1CICD

Idiotope-anti-idiotope fab-fab complex; d1.3-e225
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
218
Chain Sequence
QVQLKESGPGLVAPSQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLHTDDTARYYCARERDYRLDYWGQGTTLTVSSASTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IG HEAVY CHAIN V REGIONS)
publication title Three-dimensional structure of an idiotope-anti-idiotope complex.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 45
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1999-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cicD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cicD01
5EIIA 1EK3A 3BP7A 1G7LB 1LGVA 1UH4A 3KPPA 4KI5C 4F15B 4L9LC 3E6HA 3BP6B 3NFSH 1KCSH 4OCYL 3RVWD 3RZCA 5EULV 3VXRB 4LHUA 5D96B 4J7RA 5CEYA 3N1PC 3V5KA 4UIMA 4QOKB 3QJFB 5KSAA 4NQDD 1GGIH 1D9KD 1VFAB 4FMKA 5BV7B 4RMVA 1BEYH 2H26B 2BCKA 3THML 1MCBA 4PJ9D 1ORSA 2RHEA 4KUCF 1JGEA 3S37L 5FAAA 3RIFK 4X4XA 2VABA 2JELH 4F9PC 1BQSA 4EBQL 3IXTB 2R0LH 3T77B 4LF3A 2LV4A 2WSKA 1U3HB 3GBLA 4GSDL 3TJEL 4IEFB 5B3JF 4G8GA 2NY5H 3P0VL 3B5TA 1G6RA 1RUML 3WNMA 2OXHA 3BPCB 3DTXB 3WE6A 5DYOB 3CFDA 1I1FA 1B6DA 3DRQA 5EOCH 2ARJQ 2B0SL 3GRWA 4ZTOL 5IEKA 2VUYA 1YY9D 1CK0L 4PJ7A 1FIGL 3PWLB 5DRWB 5TGBB 3RA7L 2CD0A 4PJ7F 4BZ2L 1KJ2L 4HMDA 4HWBA 3VXTB 3DYPA 1CT8B 2FATL 2GY5A 5C08D 3Q3GB 4WIQA 5LBSL 3MV7A 5TDPB 2W0PA 3IKCA 5FV2A 4TOYH 1MWAB 4KTEL 5A16B 2JJSC 1NEUA 1YDPB 3FHQA 4GT7A 4JFDD 4I48B 4KK8D 4O58H 5DURD 4X5WA 3VFWB 2ENYA 4PJAF 3HKFA 5HGAA 1IGJB 5ID1B 2XFXA 3V7AG 2NY4C 4MXQC 4A2MA 3MV8B 4YZFE 2QQLL 1TJIH 4KWUA 1BLNB 1EHXA 4DEPB 3IETB 2DLIA 5DJ8A 5C7XH 3J7HA 2J8HA 4FTVB 3AUVA 2PO6D 3FRPA 3MRIA 2VN4A 4DN4L 4OV5B 5CAYB 4QY8A 1KB9K 1A4KA 1HIML 3EBAA 2EDHA 5E99L 3MNVA 3VDAA 4PTTA 1CLZH 1Q9KB 4KTDH 1B2WL 2LAGB 5K9QG 5IW6B 1U8PB 4LCWB 4NKDB 1N3NA 3RU8L 1EBAA 1U3JA 3HS0B 2YD6A 2BSED 3HE7B 1T21A 3QIUA 2H2PD 1SMAA 3DV6A 4PLOB 5T5FL 2FEEI 3WFEH 4YXKH 1IE5A 1IGYA 3ARWA 3QEQB 1INDL 5E8NB 4POUB 1F11B 5KVDL 3OJDB 3VWJD 2VE6A 4WI9A 3U6RB 5F6HJ 4KAQH 4MNGE 1N2RB 2D9CA 3VXSA 5IMOA 1MCOL 5D7IB 3OAZK 2ICWJ 4M6ML 4PG9A 5CJXA 2XACC 3ARTA 3PQYA 4L8DA 4EN3B 4QXUL 4MX7A 3P0GB 2EIZB 1NUFA 5FB8B 1WWAX 4MSWA 3S34H 3ZKNC 1MCRA 4P9ML 3S96A 4Z0BL 3MRPB 1F5WA 3ARSA 5ICZA 1F4WL 2WBJD 4P3WA 3ARED 3O2DA 4HK0B 3OGOE 1FAKT 5DD6A 5EZJB 4EIGB 5IB2A 3E3QC 3CFKA 5FO8A 5HI3C 5CLWA 2EH7L 4NC1C 2HRLA 3SKNB 3SO3C 1CD1A 2XV6B 3UBXI 2ICWA 3PP4L 3CMOL 4NCC2 4RBPK 3HMWL 1JYXA 1JZ5A 4LAQH 1V7NL 4LLVA 1DR9A 5KW9L 3MACL 4JFEA 3RWJB 2X4TB 2I27N 3TA3D 4LQFH 1X44A 1HCVA 3KPOA 4TTDD 5AAMA 2YPKB 1BWWA 1DBAH 2GITA 2Q86B 4KZDL 3SHSA 4I1NB 1QQDA 3DJ9A 1ACYH 4RGNC 3ARBA 1BBDL 4U3CA 1UM5L 3KYAA 4TNVK 4EKXA 3UBXA 1E27A 5IT2L 4HC1H 2XN9A 3T08A 4QXGH 3BKYL 1AY1H 4FOMA 5F3HB 5T5NG 4NRYA 3F7QA 2PXYB 2CRIA 4XTRC 5C0JB 1HHJB 3D87B 1V7ML 3MNWA 3RWHA 2V5TA 3V4PL 3ZE0E 3O0RL 3VFNB 4U7MA 5D6CB 5E03A 2KZ1B 1RZJC 3GMRB 2NY7L 4M7JH 4XVTL 3BEVB 4LCIH 1DDHB 1PYWB 3KWWA 4M7LT 3HE6A 3TWCL 4M00A 1TETH 1SYVA 1ZHBA 5E70A 5LCVH 4GW1A 4JKWA 1ETZA 1KIRA 4X7DC 1BIHA 3QO1B 5JR1L 4UTBH 3GSRA 1JRHH 5D5MA 1JWMB 2YPVH 1D3CA 2IMMA 3BRDA 1IQWL 2VL5B 1E4XL 3D3VA 3MA9H 2O5YL 4PBVC 1F6LL 2CDEA 5JQ6L 5T3XD 4KRNA 4OF7A 4KU1A 12E8L 4EI6A 5EN2B 4KRPC 3CPLB 5J6HA 4BJLA 4P59H 4UDTB 1HWHB 3G6AA 3O4LE 2EIDA 3CSYB 3FQNB 1QSEE 1INEH 1W72L 3MR9B 4Z7UA 4G42A 1A6ZB 4WWKB 1F4HA 3OXSA 1UJ3C 1CLCA 2BX5A 4Z7UF 3JWDH 1ZLUK 5EC2A 3GMMA 4JY4A 1D5BA 2Y06H 3G6JA 1VGEH 4AM0A 1SEQL 1MCFA 1FCGA 4F7CA 4UV4H 3EFDL 4Y4FC 5T1DL 2DTSA 2VXQH 2C5DC 1RVFL 4APQA 3QULB 2VXTL 3GBML 1T6WA 5KVEH 1IEHA 4XNQB 2HKFH 4NKIH 4X6FB 1VDGA 2GJ6E 5FGCE 4B0MM 3K2MC 4X83A 4GKNB 1CGWA 4H88H 2D31A 5IMMB 4QTIH 3RVVC 3BKMH 1CGTA 1A6VH 4QGYA 4TVPE 4F7PB 5L8JB 3VWKB 4K7PL 4YDVA 1Q94B 3AVEA 3VD9A 3BQUA 1H15B 4U6YB 5DC4B 3QUYA 4UU9A 2GT9A 1J18A 2JLLA 2FZ3A 5I18L 4CJ0A 2BOBA 2OX5A 3MROB 3KNBA 1AE6H 5D9SA 3CGTA 3WXVH 1I1RA 4LCUA 1BFVH 1KPUA 1VHPA 3MLWH 1U8LA 1F3DJ 3O41B 3Q0HA 4HUUB 4DKAA 1TZHB 4K2UL 2WQ8A 4F37F 2R2HA 2AJZA 3BKCL 4ZUUB 5AD0B 2WM0A 2ED9A 4JAMA 4J2XA 2NYYC 1NCAH 1MEXL 2X4UB 3NZ8A 5E2WH 1YN6A 4HEPG 4ZPVB 3D0LA 4Z7NF 5K33A 1RIUH 5L2KA 5ACMA 3PWUB 1TJIL 4RCAA 5IB5B 5FCUH 3KPMB 1I85A 1C12A 3BIBX 1NBYB 4FXKA 3C60B 5C7XL 2P47B 3EZJB 4HKXA 2XIDA 1XR9A 1VPOH 3GSVB 1A9EB 2XYCA 1XGPA 3BGAA 3EFFB 4GG8B 4K3EL 2CKBH 1BREA 3EO1A 2ITDB 1A7QH 1S5HB 2AJSL 3L3KB 3FCTB 2VZ1A 3MCKB 3QXUA 1MCKA 1CLZL 4KTDL 1ZS8A 1D9KB 5EC1B 4XZUB 1QLEH 4WUUA 3KPQB 1QACA 5I30H 5FYLH 1FH5H 5IQ9A 2DYPB 1CDUA 5CJOH 2DMKA 3O2WL 4HV8A 3GHEH 3QQ9C 2P5ED 1PKOA 1CFBA 2FSEB 3JTSA 4M5YH 3AY4A 3QIWC 3PGCB 4ZAKB 1IAMA 1T83A 3DSFL 1S7QA 3QCTL 1OSPH 4G8FB 1JNHB 4RX4D 4NOBA 3QQ3A 3ZHKA 1NGPL 1VADA 2MPAH 1EV2E 1Q1JH 4GQ9L 1DEDA 3SDYH 1EFQA 4Y4KD 4AMKH 4KAQL 4EUPG 3GO1H 3QZWA 2H41A 2B4CL 2GJZB 3RP1A 5K9JL 1QBBA 1DBBH 2ICEA 1BVKB 2MCPH 3ZT5A 4LSQH 3P9LA 4DW2H 2F15A 4PJCA 3PIQA 4R4BA 1NCTA 4PJCF 1NMAH 4ORGB 1UEYA 5GZOD 1A02N 4JFDB 4MNQE 3WLWC 5EIVA 4XGZB 3E2HB 5DMGD 3P4MA 3LS4H 5DD1H 4PY7B 5FOJA 4LKXA 1RHFA 5M95B 3FQUA 3MGTA 3JZ7A 4OQTL 1RJYB 1T0NB 2PO6B 1OL0A 1V5JA 1PG7X 1RZ7L 4PYHA 4HSQA 1LD9B 2R1WB 3CFJB 1ZGLA 3W11C 3U30C 2VO5A 4LCYB 3NGBC 4M6OH 3FFDA 5DUBB 1ZVYA 3VXRA 2EDOA 3D85B 1HYSD 3B9EA 3CZJA 4LQFL 2IFFL 4QOKA 1XF4B 4EUPB 3TYGH 3QJFA 3DBXB 4YBQC 4NM8H 1DBAL 4CU7A 3CH1B 4XB8A 2IPKA 1VFAA 8FABA 4JFFE 1JP5A 3ELAT 4R2GC 2ADGB 3L5JA 2H26A 4YFEA 3UTTB 4Y4HD 4F58L 3SBWC 1UB6B 1N64L 1VFBA 4JB9L 3O8XC 4OF8A 1X5HA 4R7NB 2G2RB 4AQ1B 4H20H 3IXTA 1AY1L 3HI6H 2ZKHH 4HK3N 1S5IH 2A0LD 2X5PA 3BKJL 2EO9A 4Q6IB 3TGXA 3VWJB 2DLFH 3IJHB 3MXWL 4GOSA 5HYSG 4KKCC 3VJ6B 1J5OL 4E9LA 3BPCA 2FHFA 3DTXA 5DGRA 2BFVH 2BP3A 1YEDB 4JJ5B 4B5EA 5BCAA 2B5IC 4IRJC 1FSKB 1ZT7B 5DZNA 4UT7H 4P3DB 2D0GA 3T3MF 4R4FH 4KVCH 25C8L 5DRWA 5TGBA 3UZEA 2OK0H 5D2NB 2HFEA 3T2OA 4CADB 3OAUH 1I1YB 1IVLA 3DMMC 2BSTB 2DMCA 7FABL 1S7UB 3GIZH 3NIGE 1ZT4A 4PJBE 5I1DA 4YHYB 5TDPA 3ZYIA 1AHWB 5B39A 2D7TH 1YDPA 4NNPL 4GG6A 3AREB 4I48A 1XF1A 4CBPA 3OHXA 2EZ0C 3VFWA 4XNXL 4OLVL 3QCUH 1SVCP 1IGJA 4U1GC 5ID1A 4M6NH 3VD3A 3MV8A 1KELL 5JIPA 5FM5M 1BLNA 3T0EA 3K1DA 1JFQL 2DLTA 4U3HA 2V5MA 5MP6H 3RNKB 2PYEE 4FTVA 3O3EB 2JJWA 4XMKL 4XHJD 4OV5A 1MOEA 5D1ZA 4HCRA 3S6CA 3QIBC 3EOBB 2AK1L 4QNPE 1INEL 4K7PY 3TA3B 1J11A 3B8SA 3R1GL 2VLLB 2C26A 5HYSB 4LLMB 1ZLSL 3KDMB 1Q9KA 4QHKI 3QWOA 3T8XB 4WFED 5DJYB 5IW6A 4NKMB 1U8PA 2Y06L 2IBZY 4LCWA 4NKDA 5D8JH 4LKCA 1C08B 4KUZL 3HS0A 4I0PC 4UV4L 2VXQL 2DBLL 3QNYA 2GJ6D 4JO3H 5KVEL 5GS1C 5CBEB 4NKIL 4CMMB 5TE7L 1NLBH 1CVSC 4JFOB 4H88L 4PRIE 3QEQA 4TVPD 4KY1L 1IGTA 5F9DC 3B6SB 2W9DH 5E8NA 1A6VL 1F11A 4M1DL 3OJDA 4NN5C 2QQQA 1KEGH 4KK6C 4RISH 5DJDB 1KCUH 2R9HC 3F6IA 1TJGL 1Q9LB 1FN4B 2AJYH 5CZXD 4NP4H 3G5XB 4NWTH 1RZJH 5C0BD 2D9QB 5JQHC 3V5HB 1QPXA 5D7IF 3U7YH 3IDXL 4EN3A 5CILL 3BUTA 3CFIC 2EIZA 3OXRB 5JDSB 2NLJB 2VISB 3HRPA 5FB8A 1QNZH 2CIKB 3B5HA 1DE4B 1BFVL 4OTXH 4F2MB 1U8OB 4QRRB 3C8KB 2IAMB 4WW1B 2R2EB 3MLWL 1TQBC 2C3VB 5F7NC 1FCCA 2ZCLH 5F96L 3HZMA 2V7NB 3MRPA 2A73B 2HVJB 4XC1H 4XCYB 2CK0L 1XH3A 4GAGH 5CP3A 5FO9B 4HK0A 2HT2D 5EZJA 3UCRA 1QA9B 3QRFM 3QI9D 2R0WH 4Y5XB 2ZP0T 3T4AB 3SKNA 2A2QT 4KJYA 3J8F7 2R29H 3FQXB 3VFPB 4DGIH 5FCUL 4XBPB 1CGSL 2MWCA 1GAFH 1VSCA 4MQ7B 5GGTH 5C6PB 2RFXB 3C09B 3RWJA 1DLHB 2P5WE 3SOBH 2X4TA 2D3VA 4XXDA 2HMID 3MLZL 1FLRH 4FRWA 1OD7A 3HMXH 1A7QL 4K07A 3U36B 2YPKA 4G7VL 3UAJC 2Q86A 2FX7L 2FBJH 1N4XH 3EHBD 5ECJE 5EZIH 2X41A 4ODBD 1QLEL 4DUWA 1HEZB 4ODUB 3SQOL 5I30L 5FYLL 3S4SG 4UT6L 3GBNH 5CJOL 4DVBB 5F3HA 1NUDA 4P57B 2ZUQB 4M5YL 4GAJH 4LMQI 5C0JA 2P8LB 2ARJB 1LO3H 5GRUH 1KIPB 3C5ZC 2HP4A 5IESH 4OFVA 4FXLA 3VFNA 3TVMD 2LTQB 5D6CA 3GMRA 1FBIL 4HZAA 5BQ7B 1IAOB 3P77B 3BEVA 4X4MA 1PYWA 5L8LB 3KLHD 1MVFA 2OZ4A 3TM6A 4HWUA 1QSFE 1EHLH 4U1JA 1FFPB 1UZ8B 4RFNC 4PBWD 1DBBL 4AEHL 5LGJB 3QO0B 2MCPL 3WIFB 4HEME 4QF1A 2R2BA 4PY8I 4J4PD 3V0WL 5H2BB 2I9LB 3WNPA 5JHDB 1EEYB 1JPTH 1OP3H 2IQ9L 5FGBA 1ZOXA 3IU4L 4QXTB 3O3UN 3DUUB 3E1F1 1JWMA 4N5ED 3ZYZA 3OF6D 3RVUC 5GRVL 2VL5A 1D5IH 5J13B 5EOTB 3LS4L 5CGYC 3SDXE 3S4SB 5BS0D 3VRLE 5EN2A 3CPLA 3L5WB 1CGUA 1FLTX 1RJCA 4P2RB 5DVKA 2HLFC 5E08H 4MMXC 1MQ8A 3CSYA 4LSDA 1R3KA 1U8HB 4U6TA 3FQNA 5T5NF 3EKCA 3MR9A 4RA0C 4G9FE 1A6ZA 2UZIH 4WWKA 4CVUA 3HPJB 3CLFH 3B9DA 3BYTA 3WNOA 4QHLB 3VCLB 4M6OL 2DQCL 4WI6A 5I8KL 1YC7A 3FT4B 3LH2H 1HQRB 1DL7H 1G6RL 4LNRB 4E5XB 3IFNL 2DF3A 1B0RB 2BNRB 2YN5A 1KBGL 1H3WM 3GMOB 5GS3A 3T09A 3GRWL 3ULSA 4G3YH 4XNQA 1TQCC 1MCNA 1AGFB 4Z7OE 1NDGB 4H0GA 4XNZB 4GKNA 3CX5K 4A2LA 5IMMA 2XTJC 1UZ6E 1F4YH 1LP9F 4HWBL 4P23C 3HI6L 4NM4H 2LVCA 4E41E 1VACB 4F7PA 2A74A 5F9OL 1CXLA 1HH9B 4MNGB 3ZO0A 1Q94A 2DLFL 2I60H 1LO2H 4P9HC 2X2YA 4Y4KB 3BP4A 4U6YA 1RY7B 5I8CB 1QLFA 5FA3A 3BIKB 4X7TB 1MJUL 3RUGA 3SE3C 1AO7B 2CLZB 3MROA 4XMLH 5EU6E 2BVUA 2VXUH 2E7LC 1YN7B 4YC2B 3EO9H 2OK0L 5HHVH 3OAUL 2W92A 1TFHA 5FGRA 3O41A 1P6FA 5CZKA 3H9YA 4M9PA 1CLYL 1TZHA 3P3YA 4K8RL 3O6ML 3QG6B 2D7TL 3IDJB 4IHOB 2R0KL 3M17B 4ZUUA 3RWIB 4JN2A 2CRZA 3IFPB 3W82A 4ELME 3EZ8A 1U3YA 4ZYKB 1OTTD 2X4UA 1L6XA 5TFSL 4PIRF 1NQBA 3WS3B 4R97B 2PYED 3PWUA 5IB5A 1CF8H 5JW4N 3KPMA 2PUQT 1NBYA 5MP6L 2P24A 4LASH 5I0ZA 1HHIB 1CR9H 5GGSB 3BMVA 3GSVA 4GG8A 3EFFA 1KCRH 4JFHE 4X98A 1L0YA 3Q6GH 4KKLD 2VDMH 1QFWM 5E2JA 4GRLC 1XF5A 1WBXA 2P8MA 1T22B 1WSST 2W0LA 4NQDA 3MCKA 1NMCC 4M8QA 1BZQK 1D9KA 5EC1A 4XZUA 5IBUG 3RQ3A 3KPQA 1ONQA 3RVTD 4PJ9A 3T2PA 5KVGL 3QRGH 4Y4HB 1SJHA 3UJIH 2DYPA 1WEJL 2EDYA 1NGXB 3G5ZB 2Y36H 2FIKB 4N0FB 2FSEA 4JQVC 4I77H 4JO2H 1EFXD 4WEUD 1FO0H 4PRID 1HHGB 1FDLH 3HAEH 1JNHA 4G8FA 4CU8A 4LPYA 5ID0B 4XP5H 2BVPB 3BGFB 1D5MB 4UMGA 3SKJH 3FL7A 1YY8B 5KVMC 1KEGL 4OCRL 3O6FD 3O2DL 4NQVB 3QJHA 5A3IC 2XZCH 2P43B 5ESQB 5DFTA 3U7YL 2DQHL 2AXHA 1BPVA 5IOPB 4G6AC 3ZL4H 5HVHC 3MCLL 4QRTA 5BXFB 4X9HA 5I1EL 4XMPH 2DDQL 1QNZL 4ORGA 3QPXH 4JFDA 5D1XD 4XGZA 5CGMA 1NUGA 5IBUB 3S35L 2IFGA 1LO0H 3NH7L 4XWOC 3C87A 4GAGL 4N90E 1RUAH 2G5BB 5C3LD 4H0HB 3O4LB 1RJYA 1MLBB 4Z78B 2PO6A 1RHHB 3BW9B 3F7YB 5IP4A 5FO7B 1QSEB 3SJVE 2R1WA 2D03H 3AROA 3CFJA 3VG9B 4PLKD 1NLDH 4DFIA 1A2YB 4F8TA 4LCYA 2YD1A 3GJFB 2P5WD 4MVBD 1GAFL 4MZ2A 1SY6A 4G6JH 5DUBA 4XNYH 1AXIB 5KSBE 2QTEA 3H3BC 3UC0H 1BM3L 1MJJB 3C5JB 3BD5A 4IIQA 1UQSB 1XF4A 4EUPA 1JNLL 1GHFH 1TPXC 3CH1A 3GSQB 1CU4L 2FBJL 1N4XL 4HMEA 5EZIL 1HKFA 1N0XH 3KYMB 1F4XH 5C2UB 2VDPH 3VXUE 3O11B 1UB6A 3QISA 1O0VA 4R7NA 3TH4T 5IMLB 5F7WC 1YEKH 4R4ND 1UXSB 4JHWL 5FHAH 3I3EA 3VWJA 3VH8G 1X5ZA 3WSQH 3H9HA 1LO3L 3H2WA 1OP5K 1Q9OB 3VJ6A 2DKUA 2XQYG 2CDGA 3MLPA 1RJZB 1FNEB 5IQ7L 1YEDA 4JJ5A 3WD5H 1F2QA 3FZUC 4P3DA 3ZDXE 1T03L 1QSFD 5IFJB 3SDCD 3VGAB 1LK3H 5D2NA 1O7VA 1T0MB 3LPWA 1DLFH 3RJQB 5ABDE 1I1YA 2BSTA 3ILQD 1QBLL 5KANI 1S7UA 5GJSL 4WO4C 2P46B 2FD6H 1AHWA 2IPTH 3X3FH 4MD0B 1JPTL 2HWZL 2WBJA 4X6DE 4I18B 4OM1L 3AREA 4RBPH 3UJJH 1MVUB 5BMFH 3QI9B 4KKAC 5DUPL 2LU7A 4N1HB 3TNNB 4JDTL 4WI8A 1E4JA 2MKLC 4PJGE 4ZDHB 2UY7A 4K71B 1SBBA 3GJFK 3RNKA 3VI4E 3O3EA 3WFZA 2E27H 3DO3A 1KB5B 3MLVH 3IDYB 3O6KH 4XXCC 1JF1B 3VH8B 3DVFA 2BJMH 3TA3A 2VLLA 1X9QA 1T20B 5HYSA 3ZE2F 4LLMA 2EDBA 1I4FB 4M93B 3KDMA 1ZT1B 3T8XA 5DJYA 5ADPL 4AYFA 1ZHLA 1OWWA 4JVWA 4KKBC 4NKMA 3C6LD 2DQUL 3IDUA 4G9DB 4HK3J 3RZCC 1CXHA 2V2WA 1C08A 1EHAA 4MA3B 4XPHH 1C7TA 1DL7L 3DRTA 5E8EA 1FZKA 3FN0L 5KSAC 4OJFL 1DQTA 4FQJH 1HDMB 3H7BB 5D72H 4P4KB 2Z8RA 3WHE0 4CMMA 3BZEB 2AXFA 2ZOLA 4JKKA 3G9VA 1RUPH 2QSQA 2QQNH 3T65B 4JFOA 3MRKA 3V8CA 4PJFA 4PRHE 4E41D 3IFOA 4HFWA 4PRAB 2PTVA 4CL7A 1VA9A 3VGDA 3B6SA 3TVMB 1WWCA 4U1IB 1F90H 5DJDA 1OF2B 2I60L 1LO2L 1KPVA 1KJ3H 1FN4A 3G5XA 1XIWB 1MIMH 2IPUG 4NBZB 3P30H 3ULVH 3V5HA 4I3GA 5EU6D 2AGJL 4BKLB 1FHGA 1U91B 4XMLL 2P49B 3OXRA 5DQ9B 4BQ8A 3SGEH 2VISA 4RGOL 2C1OB 4I0KA 2CIKA 4P46D 5ESVA 1DE4A 4MNQB 1M7XA 4F2MA 3NFNB 4WW1A 2R2EA 4FZEL 3WJJA 1MFBL 4XCFH 2W59A 1CE1H 2VQ1B 4V1DE 3ARFD 2V7NA 2A73A 4RAHA 2HVJA 1Z6JT 4HFUH 1MHPH 4FG6D 2UV3A 4YHZL 3MRGA 3QEHA 3MLXL 4NUGH 1MI5E 1J0KA 4Y5XA 5IVNA 4YFLI 3T4AA 2MNUA 4I3RH 4ODTL 1YNLL 3CK0L 3G04B 3JV6B 3EOAB 3IYLW 3FQXA 4S1RL 3VFPA 5JW4R 4XBPA 3NACH 1EDQA 2HA1A 3UROR 4JFHD 4LASL 4GKSB 2JB6B 3BDYH 4DAGH 2W9EL 2QADC 3S36H 3IAGC 4MQ7A 4NKOB 4R0LC 2RFXA 3KHQA 3ULUC 1DLHA 3Q6GL 5DJAB 1NGYB 5ICXB 3U36A 3P11H 4Z95H 4EVNB 4CDHA 4DWHA 4JFFB 3RWFA 1IC1A 4XHQA 3R0MA 1FZOB 3LZFL 1HEZA 4ODUA 4AEIL 3QRGL 5F70A 1TJHH 1FE8H 3DETD 5J1TC 2K7QA 4DVBA 4JZOB 5F9WB 1KLGB 2DI9A 2HVKA 3WBDA 2P8LA 2ARJA 4I77L 3GNMH 1GGYA 1INQB 1FO0L 3QIUC 4HJ0C 3F5WB 1HKLL 5DFVC 4C56E 1JMZA 2GCYB 5BQ7A 1R24A 1IKFL 1IAOA 3F65A 3P77A 4LEOB 4P9HH 5HGGS 3MOQA 4ETQB 2JJVA 2ADFL 5I1HH 2XZCL 3OKYA 1FFPA 2VXVH 1UZ8A 5LGJA 1R3IL 3QO0A 4PJBB 4C57C 3MXVH 1SYSB 4YO0A 1IGFL 5H2BA 3CLEL 4KJPC 1G0XA 4XMPL 5ACZB 4AIOA 3SE4C 3VXOA 4OLWL 3DUUA 1S9YB 3QPXL 1LMKA 5GRXG 1UXWB 1EJOL 2NX5E 2IANE 2QSVA 4N90D 5EOTA 3NZHH 3TPUB 2M26A 3RVXD 3AB0C 3KLAB 1CDIA 4R8WL 4X9BA 4YZFF 2PYEB 3L5WA 5SV4A 3SJVD 2R1XA 5BV7L 5DSCB 4Y2DD 1U8HA 5BZWB 3CVHB 2Q1EA 5GGUA 4WY7L 1NLDL 1IT9L 3MZTA 4LLQA 4YHMH 4BFBD 2BZDA 2CIIB 4QHLA 3VCLA 5D7LE 3IJSB 3UC0L 2OMNA 1KN2H 3JUYA 3FT4A 5INDB 1HQRA 3NVQA 1GHFL 1EVTC 2BRQA 2ZUWA 4LNRA 3LKPB 1BQLH 2Y6SC 3ZMRA 1B0RA 3VXUD 4UQ3B 3GMOA 2H8PB 3ARDD 1N0XL 3LEXB 4OF5A 1AGFA 1EFXB 2VDPL 1LO5B 1NDGA 4X6BA 3MV01 4PRIB 2AJVL 1MHCB 4RX4A 3R4DA 4MQSB 2VLJE 1VACA 5FHAL 1HH9A 4JN1H 4MNGA 3TCLB 4WW2B 3WSQL 4Y4KA 5I8CA 1KNOB 3O6FB 1CDGA 3QDME 2DIAA 1ZHKA 4X7TA 3IAQA 2CLZA 2N4IA 1PGRB 3QXVA 3VGBA 5GRYA 4UAOC 2GEEA 1A6PA 1BJ8A 1YN7A 1XGUB 5T33H 2RAMA 5I6XB 3H0TB 5CUSL 1IRAY 5L9DH 1T5WB 3SKMB 4HCRL 4HUMB 5JUEH 3A0OA 4ONGL 3SCMC 1ND0A 1BOYA 1XF2A 5FV1L 5I1JH 2NNAB 2IPTL 5IF0B 3S5LB 4LAJH 3IDJA 2AVGA 4IHOA 1U41A 5EOQH 1GRWA 1UWXK 3QBTB 4U7KA 1A6WH 4LLAA 3JWNC 5C6TH 3E8UL 4OB5H 2H9GB 4ZYKA 2DQIL 1S9XB 2X6MA 3LKSB 4WU5B 1CTNA 2VDQH 3GB7B 4JPVL 4BUHA 1SEBB 1HHIA 3TP4A 5GGSA 3U9PH 2FGWL 2JTDA 2P5WB 3O6KL 5H37G 2X89D 1H0DB 1ZVSB 2ILLA 3ZKMD 4ORZC 4LGRB 3DPBA 2ZSVB 1T22A 1JTPA 1M7IB 5I16B 3S98A 3QDAA 4I3SH 2DBJA 1BVLB 4KI5E 4S1SH 3MJ8A 4ODVH 3ARXA 3D9AH 1ZKAA 1M71B 3F12B 4YFDB 2WBKA 4UDUB 4Y4HA 3AS1A 2BVOB 2CK2A 2DTMH 1EUUA 3VA6A 1NGXA 5FYLE 3DIFB 3V6OC 5KN5B 2FIKA 5GGVH 4OV6F 3WEXB 5FYJH 5HHNA 3H42H 3KPNB 4PRHD 4P0DA 1HHGA 4A6YB 5DEFA 4TSBL 2QQNL 2V17H 3MJ6A 3ZE0F 5ID0A 4XT1C 2BVPA 3LB6D 4DKDC 5EIQA 3KYNB 4TRPH 5JXAL 3SDAD 3O9WD 1AKJD 4NQVA 5ITBH 1GVIA 4LQ1A 5HVFB 3LEYL 2IQAB 2DD8L 4L8CB 1QSFB 4HPOL 3BMWA 2JB5L 3BQUC 1I9RH 3HZVA 4JHAL 5HDBE 3T0DA 3EDFA 1X5JA 2O5XH 1PBYA 3ULVL 1S7WB 5ESQA 3FOMB 3UTSE 1KJ2B 4OGAD 2WANA 5L88L 1OT1A 1B4JL 5IOPA 4TQEH 2UYLA 4HW6A 3VFUA 1FORL 3EYSL 1EEZB 1UKTA 4V1DD 4PGCB 5ANMB 1DZBA 1I8MB 4I5BB 1KFAL 4YGAB 3QDGE 4Y1AE 5LXGL 1NCDH 4QRPB 5DI8B 5AEAA 3BPOB 2G5BA 4P2QE 1MJ8H 3VGFA 3O4LA 4OUUB 3GK8L 1MLBA 4Z78A 3PWPE 3BW9A 1RHHA 3MNZB 3F7YA 5MHSE 5IEHB 5FO7A 1QSEA 1A4JB 4KK9C 1H3GA 4G9FB 4LGSB 3SGKC 1W2KT 5ADOH 4GKZA 4PJIE 5KZCD 1A2YA 4OD2B 3GJFA 3LKOA 2OQJB 2WP3O 5EPMB 1I85C 2R2CA 4DAGL 4XBEL 3PGFH 1FYHB 1VENA 4YDLC 4LOUC 1MJJA 3C5JA 3HNTH 4XVSL 1DUYB 5CSZB 5E8DL 1UQSA 3RHWK 4XPGH 2RIKA 4PG2C 5E7BA 4MJ5B 1DVFD 4OD1L 3GSQA 2BHUA 3KPLA 1D6EB 1OD9A 5SWSB 5JPMB 5F1SA 4M43H 3HB3C 2GJ6A 3KYMA 3IDNB 4HKZB 1P5UA 2J1KA 3BH8B 1N6UA 4KKNA 4ZOBA 5IMLA 1FE8L 4UT9H 3V4VH 4LVOB 1CGXA 4E41B 2NTSP 3LCYA 3UTZA 2MQ0A 1UXSA 3UYPA 5J4MA 2D4FA 1EHNA 4OKVB 2PTUA 2GYSA 3GNML 4C56D 5C0DB 4K3JH 1QKZH 1Q9OA 3WS6A 2H32A 1EX0A 1FQ9C 2VN7A 1RJZA 1FNEA 1N6VA 3TJHC 3DYOA 5I8EB 3DUSA 4JCMA 2ZCKL 1WZ1L 2F54E 4MA8H 3MOAL 4MDIB 1BGXH 4RAVB 1T0MA 1YPZB 4P46B 5I1HL 3ETBF 2D7PA 3WXWL 4XNMB 1FFOA 5EO9B 5LQBH 2I26N 3GM0A 1JHTA 3CIQA 4MD0A 1TTUA 1A14L 1CICD 3MODH 4I18A 2NX5D 4YXLL 3QI9A 1LNUB 4G6MH 5I1AB 5FYKH 3TNNA 5C0ND 1II4E 5SWZE 1X5AA 3I3DA 5MEQB 4ZDHA 3FB7B 1R5IB 3LY6A 3FQRB 4Q97A 4LSUH 5I1CH 1KB5A 1JF1A 1K6QL 4FQIL 5HD8C 1GPOL 4NC1E 5HHME 3LN5B 4MLSA 4Y16C 1E4WL 1T20A 4PRBB 1ZLVH 4FFWC 4MWFB 2RCSL 5JPNB 5D7LD 2EC9U 4YHML 3WFHB 1OAKL 1NGQL 1ZT1A 3ULUH 4C4KO 5FXCH 4GO6B 2GIYA 2F58H 3C8DA 1FIEA 1YEEH 5D96C 4AEFA 2IMNA 1UGNA 3MLTB 1BQLL 1L0XA 2QSCL 1K5NB 3RWEB 5H8DA 4JM4H 2FR4B 3A67L 3BN9C 4JKLA 1HDMA 3H7BA 2IWGA 3DO7B 1OPGL 5H94B 4KK5D 1RZIB 4J12A 2VLJD 1OTUC 2YUXA 2CR6A 4PRAA 4QHMB 4XP1H 4MJ2A 3TVMA 5F3BB 5KJRH 4U1IA 4U1MB 3BPLB 4PD4K 1OF2A 5T3XH 1J87A 1WCBB 3QDMD 1U3HC 3BJLA 1GGBL 3X13B 1MFAH 3HC3L 5HDOA 4ODHH 2FRGP 2FEDC 5IGXH 3BIAX 4DGYL 3DX9B 1U91A 1IM9D 4PS4L 5JOPE 5DQ9A 1CE6A 1JGLL 4QYOB 5E7FA 4AZ8A 4X6CE 2C1OA 5E2VH 5E4EB 4MNQA 5T33L 3U4BL 5JW4M 2DL2A 3NFNA 2EC9T 4LPVA 1NC4B 1OAZL 3W0WE 3SPVB 1IGCL 1KSRA 2VAJA 2VQ1A 3OF6A 1NCUA 2WLZA 5HYQB 3RTQB 3QFJE 3FTGB 3OX8B 4LEXH 3ZLQC 2GK2A 2R56L 2HN7A 1CZ8H 4YIQB 5DWUL 2RQ8A 4JM2D 1AR1D 3SJVB 1U8MA 1T66D 3G04A 3G5VA 4OB5L 4OLYL 3JV6A 4Y2DB 2DICA 5GRZA 1G9EA 2OM5A 5CJ8A 3SE9H 3MSPA 1LE9B 1W72B 4LSTH 2VDQL 3OKMB 4GKSA 4DEPC 2JB6A 3QG7H 3RZWA 1J0YA 1RU9H 2J4WL 4NKOA 5KSBB 1I7ZB 4KQ3H 3K2UL 1E6OL 4FFYL 3A6OA 3N85H 4J3VA 4MDJB 4NZUL 3N06B 3OKOB 5EU5B 4ZD3L 5DJAA 1NGYA 5ICXA 2ZG3A 4KI5D 2WUBL 1OLLA 4EVNA 2XICA 4JFFA 5A40E 4LIQH 2QJDA 2G5RA 3NA9H 1FZOA 4CN4A 3ARDB 5CCKL 5E9DE 4Q0XL 5F88B 2E6PA 5EA0H 1F58L 3QHFH 1VCAA 1MFDL 4JZOA 3HE7C 1KLGA 3IU3B 2F9BT 2IH3B 4QHUB 4QLRA 1PD6A 3H42L 1W8NA 5IM7B 3FONB 3F5WA 2V17L 3T0BA 2GCYA 2K1MA 1A1NA 1QR1A 4TRPL 3SE8H 4ETQA 3GI9H 3KPSE 2OI9B 3UTSD 2BHZA 5EZLB 4PJBA 2OR9H 5DA0B 3MRDB 2NY0D 5DTFB 5AUMB 4AH2B 2GKIA 3NIGF 3SKOB 4PJBF 1KEMH 3F8UB 4J3UA 4X6DB 4EN3C 32C2B 5ACZA 1QFWI 4OCXH 5GGRY 2E9WA 3QB7C 1SY6L 4FP8H 3QHZH 1UXWA 3QDGD 4Y1AD 2EDJA 2QKIB 4JPKH 1AD0B 3PL6C 5DJ6B 3TPUA 4PJGB 3QXDB 4TSCH 1TMCB 2XXCB 3C2SA 3RX7A 1NGWB 1U92B 2X09A 4P2QD 2PYEA 1NCDL 1NC2B 3HNVL 3PWPD 2PR4H 2X70B 2GTZB 5MHSD 4BQ6A 5C6WH 5DSCA 5JHLL 3LDBB 3NCCB 4YHIA 4RRPG 5BZWA 2NY4D 3CVHA 4W70A 4QNPF 1MY5A 43CAB 1MJ7L 3ESUF 3ALXA 5EU3B 2UUDK 1AC6A 4OIAA 3KGRA 1EAJA 4GJTB 2CIIA 2AABL 3IJSA 5HDQL 2ZUXA 4D3CH 5C0GB 1MHHB 4RFOH 1K4DB 5INDA 2R8SH 2AEQH 4YWGH 5DMJB 1C16B 1ZV5A 2H8PA 1JZ4A 5HYJE 3LEXA 2VTFA 1EFXA 4FZ8H 4HQQL 5JMOC 1LO5A 1DQJB 1KJVB 2F53E 4PRHB 2FH6A 1U2CA 4PRIA 2EH8L 4NO2B 3TT3H 4UT9L 4NHUB 2OBGA 3PNWB 4ZOAA 1RULL 4WI4A 2PXYC 2H1PH 3TCLA 1ULVA 4PJHB 3W5MA 2J2ZA 1I7UB 1RIHL 1Z2KA 3O9WB 1OY3B 1AKJB 3O6FA 4WW2F 4K3JL 4Y7MA 3SDDB 1XGYL 5IG7B 5A2IH 2DKSA 1MFEH 2C3GA 1YYLL 2DM7A 2F54D 1KV3A 3WNLA 1XGUA 3TV3H 4BZ1L 4WVRA 3H0TA 1KYOJ 2CMRH 2CXKA 5D71L 5DEZA 4DKEH 1EMTH 1HXMB 3SKMA 3BD3A 3DVIA 1G7IB 5MENB 5D1XA 3B9AA 3HZYB 5LQBL 1U8JB 2NNAA 5IF0A 3S5LA 1H5BB 3TT1L 2BC4B 4ZO7A 1MI5B 4LFHD 3ZKND 3A6BH 4YBLB 5FGBC 1OAUH 4O02H 5E6IC 2VIRB 1WWWX 5SWZD 3WN5B 4G6ML 2NXYC 5FYKL 1MAKA 4UIKH 5I2IB 5JA9A 3GMNA 5IHBA 4AY0A 3LSOB 2L7UA 5KZCB 3GB7A 4MZ3A 1IC4H 5HI3D 5I1CL 3MRJB 2P5WA 1RUQH 3DECA 5HHMD 5TE6L 1H0DA 1ZVSA 2FJGB 4JO4H 1UJTA 1NAMH 1CXIA 2DB8A 2ZSVA 5LJYH 1M7IA 4WWKC 1ZTXL 4LRNH 1IAIM 1PQZA 1Z3GH 3BEWB 4JREB 3T1FB 2MQCA 1M71A 2WZPD 3F12A 1VEPA 4Z7QF 2F58L 4Z7WF 4UDUA 2X1OA 2Q8AL 2DM3A 2BVOA 4RQQB 2FX8L 1D6VH 1RQ5A 4P2OB 3DIFA 1UKQA 3O3AB 1F3DH 4HBCH 4RGND 4JY5H 4L4VB 4PLJD 3U46B 4QT5B 4A6YA 5TF1L 2A9MH 4C56B 1WV7T 1ZHNB 1ZWIB 4NQEB 1FG2B 2B1AH 3LQAL 4XTRD 2J7LA 4JDVA 1KPRB 3VDBA 3CDGB 5T1MB 1QYGH 1DQLH 1OAQL 4U33A 2DM4A 3VWKC 1P7KB 5T3XL 4H26B 4L8CA 3E6FA 1QSFA 4OM0H 4ERSH 2BOCB 3BT2H 2NCMA 1JI2A 4PUBL 1S7WA 2F19L 2I5YL 3ES6B 3FOMA 4ODHL 4X8XA 4WI5A 5JOPD 4PV8B 3PDDA 4RWYH 4U6VL 4JRXE 4MJIE 3CC5B 4ZTPH 3W0WD 1MF2H 2AK4B 2O5ZH 4PGCA 4QHNB 2R4RH 3BDBA 4ZPTB 2NX5B 1I8MA 2IANB 3QFJD 3V7MA 1JF6A 3SDXA 5F1IB 5EBWB 5IVXE 3S3PA 5JOFB 1J8HB 5D7JB 4QRPA 5DI8A 2CLRB 4LEXL 1I9IH 4F7MA 5DQJB 1BFOB 3N1GC 3BE1H 4OUUA 2XI9A 3MNZA 1BVZA 4JQXA 4PB9H 3MRFB 5IEHA 4PJ8B 2AEIT 35C8L 4G9FA 1KLFA 1MFNA 3HR6A 3MJ7B 4KRPD 1TITA 1RIVH 3D2UD 5EPMA 3VW3H 4S1QH 5D7LB 2VXSL 3ILPB 2HAZA 3QG7L 3C60C 4MAYC 5FUCC 4LARH 3LHPH 4O2FB 1RZ8B 5IV2B 2QHLA 4XH2B 5CSZA 3LKRB 4OIIL 1CLOL 4ZFFB 2V2TB 2H32H 1N26A 1HI6B 4MJ5A 3D39E 2YXMA 5JPMA 1TXKA 2XOTA 3S97C 5JW3L 3KYKH 1MCEA 3MYJB 3IDNA 4HKZA 3HC0B 3BH8A 4GLRI 4Z7OF 1KCVH 4Y4FD 1AIFA 4XX1G 2VLJB 4E41A 1UZ6F 3T2NH 1BJ1J 3CH8A 3O3DB 1NBZB 4UINL 3WV0A 2AJ3A 3ZTJH 2E7MA 4OKVA 4ZAKC 1ZSDB 5C0DA 1CL7I 1X5FA 3QDMB 1J1OL 1S8DB 5TPWH 4CVWA 5T1LD 1MRFL 2Z92A 1T7VA 5EU6A 2MCG1 4R3SB 4OZFA 5I8EA 3KPSD 5DZLA 3SE8L 1IM9B 5FK9B 5I73B 4MDIA 4RAVA 4TNWF 4Y5VC 5J6GA 3S8WA 4XNUL 4P46A 3FAWA 1X5KA 4NGHH 2Z31B 4OBSA 4XNMA 4Z8FH 4FQXD 1YPZF 5D6DC 4P5MB 3NOIA 1F02I 4NZJA 5EO9A 5HXMA 3ARFA 4XPBH 2CJUL 1UKSA 3FQTB 2GY7B 4Q74A 4ELMA 1J05B 2AV7B 5GJTL 1LNUA 5I1AA 3QHZL 1MUJB 5AZ2L 4KK8C 4G6KL 5T1KD 1A0QH 4FS0A 1YYMH 3E2HC 2APTA 4MD5B 5MEQA 3FB7A 1MWAH 1IKNA 1R5IA 3HRZB 4NBXB 5I1KL 1RZFH 3FQRA 1SJEB 3QDJD 2PR4L 4BH8B 4KV5E 4F57H 5BO1L 4U7SA 2NYYD 4AG4L 3LN5A 3L3GB 4FQCL 4MXVE 4PRBA 3WIIH 4PRDA 2CKBB 1OB1B 5JPNA 4XBGB 5C09E 1BAFH 1VESA 1P84J 2VITB 4L4TD 4LHUG 1YC8A 2PKDA 2YWZA 1UA6H 4LBEB 1KT2B 3VU2A 5HYJD 4P3CL 1JHKH 1AJ7H 3ARYA 4YWGL 5CLTA 3WUZA 2FR4A 3QUZC 2F53D 1VEOA 2P45B 2UWEE 3DO7A 1QSVA 4XPFL 1UWGL 2OR7A 4FZ8L 4Q9RL 5H94A 1RZIA 4RMRA 2EYSB 2OJEA 3TT3L 2H2PC 1R0AL 1FGNH 2DLGA 5FDYA 5F3BA 3QIWD 3TBTB 1YEJH 3GSNA 4Q6IC 4OSUH 2ZJSH 1B4RA 1ERNA 1Q72H 3UTSB 5FYJU 3T1WA 3L3IB 5C0AB 4WFGE 3HNSL 3WFDH 4B41A 2JJTA 4UI2A 4LP4A 2NY0B 4HKJB 5DT1H 3ULVE 4O4YL 3MJ9H 4QYOA 3TV3L 3VFVB 5E1HB 5D2NC 3CXHK 3SPVA 1MCLA 4FQQB 4Y1AB 5HYQA 4WGVB 4LHUB 3FTGA 3OX8A 3PDOB 4YHYC 3V5KB 2DI7A 1HSAB 4J6RL 4P2QB 15C8H 1P4BH 3F6LA 4YIQA 3PWPB 4JR9H 3SJVA 3MTRA 1U36A 5CSBA 4Y2DA 4I4WA 1G9NC 2BCKB 3Q1SH 4PJIB 5IHUH 1ORSB 1JGEB 3FHAA 1IC5L 1LE9A 2VABB 4NZTH 5F8RC 4PGZA 4S11A 5DQDH 3FRPG 3MUGB 5KSBA 1I7ZA 3K3QA 5KSBF 3OKOA 1NAKL 5EU5A 3LKNA 1KACB 4JO4L 4W4NA 4CUCA 3JV0A 3W11D 2YOCA 4YLQT 5CS7A 4L4JA 4NRXB 5F7FA 2EE3A 3ZHDA 4LRNL 1A3QA 4UB0H 4HIXL 2EEDA 1CDCA 2JCCE 1I1FB 3VXUA 1N6QH 1CTOA 3ARDA 1OTSC 3Q5TA 5L7XH 2D2OA 4YBQD 3KPRE 4NQTA 1D6VL 1FL3B 4HZLB 2NY6D 3TIDA 3GMLB 4R2GD 1GSMA 3AMLA 4HBCL 3IU3A 4G6FD 4JZJB 1IAKB 2IH3A 2IG2H 3MV7B 4QHUA 3IXAB 2X4SB 4FFZH 5JORB 3CVIL 2ZPKH 2AERT 1C1EL 3O8XD 5IM7A 2JKXA 4XP9H 1E28B 3FONA 1YEGH 3RL1A 4HX1A 4XWGL 3QEUB 3KPTA 4ZODA 3VFTA 3S36X 1DQLL 3ZDXF 4KKCD 4MCZB 1CGVA 4DCQA 4H0IA 1UWXH 4BQBA 1A7OH 1G9MC 3V6ZB 2XQBH 4KHTL 4XVJH 3MRIB 4JRXD 3EDEA 3MRDA 4IRJD 5DTFA 4AH2A 5E2TL 3RJDA 4GKOA 3X17A 1LEIB 3SKOA 1C5BL 4QY8B 1F8TH 1QFWH 2B1HL 1GIGH 1HZHH 4X6DA 3V4UH 5EORH 5DS8B 4WI7A 1MF2L 4X6DF 3TN0C 5E8PA 3DMMD 4JRWA 1NCBH 4NC0B 2IAMC 5SWZB 2J6EH 1AD0A 5DJ6A 5CBAB 4PJGA 3QXDA 5ISZE 2DJ4A 1XCTB 3LQAC 1LO4L 1NGWA 1FVCA 1U92A 4PJGF 1NC2A 1MCPH 2GTZA 2EZ0D 5GS0H 3X3GH 5TQ0L 2OLDA 3LKQA 5CJQH 5HHMB 2X89A 1QVOB 2APBA 3L5XH 4HLJA 4UBDC 43CAA 5FYKU 4TVPL 3VW3L 1HYRC 2YZ8A 4GW5A 4S1QL 4M3KB 1AGCB 4LARL 1EVUA 2NXZD 3C09C 2GAZA 2X1XR 2BY0A 2A9NL 1MHHA 2FJFB 2HH0L 3D39D 4JFXB 1RK1A 4PG9B 1C16A 1ZEAL 3V6BR 4BA8A 4TSAL 4EDWL 1LVEA 4GFTB 4IOSD 4MX7B 5C0EB 1KJVA 4PRHA 5IJKC 3P4NA 3UBXG 1DBMH 3NCYS 3OR7B 4I0PD 5FM4A 3PV7A 4FHBD 2W07A 4H1LH 1BX2B 4NHUA 1FPTH 1UCTA 3PNWA 3T2NL 1PKQE 2XA8L 2YMXH 5KTEH 2O26U 1I7UA 3BSZH 1WITA 5T3ZH 4LVEA 3OKNB 3SDAA 5ICZB 4LLYB 3O9WA 3UTQA 4J3TA 1AKJA 4RMTA 2V5SA 4PJHF 2O61B 4KPHH 4HUKB 3JV4B 5IG7A 2OTWA 2WINA 1AXTL 1JZ6A 3FMGL 4U1KA 5TPWL 2FLRT 4KK6D 4RRPA 5EO0B 5HGBB 2NY3C 1C5CL 3GSWA 2R9HD 3MOBH 5C1MB 5HI5D 3ARZA 2GW5A 4X6CB 3WO3B 4KVNH 1U8IB 5GRJH 5C9KA 2AJXL 1KB5L 3W0WB 4LLWA 4V1DA 4MA7H 4NGHL 1G7IA 4HH9A 4XPTL 3QFJB 4DVRH 3HZYA 5HI4C 4FN0A 2Q20A 4IDJL 1U8JA 1PW3A 1H5BA 1QZ1A 5GSVB 3PGDB 4JPIB 1TVDA 4H8WH 1MI5A 5C0CD 3OMZA 2VIRA 3WN5A 4NCDA 4GXUN 2ZUUA 5I2IA 1YYML 4RMUA 4KRLB 4DQOH 4WFFE 4U3XA 4HJGB 3LSOA 2G75B 4KRPB 3KXFE 1I9EA 4PYGA 3U83A 2F8XC 4NCC1 1M7DB 3FFCE 2FJGA 1NFKA 1R3HB 2C3XA 5C09D 3TCXA 4U1HB 4XC3H 1PG7L 4JPWH 1JHLH 4GMTL 1DVFA 3BEWA 2YA0A 5HTSA 4KMTL 3T1FA 5E9DB 1P6AB 4ZUWB 1FRGH 1JGUH 4MNHA 3UAJD 2IALA 4RQQA 4HC1A 5JW5A 4DGVH 3O3AA 2P8PB 3PHQB 1ETZB 1AXSB 2X40A 3U46A 4N0UE 4NDMB 2VKXA 5C08E 4QT5A 3OQ3B 3GSRB 4R90L 4C56A 4WFHE 5FYJE 5IFAL 1ZWIA 5DGQA 1FG2A 4RMSA 4XNZC 4BFGA 4LSVH 5ENWA 5EBGA 3OTTA 3CDGA 1EBPA 5E56A 5T1LB 5T1MA 4Y88A 1OAXH 1I7TB 1YEJL 4K94C 3KPSB 3C5ZD 4H26A 4EI6B 4ENEC 2BOCA 2GSGB 2ZJSL 4WFGD 1M6OA 1Q72L 4C4KT 3ES6A 3B9KC 3HI5H 4FQXB 2Y23A 4RIRB 3P0YH 5EWIH 1CICA 3UJTH 1KC5H 1YMMD 4QHNA 4NN7C 4YC2C 3GMMB 2NX5A 4XCCH 2IANA 3BXNB 3REWB 3G6JB 2AEPH 5F1IA 5EBWA 3L7FB 2XWJB 5JOFA 5D7JA 4F7CB 5C9JB 15C8L 1P4BL 5DQJA 4UILL 4IRZH 4TUKL 3W5NA 2FWOB 4YDIH 3RVUD 2OSLB 3AC0A 4J3SA 3C9NB 2BSRB 5CGYD 1CIUA 1JPGA 4HIEB 3FQWA 4ONFL 1MPAH 1T2QL 4R97C 3CU1A 3B2VH 5A2LH 4HT1H 5D7LA 5DQDL 3ILPA 5HGDA 1G0DA 3F62A 4G7YH 4O2FA 5IV2A 1FVDB 4XH2A 3S88H 3LKRA 2V2TA 1DN0A 9CGTA 3QUYB 5IWLC 1TVBA 1CXEA 1HI6A 2GT9B 4UU9B 1F6AB 1YMHB 1Q0YH 3CUPB 1N0LA 3JWOH 4HD9A 1NBVH 4UB0L 5DC9B 3LRSB 2VH5H 4U2ZA 5HYJB 5LAXB 5DMIH 1T1YB 5D9SB 2F53B 1BZ9B 3HC0A 3KPRD 5GPRA 4O9HH 2MOVA 4LCUB 2JIXD 3NABH 2FO4B 1FAIL 2VLJA 4Y4HC 4EQ3A 1NKOA 3WCYA 3O3DA 1U8LB 1UWEH 5A2KH 5EZOL 1CL7H 1QHOA 4FFZL 2ZPKL 4XP4L 3QDMA 1K4CB 2XTJD 4DKFH 3GMQB 1YEGL 2VDLL 1PEWA 4P23D 4LRIA 3OL2A 4X9IA 4JAMB 1F3RB 4KGJA 5HPMB 5KVFH 3U4EB 1QBMH 4JLRA 4HMCA 4XPAH 1IBGH 4R3SA 4LVHB 3D0LB 2MKWA 1IM9A 5B3JE 5FK9A 4Q2ZA 2YWYA 3DXAD 2Z31A 4HKXB 5IMKB 1XR9B 1CDYA 4P5MA 1XGPB 4DOHE 1RZKL 3G6DH 5CD3A 1F8TL 1QFWL 2DQDL 4NQCE 3CFEA 3V4UL 2V7HA 3GSUA 2VWEC 2VSCA 3FQTA 3DVGB 2AV7A 1NCBL 4MD4B 5GXBB 5ISZD 1MUJA 4JM2A 1L7IL 5D2LE 5FYKE 2OJZL 4XVUC 3HRZA 5E1AB 4X7SH 2HTKC 1E4KA 1SJEA 2A38A 4ZXBD 4BH8A 5LWYH 2NY1C 3GM8A 3CXDL 2A6KB 4HXBH 3X3GL 1G9NH 4PJAE 1TZGH 4OFIA 5CJQL 5IW1A 1YNKH 2NQCA 2GSIB 3S9DB 3L3GA 3L5XL 4JG1H 2E5EA 2CKBA 2DQEH 1OB1A 1U8QB 2F5BH 3VRJB 3NGBB 4L9LA 2BK8A 1A1MB 4WGWB 4KI5F 1Z9MA 2VITA 4IS6B 2X4PA 3ULUE 4GRLD 4U1LB 3NAAH 3K1KC 1OCWL 5E8OA 5B3NA 1S3KH 1KT2A 1WTLA 1VFMA 1TCRA 2NY6B 1AQKL 1LK2B 4L8BB 4G6FB 3AGVA 2EDXA 2JF1A 4R4BB 1FO0B 2RJMA 2EYSA 1DBML 3O8XB 5FGSA 1CQKA 4F9PA 1EJ6A 1GC1L 4HXAH 3KS0J 5IUSA 1X5IA 1X4YA 2YRLA 1AC0A 1UM6L 4MS8C 4U4BA 3MMEA 3TBTA 5KTEL 3BSZL 1A5FH 3VGGA 3FQUB 1B6UA 3UTSA 4HKBB 3WS6C 3L3IA 3L7EA 2FX9H 4EI5D 4MJIB 1G7PA 2B5IB 4HKJA 2A6IB 3NCFB 2EDDA 5A3ID 4KVNL 3VFVA 3SEPA 2VR4A 1G9MH 4L5FL 5L0QC 1U93A 3VGAC 2FECI 4FQQA 3FFDB 4Y1AA 5IVXB 4I9WE 5F7UA 4G6AD 4X9FA 1W0VB 5HHXH 3PDOA 5B39G 1HSAA 3IKKA 1I8IB 2JJSA 3OKEA 3WDHA 4P2QA 2UUDH 3PWPA 4I18C 4YHLL 2IPKB 8FABB 3NPSB 4TULL 4WFFD 4QRUB 1NCNA 3QI9C 3RKPA 1Z9LA 4U1GB 2AAVA 4PJIA 2ZG1A 3AAZB 3W9DB 4DQOL 1DQMH 2AS5M 1VFBB 3KXFD 4CU6A 4KHXL 4K71C 3MUGA 3FFCD 2JK5A 2EDTA 1VGKB 4KJWC 3SQBA 1FJ1B 4Z5RA 4A6YL 1WVZA 2NXZB 2HFTA 4YHKH 1HSBB 2CDFA 5F7EH 1CI5A 3EYQD 3FO2B 4GH7B 4NRXA 3D39B 2FLBT 4L3EE 4JPWL 3CJJA 3GJEB 2EXWC 4M93C 1KIQB 4J3XA 1DSFL 2X9YA 2YD2A 4LIQE 5DEGB 1J1XH 5IW3A 2EEBA 1IZKA 1FL3A 2HFEB 4HZLA 4NO0D 4DZBB 3GMLA 4XAWH 5FCSH 4JZJA 1IAKA 1ZT4B 2VLKE 4FQLL 5I1DB 1ADQH 3IXAA 2X4SA 4WFHD 5FYJD 5JORA 2AQ2A 4DK3A 4Q9QH 2D7QA 3RPKA 5B39B 4H5SA 1E28A 4P4KC 5K9KB 4GG6B 3OHXB 1A6UH 2JJUA 1FVEB 3QEUA 5J3HC 4FQ1H 4P4RB 2DWEB 4I2XE 2F54A 2XY1A 4K9EC 1P5VA 3QUKA 1G0YR 3T0EB 4ZFOA 4MCZA 2YZ1A 5E0QA 4FXGB 3V6ZA 4J3WA 1XIWC 1U58B 1L9NA 5D1ZB 1LEIA 1YJDC 4JO1L 3FZUD 3M1BB 4KJQD 4MB5A 3MLSH 1A21A 5DS8A 3P0YL 4M62L 3VGHA 3UMTA 1Z5LB 4LU5L 3GMPB 4EQ2A 1ED3B 3QSKB 4NNXA 1V3LA 1RMFH 4OGXH 3QWOB 5SWZA 1UYWH 1IAII 5I75B 5CBAA 1XCTA 1NSNH 4JQIL 4LKCB 3HUJE 3WFCL 4KKAD 3K74B 3Q48A 3QNYB 3I9GL 4OF6A 2P5EE 1RURL 4YEFA 5F7LB 1QVOA 2YEZB 3D3VE 1CFQA 2Q8BH 3O4OB 5C09B 1IGTB 1AGCA 1GH7A 3A6CH 5F72S 4PJ5E 1T3FA 3IS1X 3S88L 2FJFA 3W2DH 4KDWA 4JFXA 4URTB 5F6IB 3QFDB 1Q0YL 2Q7NA 1MCIA 1S7TA 3JWOL 5J8OA 4NWUH 3RAJL 3X14B 2AW2A 4R26H 5DMIL 1DCLA 3DI2B 5GISL 3RZCD 2DLEA 1JPSH 5C0EA 5CFHA 4LHQB 3AFLA 3OR7A 1WBYB 4E42A 2XPGB 5JO5B 1QHPA 3NABL 2R0ZH 1BX2A 4ODWB 3VG0H 2B7DT 3OKDA 1Q0XH 4N0YH 3V6OE 4HG4J 4CW1B 1UWEL 3HZMB 1H3XA 4YJZL 1F00I 2NZIA 5F9WC 5D7KE 3OKNA 1XH3B 4LLYA 3DURB 2O61A 5IR1B 1I3UA 1KXVC 1PJ9A 4M03A 3JV4A 2FHCA 3HFML 4L3CB 1OW0A 4ZO8A 4ODSL 1ZANH 5KVFL 5EO0A 5CGTA 1CDHA 3H3PH 5HGBA 4XCNA 4XPAL 1IBGL 4K94H 4KJYB 2EIBA 4X6CA 1T2JA 3LD8C 1U8IA 3P4OB 4X6CF 1V8HA 3W0WA 3QWRD 4UOW0 4Y5YB 4WU7B 3QFJA 4NQCD 4LGPB 4HIHB 4XXDB 1F6FB 4DN3L 1T1ZB 4L8SB 3DI3B 5GSVA 2DJSA 1CFVL 1YEIL 3PGDA 4JPIA 4CNIB 4WCYL 4HF5H 1DANU 3K4ZA 5FYKD 1Q9WB 5TH2B 5E24E 5DJCB 2DMBA 2A77H 5KSVA 3ISWA 4Z76B 4HJGA 2G75A 1QFUH 1FNGB 2COQA 3BPNB 4BUGA 3D2UA 4HXBL 1S7XB 2YD4A 1T80A 1M7DA 1Y6KR 5GGTA 3NIDE 1R3HA 2A1WH 3N9GH 3VE0B 4Z7NE 4JG1L 4U1HA 1UJ3A 4KKLC 3RL2B 2DQEL 3HMXA 5GGRB 3WFBH 5M7QA 2F5BL 2QADD 1A9BB 5FM8A 1N5YL 3ULUD 4OFKA 3CD4A 3GSNL 5E9DA 5K9OB 4ZUWA 1HINL 4D9QE 1VERA 4NUJA 2QLVB 3GKZA 2IGFL 1CD9B 4Y4FA 3NCMA 4U1JB 1A7RH 4JCLA 2P8PA 3PHQA 1AXSA 3CFCL 4M7ZC 4QF1B 2R2BB 1GYAA 4NDMA 2VDNL 3LEVH 4PJDE 2A6JA 4HXAL 1DANT 5FECB 4P23B 5D5MF 3LS5L 4JG0H 1F13A 4PB0H 5T1LA 4NJAH 2X4RB 5HPOA 4LCCB 1I7TA 2FYYA 3UPAA 1H8OA 1AGEB 3KPSA 1A5FL 2APFA 4D8PA 4WW2C 3R0NA 5DFVD 2Z35A 3U0TB 1B90A 2GSGA 4K55A 4WEBL 5CP7B 1KN4H 2EDLA 3GGWB 4HULB 5JIIA 2FX9L 1R3KB 4FQXA 4RIRA 3QUMH 1DQQB 3VXSD 1KLUB 3MRBB 4YDKH 5I6XC 4I9WD 1HE7A 3DVNB 3BXNA 3I50H 3REWA 3NFSL 1KCSL 2O93L 4YE4H 3L7FA 4WFEE 5HHXL 2XWJA 3G6JF 1SHMA 5C9JA 1S9VA 4ZXBB 4EJ1C 2FWOA 1GGIL 2OSLA 3PHOB 4O5LH 3VXPB 3ULSB 3C9NA 1BEYL 2BSRA 3UO1H 2NY2C 4HIEA 1D5ZB 1DQML 2BNUB 2JELL 2OL3H 1EH9A 4PLKC 3FKUS 4AL8H 2R0LL 1L9MA 5I1LB 2A74B 1U8KB 1FVDA 2NY5L 2VZOA 4L3ED 3BP4B 4GRLB 3AS0A 5DJXB 5F7EL 1QLFB 1F6AA 1UENA 1YMHA 1RV6X 3HC4H 5FA3B 2OP4H 3CUPA 3MLYH 4KI1A 3RUGB 3LRSA 3WUWG 5HYJA 5LAXA 1T1YA 1CFSB 5C0BE 5L6YH 1O7SA 2F53A 5EOCL 1BZ9A 3DROA 4P48A 5DXWA 5KOVC 1JGDB 3STZB 3BO8B 2WBWB 1SBSH 1J1XL 2FO4A 3OPZH 2VLKD 2Y6SD 5DK0B 1PKQB 4XAWL 3MRNB 2AV1B 4M1GH 2FJHA 5F21B 4TOYL 4YXHH 1B9ZA 1K4CA 3GMQA 5F8QC 4ACPA 5J56B 5K59E 4JN2B 1KUMA 2Z4QA 4S2SB 4O58L 1A6UL 5HPMA 3U4EA 5BVPH 3G9AB 1QD0A 2A83B 4EI5B 1OGTB 2GFBA 3MUJA 4JY6B 2P24B 4X80H 5IMKA 4LVNB 4X98B 1WT5A 4Q58C 3JUZA 2I9TB 4YDJB 2W38A 3L3JA 3VMPA 5HVHB 3EDJA 1XF5B 1WBXB 1RFDH 3V0VB 2IADB 2P8MB 2Z8SA 3VD4A 3DVGA 1RAMA 4NQDB 4M8QB 4MD4A 3SCMD 3WUWB 3ARVA 5BW7A 3IDMA 4EXPX 4M8VA 1XR8A 1NSNL 2MSPA 1ONQB 1IEAB 4PJ9B 2W9LA 5E1AA 1SJHB 3F58H 3ZYOA 5B8CC 4U1SA 2J8UE 3HR5B 4BQCA 1OQOA 2YD3A 2W0FB 3BPOC 1U8NB 2A6KA 1L7TH 3U0WH 2VKWA 3OB8A 3DX6B 4JQXC 2M1KA 3D3VD 3EYUH 4GRMB 2GSIA 4PREA 1JIBA 3BUYB 5JA8B 3WFEL 4YXKL 5C92A 1MCJA 5DJ2B 1U8QA 4Q9BA 3VRJA 4JFPB 2ATKA 1Z0NA 5HYIA 1A1MA 4PJ5D 3RIFF 4BFEA 1B0GB 4PP1D 1LILA 4WHDA 4IS6A 3D69B 3FO9B 4CMHB 4U1LA 3LIZH 1PFCA 3QJHB 1FGVH 3W2DL 2E3VA 1LEKA 2CUHA 1IGIH 4N0UB 1LK2A 4L8BA 4Y19E 1EPFA 5C08B 2APWA 4MJ6B 5JXEC 1JPSL 3SBWA 2ZG2A 5A2JH 4QRTB 1FO0A 5KAQG 2VL4A 3O8XA 1KENH 1KB9J 3G08B 3HAEA 3VG0L 3S34L 3MRHB 5DURB 2ZUSA 4M48H 2YD8A 4LVOC 5D7KD 1I3RA 2VRAA 5I71B 3BISA 3B3IA 1AP2B 4Y2OA 2X1WL 3N0PB 5BS0E 2XZQH 3ZT6A 4HKBA 2PYFB 4JFZH 4JRXA 4MJIA 2A6IA 4K9EH 4GXUM 4MQXC 5EH1A 5DD5H 3BQUD 1KULA 3DMMA 4LAQL 1IQDB 1EO8H 5IVXA 5D7IE 5AYUH 1W0VA 4IIQB 1I8IA 5C0FA 1PX4A 1H3UA 4QRUA 3PP3K 1ACYL 3AAZA 5ALBH 3W9DA 4EOWH 1YEFH 4HC1L 3RGVC 1IKNC 4QXGL 1NFDE 2UY6A 5HSFA 5KANG 1VGKA 1I1AD 1T7WA 1FJ1A 2HJFB 4WUKH 4KK9D 3PG2A 4F7EB 4ELKB 4JEGB 3VXME 2A1WL 2ESVE 1HSBA 3H9HB 3MRMB 3FO2A 2CRYA 3D39A 3CU7A 2CDGB 4NNYB 3N1FC 3RY4A 3GJEA 4M7JL 1LWRA 3SY0A 4LOUD 4D9QD 3RGHA 1KIQA 1UEMA 2J12B 3NIFE 4LCIL 5DEGA 5SX5H 5HY9B 2BY1A 2VDKH 4I0PA 5C2BH 1E6JH 1TETL 3LRHA 3DARA 3IDGB 4DZBA 1I8KB 5LCVL 2KQMA 4HS3B 3HB3D 2SEBB 1P9MC 4G8EB 1U0QA 4UTBL 1NL0H 1JRHL 2WBJB 3V95A 5K9KA 3AS2A 4GRWH 2YPVL 4GG6F 1FVEA 5E5MB 4PB0L 4P4RA 3MA9L 2DWEA 4NJAL 2Q7YB 4OFYD 4NBYB 3V79C 1JVKA 3VFGH 3Q6FB 1ZLWH 4FXGA 1BZ7B 4P59L 4XB7A 1KN4L 1U58A 3EOTH 4DOHB 4QHKJ 3REVB 3GFUA 2V6HA 3M1BA 2NTFB 4NQCB 1IGMH 1UB5B 2H6PB 2JJTC 4JKPH 1Z5LA 1PLGH 3GMPA 4YDKL 2M8XA 1ED3A 3JWDL 5E4EC 1IAIH 1DFBH 1P7QD 1REIA 1ZHLB 5D2LB 5F7HA 1MY7A 3U7WH 1VGEL 4NZDA 3BHBB 1I7RA 2V2WB 2XNAA 1OT2A 3RTQC 4U0RC 2XT1B 4U1NA 3RVXC 3U1SH 3DRTB 5E8EB 1FZKB 4KV5F 5I74C 3CDFA 4NC2B 4HJJH 3UYRH 1AGDA 5DLMH 2HKFL 4P5TC 2YEZA 4YGVB 5I76B 2AXFB 2ZOLB 5IFHH 3MRKB 4MXVF 4PJFB 4TNVF 3IFOB 5C09A 3VFMA 4HFWB 4QTIL 3BKML 2QADB 2VUOA 2VQUA 4R0LB 2UZXB 5HD8D 4M5ZH 4F3FA 3D6GA 4Y16D 1AD9B 5LG1A 3T0XA 1ZGLM 4AENB 1EGJH 1KPVB 4FFWD 4OCWH 2EYRA 3PXJA 3QFDA 1ZA6A 4OLXH 1HNGA 2ARWA 4RMQA 2C3WA 5CEZH 2R69H 4MLIA 5ILTH 3MLYL 2XG4A 4WHCA 2UVEA 4F80A 5J11C 2UWEA 3WIHH 3MRLB 3X14A 3TO4D 1AE6L 5KBNC 5L6YL 4MAUH 3VXRD 5IIEA 3WXVL 4ISVA 1WBYA 3GHBH 4M1CD 2XPGA 5ESVB 5JO5A 4ODWA 3SGEI 1H9VA 3BN9D 2HFGH 2C1PB 3IDIB 3MYZA 4CW1A 5I1GH 2Y5TB 5BRZE 3QHTC 3EJJX 4M1GL 1R3JB 5DDHB 3DURA 1G84A 1VKXA 5IR1A 1OTUD 2YK1H 2JE8A 3C5ZA 3MRGB 4JANB 1JNJA 3QEHB 5T3ZE 2DQGH 1A6TA 4L3CA 1HXYB 3ZYJA 3OWEA 2DQTH 3VXQB 1LP9E 3AS3A 1NBQA 5BVPL 1NCAL 1NCWH 3OKKB 5E2WL 3ULVF 1U3HD 1RIUL 4NYLB 2G9HA 3P4OA 3FB8B 3QXTA 2OI9C 2FEDD 4X80L 3QNZA 1BBJA 4Y5YA 4CVZB 2BNQE 4LLUA 1VPOL 4WU7A 3DNKA 4HIHA 1T4KB 5ETUB 1T1ZA 4L8SA 3NBNA 1CXFA 2CKBL 1FL6A 4ETYA 4CNIA 4M61B 3RWFB 2DQJH 2AKRA 1B88A 1Q9WA 5TH2A 3B5GA 2IF7A 2W91A 1T7XA 1YQVH 1WIUA 5DJCA 3UEZA 1FH5L 3PXHA 4Z76A 3F58L 1EXUA 1ZLVK 2P42B 4ZS7H 1FNGA 3GHEL 1QLRB 5GHWH 4CVXB 3CZFA 3IVKB 1S7XA 4Q7DA 5GIRB 2HVKB 3MRCB 3LDBC 3EYUL 2EIEA 3VE0A 2CSPA 1OSPL 4LSRH 4GUPB 3NCEB 4L3EB 3RL2A 5GGRA 1QFPA 2JCCA 5I9QB 1A9BA 1T5XA 2MPAL 1R24B 1Q1JL 3K8KA 3SDYL 3CCHA 1FFQA 5K9OA 4PY8J 3MX0A 4ZS6C 4AMKL 2FDBP 3QT2A 4X5XB 3V8OA 3KPRA 4HAFA 1P53A 3GO1L 4D9LH 4YUEH 4P5KB 3K8LA 4Y19D 2VLKB 1OSZB 4LSQL 1MREH 4DW2L 4YO0B 4ZOCA 1G7HB 3THMH 5IHLB 3VXOB 1NMAL 1Y6MR 4B50A 4HWNA 5FECA 2Z91B 4P23A 5D1QC 3HE7D 4EBQH 2YD9A 8CGTA 2X4RA 4LCCA 1ZA3B 5DD1L 1MRCH 5IVZB 1AGEA 4GSDH 3TJEH 1BECA 3U0TA 5IHZB 2BY2A 3O9WC 2EDEA 4XAKE 3SDDC 5CP7A 2R1XB 3GGWA 3SE3A 1RUMH 2B4CC 5CEXA 3OG4B 1DQQA 3UDWA 4Z18A 5GGUB 3UZVB 1CD0A 3O45B 2B0SH 3QCVH 5J1AA 2E7LA 1KLUA 1EO7A 3MRBA 1UM4H 4LLQB 1ITCA 1TTFA 2FECL 3E0GA 3X11B 1XGTB 5I19H 3RA7H 3DVNA 4BZ2H 1N5AB 5ISZA 1KJ2H 3SCMB 1V3MA 1J0JA 2WAHA 2EO1A 3HUJB 5AYUL 5LBSH 1JF5A 5TDOB 1U2HA 3TYGL 4NM8L 4ZXBA 1G6VK 3I6LE 1FNHA 2P5EB 4YBLC 2VB5A 3PHOA 3PL6D 3VXPA 4EZMA 5KG9A 4OCLC 3WN5C 3LQZA 4EOWL 5ALBL 1D5ZA 3BP5B 4WTWA 4XRCA 2BNUA 4X6BB 2J5LC 4H20L 4KDVA 2ZKHL 1S5IL 5I1LA 3VXMD 5M94B 4DN4H 1U8KA 2ESVD 3MGAA 5DJXA 4GRLA 2EDWA 4AIZB 4WRLA 1ZHKB 5E99H 1PSKH 4CDGC 4NKQB 4BFIB 2LABA 3QDHA 3TIEB 2BFVL 5HHQA 1CFSA 4ZFZA 3EYFA 1WTGT 3RUGF 4K3GA 4JREC 1JGDA 3STZA 3BO8A 4UT7L 3ZE1E 1J0ZA 4ZFOL 2I07A 5E5UB 1F2XK 1WC7B 1TVHB 4R4FL 4KVCL 1R5WB 2VDKL 3RU8H 4WTXA 5DK0A 5MERB 1PKQA 4P2OC 1Q38A 3WJLC 4JQVA 1ND0B 3GIZL 4RFEB 3MRNA 2AV1A 3BZFB 1XF2B 4IRSC 1RK0B 1HN1A 4WNQB 2XKNA 5T5FH 3UTTE 4S2SA 5CIPH 4S1DC 3QPQC 2PXYD 2HTLC 3QCUL 2A83A 2OS7A 3I3BA 4EI5A 1U95B 5KVDH 4M6NL 1S7SA 1OGTA 4Z7VE 4JY6A 5DVLA 1T04B 1MCOH 2HT4C 1IEBB 5C8JB 2I9TA 1WICA 4YDJA 3OAYH 5J1SC 4QXUH 3V0VA 2IADA 3TZVD 1PLGL 3L3DA 1IAIL 4MHHI 5IROA 3WUWA 3B43A 1W0WA 3MJ8B 5ACLA 2CO6B 4P9MH 3H8NA 4N5UA 4GXVH 2MHAB 5D8JL 1IEAA 4F8QA 4Z0BH 1QBAA 1X7QB 1F4WH 3HR5A 3KYOB 3KXFA 5D7JC 5E6ID 2W0FA 2PNDA 2CO7B 1U8NA 4NQUA 2NXYD 5GS0D 3DX6A 3Q5YA 1I1AB 3CX2A 1PG7W 4JO3L 5HHNB 3UYRL 2FEEL 3I6KB 4GRMA 2GTWB 1AGBA 4C58B 4PJ8C 2D7OA 1NLBL 1JMXA 5K93A 3BUYA 5DEFB 2XWTA 1GOFA 5DJ2A 4JFPA 4LDOB 2OMBA 1HOCA 1B0GA 2W9DL 3UPCA 1JPST 2VZVA 4YEEA 1V7NH 3D69A 3FO9A 4RISL 3MACH 1KCUL 1EGJL 5JIKA 4OCWL 2AJYL 2HLAB 4WWKD 4NP4L 1Z0MA 4UQ2A 5MEPB 3HZVB 3ZE2E 4NWTL 1RZJL 4NO0A 2NW3A 4N0UA 1MLCB 3WIHL 2VLRE 5C08A 2QHRH 4MJ6A 4PJDB 4NHCH 1BBDH 2UYLB 5JZ7D 3T0AA 1N59B 5F1NA 2B20A 3VFUB 3G08A 3PABA 5L8KB 1GJIA 5IT2H 4IDLA 4OTXL 3MRHA 4KK5C 5DFWH 2K9UA 5BRZD 4PGEA 4G43B 2ZCLL 3G5YB 2E7CA 4XC1L 5T3ZD 1AP2A 3LOWA 5HVWA 1V3KA 4UOW1 2YK1L 4Y0GA 1V7MH 3V4PH 2CUMA 3BFOA 2R0WL 2DQTL 2PYFA 3BI9X 3IF1A 2DWDB 2NY7H 4XI5C 1DTUA 3VWKD 2R29L 4GKZB 1WBZB 5H35B 4XVTH 4DK6A 1Z9OA 3U82B 4W4OC 4DGIL 2BNQD 5MI0B 5I73C 3LKOB 1HQ4B 1IC7H 3IGAA 5DHYA 1IQDA 1P7QB 5GGTL 2VOTA 3QUXC 2Z31C 3MRQA 5AG9A 3SOBL 4C55A 1FLRL 3DX8B 4F37K 3HMXL 5JR1H 3B2UC 3EIFA 3EUUA 2MJWA 1CFNA 3KPLB 4N1CA 3TEUA 4NFCA 4HUXA 4AK1A 4QRRE 2GJ6B 5FGCB 4PGDB 2O5YH 4WV1C 3NCBB 4L3AA 1IARB 1VB9A 5JQ6H 2EDQA 3GBNL 12E8H 4IMKA 5KAQF 5MEOB 1TZIB 3UTZB 1LEGB 1IFHH 2NMSA 2HJFA 4XXCA 1SJXA 4GAJL 3JXAA 4F7EA 4ELKA 2RBLA 4NZRH 3TYFA 3MC0A 5GRUL 3MRMA 1W72H 4LSRL 5IESL 2H32B 4NNYA 3C60D 3OG6B 4MAYD 5DHVH 5C0BB 3L9RA 1JI1A 4DUVA 3DUSB 1T6VN 3QA3A 2R1YA 1A6AB 3TO4B 2XZZA 1SEQH 3M45A 5HY9A 4D9LL 4NQXB 4YUEL 4N68A 5TDNB 1EHLL 1K8DB 2AI0H 3IDGA 3EFDH 5T1DH 1I8KA 1FFOB 4HS3A 5EUOE 1RVFH 2SEBA 1MREL 1JHTB 2VXTH 4G8EA 4RNRB 3GBMH 3PWVA 4UTAH 3U2SA 2DYPD 2DIBA 5E5MA 4GBXD 1MAMH 1JE6A 4N9GB 1D5IL 1VFOA 5DK2A 3TO2B 2Q7YA 4ZAKD 5E00A 1MRCL 2V9TA 4K7PH 3Q6FA 3RX5A 4XAKD 2VJXA 1BZ7A 2Y25A 5HYEA 3QWRA 5CHNB 3BGMB 5E08L 3REVA 5I18H 2AXGB 2NTFA 4NQCA 3IRPX 4OCMC 1UB5A 2H6PA 2NY0C 2UZIL 3AU1B 2YPLE 3QCVL 4YNYB 1UM4L 2AXJA 4DZ8B 3CLFL 5I19L 1G7MA 3ORJA 5D2LA 5DJZB 3IB4A 3BHBA 4GW4A 5D2LF 3IFLH 2J8UB 3I6LD 3LH2L 4K2UH 5JHDE 3BKCH 5F93C 4PJAA 2HYMA 4G3YL 1QP1A 4QRQB 5ALCH 2GHWB 4D0CB 4YGVA 4K3DH 1MEXH 5I76A 3QWQB 5C70A 2YUZA 1OARH 1F4YL 4PJFF 4NM4L 3BOVA 1MIEH 4R0LA 4P2RE 4V2CB 4K7FB 2FH8A 2G60H 1AD9A 2HG5B 4K3EH 4AENA 3ULUF 1DQDH 4M4RA 5DR5H 2YA1A 2AJSH 1PSKL 4HBQA 4G5ZH 4Y19B 3MRLA 2CQVA 3TFKC 4L1DA 1MCHA 5CZVH 3D85D 2VXUL 1CE6B 1I8LA 2DOCA 3NTCH 2WNGA 4FQ2H 4UUJB 3EO9L 5HHVL 3P9WB 3DGCR 4TVSa 3O2WH 1TTGA 2C1PA 3IDIA 3QUZD 3SKUD 2Y5TA 4IMLA 5DDHA 1R3JA 4JZJC 5CJBA 5D4QA 2BNRE 3UTTD 3DSFH 4ZQKA 4JANA 5BS0B 3QCTH 2HN7B 1HXYA 3VXQA 4J23A 4QWWD 3TH2T 1U8MB 3G5VB 3RPIB 1NGPH 2EKSA 2KZWA 4P2CG 3OKKA 4GQ9H 4J1UA 1KOAA 4NYLA 3T04D 1CF8L 3R8QA 1N7MH 3FB8A 5I15H 2PF6A 1CR9L 2B4CH 3CX5J 4D0DA 4CVZA 1LDSA 5K9JH 2EXYC 4BM7A 3WDJA 1KCRL 2X42A 1T4KA 5ETUA 2VDML 5F6HI 1AO7E 4NSKA 4R96A 3SE4A 4M61A 4K8RC 1CYGA 3EJYC 5IB1B 2ICWI 2YS4A 4Z6AT 4YFLF 3PL6B 4GXVL 1HH6A 5J0BA 2PTTB 5E6YA 2OR8A 3UJIL 1QUNA 1NFDB 1QLRA 2WIIB 2C7UA 2Y36L 4CVXA 3IVKA 1QFHA 4OQTH 5GIRA 3MCG1 3MRCA 5IBTH 3VXMB 4JO2L 1ZMYA 3EJZD 2APXA 1RZ7H 1YEHH 2ESVB 1BIIB 3STLB 1FDLL 4GUPA 4L3EA 5J12C 4XP5L 3BD4A 2WWKO 2XKSA 3SKJL 1A1NB 1QR1B 1K3ZA 1CFTA 1OQXA 5E2UH 4KROC 5EO1B 4X5XA 1RJLA 1JZ2A 2IFFH 5I66B 1FL5A 1L4IA 4P5KA 2VLRD 2VLKA 1OSZA 5HDLA 5CJXC 5DD0H 1OTSD 2QHRL 1G7HA 4NHCL 2DN7A 1KXTB 3ZL4L 4PRNA 4Q6YA 4F58H 1A7BA 4PLJC 5E4IA 1N64H 5D93B 4JB9H 1YQ2A 2Z91A 2W1NA 5IBLC 4I2XA 4P2YA 1ZA3A 1LO0L 5IVZA 3BKJH 3Q5OA 2VZTA 4KFZC 2X1QA 1RUAL 5IHZA 3I6GB 3MXWH 4OZGE 1J5OH 4YX2H 1OW0C 4M4PA 4YHIB 4ZO9A 2EICA 4X99A 2D03L 5CJ5A 5DRXA 3O45A 3QQNA 5DO2D 3X11A 3TZVB 2F8VA 1XGTA 25C8H 4H1LG 1IC7L 2EDNA 1PY4A 4RMWA 4G6JL 1N5AA 4MQTB 2C4XA 4XNYL 3SCMA 7FABH 3HUJA 3PWNB 2FBOJ 3S5LG 5TDOA 3HUJF 1JWUA 3TN0D 4F9LA 4AQOA 3MA7B 4MCYA 3OGCB 4JDZB 4NNPH 2VWEE 4QRRD 5E6IB 2P5EA 2IAMD 2EKJA 2NXYB 3SN6N 2NW2B 4XNXH 4OLVH 1F4XL 3ARBC 4H25B 3BP5A 5EU7C 3DGGB 3I75A 1I75A 1KELH 1JFQH 5F9JB 5IVOA 1NEZG 3HTLX 2AQ3A 1KJMA 1QG3A 4PJ5A 1YEKL 1JTOA 1IFHL 2N7AA 4XMKH 4ZUVA 4GAYB 2F5AH 4UBDD 2ZUVA 2W65A 3NCYP 2AK1H 4NZRL 2YR3A 3FO0H 3I2CH 4AIZA 3R1GH 3DLQR 2DKMA 4O2CA 3VFSB 2ZOKA 4BFIA 1ZLSH 3TIEA 4HLZG 3MBED 3WD5L 1FZJB 1WC7A 1TVHA 2B2XH 2DLHA 4ONHA 1LK3L 4D0BB 3TH3T 2EE9A 1MCWW 2FHBA 1R5WA 3V6OA 4KUZH 1DLFL 4H1LB 2AI0L 3VGEA 3HE6C 5MERA 5BRZB 5D1XB 2DBLH 3M8OH 4RFEA 3QXAB 3BZFA 4HGMA 2FD6L 2H3NB 2YRZA 3X3FL 4UTAL 1WISA 2KKQA 1RK0A 4JZNA 4QTHB 4WNQA 1T89A 3P9MA 5TE7H 3UJJL 1LP9B 2H45A 4HIJB 5BMFL 5JW4Q 1LQSR 2QSTA 4KY1H 1MAML 3CAFA 5EDXA 1U95A 4M1DH 3GMNB 3U4AA 4HGWB 2BSSA 4MA1B 4R6UA 1TJGH 3D25B 5SV3A 1T04A 1NEZB 2BNQB 2E27L 5SWQB 1J7VR 3MLVL 4S10A 1IEBA 5C8JA 3QAZB 2NY3D 3ARUA 3PP3H 5F89B 2YPLD 2YSSA 3WO4B 2BJML 4FQXC 3IDXH 2EDRA 5CILH 4LDLB 4NPYB 4Y8AA 3ARGD 4X7CC 2YBRB 1PQZB 2VZUA 3QR2A 5DZOA 5HI4D 5F96H 2MHAA 4BH7A 3X12B 2VSDA 1A7NH 1X7QA 3IFLL 2CK0H 5JHDD 5DC0A 2BDNH 3KYOA 3UP1A 4XPHL 1PZ5B 1BP3B 3K4AA 3RDTD 3CNKA 3ALWA 4QKXB 1TNMA 1I1AA 4APQC 1NANH 4FQJL 4GS7B 5D72L 2Z93B 3I6KA 2GTWA 3SGKA 5ALCL 3NIDF 4K3DL 1RUPL 1NAMA 1J10A 1OARL 1CGSH 1NJ9B 4P2RD 1F45A 4MAYB 1MIEL 4JDVB 5SX4I 3ZKXC 1XGQB 2UZYB 3WL9B 1F90L 2G60L 2ICES 1DQDL 1KJ3L 3E6FB 2HLAA 3MLZH 5DR5L 5E5RB 4PG2A 3SDCB 5MEPA 3QUYC 1MIML 4G7VH 4PP2B 3P30L 5LVEA 2ZNXA 1MLCA 4G5ZL 2FX7H 1OAYH 3HG1E 2W60B 4PJDA 1J0IA 4F33B 5CZVL 3LN9A 1N59A 3C6SB 2KDGA 4MGXA 4PJDF 3NTCL 3SQOH 3CSGA 4FQ2L 4ZSOE 5JDJA 4UT6H 5EUKB 1J9CT 1S78C 1TDQA 4XCFL 4G43A 1I1CA 1CE1L 2BNRD 3G5YA 4GBXB 4DUXA 3SDXB 1ODAA 4HFUL 4OFYA 1BQUA 1MHPL 5FKPB 3BX7C 4F7MB 3TBYB 1M4KA 4NUGL 4M7KH 3L95B 4IBLT 4WJ5A 3K4DA 4MJ4A 4I3RL 3M07A 2DWDA 1FBIH 4OZFG 4HS8H 4ENED 1WBZA 4IJ3B 3NCJH 4LVHC 5H35A 1JN6B 2NZ9C 4YAQB 4Y5VB 1N7ML 3NACL 1HQ4A 5I15L 3B9KD 3BDYL 4CKVX 3S36L 1P7QA 3P2TA 1AO7D 4AEHH 3HPLB 4QCIB 1UVQA 3C6LB 1WT5C