1CICD

Idiotope-anti-idiotope fab-fab complex; d1.3-e225
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
218
Chain Sequence
b'QVQLKESGPGLVAPSQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLHTDDTARYYCARERDYRLDYWGQGTTLTVSSASTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IG HEAVY CHAIN V REGIONS)
publication title Three-dimensional structure of an idiotope-anti-idiotope complex.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 45
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1999-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cicD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cicD01
4HS6B 2EXWD 3L7FA 5DK0A 3T77A 4G8FB 4OF5A 3WN5B 5DI8B 5IBUB 4WCYL 1N0XH 4LLAA 4ERSL 3VD7A 4LEOB 1PY9A 1DQLH 5GS0H 5E1AA 4X4XB 2XI9A 4ZYKA 4YPGB 4MA8L 5DMGC 3P9WB 1NLDL 1X4YA 4AT6A 4LFHD 1MLCB 5E2UL 1ND0B 4I3RL 5JO5A 4M62L 4KJWC 5C09B 5EBLB 3MV7B 1N59B 4HJGA 2NY0D 1EO7A 3EYFB 3CVHL 1KACB 2P8PB 3F7YA 3GMNB 1UWXH 2AEPL 3KLAB 3PF2A 2A83B 1G7QA 4HV8B 4ZO6A 1I8MA 1FIGH 4EN3A 1KELL 2VKWA 3VWKD 15C8L 4R6UA 4APQC 5H94A 5ID0A 5J6HB 5GZOD 1CF8H 2NZIA 4HF5L 4N5UA 3G6JE 4R7DA 2EDDA 1ONQB 4EXKA 3L3JA 3ULUC 1MWAB 4LVHC 1FJ1B 1U95A 3QDHA 2F8VA 2VXVH 4HBCL 3QXAB 1KFAH 4ELMF 5IQ7H 1AGFA 2BNUB 3OJDA 2VZVA 4JFYB 5DEFB 4LMQE 1QNZH 4PJHB 1FO0B 4UBDC 3KDMA 3PWNA 3QBTB 4P2OC 5DJZA 5EZLA 1A14L 3IDGA 4KUZH 1HKLH 1TETH 3I50L 3KYKH 3B6SB 5FK9A 4Y7MA 1PZUB 1IGYA 3QUZC 4PRAB 3L3IA 2NXZD 1ZA3B 5FOJA 1QYGH 1BJ1J 4UOW1 5I15H 3I75B 4YXHL 2I9TB 4L5FL 3MJ7A 4JJ5B 4K07A 4EUPB 3GHBH 1JHTA 4OD1L 1CFQA 4GKSB 2W65A 3M1BB 3VRLF 1G7MB 1XIWB 1GIGL 5GRXG 5I8CB 4WW2A 3PABB 3IVKA 3PL6C 4PRBB 5D6CA 1EFXA 5DMYA 5IB2A 5FKAA 2HH0H 5BS0A 4WHYG 4ZMAT 4MQXC 3RWHB 3Q1SH 3D0VB 3BKCH 2MKLC 4FP8L 1AH1A 1ZT1A 1JZ2A 4O9HH 3JV5A 2YZ8A 4M1GL 4YFDB 5DDHB 4JEGB 4YUEH 1NGYA 5HDQL 4LL9A 2MPAL 3LN4B 1EHAA 4LPXA 3MUZ1 3EJZC 4KUCD 3MBEB 1H3PH 4LSDA 4OKVB 4YDVB 4EIZC 1KGCE 3MJ8A 3MJ9H 2FECL 4BSWB 3LCYA 4XHJD 5CEZH 5HYQB 4OCXL 5I0ZA 1LILA 4X6EA 4L8BB 4R2GC 2P45B 2JJSA 4JGUA 4UB0L 1EJOH 5IB4A 1TLKA 4QHNA 2XTJC 3X13A 4X0KB 1AHWA 4Z7UE 5F9WC 3U0PA 4OLUL 2B1AL 2BMKA 3ESVF 1IEBB 2VQUA 1ZS8A 1J5OH 3F7RA 1Y18B 2AW2A 5HD8C 4PGEB 5I74B 2GQHA 4OZ4A 2EIZB 3SKJL 1JWSA 3SE4C 2YMXL 2A6JA 3BFOA 3QDJD 1AO7A 2BDNH 3LS5H 2HLAB 4HK3N 3U79A 3VXMD 4RDQF 3NIDF 4XPGL 2DWEA 3ULSB 5J56B 1BEYH 2XN9A 1IRAY 5FA3B 1GXEA 5DFWH 3FO0L 2WV3A 3AREB 4L4JA 1CBVH 5FYKD 3WIHL 3STZB 4D0DA 1A7QL 5A16A 1A0QL 2IPUK 1BF8A 5IB5B 1NKRA 1I4FB 4PJ5D 2WIMA 4MXQD 5D1QA 5FFLA 4P3DB 1KJ3L 1YUHA 1AXSA 2Q8AL 4ISVB 3QUXC 4JZJA 4GAGH 1M7IB 3O81A 3T08A 1T21A 3WSQH 1K9TA 4Z7UB 4FQQB 5ISZA 5LKNA 4K7FB 3Q3GB 3HZVA 5H35B 5E2VH 4C57C 4JM2D 5I1LB 3GM8A 3H9SA 4MAUL 1IBGH 5CEZE 2FJGA 3S5LB 3IJYB 3G5VB 4QHMA 4XBPA 5DO2D 1HCFX 1T1XA 3C2AL 3M8OL 4FMKA 4D9RE 2HTLD 1B9ZA 2A6DA 2AJXL 3G9VA 3U2SB 1TXKA 5FYJL 1WUNT 2AP2A 2EH8H 4N8CH 4F8QA 4U1IB 3PHQB 4DKAA 1I3RA 3RVVC 4U1SA 4NO0B 2H2PC 3O2VL 1GH7A 4ODSH 5IIEB 1Z9SA 4Y19A 3R8QA 2VDPL 2E9WA 1WZ1H 2Z91B 1UA6H 2D7QA 4MD0B 3L5HA 4GRLD 4JRYD 4P4KA 5ENWA 5F6IB 4OFIA 2V7HA 3VFUB 4HPYH 2KQNA 1IM3A 1KN2H 3MTRA 4BQ6A 4HMDA 3NTCH 3S36L 4YHYB 3BH8A 3V5HA 1PLGL 1IQWL 4JFFE 1TQCB 5KOMC 1CDJA 3BN9D 3K8MA 4XB8A 4ELME 5FKPB 3TN0D 5JHLL 2P5WA 4ELKA 1CICA 4ZFOL 5T3ZD 3ZKND 5D7LE 1T89C 4DKFL 3JVGC 3BX7C 2C1OA 3MLRL 4HMEA 5DHXB 5DJDA 3RGVA 5DA4A 3DUSA 2JIXD 2BVYA 4K23L 1TQBB 3H0TB 4AEEA 2IAND 5GISL 1S5HB 3J8F7 4UT6L 1M4KA 4TRPL 5GRZA 5IBUG 3LMJH 3WXWH 3E2HC 4WHTA 5D1XA 5EO0A 4AG4L 2YD8A 2NY1C 5J6GB 4XZUA 2DWDA 1YEEL 3UTZA 3QNYB 1YEJH 3CDYA 1CFVL 3FT3A 5D2NA 3VRLE 2D9QB 5C08E 1KXQE 3GNML 4AK1A 4NJ9L 4F7EA 3CJJA 1P7KA 4RGOH 5JUEL 3MRGA 2MNUA 2Z31D 2D0FA 4HUMB 3PIQA 5C0AA 2J6EH 3C5SB 2YOCA 1IM9B 4U6XA 1F4XH 1NEZA 5GGQH 1T1WA 2GSGA 1N3NA 3ZYJA 1Q9LA 3UC0L 2OXGA 3HE7B 3OR7B 4JFFB 1HOCB 3DHMA 5DF0A 1Q72H 3MBXL 4ELMB 4DFHA 1NUFA 4W6YB 3WFCH 5HHOA 5D7IF 3UZVB 2YD2A 3ZO0A 4ENEC 1HDMB 1YECL 3GMMB 2FEEI 4NM4H 1OD7A 5D7LB 4XXDA 5TQ0L 3RX8A 4EVNB 2VDLL 3TZVD 3O41A 4YHPA 3DUHA 4HWZA 4WV1B 2HRPL 1KN4L 1I9JL 1T4KA 1JUFA 3IDXL 5CUSL 4LHQB 1EGJA 2CRIA 1BD2A 2XA8H 4LIQE 1FYHB 3VH8B 1RIHL 5DRXA 4XC3L 5C08B 5C8JB 4NRZA 1M7DB 3IDYC 4OAWA 5SX5K 3BRDA 2C3XA 1ZVSB 1MHEA 5JNYA 3GMQA 4PD4K 1RZJL 3Q5YA 1I9IL 3ALXA 4EOWL 1VGKB 5IHZA 3SGDH 4QNPF 4P5MA 1DQML 3DRQA 5D72L 5IJKA 3UPRA 4M5ZL 3W2DL 4DW2L 4HUNB 4NUJA 3T0AA 4AMKL 3NIDE 2E7BA 4PJEA 5C09D 1MF2H 1NC4D 3DSFH 1B4JL 3T0EE 3MV7D 3DETC 5CLTA 4EUPG 2FLBT 5CS7A 4KH2A 5GJSL 2HG5A 1HI6A 4UTAL 3P0VH 1MRCL 5KANG 5L88L 3BKMH 1YYML 3HAEG 3S9DB 3QEHA 1EO8L 1PG7H 4ZOAA 3NCMA 1AIFB 1JBJA 2AJYH 1A3LH 3CCHA 4TN9A 4MZ3A 5J0BA 3BDYH 1A7OH 4K9EH 3BIBX 3DYPA 3T1WA 4XXCC 4KFZC 4OCYL 2X4RA 3BWUC 4HUUA 2ZOLA 3QUYA 1EH9A 3GGWA 4MNGE 5L8JB 1I8KA 3REWA 4GRMA 3TBYB 3F6IA 3DV6B 3S96B 1UGNA 1L0QA 5E9DE 3C87A 2I9LB 3T0EB 1JHKL 3WDJA 4KI5C 1SVCP 3AXLA 4ODWA 1NGQH 4K8RC 5JHDD 1IAKA 1MRDL 3NCJH 3QH3A 4PJ9A 5I1CH 2NY7L 4QOKE 4U1HA 2H8PB 3ULVF 3A67L 4Y5YC 2BJMH 2VAAB 5F3BB 2B20A 3N1MC 3ARZA 2DBLL 1E4KA 3RZCB 3S88H 1EEUA 4XBGB 3I2CH 3MA7B 2BFVH 4RZCB 5CLWA 1F4AA 4UDUA 2GJJA 3SDCB 4O02L 4KRMB 2Y5TA 5SX5H 2E7HA 1P7QA 1ZT7A 4PJBF 3D6GA 2VITB 5IMMA 1JYNA 1K6QH 5DUPH 3TO4A 1CIDA 3PHOB 3D25A 4CMMB 4UNVA 2DLTA 2WINA 3L3OA 2G5BB 1X5LA 1OTUD 3KPRD 4MWFB 5FF6A 4JFQA 4NQCA 2D2OA 4YXKH 3U0WH 1RK1A 4MNGB 4KGJA 4R4FH 5A3ID 1DANT 1DN0B 4D9QD 1IKNA 1MEXL 3NCCB 1IAII 4G8GE 3W82A 1KXVC 5E9DB 5K59F 3B5GA 5I30L 3UTQB 4BSVB 1ITBB 2BVPA 1GGIL 1UXSB 2OL3B 2J12B 1R3KA 3MUY1 5GS0D 5MP6L 2EE9A 1J87A 3MOBL 3ZHKA 4FS0A 1QRNE 5I73B 5EU6B 5A1AA 1DQQA 3PDDA 4QOKB 5TE4H 4RAUA 3QJFA 4XAWL 3O4OB 1U3ZA 3S5LG 4Y16A 2BOBA 2DLIA 4NCC2 4WFGE 2F54E 1T80A 2Y1VA 1XGRB 4HKBB 4GG8B 4NPYB 4XCCL 2EC9U 2P5EA 3H7BA 4RMRA 5IG7B 4TULH 4TTGA 1A3RL 3BKJL 3JWDC 1WFNA 5D7IE 4YXLL 2I27N 3U4BL 4WU5B 1F90L 1FAKT 3C8KB 2W0FB 3SE9L 5MERA 4V2BA 2V5RA 4OZIA 4MAYD 3DNKA 2C3GA 3VI4F 3BGMA 3T3PF 4L8CB 1JGEB 4G8GB 4ZNEE 2AK1H 5JPNB 2W0PA 1KT2A 2CLVB 4NUGH 4GSDH 1JZ5A 1PSKL 3PXHA 4LP5A 2A1WH 5CEYB 3P4MB 4HS3A 1NMCC 5EO9A 4F3FB 2DLHA 2ZPKH 2QSQA 3BVNB 4U7MA 4XAKD 2R8SH 4HH9B 4IOIB 1X5IA 4HXBH 3CFCH 5ERWB 4DN3L 4PJGB 2DQDL 2PYEA 4YBQC 5GIRA 4YX2L 4QNPE 1KNOA 2F54B 4OZHA 4ZFOA 3WIIL 4QY8B 3F8UB 1MCRA 2OZ4A 3K8LA 3BD5A 3LB6D 1YEGH 4WI7A 2H6PA 3W11C 4FQXB 3OMZA 1CIUA 5T1KA 4NNXA 1Q9OB 4P9HL 5D7IB 3EFFA 3KYNA 1BPVA 2ADGB 3OKMA 1AR1D 2WNGA 2IQ9H 4ORGA 5L2KE 3H7LA 3MUGA 4P2CG 4X6BA 1V05A 4OGAC 4QF1B 4CW1A 5I9QB 1A7RL 1CGSH 1FORH 2R0KH 3PQYA 4NN5C 5J57B 1FZOA 3UZQA 1I7TA 2UZIH 4QHLA 3ULUF 1IGTB 3L3HA 4JVUA 1I9EA 1IT9L 3BMVA 1NC2A 4LLQA 2YPKA 2W91A 1PBYA 4HK0A 3OKYA 4KMLB 4LQFH 3QEQE 3VXUD 3RTQA 5EU3B 1DN2A 4P5TA 2XZQH 4QRRE 4RMSA 1WIUA 2YSSA 4JDZB 3HZKB 3WE6A 5M94B 5D2LF 1A47A 1NQBA 2BNQE 1TVBA 1JPFA 2LV4A 2H2SC 4LU5L 5CEZD 1XAUA 5EC1B 1N2RA 3NACH 1XMWA 1NJ9B 5DJCA 5ESQA 2F8OA 3VRIB 3SKNB 3DX7B 1KCVH 3MX0A 1VEMA 5CJXA 1IGIH 3VH8G 5JORA 3BDBA 2BSRB 2DN7A 2KPNA 2VERN 3TPUB 4NFBA 5L2KB 5GGVL 2DI7A 1FFRA 2LAAA 2ZUUA 4JZNA 2DQFB 3ULVE 2AJVH 2ITDB 1MSPA 4K3EH 3T0DA 3I6GB 4N8VB 4RNRA 4P49A 4XNYH 2PO6D 3LEYL 2IC2A 3KHQA 4F9PC 4FQ2L 4BFGA 1JZ7A 2ICWA 1IGCL 4HUVA 1QR1B 1XCQA 3H3BC 3QEQB 5DVKA 4PJBE 2DQIH 3CX5K 4QRRB 3EYSH 4QTIH 1YJDC 3QIUB 1W0VA 5SWSB 4PIRF 3QIBC 4PLKC 4XMLH 1HHKA 1HXMA 1K5NB 1E6JL 1U8JA 2BNQB 4OFYD 1NFKA 3QO1B 3I6LE 1EJ6A 1HSBA 2RR3A 2B7DT 5D7LD 1A21A 3WKMH 1OGAA 4LCYB 3ZTNL 2WUCL 1KJ2H 2LFGA 2PXYA 4JDVB 3AC0A 4KXZH 2CLRA 1JGUL 1IEAA 4QXUH 4XC1H 1MPAH 1T22B 4O2FB 1JZ4A 2X4NA 4HFUL 4EJ1C 5A2IH 1GZQA 2VZOA 3QQNA 4B7IA 4QWWD 3BD3A 4FZ8L 1CXIA 4NWUH 5F1NB 1TZIB 5CCKH 4PJIA 4OGYL 2EYRB 2IPUG 3NN8A 2OM5A 2VLKA 4RDQG 5IMKA 1PX4A 4NZTH 1WZMA 4J8RA 1XZ0A 4MCZB 3QUKB 4PJBB 2ZCHH 5IW1B 3CU1A 1A6VH 1X5FA 3WS6C 1HCVA 2P49B 1BFVL 1R3IL 4UIKH 4HFWA 3N0PB 5EU5B 5T1LA 5BZDA 1NCDH 2F53B 2R29H 4LDOB 5GS3A 4KJQC 4IRJA 2W60B 1II4E 2FR4A 3HC3L 3Q6GL 3VI4E 2ATKB 4XPHL 1R24B 4YDLB 3T3PE 2EDYA 2W9EL 1C08A 1RFDH 2A74B 4OLZL 3U1SH 1OAZH 3LKQB 2ENSA 5E2TH 3OWEA 3WDIA 1I3UA 2FX8L 2BHYA 2O5YL 5FO7A 3G08B 3HHRB 3TM6A 5EA0H 4O2CA 3VDCA 1T1YA 2FATH 2O5XL 1FNGA 2VWEC 3ZDXF 4ZUSB 1NANH 4NNYB 5IVZA 4UIMB 1KB5H 4HIXL 4NC1E 4LSRH 5KVDH 3VJ6B 3ZL4L 1I7RA 4RMTA 1U8MB 1NBVH 3FN0H 4LLWB 4K3JH 5D7JC 1A1MA 5IHUL 1NCAL 4HWEH 1U8HB 2I07A 1KLFA 4GBXD 3BRFA 4NQUA 1TITA 4U3CA 1IQDB 1RZFH 5LGHL 3FRUA 4NQTA 5E6IC 7FABL 4N1EA 3RKDC 2I60L 4FFYH 3K1DA 4X4ME 1NFIB 1D5ZB 5ESVB 5GRUH 3CSYA 3VFVB 4I8DA 1YNTA 2XRAL 1C12A 4LNVA 3ULUE 5GRJH 1BZQK 4JO3L 4XP4H 2CGRH 2FCBA 1YN6A 1J0ZA 3SDXF 1XGTB 4PRHE 5ACLA 1KIRA 1DLFH 2FSEB 3HC0B 4QRSA 4H1LH 3WFDL 1LO5B 1U3YA 3KPSA 4AH2B 1MIML 5IFHL 2AJZB 2FECI 2EECA 1AJ7L 3IDIA 3DMMD 1OAKH 3U7WL 5BQ7B 5D2LE 3OKKA 2NW3B 3ZE2F 4LSUL 4Q0XL 2QKIB 1A22B 3RHWF 4KRPC 1RZGB 2VL5A 1FZJA 2OJEA 4GKNA 5JXAL 1A6TB 3BQUA 2DD8H 4HEME 3GI8H 3IFNH 5E9DD 4YHLL 4NQXA 1I9RH 2NY4B 3F12A 4ZFZB 1C1EL 2WBJD 4APQB 5EN2A 3RHWK 5TDPB 1G7HB 4QHKJ 4M7LT 4M1CC 5ITFB 4X99B 4KY1L 4FXGB 6FABL 3D18A 4HKXA 4M7LH 1S7SA 5DEZA 4G6KL 4G5ZL 4PRHB 4ODXA 1TVHA 4EZMA 3K74B 3C09C 2EZ0D 5ICYA 4YDJB 5TF1H 5I8KL 1SEQH 4J2XA 5ANMA 5C1MB 3FFDB 1YQVL 4XCFL 3LRGA 5CEXA 4CJ1A 2OSLA 4QGYA 3VXOB 3KNBA 4M7KH 3A6CL 4XVTH 5D2LB 3VRJA 3HNSL 1D9KD 4G8IB 3TBTA 2JJTC 2IG2L 2YWZA 3LEVL 5D70L 5DD0H 1TZGL 2A0LD 3MRJA 3QUZB 2BNRB 4XVJL 3BP7B 3SGEI 1M7XA 3V4VH 3WJLC 4JFDB 5JOFB 1KOAA 4JREB 4MD4A 4PJ7A 3JTSB 4NRYA 2DQUH 1G7IB 1UJ3A 3V52L 4GW5B 4IMKA 1YPZA 2XTJE 3MRCA 2HKFH 2VQTA 3BUYA 4N9GB 4PBVC 1OCWL 1MI5B 5C3LD 2NW2A 2DM7A 1FL6B 5C0DB 2VKXA 3PL6B 5HDOA 2XWBB 5FECB 1U8IA 1X44A 1QRND 1DR9A 1M05A 2ENYA 3LS4L 3P30H 3SBWC 4E5XA 1MRFL 1NCCL 5CZKA 4DZ8B 1R0AL 1T0PB 3GRWL 5E5MA 2ED9A 2BY0A 4R0LC 1CQYA 4FQJL 5C0JB 2EYSB 4XWOD 1MFBH 1YEIL 4WFGD 4RCAA 4GAJL 4XP5H 4MJIA 3BH9A 3L95B 4LAQL 3D48R 4AM0A 4H20L 4FQXD 4Z76A 2EDRA 4X80L 1BZ7A 4WVRA 3W0WA 1ZA6B 3KPTA 1ED3B 1T7WA 3AROA 3EO0B 5FDWA 3V95A 1F5WA 3SO3C 1BFTA 5EBGA 3OAYK 5CP3A 4RX4D 5CP7B 4KV5F 4R2GB 3ARDC 3TFKD 1BZ9B 1HINH 2XTJB 3DXAA 3GJFH 1D6EA 1ZGLP 1INQA 2WM0A 4UINH 5ESAB 1TZHB 3SCMA 4ACPA 3ZDXE 1AXTH 3D3VA 1H3WM 1G6RB 2EDHA 1IZJA 1JYVA 1K2DB 2HN7A 3GMLB 4ONOA 3IGAA 3OJMB 4M3JA 3EBAA 1QLRA 5CILH 1KCUL 1HHIA 4ZFFA 3BAEL 3GSXB 1G1CA 2AEQH 2NLJA 2WQRA 4Y5VC 3UROR 1OLZA 4P4RA 4I18A 4KI5F 4D0CB 1YY9D 4PRDB 2YUXA 5IP4A 1P4BH 2PNDA 4PP1D 3DROB 3X14B 2CIIA 4ZAKC 4WJ5A 5C92A 2XZAL 4A2MA 4IDJH 2DJSA 4PB9L 2NX5E 3WHE0 5D1ZA 2DJ4A 4OF0A 5L2KD 1L9NA 4KI1A 4JHWL 1Y0LB 3IAQA 2ZWLT 4LSVH 5KSAA 3SDXE 4KRLB 3ARGC 3MREB 1J0YA 2XG5A 3SDAC 2AKRB 5DJ2A 4HG4J 3P2TA 5GZND 1ZHBA 4NQEA 3T4AB 4C58B 3VD3A 3FFCD 4NO3B 4P59H 4BYHA 2UWEF 4YBLB 1Q0YH 5B38B 4HCRA 4GMSL 2FHFA 2MHAA 3ZE2E 1XF3B 2YD1A 4PRIE 1MVFA 4MNHA 2FD6L 1S9WA 1C5BH 1TJHL 4LLVB 4OV6F 1X5GA 4M9PA 3F7VB 4M48H 1P5UA 3V6FB 1S3KH 2QHRH 4Q6IB 4XCYA 3A6BL 3DECA 2IH1B 3H42H 2DBJA 1Q8MA 3MRIA 4NT6A 4RQQB 4DKEL 3FQUA 3OAYH 1D5MB 5CKAA 3VXSA 4UQ3A 2N7BA 1RPQA 4IBLT 4L29B 5JPMB 2NX5B 2Z93A 1XCTA 1KIPA 1MCNA 2EDBA 1CLYL 3QDGE 2EYTA 4NN6C 3V7AE 3B3IB 3KPNB 1BLNA 3DBXA 2YXMA 1IGML 1SJHB 5DLMH 1D5IL 3SDXB 1B0GB 3BW9B 2JK5A 4JLRB 4I5BB 3FKUS 4OGZA 3O3DA 3UJJL 3QRGL 5I1HH 5I16B 1OTSD 4MA1B 5C0CE 3C9NB 3DSNA 1DBML 3JV0A 1U3HA 1JNNL 4U0QB 2ZNXA 4ODUB 4WHDA 4P57A 5J06A 4IS6B 3X12A 43CAA 5FYKL 1NBYB 4LEXL 1OM3H 3D85D 3PGCB 4PRIB 2VABA 4HZAA 3VGAB 3PWJB 3I6LD 4B5EA 4HLJA 2ZJSL 1F2XK 1S9YA 1IC4L 3J7HA 3D69A 2VNCA 3HPJA 4MXVF 2CIKB 5ADPH 4X6CF 5BVJA 3QXDA 2Q8BL 4G6FB 1NSNL 3WJJC 1UB5A 1KPRB 4BQBA 2XPGB 1MHPH 5IBTH 4JFOB 4YR6A 3QDGB 3V2AR 2P8LB 4IRZL 4HGWB 1RAMA 3ZMRA 5CSGA 3BXNA 4HHAA 3NZHL 4FRWA 4ZUUB 3MUJA 1Z2KA 5C0CB 3VXPA 4BZ2L 5ITBL 2Y5EA 5DYOB 3HE6B 1G9NL 1LDSA 1L7TL 1LP9A 3TVMB 3NABH 4DTGH 4XI5D 3WHXB 3OHXB 4O4YH 1AXIB 1HYRC 4L4VA 3VFOA 4U6VH 1F11A 2R69L 3BPNB 4CU7A 1P84K 3QCUL 5I1KL 4KV5E 1TVDA 2XICA 4F57H 3EZJB 3EOAB 4D0BB 1N64H 1JPSL 1MFCL 2ATPA 3RU8L 3BRGC 5DJXB 1U8OA 3E8UL 2MCG1 4WWKA 1G7JA 1DL7L 4M5YH 1MJ8H 3TNNB 2NXYD 2APWA 4P5KB 5T3ZL 5DMGD 2C4FU 3HS0A 4KQ4H 2JELL 2UUDH 2Y23A 4HUWA 4DVRH 2ZCLH 1JNLH 1DUYA 1I1YB 3VCLB 4JRWA 1NL0H 5LGJB 3FO9A 3CMGA 4POUB 3RQ3A 2VYRE 4U4BA 3E1F1 4KI5E 1EZVX 3WFBH 3U30B 3QJHA 3WCYA 1DVFA 3CIQA 1E27A 5K9KB 4Y4FA 3WO4B 1KJVB 4R9HA 1NMAH 1KG0A 2CK2A 5CIPA 3QPXH 3EHBD 4LLYB 1H3GA 2YK1H 2C1PA 1H3XA 4OM1H 2QQNH 3HI6H 4APQD 5E2WH 4QRPA 4YFEA 3D87B 3MQIA 3IKKA 1VKXB 4YFLI 4HJGB 3ULUD 5L2JA 4GAYA 3IDMA 1HNGA 1YY8B 1LO3L 4CMHB 2VXSH 1GGUA 3F7YB 1GCFA 1MIEL 3RX7A 1CFTB 1ZVYA 2XWTA 5B39B 3ROLB 3HB3C 3QHFL 4HC1A 2VRAA 2UWEE 1NAMA 5E6YA 2APBA 5AG9A 3NCFB 4WEUD 2AXGB 4FFVC 5DWUL 4Y89A 4P2OD 4TUJA 3VWKA 1E4WH 3V0WL 3AS0A 3GK8H 5E70A 3C5ZB 2RBLA 3U7YH 4AL8L 1R3LB 2YPLA 4FQ1H 2DQCL 1FFOB 1RZKH 2MQ3A 1BECA 1OWWA 2Q20A 4J1UA 4CGTA 3IJHB 2NY5H 1XF5B 3ARBA 4PUBL 2M26A 2XTLA 1CD1B 5DJZB 2HMIC 2WK2A 1MFNA 3EYVA 3PL6D 4GKOA 3TBWA 5D9SB 5JDJA 2BVOA 4YHML 5L6YL 4MQXD 4Q74A 5GS1A 4J7RA 3DVNB 4IJ3C 3HRZB 4Q9CA 2EIEA 4HWUA 1AE6L 3WNLA 3GSNA 1AKJD 5DUML 4JG1L 4POYA 3M45A 3VD4A 5ALCH 2UWEB 3UTSE 1O5DT 3DO3A 5HDLA 5BO1L 4NRXA 1QA9A 1Q38A 3ELAT 1P1ZA 4NDMA 3EJZD 1INEH 3U4AA 3WXVL 3FQRA 1VFAB 3QEGH 1E4XL 3QCTL 3UJIL 3C08H 2AABH 3ISWA 3DOSA 5GS2H 4MXVE 1TPXC 4X6CE 4GG6A 3BPCA 5DJAA 5F7HA 1ZT1B 3L5JA 1LO2H 3EYOB 4Z7VA 4XNUL 3B9KB 1LQSR 1JJUA 3V8OA 1LEKB 1UM6H 5B38G 4Q9RH 2XFXA 3BEVA 2F19L 1T03L 3MLPA 1Z0NA 4L1DA 5HD8D 3NZ8A 2X4SB 2FH8A 1S7TB 4PTUB 3QI9B 4GW1A 4X6EB 3N06B 1MJJB 2WQ8A 2PYFB 1NGXA 5E08H 2DOCA 3UXFA 3UTSB 1P53A 1DQDH 4JKPL 1OP9A 1KPVB 1XR9B 4A2LA 1ZT4B 1J8HE 1KCRH 1CXEA 2R2EB 1YJDH 4NKIH 5EWIL 5EZOL 2Z4QA 1WWCA 4WUUA 4TSCL 5KS9F 1F4WL 3U0TA 1WGOA 4C56E 3BZFA 3PP4H 1T5XB 4X6CB 1ZHKA 2ZUSA 1AQKL 1CE1H 3AS1A 1MFEL 3QDJA 1ACYH 3QUXD 3O6KL 4NZDA 3VXMA 1KIQB 5CSBA 1PYWA 3HR5A 3O8XA 5EUOF 1FZKB 4Y5XC 4TVPL 1B0RA 2YRLA 3RKPA 1Q9KB 3MCLL 4JANA 5A16B 1N5YH 4IDLA 5I66A 4KTDH 1N0XL 4M7ZC 5IW6B 1DQLL 5C0BD 5GS0L 2FLRT 4OTXH 4QHKI 5ISZB 4IOFC 3RVVD 4NQVA 3VWJA 4X98B 2X9WA 2H2PD 4NN5B 4YO0A 3V7AG 4WI6A 2ILLA 4IRSA 3TA3C 2YBRA 4C56B 4DZBB 1JPGA 5C0GB 4Z5RA 4PY7B 1PY4A 1LO4H 1CGXA 1AD0B 2MKWA 5BRZE 4HJ0D 2Y36H 5CBAB 2D4DA 4ZUTA 4WGWB 3QUMH 5DZNA 5C0FB 2PF6A 2B2XH 4Y4KC 4ETQA 3BPOB 3CH1B 1RHHA 3HMWH 5ICXB 1FIGL 4R8WH 5FA4B 4MB3A 4OV5A 4CUCA 1HEZA 1CF8L 1G7LA 1R5VB 3PUCA 5FOBA 4F37F 1YNKH 4P4KB 3C6LA 1FP5A 1XGQA 3KWWA 2VXVL 1EEZA 4G43A 1CK0H 3IU3B 1KFAL 3AMKA 4HDIA 4JFHD 2EH7H 3RNKA 5IQ7L 3QQ9D 2NY6C 2NY1D 3QPQC 5TE6H 5L0QB 4M8QA 5EOTA 1QNZL 5EUKB 1Z5LA 5GGRB 3WIFB 1UWEH 5BW7C 2VLLA 1S9VB 3HLAA 1JF1B 5JDSB 4KUZL 1HKLL 1TETL 1FL3A 3KYKL 5BRZB 3HI1B 1MCJA 1FVDA 4NKOB 1BJMA 4X9IA 1RI8A 2R0WH 1RZ8A 3BE1H 3KPPB 2X4OA 5BCAA 5F6HJ 2HKHH 4JKMA 2JIXA 1QYGL 3B4NA 5I15L 3RY6C 1JV5B 1K4CB 1FRGH 3OKDB 3MLTA 2E9JA 3GHBL 1FSKB 4H25B 4XVSH 1JWUA 1QD0A 2NCMA 3QRFM 4ENED 1UQSA 4LLMA 1IL1A 4N90D 1FNEA 3UCRA 2DJUA 2HH0L 1ZWIA 4UU9B 3Q1SL 5FV1L 2Z31A 3BKCL 4U6XB 5F89A 4AIZB 4ZPTB 5HSFA 3NA9H 4NO5B 2VUYA 3T1FA 1WBZB 4O9HL 5ICZA 3FQNA 4YUEL 3X3GH 3MV01 3CVHB 5HHNA 5HHOB 3FJTA 2VWEE 1PAMA 5B39G 2J8UA 3D0LA 2VN4A 3R06B 4S1QH 3IETB 1QTYT 4G8EB 4RRPG 4X9FA 1A4JA 5C07E 3U6RA 1JZ3A 4ZG1A 5BOZG 3MJ9L 5CEZL 1FV1B 4PJAF 2X70B 3GBLA 5MEQB 4ZPVA 4M00A 2N1KA 1O0VA 4ZD3H 1JUFB 4XPBL 1EJOL 3CFIC 1CL7H 3FMGH 1BD2B 1WT5A 2AGJH 3OGCA 3M07A 8FABB 4M9OA 5IQ9A 4F8TA 4P2QD 3DETD 4HS6A 2J8OA 3WLBB 1J5OL 1MHEB 4G8FA 3WN5A 5DI8A 1RD6A 1WF5A 5KS9E 1L7IH 4P5MB 3OZ9H 4KK8C 4LEOA 5J12C 4ZQKB 4M3KB 4X4XA 2BDNL 3LS5L 4P23B 4A6YB 3DVIA 4M03A 5F71A 1BEYL 1E28A 1MLCA 1ND0A 4KVCH 2H26A 2IJ0C 1HK6A 1CBVL 5EUOE 1EVTC 5C09A 5EBLA 3MV7A 1N59A 1H3UA 3U9UB 3AM8A 4RFEB 3EYFA 5I1DB 4GRWH 3ZHDA 5D7JB 5C07B 1HI6B 2BSSB 2P8PA 3GMNA 1DE4B 1WC7B 4J3OC 3KLAA 4L9LB 1RY7B 2ARJB 2DTSA 1BGXH 5AZ2H 3O2DH 1CTNA 3VGGA 1CVSC 1EEYB 4HV8A 3ZHLA 5HVHC 4GAGL 3TT1H 1FNAA 3WSQL 3HMXH 4DFIA 5J6HA 3DYOA 5E2VL 3VMNA 1Q0XH 4KI5D 3R0NA 5CJ8A 1ONQA 2UZYB 3ARFB 1IBGL 3LQZB 1MWAA 2X4RB 4K8RD 1CXHA 2QQKH 3RA7H 5KS9B 5JMRA 5KVEH 4WI2A 1RMFH 3QXAA 1DEDA 4JHAH 2Q3ZA 3BKYH 2B1HH 1AHWC 1I8KB 1MAMH 2H1PH 2BNUA 4GRMB 3LKRB 1GGCH 1NBQA 3K2UH 2EH8L 3UJTH 4N8CL 4JFYA 5DEFA 5FHAH 5J3HC 4PJHA 4TTDC 1FO0A 3FB8A 1A9EB 4OD3H 4X7FC 5EUOB 5FCUH 1S7VA 3JWOC 4U33A 1X4XA 5CHNB 3RY4A 4ODSL 1XEDA 4G6AD 1IAMA 5F7UA 4I0PD 3B6SA 2XG4A 4UZGA 3T4YB 1MUJB 1F97A 2K1MA 2BK8A 1WZ1L 4PRAA 3FHQA 1UA6L 1RULH 2Z8WC 1C5DA 1ZA3A 5KVGH 3F6LA 4XCEB 3N50A 3QDME 4KRPB 4OF3A 2I9TA 2XWJA 2CDGB 3I75A 4HPYL 1NGWB 1KN2L 1BVKB 4JJ5A 4EUPA 3NTCL 2CD0A 1JP5A 4FQLH 1D5XB 1S5IH 4GKSA 1ZANH 3M1BA 1JGVH 3THMH 1G7MA 1XIWA 1B6UA 5I8CA 3PABA 3P4OB 1C5CH 5L9DH 4PRBA 4J6RH 3HAEA 5IMMB 1NLBH 5AAMA 4C59B 5D1QC 5F1OB 5BV7H 2PR4H 5FYJE 3RWHA 3D0VA 4MJ4A 1E6OL 1BMGA 1X6NA 3EO1B 4JZJC 4NQCB 1JIBA 3GSUB 1MCDA 4GT7A 1YA5A 5FXCH 2X89D 4G7VH 5DDHA 5H37H 3LMJL 3WXWL 4LGSB 2EDXA 5E4EC 1O7SA 3LN4A 3QQ3B 1YEJL 1KCKA 4GOSA 3MBEA 3V4PH 4PTTB 4OKVA 4K7PX 4YDVA 2FNBA 4YK4B 5DVLA 2FBJH 3WUZA 4UT7H 4RGOL 4MMXC 4BSWA 3QDMB 4RAUB 5HYQA 1FLRH 2J6EL 1TJIH 3VFMA 1F4XL 3UTSD 3ZYZA 5KG9B 1CN4A 4X0KA 3TO2B 5B8CB 1Q72L 4CDGC 3IKCB 5KSUB 2FHBA 1L6ZA 1IEBA 3B2UC 3WFCL 4ZS7H 4OGXH 3SDYH 5SX4H 4NM4L 5T3XH 4PGEA 1KTRL 2LTQB 4U0RB 2EIZA 5F7FA 4G9FE 4BKLB 3U82B 3EUUA 2HLAA 3HC4H 2WANA 5DRZB 2JCCF 2YPVH 3ULSA 5FA3A 1A2YB 5E8DH 4PJAE 1EBPA 3AREA 4FQIH 3W11D 5IGXH 4ZFGH 1CICC 4OZGF 3STZA 4MX7B 3GO1H 5EO9B 1RU9H 5IB5A 3BP4A 4B50A 3RGVC 1I4FA 4MQSB 3EKCA 2VZ3A 4U31A 4HQQH 4P3DA 1L6XA 3QXTA 5D1XC 3RFZC 4ISVA 3AVEA 3ARDB 1M7IA 3DO7B 5F7WC 4OGAD 1J8HD 1IGJB 1FPTH 4Z7UA 4FQQA 1A6UL 3JBG7 5D2NC 4YHOH 4K7FA 3Q3GA 5H35A 2FGZA 3MRKB 1MF2L 3DSFL 5TQ2H 5I1LA 1UT9A 1X6LA 3S5LA 2V2XB 3IJYA 3RDTB 3OKMB 3WNNA 5IR1B 3VXNB 3G5ZB 2HFTA 1JVKA 3P0VL 4X9GA 3D2UB 3U2SA 3BKML 2CUHA 5FUOH 1OQXA 3K2MC 4PJAB 1UC6A 3SPVB 4U1IA 1Q94B 3PHQA 3PQYB 1PG7L 5T3XE 4K3DH 2AJYL 2H2SD 5E8PB 3MLSH 1A3LL 4BELD 5IIEA 5AYQA 1A6ZB 3BDYL 1UVQB 1A7OL 4LLQB 3O9WC 2Z91A 4K9EL 2NQCA 4OLWH 4MD0A 3SO5A 1PKOA 3VFUA 4HUKB 2GY7B 4MDIB 1OAYH 3V4UH 4LBEB 3WE6B 1G9NC 5A40E 1OY3B 2G60H 1TVBB 1IEHA 3E6FB 4V2CB 1YMMD 2CRMA 2GJ6D 3ARGB 2J88H 3SDAB 3QWOB 5ESQB 1GSMA 1MJUH 4I9WE 3LD8B 2OXHA 1ZLSH 4PLNC 4URTB 5IKCB 5DMKB 1VFOA 1NGQL 4JO1H 1EO5A 1AFVH 3NCJL 5I1CL 3H0TA 2UY6A 3QIBD 4PLKD 4MCYB 4XMKH 2BJML 1ACZA 5MEPA 4AIOA 3BN9C 4G7YH 3S88L 5J6GA 3QNYA 4YHIB 3TN0C 3I2CL 3WUWG 2BFVL 4DN4H 5DC4B 5CJOH 5GRWA 1GRWA 1K6QL 3C5SA 5DUPL 1VFBB 1IM9A 4PRPE 2DI8A 3U0WL 2NY2C 4YXKL 3HE7A 3OR7A 4JFFA 4R4FL 1HOCA 5TFSH 2BSTB 4ELMA 4BFIB 1IC1A 1HDMA 3GMMA 1G0XA 5D7LA 4OZFH 4EVNA 1SHMA 4CDHA 3BZDA 5T5NF 5TE4L 4WV1A 2X4NB 2XQYK 4OT1L 1GZQB 2Q86B 4KJQD 5MENE 3NFNB 4BM7A 4NZRH 2R4SH 3EDDA 3H2WA 3VH8A 4JZOB 3IDUA 3FB7B 5C08A 5C8JA 1M7DA 4TULL 4MD5B 1ZVSA 5EU4B 4PJ9C 2QTEA 1VGKA 4N9OB 1K8IA 2ORBH 4PRPB 4QRUB 1UKTA 4TQEH 5IEKB 3P9MB 3PWPD 1ES0B 1H5BB 1KLGB 3SE8H 4NZUH 2YR3A 4PY8J 4YHNB 3ZSTA 3OR6B 2AK1L 2JCCE 5I1AB 4NUGL 1HQ4B 4GSDL 4KHXH 3WS3B 4OUOA 2A1WL 4UDTB 4RAVB 4O5LH 1IVLA 4OZGE 2ZPKL 4QHUB 5DFVC 5DMIH 1MQKH 5FO7B 3X17A 5C9JA 4NFCA 2R8SL 3DX6B 2GSIB 2RQ8A 4JY6B 4HXBL 3CFCL 1IKNC 4DGVH 2VLRE 1CU4H 1RZ7H 5E6ID 5MENB 3RKDD 5HYFA 4W4OA 1AIFA 1PVHA 2R15A 4KVNL 1YEGL 2VXQH 5KN5B 3DV4B 1ZMYA 1I3GH 2HJLB 2XA3A 4Y16C 1OB1B 2IQ9L 3GI9H 1VFMA 1E4XI 3BI9X 5K93A 2J5LC 1S7UB 4R3SB 3TBYA 3DV6A 3OQ3B 3S96A 5JW4M 4X4ZA 1CGSL 1FORL 2JCCB 2R0KL 3PDOA 5SV4A 5C9KA 2I9LA 3T0EA 2UZIL 3WFHB 4JGJA 4OZGB 1HH9B 4PD4J 1BWMA 3HI5H 5TE7H 7CGTA 2P46B 2A38A 1W8OA 4OSUH 2VDOH 5F7NC 5L8KB 5DZOA 4LQFL 1KIRB 2H8PA 4PGJA 3C60C 2VAAA 2HYMA 5F3BA 5LJYH 2XZQL 4ZSOE 4PJ8D 1T0NA 4U1MB 3RZCA 3D39E 1WEJH 2JJUA 3TBSB 4QLRA 4RA0C 1OARH 4XBGA 3MA7A 4RZCA 1SJXA 3NIFF 3SDCA 5IOPB 3LPGA 5F6HI 1GJIA 5CSZB 3NACL 4ODVH 4HIIB 4M1CD 3O6LH 1PJ9A 1KCVL 1BAFH 1IGIL 4CMMA 3BQUB 5DMJB 1K85A 5AD0A 4MNGA 4UT9H 1CQKA 3K80A 1DN0A 4CVWA 4NCDA 2LU3A 3OB0K 5DTFB 5E9DA 1P6AB 2Y72A 3P0GB 3VFTB 2AJVL 3UTQA 4BSVA 1ZV5A 4OFDA 3QHTC 1A7NH 4KZEH 1N5AB 4K3EL 4YBHA 5KANI 1W72H 4WFFE 1UXSA 2OL3A 4M6MH 5IROC 3SDDB 4IIQC 4XNYL 5LWYH 2QQLH 2EDLA 5FGCE 2VE6B 1OTUC 4QOKA 3AUVA 3L6FB 2DQIL 4HKZB 2OTUB 4ZSOB 3EYSL 4QTIL 1A4KB 4LKCB 3MRMA 1T1ZB 4XMLL 2ESVE 1XGRA 4HKBA 4GG8A 4NPYA 1B88A 3KJ4B 2KL6A 2IBZX 4HGMA 1OP5H 5IG7A 3QG7H 3WKML 2XXMB 3MRJB 4FA8A 1D9KA 5D93C 5DD1H 1NCNA 3RTQC 1ADQH 3AS2A 1KJ2L 1DSFH 3C8KA 2W0FA 4QXUL 4X7SH 4XC1L 1MPAL 2GFBB 3DVGB 4L8CA 3MODH 4Q58C 1JGEA 3MRCB 4G8GA 2HFGH 5JPNA 2CLVA 4KK5C 1CR9H 4I48B 2DF3A 3HZMB 5CJXC 5CEYA 5CCKL 3P4MA 4F3FA 2DIJA 5T1MB 3BVNA 1EX0A 4PG2A 1QRNA 4NZTL 5FGCB 4HH9A 3MV11 4IOIA 3U36B 1DQJB 2ZCHL 4KJYB 1A6VL 3ARDD 4JPWH 2E8ZA 4LVOC 4UIKL 2F54A 1I1AB 2ESVB 4AM0B 4QY8A 2Y4SA 3VG9B 1NCDL 4Z7OF 2R29L 5SV3A 2IADB 3MZTA 4HG4K 4FQXA 3EJJX 3P4LA 4JCMA 2VR9A 3W0WB 1RFDL 3CFDB 1Q9OA 3U1SL 1OAZL 5D7IA 4J3SA 4OFVA 1FNLA 3FAXA 4G9FD 2ADGA 3WDHA 1N6UA 3D2UD 3N9GH 1ZHLB 2HLFC 2RCSH 5GGSB 4RX4A 3RWEB 1UYWH 4WU7B 2Y6SC 5EA0L 5DHVB 4JAMB 2AERT 5DC0A 5F7LB 1HQRB 2B0SH 3OB8A 1IGTA 5CJBA 1D5BB 1FH5H 1NMBH 5J11B 2PXYC 4LSRL 2R0LH 5KVDL 4UV7H 2ZUWA 1YYLL 1NBVL 3FN0L 4K3JL 4GLRI 2OX5A 4YGVB 4ZAKD 3RBSA 2AK4D 1QLRB 4HPOH 2AQ1A 1HHIB 5EU3A 4EEEA 4ZFFB 2CJUH 1MCHA 2AXJA 2BXYA 1ZVHA 3EYQC 5GGUB 4JDZA 3HZKA 1RZFL 2PKDA 4Y5XB 2AQ2A 2IF7A 4FFYL 3RX5A 3SDAD 3JTTB 2EC9T 3O6FC 3QG6B 5EC1A 5GRUL 3HR6A 1NJ9A 2KQMA 3VRIA 3SKNA 1CT8B 3DX7A 4WTZG 4TNWK 5E0QA 2IH3A 4WJ5B 1F8TH 5GRJL 2E6JA 4XP4L 2BSRA 2CGRL 5IF0B 3TPUA 4IRJC 3S3PA 5L2KA 1DLFL 1JFQH 3MV9D 4I1NB 5T3XD 4JKKA 4CBPA 3FOLB 5FM5O 2ITDA 3FB6A 2YEZB 2H32B 4PB0H 5IFAH 2CO7B 4S1DC 3I6GA 5CMAB 1OAKL 3NIFE 3DTXB 32C2B 2VXUH 1T3FB 1QR1A 5T5FH 3QEQA 3I3BA 5GJTH 4QRRA 3QIUA 2P44B 1YN7A 2D0HA 4NN7B 4HMCA 5HHVH 3DGGB 1IGFH 2DD8L 3FOMB 1XGPB 1YNLH 4LPTA 4P2RD 4DQOH 4L4TD 5DURD 1K5NA 3GI8L 2BNQA 3IFNL 1I9RL 3QO1A 1ULVA 4Y0GA 2GTZB 1JK8B 4LCYA 2PO6C 4NT6B 2WWKT 5J4MA 2BHUA 3U4EB 1DUZB 4HWBH 3VXSB 4JDVA 3ZLQC 4TUKH 4M7LL 5SWZE 1T22A 1G9MC 4O2FA 1YQ2A 3TH2T 4JFEE 1HXYB 3RWGB 1SEQL 2CXKA 1A8JH 2X6MA 5EFIB 2C3WA 2VZ1A 5F1NA 1TZIA 4JFZH 1WWWX 3RUGF 3OJ2C 4M7KL 1WTLA 2EYRA 4R4BB 4XVTL 5KBNC 4CU8A 2IFFH 1QFUH 5DD0L 3MYJB 2F74B 3OX8B 4PGZA 1U58B 4PRPD 4MCZA 5IW1A 4PJBA 4LLDB 4XCNB 5KSVB 3V4VL 4NWTH 3RIAF 5EU5A 2BRRH 3DYMA 2DQUL 4JDTH 3KPQB 4NBZB 5JA8B 2W60A 5J13C 4BJLA 1NBZB 1IC5H 2HKFL 2ATKA 3HPJB 1R24A 2YA2A 5IMOB 3STLB 3ZKMC 4O2EB 3OF6D 3HPLB 5D8JH 5MI0B 5FUCC 3ZTJG 4YE4H 3P30L 4KROD 4PR5B 3JWOH 2AEIT 2CR6A 3G08A 5SWZB 4MXWH 2FJHB 2OMNA 2IAMC 4JFEB 1MFBL 3KLSA 5MEND 3T2QA 3BXNB 5IBLC 4XP5L 3RWJB 4ZUSA 4NNYA 1ORSB 4UIMA 4X6DF 3UDWC 3VJ6A 2YXFA 4Z7OE 4MNQB 1U8MA 4LLWA 1OF2B 4GW4B 4JPIB 4JQXC 4H8WH 1SJEB 4L4VB 1U8HA 1TTGA 4MZ2A 5FUZH 1F11B 4YDIH 2I26N 2QSCH 1IQDA 4RGMB 1GL4B 4QT5B 4YLQT 4RSVA 2O61B 2FWOB 4JM2F 1HINL 2E7LA 4L8SC 3UP1A 1NFIA 1QUNA 3TGXA 1D5ZA 5ESVA 4UINL 3VFVA 5HHME 1RV6X 1AXTL 4YNYB 5IWLC 1KC5H 3CAFA 2IMMA 4P0DA 1EPFA 4I3SH 2Y7QB 4GBXC 1A5FH 2YUVA 5I6XB 1XGTA 1UJ3C 2VLRD 1KCSH 3MGTB 3HC0A 2FSEA 4IMKC 5CILL 5JIIA 1A6WH 1LO5A 2AEQL 4AH2A 4HS8H 2AJZA 2NY3B 5EOCH 4NOBA 1HSAB 4U3XA 3OPZH 5BQ7A 1P4BL 2NW3A 2QKIA 3P0YH 4XNZB 4P46D 3L1OH 5TGBA 2YS4A 2RGSA 1RZGA 3L3GB 3MUHL 4LQ1A 4IDJL 3HB3D 1A6TA 3NGBC 1ZHNB 5DZLA 3SY0B 4JB9H 1KJMB 4LSVL 4X4MA 4FFVD 4OQTA 4ZFZA 4KGLA 5JXEC 3T0VA 5EZIH 4APQA 4YJZL 2X4TB 5CJQH 3S37X 3DWTA 1ZGLM 3IDMB 3HNVH 1F2QA 1DEEB 3AB0C 1ZXQA 5ITFA 4X99A 1WJ3A 2BC4B 4FXGA 4P59L 2XWTB 5BXFB 4PRHA 1Q0YL 3I9GH 4P9MH 4HH8A 2XQYG 3D39D 4XX1E 5I75B 3FFDA 1C5BL 3GMOA 4PJCF 2HMID 2OTWB 3SGDI 4G9DB 3VXOA 4E42B 4P2OA 1S3KL 1T20B 2QHRL 5D2LA 2AXFA 5T5NG 2ICEB 4R97C 3H42L 2VLJE 1J05B 4CJ0A 2FIKB 3QUZA 2JE8A 3BP7A 3IB4A 4JFDA 4P3WA 2EZ0C 3JTSA 2ADIB 1G7IA 3JSSA 4I18C 1J0JA 4GW5A 2BSED 4WEBH 5DLML 3RJDA 2ZCKH 4JO4H 3MRFB 2RIKA 1NKOA 2DQEH 1FL6A 2NTSP 5C0DA 4F33B 3PL6A 5I1HL 5FECA 2CMRH 1H8OA 5GSRB 1PD6A 3H3PH 3EAKA 4M8VA 1QVOB 3RUGE 1EHXA 4DZ8A 4PY8I 2NXZB 1RJYB 1RVFH 3TIDB 5C0JA 2EYSA 5KSAC 1OM3L 2ESVD 4K9EC 3HN3A 4WI3A 3MNZA 4NRXB 3HG1D 2X05A 3FO2A 1NDMB 2R0ZH 1EGJH 1ZA6A 3Q6FB 1ED3A 5ADPL 3CFKB 3EO0A 2VLJB 3NCYS 5K9OA 1PEZA 1YEHH 3ARYA 1CLCA 3RGHA 2QADC 2QBWA 4MMZC 3SKMB 5CP7A 5D7KD 2VDMH 5IBTL 2X1XR 5DK3A 1MQ8A 2VC2L 3INUH 1NCWH 4GS7B 2D7PA 1J9CT 5FYKE 3LRSB 5ESAA 1BIIA 3VXTA 1TZHA 1ZLVK 3REVB 5IEHB 4MLIA 1U8KB 4QRQB 4OCNC 1G6RA 5JW3H 1XGYH 1I85A 4X6DE 3RUGB 4GW1B 4PJ5E 1K2DA 3Q5TA 3GMLA 3NABL 4NKMB 4W6XB 3WL9B 4DTGL 4EXPX 2EE2A 4O4YL 1CGUA 3BSZH 5HGDB 1YEDB 1KPUB 3C8DA 4U6VL 5JW5B 4GXVH 4XBEH 2W1NA 1F58H 1F6FB 1DBKH 2Z4QB 4D0CA 4F57L 4LARH 4PRDA 4K94C 4JY4B 1N64L 5HYEA 1QG3A 3B9DA 3DROA 3K8KA 4ONGH 3RP1A 4JR9H 3IAPA 1HN1A 5IFJB 2Q3AA 4M5YL 1MJ8L 3F65A 3T0XA 1Y0LA 2ZUYA 4IOFD 2XZCH 2H9GB 1B0RB 2AV7B 4KQ4L 3CFBB 4DVRL 2ZCLL 2AKRA 1JNLL 3T65A 3TA3D 3MXWH 4X4YB 3T4AA 2VTFA 4JPKH 1CFNB 5I1EH 1NL0L 4NO3A 1QFHA 4X6DB 4PJ5B 4JRYE 3WFBL 5B38A 4Z77B 4GUPB 2QHLA 4F9LA 1XF3A 1BQSA 1NMAL 4Y4KD 3G6JF 4LLVA 3QPXL 2YK1L 2JB6B 3F7VA 2QQNL 3HI6L 4L3CB 4OM1L 5E2WL 2HFFB 2WZPD 3VXRE 4Q6IA 3T2PA 4XVUD 4JM2B 3SJVD 4U6HB 4WENB 2EEDA 2IH1A 1U91B 5T3ZE 2W38A 3L5WB 4RWYH 2VXSL 3BUTA 4G80B 2WIIB 1D5MA 1ZAGA 2FBOJ 5JPMA 4L29A 2NX5A 2BVTA 3GSQB 4RMVA 2IANE 5BOPA 1QEWB 3B3IA 3KPNA 2XQBH 2FL5B 2NY6D 2H3NB 1SJHA 3SDXA 1HILB 3QPQD 1U8PB 3BW9A 4JLRA 5IW3A 4I5BA 5L7XH 2R23B 1G0YR 1E4WL 5I16A 3C9NA 5F97E 4WWKC 3GK8L 4PJCE 1D6VH 4ODUA 2BVEA 3U7YL 1T89A 1V7NH 4IS6A 4GRLB 1XGQB 4JRYB 1NBYA 3N1QC 4G43B 4F58H 2C5DC 3PGCA 3ILPB 4PRIA 4OCSH 1RZKL 3SGEH 1WVZA 3NAAH 3PWJA 2NY5L 1BBDH 5EOTB 2HFEB 3WNOA 3TN0B 3V5DB 5ALBH 5DUBB 4GXUN 4Z0BH 4RBPK 1DVFC 4Y4FC 1J1XL 2C26A 2X4OB 1KPRA 4OLEA 2KH2B 4U3HA 1EHLH 2JIXB 3EDEA 4JFOA 3QDGA 2P8LA 2IANB 4EN3D 4HGWA 4ZS6C 4L8DA 3E3QC 5ALCL 4X5WB 3UBXI 3FQXB 1ZLWK 4J3UA 3IT8D 4ZUUA 4M6OH 1INEL 5C0CA 3GBMH 4EI5C 3QWRA 3TBVB 4TOYH 4PJCB 4MQTB 3QEGL 3HE6A 3TVMA 3C08L 2F9BT 3PWUA 2Z31B 3OHXA 4MVBC 1YEKH 3ALPA 1LO2L 2X4UB 4WFHD 4LPCA 2EDOA 3KXFE 3GMPB 2Q87A 1UM6L 4Q9RL 3EOAA 4FNLH 1QBAA 4D0BA 5BMFH 2KZ1B 2OZ4H 5A2LH 4DKFH 3MACH 4LKXB 5DJXA 5EBWB 2GKIA 1J0HA 1MREH 1GYAA 2A9NH 1UENA 1LEGB 4KK8D 3TZVB 1UM4H 1UADC 1EERB 3TNNA 4P5KA 1UH4A 3ARBC 5CWSB 2J7LA 2VZUA 3QDAA 1DQDL 1I8IB 1EFXD 4L3EE 4WI5A 1J11A 1KCRL 1MHCB 4MDJB 5BS0D 3VCLA 1YJDL 4NKIL 5LGJA 5GS1C 5HI3C 1G1YA 4PPTA 3TYGH 1HZHH 1NGZB 3QXVA 4WI4A 3CFJB 3PP4L 3ROOA 2R56H 2YC1B 5BJTA 4DGIL 5K9KA 1SY6A 4Y88A 1KJVA 2NXYC 3WFEH 5TH2B 2EO9A 1EK3A 1CE1L 1KB9J 3DGCR 1ACYL 1E28B 4LLYA 2H26B 1X5KA 1P4IH 1L0XA 3L5IA 4KXZI 5E00B 5HHMD 4XX1G 1NC4B 4LCCC 4UQ2B 1F4HA 1AC6A 1VKXA 2CPCA 4RBPH 1N5YL 4U1JB 2EKJA 4HZLB 1YY8A 3H9YA 2Z92B 5FYLH 5JHDE 4Y8DC 1CDIA 4KTDL 1AC0A 2HRPH 1CFTA 4BQCA 2P24B 5B39A 3ROLA 4K2UH 2YN3A 1S7XB 3EHBC 1P84J 3DVFA 1ZLWH 2ZSVB 5ELIA 4OTXL 1S7WB 4RRPA 2AXGA 5J3HD 4TTDD 4L3EB 4LRNH 4F7CB 1Q9WB 4ZO8A 4X5XB 4XNMB 4N0UE 4J23A 3MPCA 1XH3B 3C5ZA 4EOWH 3STBA 1R3LA 5GGTA 1AO7D 2W9LA 4GMTH 3QCVH 4TVPE 3IDNB 1LE5B 1U42A 2XN9D 2Y36L 1FFOA 3KPRE 3C60B 3QFJE 3QUML 3GSWA 2HT2D 2B2XL 3IJHA 1XF5A 1RUKH 3I6KB 2GIYA 4P2YA 4D9QE 5HHQB 3M17B 3HMWL 3FB8B 4R8WL 1CD1A 1S7VB 2P4AB 4WNQA 3QEUA 4ODHH 4A6YL 5D9SA 5D1QD 4PGCB 3E6HB 5J1AB 1C5DB 3DVNA 3HRZA 1YNKL 5JHDB 3V0VB 2MQ0A 1NANI 2ZUVA 3UTOA 3O8XC 2XWJB 4NO2B 2GHWB 1CK0L 4MS8D 2UWEA 3BP5B 2C4FT 2EH7L 5TE6L 3H9SD 2DTMH 1X4ZA 5JA9A 3G6JB 5KVFH 3ALWA 2DIBA 4N0UB 1VFAA 3HAEB 3W5MA 1UWEL 1U0QA 4OCYH 2VLJD 4TVSa 4IIQB 3TH4T 3PWLB 1EMTH 3GDBA 3BE1L 3KPRB 3EYOA 3QFJB 2HKHL 1WBXB 4M02A 3B9KA 5F1KC 4HKJA 1CD9B 3WHE1 3VWJC 5DVOA 3O3BB 5AWNH 1LEKA 4IRSC 1FRGL 5C0EA 3P77B 5EU7C 4XVSL 3B2UD 1LK3H 4I0KA 2DQGH 5E99H 1P9MA 3PP3K 4S1RH 4P99A 4XAKE 2X4SA 2YZ1A 3PGFH 1S7TA 4PTUA 3QI9A 3JV4B 3LDBB 1MJJA 2PYFA 1GC1C 3VFMB 4JQIH 1CYGA 3NA9L 4PS4H 5GRYA 3ZE1F 3V0AC 3GHEH 4LCUB 3UTSA 2AS5M 4O02H 1KPVA 2P5WD 1XR9A 3X3GL 1ZT4A 4EDXA 1EUUA 5DS8B 2J3SA 1CICD 1W8NA 2R2EA 1QR4A 5AEAA 1LD9B 2UV3A 1S9KC 1TNNA 4S1QL 3C6LC 3RGVD 1VADA 1I7UB 3KYMB 1T5XA 3BPLC 3OKEB 4X6CA 1KCLA 1VPOH 3NFSH 5D1XD 1QFWH 1F42A 4MAYB 2DLEA 3P73B 1YC7A 4QRTB 4E9LA 3ARWA 1KIQA 3R4DA 1FZKA 4ZD3L 5DGRA 5EIQA 2D7NA 2OP4H 1CL7L 4OCWH 3FMGL 1Q9KA 2AGJL 1G9MH 5MP6H 3VGBA 5JLZB 4W81A 3BP4B 2PCPA 2CKNA 4JO2H 5GHWH 1WQVT 4RFNB 1L7IL 4NSKB 3NPZB 3OZ9L 1S9XB 3VXUE 1T83A 5IW6A 3ZKXC 2RFXB 1IE5A 4KVCL 4X8JB 2EEAA 4X98A 1A3RH 1MHHB 4WO4C 4C56A 4DZBA 3O9WD 5C0GA 4PY7A 5I71C 1AD0A 4N5EC 1MCBA 2EDWA 5CBAA 4PV8B 1PX3A 1BGXL 5E56A 5AZ2L 3O2DL 3RPKA 4WFED 3WYRA 5C0FA 4NQSB 3CH1A 5ICXA 4HAGA 3TT1L 4LSTL 1UG9A 5FA4A 1EZVY 3HMXL 4DWHA 1GAFH 3O6FB 1R5VA 3PP3H 4HK3J 4OBRA 1Q0XL 5E94B 3IXAB 4CVXB 4HJ0C 1EIBA 4OIAA 1ZKAA 3RA7L 4ONHB 5KVEL 1RMFL 2HP4A 3VXUB 4LLUB 4PGDB 3IU3A 3SEPA 1VA9A 5F7YC 1WT5C 3QAZC 3BKYL 2B1HL 2H1PL 2B5IC 1MAML 1GGCL 2JJVA 3K2UL 3VXRD 3UJTL 2BOCA 5FHAL 3Q0HA 5EUKA 5FCUL 4OD3L 5GGRA 3WIFA 1S9VA 3IAGC 1JF1A 5JDSA 5IV2B 1RQ5A 5BRZA 3HI1A 4NKOA 4F9PA 1RULL 3KPPA 4X7DC 5KVGL 2A73B 1KLUB 1CFSB 2VJXA 4FTVE 1WFUA 2X09A 5MEPB 2NY2D 3QQ9C 3QIBA 2N56A 4BUHA 1JV5A 1K4CA 3OKDA 5EIIB 4AIXA 1S5IL 4H25A 1BVLB 1MLBB 3BD4A 1ZANL 1JGVL 3THML 3LRHA 2ERJB 5F7KC 4M1DH 3K0WA 3AM8C 3SHSA 1C5CL 5L9DL 3RY5A 2P48B 2PO6B 1NLBL 3QUYD 4QGTA 2PR4L 4UU9A 1LK2B 5HJ3B 4AIZA 4ZPTA 2XYCA 1L4IA 4NO5A 4Y4HC 1WBZA 1K3IA 3UPAA 4CL7A 4G7VL 1F13A 3CVHA 1DBAH 3FQTB 1H0DB 3MMEB 3P40A 1E0OB 1WWBX 2ZUQC 1YEFL 1AD9B 3R06A 3IETA 3V4PL 4G8EA 4PJ9D 2FBJL 4UT7L 1OL0A 1OAXH 3P9LB 2VOTA 2GK0B 1FV1A 1FLRL 3MROB 4FTVB 2X70A 2ARJQ 3QNZB 5MEQA 5FAAA 3WS6A 4B53A 1TJIL 5CP3H 4DOHE 1RUPH 1VGEH 2OK0H 3DI3B 3FN9A 4F7PB 3FRPG 3ZE1E 1P7QD 3A0OA 8FABA 1FG2B 3K4AA 3WLBA 4ZS7L 4OGXL 1YMHB 3SDYL 5FDYA 4S2SB 3TO4D 5DFVD 5T3XL 1K8IB 4PBWD 1CDYA 5EC2B 4N0YH 4ZQKA 1E6JH 3HC4L 4P23A 3IXTA 1XIWC 4A6YA 3KXFD 2YPVL 5DJ0B 5HGHB 1U36A 2AAVA 4RA3A 4Q9QH 5E8DL 2OI9B 4FQIL 1QFPA 2DKUA 5IGXL 4ZFGL 1KSRA 4LPWA 2A9MH 3GO1L 1RU9L 4CADB 3U9UA 4RFEA 5I1DA 5D7JA 5C07A 5C9JB 2BSSA 2XACC 2VN7A 4YHKH 1DE4A 4Y16D 1WC7A 1B4RA 4HQQL 4L9LA 1QO3B 2ARJA 4XHQA 5CINH 5DJ8B 5B3NA 2VZTA 2X5PA 3KR3H 3T0BA 1EEYA 2P5ED 3IFOB 3MC0A 1N8ZB 3GSVB 3G6AB 4L3ED 1FPTL 4MYWB 2OTPA 3S4SB 1S78C 5IUSA 4OLXH 5EZJB 3NCBB 3LKPB 4HIEB 5TQ2L 3ARFA 4QCIB 1J1PH 4R96B 3LQZA 2GCYB 1GOFA 3GB7B 5KS9A 1JMXA 3OKLB 4KDTC 1VERA 2VO5A 3LZFH 4GBXB 3C60D 4HW6A 5I1IH 3FHAA 4PJXF 3LKRA 3MNWB 4HCRH 4JY5H 5FUOL 5KTEH 1MAJA 3PDOB 3O2WH 1A9EA 1PFCA 5EUOA 4AEIH 3ZYOA 4K3DL 5CHNA 5I74C 3MLSL 3T4YA 1MUJA 2OR9H 1FYTE 4OLWL 5FO8B 2J8HA 4XCEA 2FYYB 5K9QI 2PYED 4BFBD 3KPMB 3O3UN 5HPOA 3IDJB 3O3EB 1T0NB 2CDGA 3DLQR 3TJHD 1NGWA 3AREC 1BVKA 1M71B 5IT2H 1D5XA 5CJ5A 3AMLA 3LOWA 1KV3A 4N0CC 1WZKA 2G60L 5T1KD 1ZGLB 5FO9B 2J88L 3P4OA 1DBJH 3DMMB 3MCKB 2DKSA 4G6AC 1R5IB 4I0PC 4PLOB 1MJUL 3AB0B 1FIEA 4TVPD 1ZLSL 1IFHH 4K94H 3WIHA 3EO1A 4JO1L 5BZWB 3QFJD 4BQ9A 1RIUH 1AFVL 5AD0B 7FABH 3GSUA 4QTHB 3F58H 1SBSH 4FQCH 5IESH 1JTTA 4U7SA 1AGDB 3KVQA 4G7YL 3QQ3A 1WK0A 2WBJB 1NC2D 4DUVA 4PTTA 4Y1AE 4DN4L 5AAWA 1HH6B 1UCTA 3SE3A 4ZUWB 3RTQD 4P5TD 4F2MA 5KSBE 3QDMA 2E9IA 5KG9A 3MRMB 3MRHB 3L9RB 1RIVH 4ZXBC 5B4MC 3TO2A 5TFSL 3V6OC 1K8DB 3O6MH 4KK5D 5B8CA 1UM5H 5FYLD 3IKCA 5KSUA 4WTXA 1TJGH 1S7QB 1D9KB 4CRPA 1I1RA 5LVEA 2AEWA 5IMLB 4BKLA 3HMXA 3CZJA 5F8RC 4GXUM 2FX7H 3JV6B 5DRZA 1AGBB 1TQCC 3H9ZA 3KLDA 4N1CA 1A2YA 4AZ8A 4MX7A 4NZRL 1JRHI 2R4SL 1Y6NR 2BVQB 4Y1AB 1F45A 1QRNB 3RVUC 1TQBC 3MRPB 1UH3A 1M6OB 2KBGA 2D31B 2NTFB 1IAOB 2HLFD 5H2BB 1XT5A 2ORBL 2DICA 2Y6SD 5HDBF 3ARDA 4TQEL 5BVPH 3DO7A 2Z9TA 4MSWB 5MEOB 4BK4A 3QIWC 2Q1EA 3SE8L 1IGJA 1FZMA 1EAPB 1OGAD 2XV6B 1LDPH 3MRKA 2PXYD 4KHXL 1RZKC 4K55A 4E41E 2V2XA 1UKSA 4M4PA 3RDTA 4O5LL 1KF9B 2NY5C 5IK3B 5DMIL 4ZODA 1T7YA 5JTWA 5IR1A 3VXNA 1MQKL 3QFDB 3G5ZA 5JOPD 3HE7C 3D2UA 1T7ZA 1FDLL 3EYQD 3F7QA 3SGJA 2GJZB 4DGVL 4Y5VA 1CU4L 1RZ7L 4PJAA 3SPVA 1Q94A 4G6JH 4OIBA 2PW1B 5E8PA 3O6FD 3LHPH 1CGWA 2VLKD 3Q5OA 2VXQL 3S8WA 1MRFH 1A6ZA 2Q7NA 1UVQA 3FFCE 1G84A 4H26B 1REIA 4HLZH 1I3GL 3OG4B 4CKVX 4WV1C 4ZAKA 4MDIA 4KZDH 1FQ9C 4LOUC 4IRJD 4JN2A 4LBEA 2CKBH 3E6FA 4HC1H 4I77H 4PJXE 3ARGA 1NAMH 4M43H 4S1DD 3SDAA 3QWOA 5LQBH 2VDKH 3ET9F 4YEFA 2IH3B 4Z7QF 4EI6B 4G3YH 5IKCA 5DMKA 3HI5L 1U2HA 5TE7L 2XXCB 4OSUL 2VDOL 2X1QA 2FDBP 5F88B 4MCYA 1BBJB 4XNQB 4OCRH 1WEJL 3FB6B 5FGBA 4FHBD 1LO0H 3RWDB 1OARL 4YHIA 3WLWC 4TNVK 5LBSH 2QEJA 3U7AA 3Q2CA 4TSBH 3S34H 2YUZA 4LVNC 2P8MB 3FFCB 4ODVL 5CKGA 5CFHA 1OAQH 3O6LL 4R4NC 3MLZH 1BAFL 1VFBA 1EA9C 1YN7B 4W4OC 4QXGH 3GSNH 3V6BR 2HTKC 3I02B 3E3QE 4UT9L 2BSTA 2B4CC 4M6NH 1B0WA 4BFIA 2EKSB 4PJXB 3RJQB 1A7NL 4KZEL 1W72L 1QPXA 1JZ8A 1FNSH 4M6ML 4LPYA 5LWYL 1X9QA 2QQLL 3S4SG 4FTVD 1WIPA 4K71B 4YWGH 2XY1A 3KPSD 1KTLB 4HIHB 4U2YA 2CR3A 2Q86A 3IF1B 3NFNA 4WTZA 2M2DA 3DJ9A 3ZKMD 4JZOA 1IKFH 4I2XE 3FB7A 1VACB 5IM7B 4MD5A 3GMRB 3EDFA 3QG7L 4PJDF 5EU4A 5DD1L 3WJJA 1U8NB 1ADQL 1DSFL 1P4LB 1NUDA 5E24E 4PRPA 1CXKA 4QRUA 5C71A 3D85B 4JQVA 1WLHA 2IAMD 4X7SL 3P9MA 3V5KB 5IEKA 1ES0A 1H5BA 1KLGA 5HVGB 5IBLD 3MODL 4K7PY 3SDCC 3UBXB 3VXQB 4LHJB 3FB5A 4YHNA 2HFGL 2YN5A 3AS3A 3CFEB 3OR6A 4WUKH 2Q76B 5I1AA 1NPUA 2EIDA 1CR9L 1HQ4A 5DHYB 3WS3A 4UDTA 2DAVA 3VE0B 4RAVA 4GQPH 3TCLB 4QHUA 3L3KB 3OF6A 4DUXA 5C0NC 4JHZA 3TV3H 2OQJB 4HIJB 3DX6A 4LGPB 2CKBB 2GSIA 4JY6A 3IFLH 4Q7DA 4JPWL 4HT1H 3BP6B 4FFZH 3R1GH 3VFSA 5MENA 4XWGH 4PGBB 5HDBE 1KIUA 3GJEB 4YDKH 1MVUB 3GZKA 4WHYH 5KN5A 1QSEE 5ID1B 1EDQA 4I2XB 3DV4A 5ACZB 5I73C 4N0FA 2KDGA 1AGCB 4LEXH 3N85H 2E9BA 2HJLA 1CG9B 1ZEAL 3GIVB 1OB1A 5K33A 3N9GL 2RCSL 4U1LB 3G04B 1UYWL 4X5LA 1S7UA 4R3SA 1MAKA 2JCCA 2R2BB 2G75B 2B0SL 3WFHA 2V2TB 1NMBL 1FH5L 4OZGA 2R0LL 1HH9A 1UEMA 2WP3T 2FZ3B 4MJID 2ZZUT 4HPOL 1W0YT 1CGVA 2NXYB 5DC9B 4M61B 2VLRA 2CJUL 4U1NB 4U1MA 4H5SB 1FGVH 3TBSA 2JTDA 1KEML 4BZ2H 5JXED 1GC1H 1KJ2B 5IOPA 1Z0MA 4H88H 2GEEA 4UNUA 2GY5A 5CAYB 2J1KA 4LCCB 5CSZA 4HIIA 3H9HB 4DK3A 4D9LH 5TGBB 3SOBH 3W5NA 1F8TL 5KW9L 1BM3H 3BHBB 3SQOH 4Z7QE 4PJ8C 3DXAD 5D6DC 1JPST 1JFQL 4J4PA 5DTFA 3GJFK 3SGKA 1INDH 3VFTA 2ITCB 3D3VD 4GO6B 5DJYB 1N5AA 4PB0L 5IFAL 3SDDA 5I76B 1SJVA 3EIFA 1FYTD 2QL1A 4LVHB 3AGVA 3NCYP 3ZT7A 3FCTB 3SKUD 2DQHH 2VXUL 2VE6A 2X41A 3CZFB 5T5FL 3UYRH 3L6FA 4HKZA 2OTUA 4ZSOA 4KK9C 5GJTL 5I9QC 3K4DA 3D39A 1A4KA 4LKCA 1ZE3C 5HHVL 1T1ZA 1IGFL 1YNLL 3GMOB 4DQOL 3CUPA 2SEBB 2GTWB 3GSOB 4P2OB 3W9DB 1FFQA 5EU7E 2AXFB 2LVEA 4FFWC 5C0IB 1T0MA 4NM8H 4XP9H 2AI0H 3V9FA 5D1ZD 1XR8B 1GOHA 3IRZA 5GQBA 3RL2B 4HWBL 2X10A 5KSAD 1ROWA 4I13B 1KB5B 1RZIB 2GFBA 3DVGA 3WV0A 3RNQB 1CLZH 5C2UB 3QB7C 4ALAH 3KPOB 2R1YB 3IU4H 1U8LB 4X7EC 4I48A 3MJGX 4Y1AD 3HZMA 2AV1B 1LO3H 5C6WH 4JFZL 1MCFA 5T1MA 1MIEH 1SYVA 4QXWA 2IFFL 1QFUL 2QADD 3QHFH 3U36A 3PHSA 4PJDE 1AKJB 1V3LA 1DQJA 1QBMH 4KJYA 4OJFH 4NWTL 1C16B 3MNZB 1I1AA 2ESVA 2K3TA 2BRRL 2JF1A 4JDTL 3FO2B 3O4LE 2IADA 3B9AA 3DUUB 1IC5L 1FAIH 3T04D 4HJJH 5I17B 2DM4A 2ZKHH 3V8CA 1JGDA 3CFDA 5FIEA 4BH7B 5K9OB 4RISH 4H1LB 5ADOH 2IMNA 4YE4L 3QIUC 3JWOL 5HHXH 1BQLH 1ZHLA 2FB4H 2F5AH 5GGSA 4MXWL 3RWEA 2VDRH 4WU7A 3KPLB 5DHVA 4JAMA 1NCBH 1TNMA 5F9WB 3WO3B 1BIIB 3VXTB 1HQRA 1QBLH 3BIKB 5M95B 1J10A 4FZEH 3ZZ1A 2UYLB 1J88A 1D5BA 4CN6A 2XKSA 3LN9A 4BFEA 4YGVA 4JG1H 5FCSH 4H8WL 1OPGH 4PJDB 5FUZL 1T5WB 3ULVC 4YDIL 5C0BE 1FC2D 5GGUA 1HIMH 5D96C 2W07A 5HGAB 2QSCL 2P7TB 3MRDB 4X7CC 5BV7C 4Y5XA 1CE6B 5DRNB 4Z7NF 3JTTA 3QG6A 4BH8B 4NKQB 1KEGL 4E41D 3UTTE 4GJTB 3LQAH 5FYJU 3U46B 1CT8A 5F7EH 3TNMA 5C6TH 2E6QA 1KC5L 1QZ1A 4KKNA 4I3SL 2X4QB 1MWAH 1A5FL 5IF0A 1JF5A 4XPTH 1KCSL 3QUXB 4M4RA 2ZSWB 2EXYC 5FM5M 1A6WL 2ARWA 3ORJA 3FOLA 4JM4H 4HS8L 1T03H 1CCZA 2YEZA 3T65B 2H32A 3OKOB 5EOCL 2DMCA 5CMAA 4JHBA 3VFNB 2VXTH 1BQUA 3OPZL 1FO0H 3SQBA 3UBXG 3DTXA 32C2A 1T3FA 3RAJH 1J0KA 4Z0XB 1BFOB 3P0YL 3L1OL 1UWGH 3QSKB 4JRXE 5C0BB 3DGGA 3FOMA 4JFHE 1XGPA 5SX4I 4JB9L 1FCGA 1T6WA 4EUPH 3FONB 2DRUA 2GTZA 1DQTA 5EZIL 4CU6A 1JK8A 3UTTB 5CJQL 2GYSA 4WWKD 2X40A 1TDQA 3HNVL 3O0RH 3MRNA 3RWIB 3U4EA 3LEXB 1MFEH 1DUZA 2A6KB 4UI2A 2YKLH 1I75A 2GITA 5JR1H 3I9GL 4P9ML 2E7LC 5I0DA 1HXYA 1S7RA 3OGOE 2UUDK 3RWGA 1N6QH 5CD3A 5EFIA 1A02N 3DIFB 3ARSA 2F8XC 5BW7A 4N90E 3HNTH 4DAGH 4FXKB 4Q97A 4R4BA 3TIEA 1DVFD 4LCIH 4Y4FD 1TCRB 5DSCB 3MYJA 2F74A 3OX8A 1U58A 3PV6A 5SWQB 4JGMA 3GJFB 4LLDA 4XCNA 5KSVA 4WY7H 4BK5A 1JN6B 3WD5L 4JRXB 4Y2DC 4ZS6D 2CO6B 3WEXB 3E2HB 3GKZA 3TESA 4YAQB 5E5RB 2NY1B 3RY6A 4QRPD 3KPQA 4PJHE 4NC1C 4FXLA 4WEBL 2CUIA 1NBZA 1VEPA 1N7MH 4KKCC 5IMOA 4PBXA 3DRTB 2ZCKL 4JO4L 3STLA 1IC7H 4EI5D 1OSPH 4O2EA 3OTTA 2DQEL 3HPLA 1AI1H 1KTDB 2CMRL 4IM8A 3VGDA 2GUOB 3H3PL 4PR5A 1PZ5B 4MVBD 3RZWA 4Y8AA 4BSJA 5SWZA 4UV4H 2FJHA 1KB9K 1RVFL 4L8DB 4OBSA 5IVXF 3MRQB 2NY4C 3CVIH 4JFEA 2JLLA 4Y4HB 2IBZY 2QR0B 5I2IB 5TPWH 3MRLB 5HHPB 4DGYH 4R90H 3RWJA 4LRIC 1ORSA 3VDBA 3BMWA 3MRRB 4RFOH 1FC1A 5I19L 2ZUQB 4P2QE 2YPLD 2R0ZL 4MNQA 1EGJL 4LK4A 4YIQA 1OF2A 4GW4A 3PWUB 4JPIA 4KROC 3T3MF 1SJEA 2XIDA 3TC9A 2NNAB 1YEHL 5AUMB 3ARBD 3QHZH 2VDML 5ACMA 3CX2A 1F6AB 4TUOA 2D03H 3INUL 4QT5A 4AEHH 1NCWL 2O61A 2FWOA 2C3VB 5EOCJ 1R3HB 3PE9A 5C7XL 1JHLH 1MCOH 5HI3D 3B83A 1FNFA 3IDYB 1FE8H 4YNYA 3MSPA 2DMBA 1KYOJ 5JW3L 5CD5C 1XGYL 2Y7QA 3MFGB 4JREC 1PEWA 2QQQA 1VHPA 5GXBB 2ICCA 2G9HB 3BSZL 1UB6B 3MGTA 1VESA 4GLRH 5M7QA 2E3VA 1SBBA 5F1IA 3Q48A 4CVZB 5FB8B 4N0RA 4GXVL 3OV6A 1GPOL 3VD9A 4KKLC 1BREA 4JJHA 4XBEL 1F58L 2EE3A 5LXGH 1QSED 4YH6A 1DBKL 1HSAA 3DPBA 4HWBA 1X5XA 4P2QB 4LARL 3OAZK 5INDA 4X8XA 4Z7NE 3ROOB 5BJTB 43C9A 5F9JB 4ONGL 1OSZB 3CD4A 1AQDB 4JR9L 1A1OA 3BN3B 3L3GA 4I4WB 1ZHNA 1KENH 3SY0A 1KJMA 1UACH 2XZCL 3O11A 3AU1B 1MCWW 3GRWA 1DLHB 2X4TA 2EDFA 4FG6D 3MXWL 4JPKL 3C2SA 1DEEA 5I1EL 1V3KA 4PV9B 4P46C 2BC4A 4NCC1 4XPAH 5H8DA 5BXFA 3RVWD 4XGZA 4XPBH 2J4WH 1QHOA 12E8H 4OCMC 4H1LG 3HKFA 3DURB 3F5WB 4WUUD 4EBQH 2OTWA 1V8HA 4G9DA 2MCPH 3ZT5A 4E42A 1T20A 4LCWE 1I85C 1JCKA 1MCEA 1N26A 5EPMB 2ICEA 5EDXA 1X5HA 2C9AA 1J05A 3PG2A 2FIKA 2Z8SA 4K7PH 4RWYL 1RUAH 1FG9C 4L1HA 5C3TA 2X42A 3O8XD 1ZLUK 4Y5YB 2D7MA 3GSWB 3TLRA 2ADIA 1IJ9A 5HI4C 2XQBL 2X1WL 5E8NB 4WNQB 4X83A 4LSQH 5L7XL 3MRFA 3QEUB 5KZCD 3V6OE 3UO1H 2HT3C 2EEBA 4F33A 4I0PB 2VR4A 5TF0A 1J86A 5GSRA 1D6VL 1QVOA 2Z35B 2DYPB 1CLOH 1OW0C 1V7NL 4LSSH 1RJYA 4RMWA 3VFPB 3TIDA 1MNUH 4PLJC 4F58L 5FHBH 4D2NA 1LHZA 3VWJD 4OCSL 3NAAL 4IRSD 3VA6A 1BBDL 3TT3H 1NDMA 2CRZA 3OAZH 1QRKA 4LCWB 4QYOB 4LDEB 3MRBA 3Q6FA 4LAJH 2R1XB 5CGYC 3CFKA 5ALBL 2VLJA 1DTUA 3VGHA 4Z0BL 5KVMC 4YBLC 4RWHA 2V7NB 3HUJF 2L4OA 5B3JF 4F9LC 2FO1A 3SKMA 2Q7YB 3MO1B 1EHLL 3LAFA 5J7CC 3LKOB 2CK0H 2HT4C 4HKJB 3BGAA 2ID5A 5DD3H 1JGLH 2W0LA 4ZXBB 4BA8A 4Q6IC 1QLFB 5C0EB 1U93B 5IVXE 2HA1A 5T1DH 3LRSA 2GK2A 3REVA 4M6OL 5IEHA 1U8KA 3GBML 4QRQA 4TOYL 3C6LD 3W81A 5AZEH 4HEPG 2IQAB 1CZ8H 3RUGA 5DD5L 2QJDA 2WP3O 4S10A 4NKMA 3QNXB 3WL9A 4UMGA 4DKDC 3BEWB 1YEKL 5HGDA 1YEDA 1KPUA 4OI9A 2R4RH 2OCFD 3OSKA 3T3ME 1BOGB 3FQWB 2L7JA 5JW5A 1XF1A 2RB8A 4OUUA 3O4LD 4JE4B 4PP2B 1UH2A 4EDXB 4KMQA 4UILH 4TPRH 4MA1C 1VFUA 3V79C 3CC5B 2G2RB 4RGND 4JY4A 4FNLL 5BMFL 2OZ4L 1TTUA 1NMCB 4LIQH 1VADB 5ILTH 2B4CH 3MACL 1E6OH 1FVEB 1MREL 2CDEB 2OMBA 3P3YA 5IFJA 2Z0BA 3P4NB 4OM0L 2A9NL 1ZLUH 4OFPA 3U9PH 2IPKA 2KUTA 5DGQA 3VGAC 1UM4L 1XGUB 2VUOA 2A6IB 3OG6B 2DM2A 2VIRB 2H9GA 2AV7A 3QIWB 4Z95L 2I25N 2MFNA 3CFBA 5E7BA 5IVXB 1EXUB 3CLEH 2X2YA 1B2WH 4ZNCD 4WO4D 4X4YA 1P2CB 1NEUA 1CFNA 2PCPB 4OB5H 4YC2C 4PJGF 3TYGL 4X6DA 4N5ED 1HZHL 4PJ5A 1LWRA 2R56L 2D7TH 4Z77A 4GUPA 1XF2B 3WFEL 1J8HB 5DJ6B 1CGTA 2JB6A 4ODTH 4L3CA 1YMME 1P4IL 4MA3A 2GJ6E 5D5MF 5C2BH 2HFFA 3UTTD 3HE6C 1FBIH 1N6VA 4JM2A 3TVMC 4U6HA 5HI5C 1U91A 2X1OA 1I8LA 3MLVH 5ETUB 4MJ5B 2V5SA 3O9WA 2EDEA 3EOTH 3L5WA 4G80A 2WIIA 5FYLL 3BPNC 3MR9B 3GSQA 4CN1A 4AENA 1A7PH 1MCQA 1QEWA 4K2UL 2FL5A 1ZSDB 2H3NA 1HILA 1RJLB 2IPTH 1U8PA 3ARQA 5I8OH 4KPHH 4WIQA 2R23A 4LRNL 4XVUC 2FO4B 3LPFA 2V5TA 1YDPB 2OL3H 1UKQA 3GSRB 4GRLA 2W92A 4GMTL 4JRYA 3KGRA 3QCVL 1WAAF 4JRXD 1F3RB 3MNVB 3ARTA 3ILPA 1A6UH 3X11B 4GRWF 1V7MH 2V6HA 1RUKL 1NDGB 2BOCB 1YMMB 2GJ6B 2HFEA 3VXRA 3TN0A 3V5DA 2V17H 2YD3A 4ODHL 3BWAB 5DUBA 3U30C 4LVNB 3B9VA 1YZZA 3WO4C 2R39A 4P48A 2IANA 4Y4HD 4EIGB 3CLFH 1U92B 2EC8A 3QIBB 3FO1B 4X5WA 2XNAB 3EOBB 1UCBH 3FQXA 4XP1H 2N7AA 1FL5B 2DTML 2N4IA 1QSFE 2OJZH 4XT1C 5INCB 4CMHC 3TBVA 5KVFL 5J9PA 4PJCA 1FHGA 1T7VA 1NAKH 5D7SH 4YPJA 2FJFB 1SMAA 4Z78B 1EMTL 4HXAH 3CDGB 4EN3C 3JUZA 3HUJE 1BOYA 5B3JE 1Z3GH 4WHCA 2GT9B 2X4UA 4Z8FH 1JE6A 3PWPE 3ES6B 3BIAX 5AWNL 3GMPA 5IVNA 4MA7H 3C5ZC 3NVQA 2CDFA 3UPCA 1LK3L 1H3PL 1WBYB 2BRQA 4LKXA 4KWUA 4XNXH 1PKQE 5EBWA 1NFDF 2DQGL 5J8OA 5E99L 8CGTA 2L0DA 4S1RL 2MQCA 5EU6E 1FGNH 1LEGA 3PGFL 2D7OA 3TZVA 3VW3H 5I1GH 4R26H 4JQIL 4QO1A 5CWSA 1XIWD 4PS4L 3MV8E 4CAGA 2Y25A 3GHEL 5JW4Q 1QKZH 4LHUB 1I8IA 3TYFB 5K9QG 5EG6C 4W70A 4S11A 1MHCA 1QSFB 3L5XH 5EOQH 4MDJA 5DVNA 2HJKB 3MA9H 3QUMB 2O26U 1NGZA 3B8YA 3CFJA 5EO1B 4ESKA 2YC1A 4TYUA 3WUWB 5TH2A 1VPOL 3HUJB 3NFSL 2VQ1B 1QFWL 3IXTB 2RHEA 1T2QH 3PWPB 4WW2C 4NGHH 3KXFA 3MBED 1IAIM 4MJ6B 2OP4L 4OCWL 1S78D 5E00A