U0QB 5I1EH 5C0IB 4I4WB 3U9UB 3O4OB 4ETYA 3V0AC 4M6MH 4GMSH 3TCXA 2J8HA 3IFOB 4MA1C 2DKSA 5GZOD 5FF6B 4LSPL 3UJJH 3RNQB 1PSKH 2CXKA 3SDXA 4RAUB 3DO7B 3HPJB 4B53A 2FCBA 3H3BC 3Q1SH 2E7HA 3QDGD 4A6YA 1J8HD 4R97B 5D7LA 3I6LD 4FQLH 4X4YB 4O2EA 4MQTB 5JIIA 4GKNB 1I7UA 3W5NA 3HAEH 5ISZE 2I26N 1DEEA 1KJVA 4W6YB 4FQJL 3INUL 4B5EA 4M7LH 4RBPK 1TLKA 3GSWB 3TJEL 1BF8A 4TUKH 4ALAL 3V6ZA 5DK0B 4HIXH 4U7SA 2ADJA 1CLOL 2KL6A 4LIQL 4OLXL 4YDKH 4O58H 5DQJA 2LQRA 4XP4L 5ITBH 1OGTA 3RWEB 1FYHB 2P5EA 4P2QD 2RGSA 3PF2A 3VXRA 1A3LL 3CFBA 1UQSB 4L1HA 3F5WA 3AC0A 4I48A 4DGYL 2DQUH 5IG7A 4G6FD 5HHPB 1JPSL 2W60B 5BJTA 1I8LC 3SKUD 1IC4H 5ACMA 2DQHL 4P46B 1QA9A 5B3NA 2YD3A 3CUPA 3SOBH 1FFQA 3DV6A 4P5TC 3T2QA 1HHKB 4I1NB 3SKNB 4OLUH 2YPVL 2E7BA 4MAYA 4NGHH 4UIKH 5HI4C 1FNFA 2V2XB 3QEGH 4I2XA 1Q94A 1DDHB 4X9IA 1ORQB 1VEOA 2NY3D 5FGCB 2YSSA 4LPXA 5IR1A 4UIKL 4KK5D 3LN5A 2PYED 1CICA 2CLVB 3ORJA 4R4BB 2QQLH 2FJFB 4OCYH 3MV8A 2O93L 1OSPL 1WBXB 1QRND 3VH8G 2R23B 2VDRL 3IJSB 2VLKA 1OLZA 5J12B 1OTSC 1E6OH 1UM6H 2R9HC 5FHAL 3MXWL 3OKMB 1NCDH 4JHZA 5IT2L 1S9KC 4Z76B 2BVPB 3FRPA 2OXHA 4XNMB 2O5ZH 4M1GL 2NY4D 1KIQA 3GO1L 4O58L 4ENEC 1IQWH 3PHQB 3EYUH 1TZGL 3FTGB 2X7LB 1YPZF 1NLBH 2OZ4L 2F54A 3FO0H 5FCSH 1AR2A 5BO1H 3V6OC 3GKWL 4P2QE 1JPTL 5ESAB 2DI8A 1T80A 4FQJH 2EE3A 4ZUUB 5HSFA 4FQLL 2VAJA 3ZYZA 1OAYH 4QHNB 4YHPA 5D6DA 3RZCD 1QHPA 1TXKA 5FECA 4M7JH 1GL4B 5HVFB 2PO6A 3KAAA 1A6VL 3HKFA 1N6QL 4NQVB 4HH9A 4X4MA 1N26A 5C0BB 5DJ2A 4MJ6B 2IAMC 5ITFA 1JL8A 1G7IB 1S7VA 3L9RA 1AO7B 4N5ED 2PCPB 4APQA 1QSVA 4DGVL 1HI6A 4NM4L 4HUVB 4BA8A 3IRPX 4X7SH 1QSFE 5EU5B 3DX6A 3L3JB 5IVOA 2XXMB 4PJFF 1MCOH 3LDBB 5L0QC 2DJ4A 3QDME 5GRVK 3UAJD 3QDHA 1RI8A 1KF9B 3C5SB 3DXAB 4H88L 1U8MB 4F15C 4XWOD 3TN0A 5T1KD 4U3CA 3O3BA 5ESVB 4L8SC 1JNLH 3U6RA 3BZFA 2ERJB 2W0FA 2EEAA 1NUGA 3VCLB 3VGAB 4DKEL 3HE6C 3V5KB 2HFGH 1XCQB 2FEDD 1J11A 3R8BB 3Q1SL 1VDGA 5E8NB 3DURA 4PJ8C 3ZDXF 2QHRH 4TOYL 4XX1E 4UT9L 5HGAA 3STBA 2LTQB 3WBDA 5BS0A 3DRQA 2H8PA 3UO1L 1QR1A 5SX5K 4GMTL 2NY0D 4UDUB 1F42A 4PFEA 3ZDXE 4OGXH 3NCJL 1F58L 4PJ5E 4PRHE 1A7RL 4AENB 2VLRE 3QYCA 5ADOL 2DIJA 1VA9A 1YPZB 1YNLL 4G8GD 3MUZ1 1KPVA 1SEQL 5DJ0B 1KOAA 1MY7A 2EXWD 5IT2H 1AC6A 3H9YA 4L8DA 2D31B 2X41A 4WHTA 4BELD 2O26U 3OB0K 3ZDZF 5IEKB 1U8NA 5IMKA 5I0ZA 3ZE1F 1WCBB 3HE7D 1HHGA 1NBVH 3A6CH 4OKVB 2ZUWA 4HC1L 4NKQB 5IW1B 2J8UE 5SWZE 1A21A 4D9RD 5BJTB 1X7QB 5H37H 3GIZH 4PV9A 4Z7OE 3O45B 5F96L 4OF7A 1IC1A 5EZIL 5CD3B 5CEYB 2Y23A 2OTUB 3B8YA 3MRIA 4GQPH 1Q0YL 3QDMA 5CBEB 2V2XA 4NKDA 1MFNA 1W8OA 3D18A 3QJHB 4I3SL 4GKSB 3VWKA 3IJYA 4NNYB 4RFOH 1BAFH 4HWBL 4M1CC 4Q9BA 2BOBA 3V4VH 1JPFA 3EOBB 4URTB 4YEFA 2AJZA 1ZA6A 3BO8B 5T1LA 3BP4B 5GGVL 3AUVA 3VXSB 4H26B 4DGYH 4IOIA 5HXMA 4MJ4A 5MI0B 3MMEA 3KXFA 4QXGL 1FQ9C 1GPOL 1N5YL 3ULSB 4Z78B 4RAVA 1OAKL 2BSRB 4JFXB 2AJ3B 3S4SA 5DJCB 3GHEH 2EE6A 4K8RH 3BKMH 3TZVD 2HFEB 3OKMA 2VLJE 5CCKH 2VR4A 1YDPA 4KU1A 4S1RH 5DUPH 1QBBA 4HGWB 4P9ML 3HI5H 2MNUA 4JQVC 5K59F 2I5YH 4KROC 3QO1A 5JOEA 3NCYS 4WEUD 5I1JH 1IAMA 1L7IH 1AQDA 3D3VD 4OI7A 1FJ1A 2LAGB 2J12B 3FTGA 4MJ2A 1KENH 2JIXD 5EC1A 3DV4B 5IF0A 3GK8L 4U1KA 1S7SA 3EOTH 3L7EB 3VRLE 2IH3A 4K7PX 1OOAA 4K07A 5I1LB 1SJHA 3E6FB 3WS6C 3S36X 1GZPB 4Z7VA 4XVUD 3AS1A 4U1IA 2PXYA 1M71A 5FKPB 3WEXB 4PGEA 4U6XB 5SWSA 5C0AA 1TENA 4OZ4B 1NCBL 1JFQL 4PTUA 1QSFA 4P4RA 1G84A 1RK0A 1QNZL 4JFHD 5GGVY 4LDOB 4KZEH 2J7LA 4W68A 5HHVL 1EERB 4AEIL 2Q8BL 1Z3GH 4ZAKD 4LHJB 4AIOA 1UWEL 1AO7A 2BDNH 4MXQD 4P2YA 4X99A 1I1YA 4ENED 5C0CB 4HPYH 2M8XA 2GUOB 1F4YH 3MNVA 2X10A 4OZGF 2HT2C 2J88L 3EDDA 4N90E 3GSUA 3C6LB 5I1JL 1UT9A 4M00A 3GSRB 3HZYA 3IFPA 3OHXB 3UYOD 3EYSL 5DUPL 4JY6B 3OPZH 4ZS6C 4NM8L 1BBDH 2EDTA 3BGAA 5FYJE 5DS8A 1OB1A 1A6PA 1T7YA 4U1MA 3V5KA 4X7DC 3K3QA 2Y5EA 3D3VE 4IRZL 5KSBE 2ADFL 5ID0A 4XPTH 5D93B 5CKAA 2OM5A 4KJYB 4W81A 3UX9B 4IM8A 5EPMA 5C0BE 5CIPB 5EZLA 2P5WB 3MV9A 5DEZA 2PYEA 2ENYA 4NKMA 4E0RA 3UTTD 4OZHB 1DN0B 5D1ZC 3CVHA 3VMPA 1U3JA 3FQWA 3TO2B 3FRUB 3WHXA 2WZPD 3PHOB 2ERJC 5AD0B 3NGBB 4JRXE 1YEEH 3FONA 5DGQA 5F7KC 4RGOL 5C0NC 1WZMA 3CFDA 4F15B 3OBAA 4OIAA 2X40A 5LKNA 1R3IL 1MLBB 1VFMA 4LAQH 2B4CL 1C1EH 4NQEA 1EZVX 4HJJL 4JO1L 5C70A 1JBJA 4DZ8A 2ZKHL 3GB7A 3C87A 3KLSA 5CSZB 2AK1L 4WEBH 3U0PA 5JORB 3PWPD 1DEDA 5CUSH 4D9QE 2D7QA 3VXUA 4U1GC 1FO0H 3NZHH 3SKOB 5ADOH 2GY7B 5IMMA 1MHCA 4NZRH 3B2VL 3BPCA 4QNPE 3IU4H 3LDBC 1JGVH 5C09A 3IDMA 4NNYA 4JFFA 2V2TA 4HXBH 2IQAB 2VO5A 4JPVL 5IQ9B 4H26A 3EJZC 4DTGH 3RIFF 4Z8FL 4PJAE 2VDMH 4NIKB 5GISL 2OK0H 3NH7L 1EHLL 3EFFA 3ZT6A 3Q5TA 4AL8H 1P9MA 5JO5B 4F37F 3WO3B 1XGQB 1KENL 2G9HB 4PJIF 1FZOA 1K5NB 3HUJF 1CG9A 4H88H 1WT5A 2A6DB 4EOWH 1L9NA 4IRSD 3WUWB 4PR5A 5DQDH 3UTTE 5TDOA 4HG4K 4XPHL 4QGYA 4ZAKC 3NBNA 1JPGA 4Z7UB 2KPNA 1TZGH 2XZAL 2I5YL 4BQ8A 1HCFX 4OB5L 3IT8D 3GJFK 2ATKB 3IDJA 3ZKND 4IIQA 4IMKA 4F58L 1EEYA 5LWYL 3HI1A 4LKXA 1LE9A 4P46A 3RPKA 5KVFL 3AROA 3SDAD 1X5IA 1PX4A 2BHYA 2YA0A 4PJIB 1RUMH 4FA8A 2FWOA 3DV6B 4NQDD 1OF2B 3Q3GA 4LFHG 1FC2D 2X4UB 1WWCA 3MFFA 1MRCL 3L3OB 3AU1A 4LCCB 4Y4FB 1F3JB 1T83A 2YSSB 5CP3A 3ULVC 3IDXH 3C5ZD 4U1IB 3D0LB 1BQSA 4JRYD 3U83A 5SWSB 2YZ8A 4M7JL 3MRGB 2GIYA 4TTGA 1JRHL 4PTUB 4YDJB 3ILPB 2EIBA 3RDTD 2EDLA 5FB8A 5GJTH 5GJSL 3V4UL 1EO8H 1SEBB 3MBXH 4HUUA 4D0CB 4KI5C 2A6IA 2P7TB 5EZIH 2XA8L 1XGTB 4BSVA 3O41B 4Z76A 4Z5RA 1V3KA 2AJUL 5I19H 4LLYB 2BOCA 4U6YB 2W38A 3OTTA 3RUGB 2F74A 4HKXB 4DAGL 5CZXC 5IVXB 5GS0D 3BRFA 3QI9D 2F53E 4YXKL 2DQUL 3S37X 5MERB 2X9WA 4FMFA 3IFPB 1KT2B 5JPNB 4KMQA 1MH5B 4N8VG 1P1ZB 2P24A 1MCNA 3JWOH 1J7VR 1E27A 1CDUA 1PW3A 5B38B 1CK0L 4QT5A 1BM3L 3VXOB 4GW4B 4JN2A 4XP4H 2BK8A 4HFUL 2R4SL 35C8L 1EJ6A 4X6CB 2MQ3A 5GGRY 1QVOB 3BP7B 4CN4A 5KSVB 2SEBA 5I8KL 4F37K 4TOYH 2PO6D 3I6KB 4OIIL 5E9DD 1JV5A 3ARYA 4WU7B 1NL0L 5DDHB 2NY7H 1F3DH 4OZHA 2ZUTA 2PYEE 2VLRD 3WHXB 2EDWA 4UAOC 2A6JA 1S7VB 3L9RB 4XTRC 2EH7L 1N2RA 4QRUB 4MNQD 1HI6B 4DVRH 1ZVSB 1EGJL 4HUNB 1NUDA 1TFHA 1UVQA 2AXFB 5DJAB 2GT9A 2R1WB 4PJ7E 2UVEA 3HB3D 3HC4L 3VFUA 4PLJD 3S96B 4BZ2H 5CGYC 3KYOB 1YEKH 2OP4H 5D8JH 1IGYA 4FXLA 1Z9OA 3HZVB 4J8RB 2R39A 5D96C 4PJEE 4M7ZC 5CEXA 3O3BB 3SDDC 3QIBD 4PG2C 3WKMH 3GJFB 4OB5H 5DMYA 4LRIC 5BV7H 1FL5A 2ILLA 3PL6C 4FQIH 4UDTB 3NFSL 4IRJA 2DM4A 5C09B 3BPLB 2PKDA 2FL5B 1IAKB 1XGRB 3GMNB 5B8CC 5HYQA 3DBXA 3HMXH 4JO4H 2EDXA 1SBSL 1U8HB 5HGBB 2BNRB 5J13C 5I75B 5KZCD 4ZOEA 3MXVL 4OUUB 3BIAX 1JRHI 4L4VD 4RFEA 4G9FA 3WXVH 2C3HA 3H9SB 1EDQA 3MGOA 2Z31C 2VZOA 3MZTA 1SJVA 4NO2B 1QSEE 4GLRH 1F4AA 3SO3C 4BH7B 1D5IH 5IB1B 4HK0B 2GAZB 5I71B 4J6RH 5EH1A 4ZUVA 3U9PL 3W5MA 2FECI 2VWEC 4M5YL 1VACA 1WCBA 3WUWA 3B2VH 1G9MC 1KG0B 1PQZB 1EEQA 3QUYD 2O5ZL 4ONFL 1SY6A 1F8TL 3TCLA 1KXVC 3S97C 5A3IC 1UC6A 2XKSA 3LPFA 3BRGC 1I1FA 4L1DA 5D72H 1F97A 2GCYB 3BUTA 3LRHA 4CVXA 4WEBL 2XTLA 3QDMD 2NX5A 3MRIB 1A3QA 1AR1D 5F9JB 3ULVL 1IGTB 3IS0X 3NABL 3P2TA 4HJ0D 3SGJC 4WUUA 3RU8H 1D9KD 4TNWK 1QFWM 1RJYB 2LE9A 1FPTL 4FQ1H 2JELH 1DQJA 1TITA 5DRWA 1KIPA 5BMFH 3MRGA 1XIWA 3VI3F 4I3RL 3ZKNC 4IOIB 3BT2H 1BVLA 5AWNH 3RIAF 1N0LA 2VL5B 2VSCA 5E03A 2VOTA 5TQ0L 2FEEI 4MNGA 3QAZC 2Y5TB 3OAZK 4XPFL 1U9KA 3PQYA 1DQLL 1WUNT 1BF2A 2XV6B 3G5XB 4P2QB 1JTPA 4LVEA 2D3VA 4QHUB 4Z0BL 3FCTB 5MEPA 1FFNA 1RZJH 3KPTA 1I9IL 3KLAA 4JQVA 2V7NB 3LRSB 4PJ5A 3HFML 4IJ3C 4X98A 1PX3A 1IEBB 1MIEL 1JZ6A 2Z35B 4XAWH 1Y18A 5E2WL 3B5GA 2DAVA 4I0PA 2WQ8A 4XMLH 4PGJA 4F7EA 3FB5A 5IFHL 2QR0A 4LVOC 4L3EA 1BBDL 1ZE3C 4MJIA 4PJCF 1E27B 1PJ9A 5SWZD 4XBEL 2G2RB 5FM4A 4JN2B 3VXQA 2NXYB 4PJ8A 2AEPL 2RR3A 3T0XA 3WJJC 3QDGB 1W0WB 4OLEA 4X6CA 4HGKC 3VDCA 5C0AD 4WHCA 3L3GA 4WW1A 4YHML 3S5LG 1VFOA 3EOAB 5D7KD 3PNWB 4L4TA 3GJFH 3ARWA 4JG1L 4MJ5B 3QQ3A 5E1HB 2Q8BH 4Z0XA 1DLFH 5B39G 2R29H 5D7JB 4KWUA 3NA9H 5H2BA 2FRGP 3MRLB 2FIRT 3DXAE 3MLWL 1NFIA 5CLTA 3T0VA 4B0MM 1NCBH 4JFED 4ESKA 2OJZH 2BHZA 3MNVB 4CMHB 2VDQH 3WN5B 1PZUB 4K2UH 4DUWA 4LF3B 4XVSH 4FZ8H 1NCNA 1RPQA 1WFTA 4XBGA 1A1MA 5IJVB 4RA0C 1MCFA 4RMSA 1XCTA 3KS0J 3TT3H 3C2AH 4RGND 3LV3A 2R69H 1W0YT 3FB7A 3O3EB 4P3DA 4JJHA 4N1EA 3TO4A 2J5LC 4G9FE 4MAUL 5JXEA 4JQXC 5I9QB 2AABL 1RZKL 3U0TA 5GIRA 3ARBD 3CH8A 2BHUA 4LLAA 4O9HL 4AG4H 1VCAA 1M7DA 2PYEB 1J05A 5F3HB 5KVGL 2X4QA 2ZCLL 4PS4L 1OAKH 4YK4C 4QCIA 1N5YH 4ONGL 4RMUA 4QXTA 1F3DJ 1H5BA 2CKBH 3AVEA 5DFVC 2A0LC 4RDQF 4ZXBD 1XAUA 1DEEB 1ETZB 3HR6A 1UXSA 4HHAB 4AEHL 2BY1A 3QIBC 4NNXA 2VAAA 1IM3B 2NW2A 4UZGA 2NLJB 3V5DB 2EIZA 3GGWA 3DRTA 3V0VA 3TBWA 4EN3C 1VKXA 4LPCA 4EVNA 4HBCL 1CZ8H 5GS0L 3IDYB 1VACB 3PGFH 5DK0A 4S0TD 1QRNA 4YGAB 2YD6A 2JTDA 2NY5H 4OQTL 2O61B 1KG0A 1OTTC 4DCQA 3NIFF 4F9PC 3KPMB 4PJEB 4TRPL 1IAIL 3VXUD 4PRNB 4FFVD 1T0NB 5KG9A 4YBLB 4NJAL 4QHMB 1JK8A 5JHLL 2IMNA 3BUYA 1CTOA 5B8CB 3CFBB 4ODTL 1DL7L 5I2IB 4HIIA 3CSBA 1X6NA 5KTEH 2GJZB 1YC8A 3QEHB 3SEPA 5HHPA 2Q87A 1WWWX 4ORZC 2WWKT 4U49A 3DETD 1ZS8B 5E1AA 3G04A 1MI5D 4IHOB 3FAWA 2ZUQB 3P11H 4I0KA 4YE4H 1EXUA 3FB8B 3W9DA 3ZL4L 2IQAA 1SEQH 4L8BB 4ELMA 5JUEH 3UJTH 3F12A 4PREA 3BN3B 2EYRA 2R1YA 5EBWB 1WICA 3MLYL 4X5LA 1IT9L 2K7PA 2YC1B 3FFCD 5I1IL 1EK3A 4AQOA 2YZ1A 5F89B 4NRXA 1ZHNA 4F7CB 1F2XK 5FHBH 8CGTA 3MRNB 4L9DA 3MJ9A 2NR6C 2R23A 1F90H 5TDNA 5FDWB 2EKSA 5FYKU 4X98B 2DTSA 3TVMC 15C8L 2IWGA 3EDKA 3CXHK 5E4EC 3EDEA 3DVGA 4K3DL 4PJGF 1CQKA 3PWJA 4NO5B 4XRCB 4PGDB 2D4FA 1OGAA 1K6QH 3MV01 5J57B 1CFTB 4TNVF 3ARFC 5TJWK 3QB7C 4XWOC 1MFBL 2X4UA 5BV7L 1NCCL 1GHFL 4D8PA 2ARJQ 1G9NH 3QDGA 3MRDA 3BKCH 1QSZA 2FIKA 3ILQC 3IFLL 4GKOA 3MLZL 4JDTL 2FJHB 4G8IA 4NM4H 5IB4B 4NO3A 4ODHL 2GKIA 1LP9F 5FYJL 5SX4H 1ZLVK 4HT1L 2W1NA 2YKLH 3ILPA 1LO0L 2DL9A 4Z0XB 1E4XI 5L8LB 5E00B 1IKNA 5LBSH 5I66A 5GRUL 2APVA 4D0CA 4J23A 4ELKA 5SX4I 1ZT7B 5ICYA 5HYIA 3CFCH 3O6FB 4TSCH 3O41A 5JQ6L 1HHIB 2D7TL 3I9GL 2Q7YB 4Z5RB 1FP5A 3O81A 2DS4A 4FQIL 2DLGA 3HCVA 3RUGA 1KJ3H 4E9LA 2K1MA 1TJGH 1ZHBB 2VLKD 2F74B 4HKXA 3HC0A 4OAWB 3X14B 3FKUS 4OLWL 4LSRL 4U7KA 2NZ9C 2KDGA 4LNRB 4BKLA 1H8SA 3Q6FA 1NPUA 3B5HA 1K2DB 4HUVA 1CE1L 5FF6A 3DX6B 3P9MB 4C56D 3L5XL 3MJ8A 1QFWH 1G6RB 2DQGL 5D2LA 3L3JA 3SCMB 4L29B 1YY9C 1OPGH 1GGBH 3JWDH 5E2TL 5HGGS 1A0QL 3WS6A 1IQWL 5T1MB 3H3KA 1YJDL 4DN3H 4UNVA 3DJ9A 2XI9A 1OAXL 3ABZA 1INEL 4KMTL 5JIPA 2NY2B 3MJGX 3HRZB 4N0UE 5E2VL 3TH4T 3U7YL 2ZOKB 2DM3A 4GKNA 3TN0B 2IH1A 2ATPA 2PW1B 4XNYL 1XZ0B 4WFEE 3T3MF 3VGAC 4GQ9H 3MXWH 3RX8A 1XGYH 3BZFB 3ZE0F 1P7QD 1NDMA 4LHUA 1F4XH 1KB5A 4R6UA 3FOMB 4QCIB 1Y6MR 2IPTL 4YUEH 5J13B 2BFVL 3DURB 3FZUD 5ABDE 4P3WA 5CSGA 2J5LB 5HDLA 5J11B 1ZGLP 4Q9RL 4Q6YA 1ZGLM 4ISVB 1IM3A 3HA0A 3PWNB 3N0PB 4XP6H 4JO2L 1JWMB 1AQKL 4LKCB 3CX2A 3MBXL 4KI5E 1QRNB 1CK0H 5T5NG 4BK5A 4IOFC 3OJDA 3S3JA 5CEZH 4XCYA 3MC0A 1ZK9A 3D2UB 1CE6B 1MAMH 2DQIH 1U3HA 5D1XD 1T66D 4M61A 4NNPL 5B8CA 1QA9B 5EUKA 1HHGB 4NP4L 3SDDA 2IPKB 1A0QH 1YEGL 2UYLB 4PJAB 5K59E 2F19L 5JW4Q 1A1OB 5CHNA 4O51B 4UDTA 1HH9B 2Z4QA 4PV9B 5F88B 1CFNB 2B2XL 2VDOL 3O45A 2XA8H 4XVUC 4J3TA 3RZCA 4LQ1A 3EKCA 1KACB 1GIGL 1B6UA 2OTUA 1EXUB 3W9DB 4Z7VE 4FOMA 5HHQB 4L4VA 5F9WB 4LIQH 1TJGL 3F12B 4I3GA 4PREB 1CGVA 4QHKI 2R1YB 2DQEH 4ALAH 3GDBA 4Q0XL 2L4OA 2P49B 3WIFA 3CX5K 1LK3H 4UB0H 1OQXA 2JJTC 5C0CE 4K3EL 1H15A 3SGEI 3QXWA 2Y7QA 3MA9H 1G6RL 1C16A 4XNMA 4RAVB 1IM9D 1F11B 4HS8L 3S4SB 1G7LA 4DTGL 4Y5XC 3PABA 3MUGA 2OSLA 4HWBA 2MHAB 3E2HB 1R0AL 4GG8A 4L8CA 3RZWA 1UACL 4P49A 5D70H 1BIIA 5SWSE 4KPHH 2AW2A 4NUJA 4PY8J 2W0LA 5ISZD 4MMZC 2GCYA 2VABB 1QEWB 3UJJL 2FSEA 3DMMB 5L9DL 4ZYKB 2EIDA 3DMMC 1BGXH 3PWUB 1CFTA 3IU4L 3Q2CA 2XWBB 3MV7A 4OFDA 4EOWL 4UQ2A 2BX5A 2BY3A 2VISA 4NYLA 1J1OL 4WWKD 5FUOL 2BMKB 3X11A 5E7BA 4M48H 2R0KH 4OV6F 1V3MA 1BFVH 5D1ZB 1WAAF 1MCWW 2MQ0A 4QWWC 1VEPA 2GI7A 4KK6D 4WI5A 1KCUL 1HQ4B 3EZJB 4Y8AA 2YUWA 4NQVA 3VG0H 3WHE0 3S35H 4MNGB 3BH8A 32C2B 5FKPA 3WEXA 4B7LA 5BRZE 3MRRA 2AEIT 3SQOH 1VPOL 3BW9A 4JY4B 5CJBA 1RHFA 1HHIA 1T0PB 3EGSA 4M62L 2HN7B 4OQ1A 4NQXB 3K2MC 4APQB 3VFMA 1IL1B 2DLIA 3CLEH 1KIRA 5DQ9A 4QTIL 2VN4A 1I9EA 3ARZA 3MJ7A 3F7YA 4OLYH 3OMZA 1A7NH 4OT1H 2FEEL 2CH8A 2M1KA 2HVKB 3PGCB 1A22B 1I7RB 2FO4B 3P9MA 1QFUH 1G6RA 4NHCH 4LAQL 1TTFA 5I9QC 3QZWB 5KTEL 1HH6B 5CMAB 3GSRA