1CJEA

Adrenodoxin from bovine
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
KITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The tertiary structure of full-length bovine adrenodoxin suggests functional dimers.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
molecule keywords ADRENODOXIN
total genus 26
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1cjeA00
1JWAD 2K5PA 4JWSC 2H88B 2L83A 3SFEB 1KF6B 2PVGC 1TKEA 3NRZA 2PVOD 3AE7B 1ZXIA 3AEBB 4YTMB 3FAHA 4US9A 1ZUD2 1FRDA 1FXIA 1L0VB 1RFKA 1OFFA 4IDIA 4HROA 2WQYB 2BS4B 1E6EB 1L5PA 2KMMA 3NVZA 3L4PA 1AWDA 1QOGA 1TYGB 1JROA 1NVID 3AE9B 2JX5A 3AE8B 2QIEB 1JRPA 1QOFA 1GAQB 1XLPA 2ACZB 1VDVA 3P4QB 2WU5B 2BS2B 1E0ZA 2W3RA 1EWYC 1FM0D 1PUTA 2K22A 2W55A 1N61A 2KAJA 1SF0A 2WP9B 4WQMA 1TKGA 1OQQA 3AE3B 1PFDA 1ZOYB 2E3TA 1N63A 5C2TB 1QLBB 4ITKA 2LEKA 3B2FA 2WDVB 1ROEA 4A9AA 2BT6A 1IUEA 3AECB 2AX5A 1JQ4A 1TKYA 1WYGA 1GPXA 2FBWB 3CWIA 2DBYA 1RM6C 2BS3B 4JWUC 5AUIA 1V8CA 3VR9B 1QOAA 2JQRB 3BIID 5H92C 3WCQA 1E9MA 1JWBD 1WGKA 2MJEA 2N0SB 5G5GA 1T3QA 3HRDD 4C7YA 2K9XA 2M19A 3AE6B 3NS1A 1XLQA 4ZOHC 4YSYB 4JX1C 1FXAA 4C7ZA 2DWQA 1JALA 3AE5B 3EUB2 3AEAB 4USAA 2W54A 3LB8C 3VRAB 2Y5CA 1NEKB 1JW9D 3ABVB 1RWSA 3AEEB 1QOBA 3B2GA 4YTNB 1WRIA 2QJLA 2B76B 3ZYYX 1N60A 2Q5WD 4HRSA 2WLBA 1N5WA 3SFDB 3VRBB 3W9CB 1FO4A 1YQ4B 5EE1A 3P4PB 2MJ3A 2MH7A 4N58A 2CJOA 4FXCA 1SIJA 3VR8B 1YQ3B 1ZP0B 1YJJA 5AUKA 3P63A 1QF6A 2CJNA 1WXQA 2H89B 1J7BA 1XO3A 1YJIA 2PIAA 3AN1A 5EE3A 2G1EA 1AYFA 1UWMA 2M56B 5G5HA 2CU3A 1DOIA 3KWLA 3B9JA 1VLBA 4YT0B 1FIQA 2W3SA 1N62A 3HVZA 3W5VB 3AE2B 1KRHA 3AV8A 1L6VA 1NI3A 3AEGB 1DOYA 2EKIA 1FFVA 3AMZA 1J7AA 1E7PB 1RYJA 3P4RB 4US8A 3HUIA 1OQRA 5H8YE 1PDXA 1CJEA 3ETRA 3LXFA 2OHFA 4C80A 1F0ZA 1N5XA 3NVYA 1QT9A 2MJDA 1VJKA 1FRRA 5MPOA 1NYRA 4P6VF 4N6EB 2L52A 2WDRB 3NVWA 3AH7A 1FFUA 4YTPB 1CZPA 2PKOA 1FMAD 5EE0A 3NVVA 4KX6B 4YSXB 4ZHOA 5C3JB 1I7HA 4YXDB 2WS3B 1NENB 3DWGC 3AM9A 3DWMA 4N59A 1B9RA 1DOXA 3AEDB 2WDQB 1R7SA 1A70A 3FC4A 1DGJA 1J7CA 4ZHPA 1V97A 3PO0A 5GXGB 1E10A 3P1MA 3AE4B 5EE9A 2HTME 1NYQA 1SB3C 1KFYB 1L6UA 1TJEA 1XLOA 2WU2B 1XLNA 3W5UB 3AE1B 4LTUA 3RPFC 1WWTA 3P4SB 3AB5A 3CIRB 4YSZB 3AEFB 4WWMA 3SR6A
chains in the Genus database with same CATH superfamily
3EA6A 3QAQA 2NTTA 3SFEB 2XEWA 4B6WA 3AE7B 1ZXIA 4CQNA 2G4DB 3KUDB 2IO3B 1XXGA 2GOWA 2QSDA 2WYQA 2BS4B 3DBRI 3NVZA 4MDKE 4OW0A 4WWPA 4ICUA 4W9KA 3NUHB 4OZBA 3RNFC 2D11A 2XNAC 3AE8B 2WU5B 2W3RA 3TIXA 4FHJA 3PT2B 3BZDB 1OQYA 3UIOB 3EC8A 3H7SA 4S17A 2N4FA 3EGRA 3KLSX 3RNGC 1UGMA 1V86A 2PEAA 4OHJA 4F7ZA 4MH0E 2JPHA 3N32A 1SE2A 3PLUA 1Q1OA 1BXTA 1TZOA 5BYSA 3M3JA 3ZJVA 5J2RA 4HRSA 1SGHA 2LFIA 4ACFA 4HEA1 2KDMA 2WXOA 3DBHB 3BK2A 3H7PA 3CF6E 1UWMA 2PTLA 3DCGA 3N30A 3A4RA 2C7HA 2PPHA 3LDZE 4JIOU 2INNE 1TIFA 1UELA 3VHTC 2N9KA 3JSVB 2C9WB 1J19A 3R2TA 1WJ4A 2MRPA 3V3XA 3NVYA 2UU7A 1MJDA 4DDID 4YWGG 2AQ2B 3AH7A 1FMAD 2QHOA 2K0PA 1C79A 3DWGC 2AL3A 2WDQB 3VH4B 3FC4A 5AEKB 1E7VA 1MPEA 1RAXA 1UUPA 2Z0EB 2KKCA 4WWMA 1FO4A 1SJHD 1Y8RC 5KHOA 3EHVA 4JWSC 1VD2A 2RGFA 1WGDA 1ET9A 4A3PA 1MVKA 4RFBA 1I4HA 2BW2A 2RPVA 2WP9B 3P2BA 3AE3B 1ZOYB 4PK1A 1T0SC 1OGWA 3R8BA 2KC1A 1ZW7A 2VH1A 4C4VB 4CHKA 3QX1A 2GBRA 5G5GA 5JHAA 4R3DA 4AP4C 5E6NA 3RT3B 4EKUA 3B2GA 5IP4D 4A20A 3RMKC 1FNWA 1SE3A 5E6JA 3ZNGC 1QF6A 1WXQA 4GGQA 3E9SA 1LXDA 2MBBB 3I9V1 3U52E 3HM3A 4MGZE 1DOIA 4WIPA 2XN9C 1UBIA 2W3SA 3HVZA 4GDLB 2EELA 3WA0A 1NI3A 3VFKA 4ZDVA 5HFYA 1V1PB 3IT6B 3HVDA 2FUG1 4MSMB 3ZVVA 4US8A 2OHFA 5TSSA 5CTRC 2NMQA 3NG0A 5MPOA 1NYRA 4RH6A 1PGAA 1UZXB 2KZRA 3KUCB 3NZ3A 4I6NB 4M00A 2WX1A 3Q8BA 4F1SA 3QQ8B 4KV2A 2KWUB 3MJ5A 1V97A 3BWUD 4LNFA 1TGZB 3P1MA 3AE4B 3NOBA 4FHKA 1XLOA 3LYYA 1XLNA 1AARA 4L1BA 2KTRB 2MLBA 2V3PA 4NZLB 2PVGC 5EDSA 1ZUD2 2RDBC 4DHZE 4ICVA 1F2RI 3DHGC 3IT4B 4GSWA 2I38A 2BS2B 5G2NA 2MW5A 4MSQB 2K22A 3UGBB 3OWEB 2LRUA 1L0YB 2BBCA 3WAPA 4IKGA 4MGIE 5BMHA 2LXCA 4KVGB 3APFA 4G11A 5IO9A 1I4GA 1CQVA 1V8CA 1E9MA 4NAWA 1D5ZC 1K51A 2MP2A 3N1ZC 4JPSA 3ABVB 3A9KB 1XCQL 1WRIA 2DYOA 1N60A 2Q5WD 1WGGA 4M0WA 2JXXA 1T0QC 1WXAA 2BTEA 1Y56A 2KDBA 4G0NB 4NNJB 4BKSA 5CX3A 5L83A 1P7EA 2WXNA 4XWWA 4I6LB 5AZGA 2GBJA 2K8CA 3LXFA 4LJOB 1N5XA 2IGGA 1QT9A 2Z0DB 4GXBA 3ZGZA 4MACA 2WXHA 2ZEQA 1EWCA 4IM2A 2DAJA 2KMAA 1YD8U 4W9EA 3ZTCA 2WXRA 2FIFA 3AM9A 1HA5A 1IYFA 1DOXA 4ZHPA 1OTRB 1WI0A 1UD7A 4NAMA 1L6UA 2NPTB 3W5UB 3PRZA 2V4IB 4BKTA 2WGSA 2LGIA 3KWVA 3N20C 3V05A 3AEBB 4W9GA 1D5MC 1FXIA 2X8XX 5BO4B 4K7UA 4TV3A 1HZ5A 1EU3A 2V3SA 2NBWB 2KK8A 2V4LA 1JRPA 2MSED 2L76A 2JZZA 2GMIC 2VZKD 1TT5B 2WDVB 1Q10A 2WXMA 1GC7A 2LUMA 4DXAB 2FBWB 1KJTA 3ZDMC 4BBNC 1ENFA 1QOAA 4J3OD 5KHQA 2M19A 2WXLA 4ZOHC 5JH5C 3SD5A 4JX1C 3H7PB 1C4AA 3EECA 3Q8FA 4GU2A 1MI0A 1YIWA 3T9LA 2KACA 3J9CA 3M63B 4YTNB 2I1KA 1F9JA 4W9CA 4JLCA 1C76A 4EZJA 1ZP0B 3WAMA 3DBHI 2KJRA 2WXJA 2KLCA 2JZPA 2LWPA 1T0YA 3R7RA 4NJ7A 3ZRFA 4NPNA 4A3OA 2INPE 3QC8B 4YT0B 3IG3A 2HTHA 2N1VA 3AV8A 2K25A 2NBUA 3PRMB 1J7AA 3ZIMA 3RFZB 2V1YA 3MHSD 1V80A 3APDA 4YTPB 1CZPA 1E8ZA 2ON8A 3DVNU 4KX6B 2D3BA 3QA8A 1B9RA 5TR5A 2MWSB 1ZXHA 2KQ4X 2K8BA 2ZNVC 2BKRB 1G6JA 1NYQA 1Z2MA 2M0AA 3CIRB 3APCA 3PV1A 4K7SA 4KDLB 4TQ1A 4WAAA 4KDIC 2KHWB 1MHXA 4E3CA 1SSNA 1T5XD 4IDIA 1AWDA 3N9YC 2BB5A 2DENB 3PSEB 5G55A 4M8MA 4XDCA 4DK5A 4JQWC 4Q2JA 5FR6A 5JXVA 4JGHB 5AZFA 2IPKD 1JQ4A 1UGJA 2BS3B 2J7QB 1V81A 2CU1A 2DZIA 2D3GA 1RLFA 2KANA 3M62B 1YMHE 3ML9A 1WE7A 5JZEB 1L2NA 1TZ1A 3EFCA 1S1QB 1XF5L 3H9DA 4N9F4 3TL5A 1N5WA 1WGYA 2WHIA 2KQ7A 1T6BX 3VR8B 2WXPA 4XX5A 1AYFA 2EMTA 1X1MA 3CSFA 1GB4A 4ZRJA 4KIKA 2NS5A 3KWLA 1SJED 2HE7A 1AW7A 4ANVA 3AEGB 4LK0M 3MP9A 3Q3MC 2EKEC 2L3ZA 5H8YE 1XT9B 3VVWB 1LFDA 5IKCM 5IA7A 2KX3A 4DQOC 2JYTA 2CKHB 3DWMA 4FLHA 4LJPB 2L0FA 4WJPA 3C8YA 3MTNB 4C7ZA 2O2VB 1M4VA 4QAYA 1VCBA 4YSZB 1WF9A 2H88B 4NAWB 1SXTA 2IO2B 4BAXA 5CHFA 3ZO5B 1E6EB 1L5PA 3GB1A 3TSSA 2JX5A 2ONQA 2BWFA 2J0JA 2BB6A 1FM0D 2RDGA 5FKAC 1P7FA 2HJ8A 1D6EC 2CS4A 2XBBC 4IUMB 2QMTA 3Q14C 3LJ3A 4IM0A 4FULA 5D94A 3L0WB 3UIPB 3C0RB 3QWZB 3A1QA 3X23A 2AEHA 1V6EA 1XLQA 2LXAA 4FA6A 1GOZA 2FCNA 2DWQA 2IDYA 3KQ4A 5BMGA 4REZA 3IAS1 2UYZB 3AEAB 4RNAA 3IAM1 1WJ6A 1ISNA 1QOBA 1IBXA 2B3AA 3ZYYX 5DPWA 1P9DU 2K8HA 2N9PC 1UNSA 2KWCA 2CJOA 2MBQA 3IFWB 2H89B 2E6XA 1YJIA 2KXJA 3BYYB 4MGYE 2XK5B 3TJPA 3TEWA 2OJRA 4WAFA 1MHHE 3WANA 4KKJA 3VUXA 4G3XB 1OQRA 2MBHA 4BKSD 1F0ZA 3PHXB 4HPLB 4FJVB 4OZAA 3IBEA 2O6VD 1FCCC 4C00A 4A55A 1R7SA 1QZEA 1XCTL 5IN7A 2N7JA 1WH3A 3N3KB 1R4MB 4KZCA 4MM3A 3P4QB 2KX0A 2KDIA 1Q0WB 2INDC 1TKEA 2J42A 4IC7B 3GOEA 4P1BC 3HM6X 4ZYNA 2INCC 4HROA 4RCOA 1H4RA 2IBIB 2D3CA 3L4PA 2IO0B 4DHJB 2QIEB 3NJTA 1GC6A 3VUYA 2I2YA 2W55A 1N61A 3TMPB 2KYWA 3ZTDA 2L00B 5C2TB 5C23A 2N7DA 4HWIB 4C56C 5FR3A 2C7MB 4M02A 3RNEC 4JWUC 3BIID 4MJSB 3TEXA 2N9EB 4II3B 3SU8X 2GBNA 1HEZE 4W9LA 4XE0A 2LHDA 2KOXA 3CMMB 4AQ7A 4FADA 2KTFA 3O13A 3ZLZA 4RF1A 3PRPB 3RNBC 2JU6X 2G4SA 2G45B 3AN1A 4HJKA 5EE3A 2G1EA 3RI7C 2L05A 4CO7A 3KYCD 4RGMA 4JE3B 2ZW1A 3U7ZA 1D3ZA 3ZJTA 3Q8EA 3ZXVA 2L7RA 1KLVA 3PPAA 2R61A 3V60A 2J53A 4IM3A 3ZDTA 1K53A 1SEBD 4W9JA 1V1OA 1WMHA 3DVNV 3NVVA 4YSXB 1I7HA 2RSUA 4KGSA 2M8SA 3RULA 4GOCA 3AEDB 3TCAA 2NCNA 3IHPC 3H6NA 4MEMA 4PYZA 2A4ZA 5JHBA 3PZDA 3ECIA 2NBVB 2GB1A 2PJHA 2LVPA 2KFKB 2K1FA 2WQYB 4PS3A 4I6PA 1TYGB 1JROA 3AE9B 3TBLD 2BPSA 2WXFA 4AS1A 1QOFA 1GAQB 1EO6A 3V6CB 2LJ5A 1XD3B 1V49A 4EEWA 1WGRA 3QIJA 3S2AA 1IGDA 4CYEA 1F1HA 2E3TA 1BUIC 3U8ZA 2J52A 1LO5D 2FCSA 2EMSA 4RGOS 1D4BA 1WJUA 2MEKA 3AI5A 4XC2A 1F52A 4IWQA 2IJ0A 2DBYA 1LQBA 5AUIA 5LXHA 2L0TA 3KUZA 3PVLA 3MJWA 2GLSA 4PS7A 4ASWC 3Q8AA 3RCZA 5C1ZA 4DXGA 4WURA 1TS2A 2D3AA 5FK9C 2J0KA 3MC0B 3ZRCA 4FJZA 2QJLA 3R2IA 1YN4A 2PE6B 3MHZA 3Q6BA 1YQ4B 1ESFA 5AUKA 3GZNI 4UDUC 3PZ8A 4X57B 1KOTA 2VRRB 1FXTB 3KYDD 2QDFA 3Q8CA 3PGEA 4MJSA 3L08A 3T8MA 4NJ6A 2KWDA 5E6OA 1JWSD 1OEYA 1PDXA 1CMXB 3DBLI 2IYDB 1ET6A 3IVFA 2CR5A 1WM2A 5C3JB 3Q2AC 3HHMA 2WS3B 4IWOA 4MH8A 1EF1A 5GMVA 4GDLA 4BVUC 2JT4B 2AQ1B 1F77A 1WWTA 2DYBA 2WWZA 1UH6A 2M0XA 3A33B 3U30A 4IWPA 4RGTA 4GN1A 5CHWA 2WDTB 1RRBA 1BT0A 1E8WA 1RFKA 2BKFA 3RYTA 4ANXA 4DHJD 3Q3OC 1QQRA 3TUOA 1K52A 1P3QU 3VH3B 2M4NA 2IGHA 1K50A 2D07B 4LNNA 3CWIA 1FEHA 3RZWC 2FCMA 5J17A 3HRDD 4YSYB 2FUHB 2MBOA 4GLSC 2W54A 1JW9D 3DOWA 4M8NA 3VUWA 5BYRA 3KVFB 1ZE3D 2MH7A 3C19A 1YJJA 3P63A 3Q69A 3PTFC 1HTQA 2GBKA 3P42A 4KGRA 1FIQA 3W5VB 1JWUD 1BMLC 1H8CA 2KMCA 4M01A 3E56A 3DBSA 4PS8A 3VDZA 3TEYA 1WX9A 3B08A 1P1AA 4NQLB 1C9FA 4N6EB 3NVWA 4WJNA 4HXDA 2CHWA 4BFRA 1L7YA 2K3UA 2MX2A 3D32A 4HK2A 4K1RB 1SE9A 2KNBA 2HD5B 1E90A 3PZ7A 1MG4A 2LD9A 2YEPB 3VAWA 1KFYB 2JXTA 3BK1A 3DVGX 3NZSA 3VTVA 4MT5A 2RDHA 2KVRA 2K5PA 1I4QA 2NPTA 3V62A 2LRWA 3T3NA 3H1UA 2ZVNA 1XLPA 1YJ1A 4K3CA 1WMHB 1SF0A 2V0GA 4FJYA 1N63A 2JRHA 3PHWB 1IUEA 1UBQA 4WWNA 1L4ZB 1YQBA 2K39A 1TKYA 1WXVA 2D5GA 2TSSA 1WYGA 2G9HD 3RN9C 1EM7A 1PQSA 1WRDB 1JWBD 2OOBB 3KH0A 1STEA 4DWFA 1FXAA 2L1AA 1JWMD 2AYOB 2K6DB 2ZVOA 4JL9A 1YN3A 2NVUI 2WXKA 3AEEB 2W82A 2G3QB 5LXIB 4IG7B 2MBEA 4OVZA 5G5HA 2KJ6A 2LGDA 1GJZA 4EFOA 2N1WA 2ASQA 1IGCA 5D3IB 3U4EG 3V61A 4HPPA 4LNOA 3I3TB 1DOYA 3GE8C 4KIKB 5D7GA 1N6ZA 1FRRA 5HKHA 3Q3JA 2WX0A 1E7UA 1VZ6A 1WR1A 1FFUA 1HE8A 4DDGD 1FPYA 4LLGM 4M0WB 5EE0A 5IOIA 4ZHOA 4YXDB 4F8CB 1SBBB 3PS6A 3W1SA 2C60A 4GIVA 5DPRA 1DGJA 1EUVB 2HTME 1L0XB 1SB3C 3DPDA 4LTUA 2OJWA 4MM3B 3BY4B 5DPTA 4L2YA 4BOZB 4D2KA 3NRZA 2FAZA 1E5WA 3W1YA 4KZ0A 1V5TA 3DBLB 3K9OB 2LHEA 2Z8LA 2JYEA 1PUTA 4ANUA 1ZGUB 4YL8A 1GUAB 4EZLA 3I57A 1OQQA 1WY8A 4W9FA 1QLBB 3W1SC 1LM8B 2M1MA 2FIDA 2ZJDA 5HI1A 1GPXA 2PE9A 3DDCB 2RMMA 1V2YA 2JQRB 1WGKA 3ALBA 2KC2A 2RD0A 2LGSA 1V9JA 2JUOA 1FNUA 5BYQA 3W9CB 3OG5A 2JWUA 3B1LX 5EE1A 4NJCA 4HDQA 1XO3A 4IW0A 2UWQA 3BYTB 3O65B 1YN5A 5CHVC 4AJWA 2BYVE 2CU3A 4OZCA 1TY0A 2REXA 1VLBA 3VXWA 1N62A 4ZRQA 3A9JA 3W2DA 2CHZA 2BQQA 2L8JA 3JSVA 1C4CA 2KVZA 2Y5PA 1CJEA 2KN5A 3Q3FA 4BBNF 3BINA 2MHJA 4P6VF 3ZKJC 1EU4A 1JRUA 1FD6A 3R66C 2FE8A 1PYWD 1ACCA 1NDDA 3A9KA 2O6VB 1ZKHA 5HHDG 3BVZA 1QILA 2JY6A 4NQKE 1E10A 2LVQA 1KLUD 4PYUA 1TTNA 1HTOA 2LMCA 4FN2A 2IY0B 3P4SB 3OAWA 3SR6A 1JWAD 4AWJA 1AN8A 3L16A 1L0VB 2KLGA 2KMMA 2HDEA 1C78A 1VDVA 4ANWA 2ACZB 2DLBA 4LCDE 2DAFA 2PMVA 5LLIA 4DBGA 4WQMA 3UF8A 3NY5A 1WXSA 4P1CC 4ZRIA 2BYEA 2QCZA 4GB9A 2GRIA 4RGNA 5J18A 2FCQA 4NY0A 1NI2A 1T3QA 3X0WA 3NS1A 1J8CA 4WQOB 1KH0A 3EUB2 1WZ0A 1E8YA 1TS4A 4KSLC 2WXIA 1V1PA 4WH4A 2JSVX 1YX5B 2AL6A 2CJNA 5E6PA 2OEDA 4WWOA 3SDLC 2IY1B 3A1QB 2K6QA 2CHXA 4BKGA 2LGXA 1WJNA 1L6VA 3GS2A 1RYJA 3P4RB 1IBXB 2YEPF 1VJKA 4GDKA 2MA9B 1R4NB 2N9LA 2WDRB 3QARA 4WJQA 3H8HA 3FILA 2I1JA 3V6EB 4B0MA 3PO0A 3NHEB 5EE9A 1MG8A 3L17A 3JW0X 4OVVA 1R4MI 2DYMA 5I4DA 5IAAC 3QJZA 2KD0A 1OFFA 2NR2A 3ZQ4A 5AZHA 2VH2A 4O1NA 2ZCBA 5HG2A 4P7IA 1E0ZA 1FNVA 1JMLA 3MC9A 4A90A 2JZ3B 4AOFA 5D2MB 1PFDA 2DZJA 2BT6A 3DBRB 3AECB 1R4NI 2KFJA 1LGRA 3AU5A 4AJYB 2Z59B 1VR9A 1C1YB 3WCQA 2N0SB 3UINB 1WYWB 2K9XA 1D5XC 3AE6B 3N1YC 3AE5B 3WALA 2O6VA 2PW9A 2B76B 4HDOA 4BZAA 1WE6A 2L32A 2C5LC 3P4PB 3M95A 2BF8B 1KM7A 2LJIA 3VTWA 3OJ4B 4HKZE 2LVOA 2BWES 3B9JA 3QK0A 3UQBA 3MFGA 2IGDA 1EF5A 1IPGA 3HK0A 2C7NB 3I5JC 3CSTA 4RM8A 1RFAA 3AMZA 2IZVB 2N7EA 3HUIA 4OVUA 3ETRA 4C80A 3R3MA 1KLGD 2MJDA 2WXQA 3BVGA 4S0RA 2JRIB 3EFUA 3AU4A 1FCLA 3OJ3A 5D6JB 3UI3A 2J0MA 2LI5A 2WNMA 2MCNB 2LASA 3ZW3A 3UQAA 3ZNHB 3TEZA 3NS8A 5BMIA 4HKQA 4W9IA 1P0RA 2ZCCA 3DVGY 3RD2A 4L23A 2KDFB 1KF6B 1KTKA 3DQVA 1M94A 4ZRPA 3FAHA 4YTMB 3Q3NC 2HJ1A 4LNIA 2QILA 4RF0A 4URKA 2DNFA 2KAJA 3IXSA 4ARIA 4K7WA 2BGFA 4XGAB 3JYUA 2N9XA 2BVCA 4LNKA 4W9DA 3U7DA 4LDTD 1S3SG 3RZFA 1C4PA 3GP7A 4G50A 4KSKC 1RM6C 3VR9B 2KDEB 5H92C 2KO3A 4GDKB 4LDTB 3RUIB 2O2VA 4EE2A 1L4DB 4HPMB 1C77A 3ONSA 3PREA 1XQQA 3VRAB 1YX6B 5DCNA 1HXYD 3AXCA 2Y5BB 4HVBA 3SFDB 1NBFC 1U4AA 1WSPA 1YQ3B 4E74A 3OLMD 4HJGE 1GG3A 2ZW0A 1SIFA 4II2B 4TQ0A 1C3TA 1YNTE 1IP9A 3AE2B 3DHHC 2DZMA 1KRHA 1ZPSA 4C4VA 1A5RA 2MQJA 3GZNB 1FFVA 3VQIA 4HCNB 3JVZX 1E7PB 2KT7A 1WX8A 4GMVA 1B1ZA 2A5UA 2VZKB 3QCAA 1TS5A 1I35A 2LGYA 4TUUA 1VZ7A 5GXGB 4IOIE 4A6QA 1TJEA 2KQSA 3L54A 3U2SC 3RNAC 3N1XC 4AUQC 5L95C 3SHQA 2KJHB 2ZNVB 2LZ6A 4US9A 1SE4A 1ZDVA 1FRDA 2SAKA 3HIZA 4XZ4A 1YOVB 4B9KA 4RM9A 4HCPB 2XK5A 2IO1B 3WIMA 1EWYC 4TKNA 4EUTA 1Q5WB 1WM3A 4ZYSA 1DYQA 4P16A 2JF5A 2LEKA 3ENEA 4A9AA 2AX5A 1UWXA 3SEBA 1QKZA 4HLEA 2DZKA 1Z5SB 3VTUA 3WAOA 1TS3A 1WGHA 4C7YA 2R2OA 2KTRA 2R2QA 4USAA 3LB8C 5DPSA 2Y5CA 1NEKB 1JCKB 4XDDA 3VRBB 4EZKA 2MJ3A 4N58A 2W9NA 1SIJA 4B95A 2PIAA 3L10B 2ICIA 3MC8A 1J0GA 2QC8A 2GBMA 2JWZA 1OEYJ 2YLMA 2V3NA 1P98A 1V5OA 3URYA 3FKYA 3B0AA 1VZ8A 3A9JB 1UF0A 1WR6E 1WX7A 1HZ6A 2M17A 1K8RB 4RMAA 2QEJC 3ZNID 4XWTA 1GB1A 2SEBD 3ZJUA 1NENB 4WJOA 2PLPA 5D3DA 2D2QA 1T0RC 4MELA 1J7CA 1TY2A 3RNCC 2RR9A 3KW5B 3R7QA 4W9HA 5LNK1 2BYFA 3AE1B 3AULA 2RPQA 3AB5A 2JVCA 2ZPYA 2FNJB 1XEEA 3NZUA 2L83A 2PVOD 1PGXA 1HQRD 1PGBA 4A8XC 1QOGA 1NVID 3ZUNA 1I4RA 2YVCA 3FILB 1TBEA 3QHTA 1TKGA 4H2AA 4ITKA 3B2FA 1ROEA 4PT5A 1WZ3A 5T8IA 1WIAA 1CK1A 4EOYA 3PLVA 4DXFA 4ARCA 3I63C 4KGTA 1I4PA 2MJEA 4B0EA 1E8XA 3K9PB 2AQ3B 2AWTA 2J4XA 4DHZB 1JALA 4J6IA 1I42A 1RWSA 2KWVB 2D10A 1I4XA 2WLBA 3DHIC 1MFWA 2DHZA 2ZPNA 4FXCA 4K81A 1ZDXA 2MP2B 3ML8A 1J7BA 4XYCA 3ZXRA 4K3BA 3T3OA 2DX5B 4FBJB 2M56B 4TSSA 3BVMA 2KN4A 3ZNZB 1GNUA 2V9HA 4ZRKA 2EKIA 2LUEA 1VRAB 2ZZPB 2X38A 2L52A 4TMAB 2PKOA 2WXGA 2GI9A 4E71A 4KKIA 4N59A 1WXMA 4MGKE 1A70A 1F2RC 2KFKA 4BOSC 1WFYA 2WU2B 3A4SC 3L13A 3GE3C 2Y3AA 3RPFC 2BYTA 2NTSA 3AEFB
chains in the Genus database with same CATH topology
5I4DA 3EA6A 4TQ1A 4RGTA 2NTTA 3SFEB 1MHXA 3AE7B 1ZXIA 4CQNA 1SSNA 1XXGA 1RFKA 1OFFA 1T5XD 2QSDA 4IDIA 3ZQ4A 2BS4B 4O1NA 3NVZA 4OW0A 1AWDA 3N9YC 5HG2A 3NUHB 2BB5A 4OZBA 2XNAC 3AE8B 1E0ZA 1FNVA 2WU5B 2W3RA 1JMLA 4A90A 1QQRA 4XDCA 3TUOA 1PFDA 1K52A 3BZDB 4Q2JA 5JXVA 2IPKD 2BT6A 3AECB 2IGHA 3EGRA 3KLSX 1JQ4A 1K50A 3CWIA 1FEHA 1UGJA 4OHJA 2BS3B 1VR9A 3WCQA 1SE2A 2N0SB 3HRDD 1BXTA 2K9XA 1D5XC 1TZOA 3AE6B 4YSYB 5BYSA 1YMHE 3ZJVA 3AE5B 4GLSC 2W54A 1JW9D 1XF5L 2PW9A 5BYRA 2B76B 4HRSA 1N5WA 2L32A 1ZE3D 2LFIA 3P4PB 2MH7A 1T6BX 3VR8B 2WXPA 4HEA1 1YJJA 2KDMA 2WXOA 3P63A 2LJIA 3Q69A 3BK2A 1AYFA 1UWMA 2PTLA 4HKZE 1GB4A 3P42A 3KWLA 3B9JA 4KGRA 1FIQA 2INNE 1SJED 3W5VB 1JWUD 3MFGA 2IGDA 2N9KA 1BMLC 1AW7A 3AEGB 4LK0M 3MP9A 3E56A 3AMZA 3R2TA 3HUIA 5H8YE 4C80A 3ETRA 3V3XA 1KLGD 3NVYA 3TEYA 2MJDA 2WXQA 3BVGA 4YWGG 1C9FA 2AQ2B 1FCLA 4N6EB 3NVWA 3UI3A 3AH7A 4DQOC 1FMAD 2WNMA 2K3UA 2JYTA 1C79A 2K0PA 3DWGC 3DWMA 2WDQB 3FC4A 3TEZA 5BMIA 4HKQA 3PZ7A 3C8YA 2YEPB 4C7ZA 1KFYB 1MPEA 2JXTA 1M4VA 3BK1A 1UUPA 4YSZB 4WWMA 1FO4A 1SJHD 4MT5A 2RDHA 4L23A 2K5PA 4JWSC 2H88B 4NAWB 1I4QA 1SXTA 1KF6B 1KTKA 4ZRPA 3FAHA 4YTMB 1ET9A 1E6EB 1L5PA 2QILA 4RF0A 3GB1A 3TSSA 3T3NA 2JX5A 2ONQA 1MVKA 1XLPA 4RFBA 1I4HA 2BB6A 1FM0D 2BW2A 2RDGA 5FKAC 1P7FA 1D6EC 2KAJA 1SF0A 2RPVA 2WP9B 3IXSA 2V0GA 4ARIA 2QMTA 3AE3B 1ZOYB 1N63A 1IUEA 1L4ZB 3R8BA 1C4PA 1TKYA 2D5GA 2TSSA 1WYGA 2G9HD 3GP7A 1EM7A 1RM6C 3VR9B 5H92C 4GDKB 1JWBD 5G5GA 1STEA 4R3DA 1XLQA 1GOZA 1L4DB 4EE2A 1FXAA 2DWQA 2IDYA 3KQ4A 5BMGA 4REZA 2L1AA 1JWMD 1C77A 3IAS1 3AEAB 4RNAA 3IAM1 3VRAB 1YN3A 1HXYD 2WXKA 3AEEB 1QOBA 3B2GA 1IBXA 2W82A 3ZYYX 3SFDB 1FNWA 1SE3A 5E6JA 1WSPA 1UNSA 2CJOA 1YQ3B 1QF6A 1WXQA 2H89B 2E6XA 1YJIA 3BYYB 3E9SA 4OVZA 4HJGE 3I9V1 3U52E 2ZW0A 5G5HA 4WIPA 1DOIA 2XN9C 4TQ0A 1YNTE 3TEWA 2W3SA 3HVZA 1IGCA 4WAFA 4GDLB 3AE2B 1MHHE 2EELA 5D3IB 1KRHA 1ZPSA 3U4EG 4KKJA 1NI3A 1DOYA 5HFYA 1V1PB 1FFVA 3IT6B 3HVDA 2FUG1 3VQIA 1E7PB 4US8A 1OQRA 2OHFA 5D7GA 1F0ZA 5TSSA 2NMQA 1B1ZA 1FRRA 2VZKB 5MPOA 1NYRA 4RH6A 4OZAA 1VZ6A 1PGAA 3NZ3A 1FFUA 3Q8BA 1TS5A 4LLGM 5EE0A 4ZHOA 4YXDB 1FCCC 1SBBB 1VZ7A 3W1SA 4A55A 1R7SA 1XCTL 1DGJA 3MJ5A 1V97A 2N7JA 3BWUD 5GXGB 4IOIE 4A6QA 3P1MA 3AE4B 2HTME 1L0XB 1SB3C 1XLOA 1TJEA 3LYYA 1XLNA 4LTUA 3U2SC 4L1BA 3P4QB 4MM3B 2V3PA 4NZLB 2PVGC 4L2YA 1TKEA 4D2KA 2J42A 3NRZA 4US9A 1SE4A 1ZDVA 1FRDA 1ZUD2 2SAKA 4HROA 1F2RI 4RCOA 3L4PA 3IT4B 2I38A 2LHEA 2QIEB 2Z8LA 2BS2B 2JYEA 1EWYC 1PUTA 2K22A 2I2YA 3OWEB 2W55A 1N61A 3I57A 1OQQA 4ZYSA 1L0YB 5C2TB 1QLBB 1DYQA 4P16A 2BBCA 2LEKA 4A9AA 4IKGA 5BMHA 2AX5A 1UWXA 3SEBA 5HI1A 4C56C 5FR3A 1QKZA 1GPXA 1I4GA 2RMMA 4JWUC 1CQVA 1V8CA 2JQRB 3BIID 1TS3A 3TEXA 1E9MA 1WGKA 1D5ZC 4C7YA 1HEZE 1K51A 4XE0A 2LHDA 4USAA 3LB8C 2Y5CA 1NEKB 3ABVB 4JPSA 1JCKB 1XCQL 4XDDA 1WRIA 4AQ7A 1FNUA 1N60A 2DYOA 2Q5WD 5BYQA 3W9CB 3O13A 3VRBB 2JWUA 5EE1A 2MJ3A 4N58A 4NJCA 1SIJA 4RF1A 4M0WA 2JU6X 1XO3A 2PIAA 3BYTB 1YN5A 3AN1A 2ICIA 2G1EA 5EE3A 2BTEA 1Y56A 1P7EA 2CU3A 2WXNA 4OZCA 1TY0A 2V3NA 1VLBA 4RGMA 3U7ZA 4JE3B 2ZW1A 3URYA 1N62A 4ZRQA 4XWWA 3W2DA 3ZJTA 1VZ8A 3Q8EA 1C4CA 1HZ6A 2Y5PA 1CJEA 3LXFA 2R61A 1N5XA 2IGGA 1QT9A 2J53A 1K53A 1SEBD 3ZGZA 2QEJC 4P6VF 4MACA 1EU4A 2WXHA 1EWCA 1V1OA 1FD6A 4XWTA 1GB1A 2SEBD 3NVVA 4YSXB 3ZJUA 1I7HA 2FE8A 1PYWD 1ACCA 1NENB 2WXRA 3AM9A 4KGSA 1HA5A 2PLPA 1DOXA 3AEDB 5D3DA 1J7CA 5HHDG 4ZHPA 1TY2A 1QILA 3BVZA 1E10A 1KLUD 2LMCA 1L6UA 4NAMA 5LNK1 3W5UB 3AE1B 3P4SB 3AB5A 2GB1A 2V4IB 3SR6A 1JWAD 1XEEA 2LGIA 3KWVA 2L83A 3V05A 1AN8A 2PVOD 1PGXA 3AEBB 1HQRD 1D5MC 1FXIA 1L0VB 1PGBA 2WQYB 1HZ5A 1EU3A 2KMMA 4A8XC 1QOGA 2HDEA 1C78A 1JROA 1NVID 1TYGB 3AE9B 2WXFA 4AS1A 1VDVA 1JRPA 1QOFA 1GAQB 1I4RA 2ACZB 2DLBA 3FILB 2PMVA 4WQMA 1TKGA 1IGDA 4H2AA 2VZKD 2E3TA 1BUIC 4ITKA 2J52A 1LO5D 2WDVB 1ROEA 3B2FA 4PT5A 4RGOS 1Q10A 2WXMA 1D4BA 5T8IA 2MEKA 1CK1A 2LUMA 2FBWB 4DXFA 4ARCA 2IJ0A 2GRIA 2DBYA 4RGNA 1ENFA 5AUIA 1QOAA 4J3OD 4KGTA 1I4PA 2MJEA 4B0EA 1T3QA 2AQ3B 2J4XA 2M19A 2WXLA 3NS1A 4ZOHC 3Q8AA 4JX1C 1KH0A 1JALA 3EUB2 1C4AA 4DXGA 3Q8FA 1MI0A 4WURA 1TS4A 1TS2A 5FK9C 1RWSA 3MC0B 2KACA 3J9CA 4YTNB 2QJLA 3R2IA 1I4XA 1YN4A 3MHZA 2WLBA 2WXIA 1YQ4B 1V1PA 4WH4A 2JSVX 1ESFA 1C76A 4FXCA 1ZP0B 5AUKA 4UDUC 1ZDXA 2CJNA 2WXJA 1J7BA 3PZ8A 2OEDA 3T3OA 2JZPA 2M56B 3Q8CA 4TSSA 3BVMA 2INPE 4YT0B 2KN4A 2KWDA 3AV8A 1L6VA 3GS2A 2EKIA 1JWSD 1J7AA 1RYJA 3P4RB 1PDXA 3RFZB 1IBXB 2YEPF 1VJKA 1VRAB 1ET6A 2X38A 2L52A 2N9LA 2WDRB 4TMAB 4YTPB 1CZPA 2PKOA 2ON8A 3H8HA 4KX6B 5C3JB 2WXGA 2GI9A 3FILA 2WS3B 4KKIA 4N59A 1B9RA 1A70A 4MH8A 1ZXHA 4B0MA 2KQ4X 3PO0A 1F2RC 5EE9A 1NYQA 2WU2B 2AQ1B 1F77A 3RPFC 2DYMA 1WWTA 2Y3AA 2M0AA 2BYTA 2NTSA 3CIRB 3AEFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWA D;  2K5P A;  4JWS C;  2H88 B;  2L83 A;  3SFE B;  1KF6 B;  2PVG C;  1TKE A;  3NRZ A;  2PVO D;  3AE7 B;  1ZXI A;  3AEB B;  4YTM B;  3FAH A;  4US9 A;  1ZUD 2;  1FRD A;  1FXI A;  1L0V B;  1RFK A;  1OFF A;  4IDI A;  4HRO A;  2WQY B;  2BS4 B;  1E6E B;  1L5P A;  2KMM A;  3NVZ A;  3L4P A;  1AWD A;  1QOG A;  1TYG B;  1JRO A;  1NVI D;  3AE9 B;  2JX5 A;  3AE8 B;  2QIE B;  1JRP A;  1QOF A;  1GAQ B;  1XLP A;  2ACZ B;  1VDV A;  3P4Q B;  2WU5 B;  2BS2 B;  1E0Z A;  2W3R A;  1EWY C;  1FM0 D;  1PUT A;  2K22 A;  2W55 A;  1N61 A;  2KAJ A;  1SF0 A;  2WP9 B;  4WQM A;  1TKG A;  1OQQ A;  3AE3 B;  1PFD A;  1ZOY B;  2E3T A;  1N63 A;  5C2T B;  1QLB B;  4ITK A;  2LEK A;  3B2F A;  2WDV B;  1ROE A;  4A9A A;  2BT6 A;  1IUE A;  3AEC B;  2AX5 A;  1JQ4 A;  1TKY A;  1WYG A;  1GPX A;  2FBW B;  3CWI A;  2DBY A;  1RM6 C;  2BS3 B;  4JWU C;  5AUI A;  1V8C A;  3VR9 B;  1QOA A;  2JQR B;  3BII D;  5H92 C;  3WCQ A;  1E9M A;  1JWB D;  1WGK A;  2MJE A;  2N0S B;  5G5G A;  1T3Q A;  3HRD D;  4C7Y A;  2K9X A;  2M19 A;  3AE6 B;  3NS1 A;  1XLQ A;  4ZOH C;  4YSY B;  4JX1 C;  1FXA A;  4C7Z A;  2DWQ A;  1JAL A;  3AE5 B;  3EUB 2;  3AEA B;  4USA A;  2W54 A;  3LB8 C;  3VRA B;  2Y5C A;  1NEK B;  1JW9 D;  3ABV B;  1RWS A;  3AEE B;  1QOB A;  3B2G A;  4YTN B;  1WRI A;  2QJL A;  2B76 B;  3ZYY X;  1N60 A;  2Q5W D;  4HRS A;  2WLB A;  1N5W A;  3SFD B;  3VRB B;  3W9C B;  1FO4 A;  1YQ4 B;  5EE1 A;  3P4P B;  2MJ3 A;  2MH7 A;  4N58 A;  2CJO A;  4FXC A;  1SIJ A;  3VR8 B;  1YQ3 B;  1ZP0 B;  1YJJ A;  5AUK A;  3P63 A;  1QF6 A;  2CJN A;  1WXQ A;  2H89 B;  1J7B A;  1XO3 A;  1YJI A;  2PIA A;  3AN1 A;  5EE3 A;  2G1E A;  1AYF A;  1UWM A;  2M56 B;  5G5H A;  2CU3 A;  1DOI A;  3KWL A;  3B9J A;  1VLB A;  4YT0 B;  1FIQ A;  2W3S A;  1N62 A;  3HVZ A;  3W5V B;  3AE2 B;  1KRH A;  3AV8 A;  1L6V A;  1NI3 A;  3AEG B;  1DOY A;  2EKI A;  1FFV A;  3AMZ A;  1J7A A;  1E7P B;  1RYJ A;  3P4R B;  4US8 A;  3HUI A;  1OQR A;  5H8Y E;  1PDX A;  1CJE A;  3ETR A;  3LXF A;  2OHF A;  4C80 A;  1F0Z A;  1N5X A;  3NVY A;  1QT9 A;  2MJD A;  1VJK A;  1FRR A;  5MPO A;  1NYR A;  4P6V F;  4N6E B;  2L52 A;  2WDR B;  3NVW A;  3AH7 A;  1FFU A;  4YTP B;  1CZP A;  2PKO A;  1FMA D;  5EE0 A;  3NVV A;  4KX6 B;  4YSX B;  4ZHO A;  5C3J B;  1I7H A;  4YXD B;  2WS3 B;  1NEN B;  3DWG C;  3AM9 A;  3DWM A;  4N59 A;  1B9R A;  1DOX A;  3AED B;  2WDQ B;  1R7S A;  1A70 A;  3FC4 A;  1DGJ A;  1J7C A;  4ZHP A;  1V97 A;  3PO0 A;  5GXG B;  1E10 A;  3P1M A;  3AE4 B;  5EE9 A;  2HTM E;  1NYQ A;  1SB3 C;  1KFY B;  1L6U A;  1TJE A;  1XLO A;  2WU2 B;  1XLN A;  3W5U B;  3AE1 B;  4LTU A;  3RPF C;  1WWT A;  3P4S B;  3AB5 A;  3CIR B;  4YSZ B;  3AEF B;  4WWM A;  3SR6 A; 
#chains in the Genus database with same CATH topology
 3EA6 A;  3QAQ A;  2NTT A;  3SFE B;  2XEW A;  4B6W A;  3AE7 B;  1ZXI A;  4CQN A;  2G4D B;  3KUD B;  2IO3 B;  1XXG A;  2GOW A;  2QSD A;  2WYQ A;  2BS4 B;  3DBR I;  3NVZ A;  4MDK E;  4OW0 A;  4WWP A;  4ICU A;  4W9K A;  3NUH B;  4OZB A;  3RNF C;  2D11 A;  2XNA C;  3AE8 B;  2WU5 B;  2W3R A;  3TIX A;  4FHJ A;  3PT2 B;  3BZD B;  1OQY A;  3UIO B;  3EC8 A;  3H7S A;  4S17 A;  2N4F A;  3EGR A;  3KLS X;  3RNG C;  1UGM A;  1V86 A;  2PEA A;  4OHJ A;  4F7Z A;  4MH0 E;  2JPH A;  3N32 A;  1SE2 A;  3PLU A;  1Q1O A;  1BXT A;  1TZO A;  5BYS A;  3M3J A;  3ZJV A;  5J2R A;  4HRS A;  1SGH A;  2LFI A;  4ACF A;  4HEA 1;  2KDM A;  2WXO A;  3DBH B;  3BK2 A;  3H7P A;  3CF6 E;  1UWM A;  2PTL A;  3DCG A;  3N30 A;  3A4R A;  2C7H A;  2PPH A;  3LDZ E;  4JIO U;  2INN E;  1TIF A;  1UEL A;  3VHT C;  2N9K A;  3JSV B;  2C9W B;  1J19 A;  3R2T A;  1WJ4 A;  2MRP A;  3V3X A;  3NVY A;  2UU7 A;  1MJD A;  4DDI D;  4YWG G;  2AQ2 B;  3AH7 A;  1FMA D;  2QHO A;  2K0P A;  1C79 A;  3DWG C;  2AL3 A;  2WDQ B;  3VH4 B;  3FC4 A;  5AEK B;  1E7V A;  1MPE A;  1RAX A;  1UUP A;  2Z0E B;  2KKC A;  4WWM A;  1FO4 A;  1SJH D;  1Y8R C;  5KHO A;  3EHV A;  4JWS C;  1VD2 A;  2RGF A;  1WGD A;  1ET9 A;  4A3P A;  1MVK A;  4RFB A;  1I4H A;  2BW2 A;  2RPV A;  2WP9 B;  3P2B A;  3AE3 B;  1ZOY B;  4PK1 A;  1T0S C;  1OGW A;  3R8B A;  2KC1 A;  1ZW7 A;  2VH1 A;  4C4V B;  4CHK A;  3QX1 A;  2GBR A;  5G5G A;  5JHA A;  4R3D A;  4AP4 C;  5E6N A;  3RT3 B;  4EKU A;  3B2G A;  5IP4 D;  4A20 A;  3RMK C;  1FNW A;  1SE3 A;  5E6J A;  3ZNG C;  1QF6 A;  1WXQ A;  4GGQ A;  3E9S A;  1LXD A;  2MBB B;  3I9V 1;  3U52 E;  3HM3 A;  4MGZ E;  1DOI A;  4WIP A;  2XN9 C;  1UBI A;  2W3S A;  3HVZ A;  4GDL B;  2EEL A;  3WA0 A;  1NI3 A;  3VFK A;  4ZDV A;  5HFY A;  1V1P B;  3IT6 B;  3HVD A;  2FUG 1;  4MSM B;  3ZVV A;  4US8 A;  2OHF A;  5TSS A;  5CTR C;  2NMQ A;  3NG0 A;  5MPO A;  1NYR A;  4RH6 A;  1PGA A;  1UZX B;  2KZR A;  3KUC B;  3NZ3 A;  4I6N B;  4M00 A;  2WX1 A;  3Q8B A;  4F1S A;  3QQ8 B;  4KV2 A;  2KWU B;  3MJ5 A;  1V97 A;  3BWU D;  4LNF A;  1TGZ B;  3P1M A;  3AE4 B;  3NOB A;  4FHK A;  1XLO A;  3LYY A;  1XLN A;  1AAR A;  4L1B A;  2KTR B;  2MLB A;  2V3P A;  4NZL B;  2PVG C;  5EDS A;  1ZUD 2;  2RDB C;  4DHZ E;  4ICV A;  1F2R I;  3DHG C;  3IT4 B;  4GSW A;  2I38 A;  2BS2 B;  5G2N A;  2MW5 A;  4MSQ B;  2K22 A;  3UGB B;  3OWE B;  2LRU A;  1L0Y B;  2BBC A;  3WAP A;  4IKG A;  4MGI E;  5BMH A;  2LXC A;  4KVG B;  3APF A;  4G11 A;  5IO9 A;  1I4G A;  1CQV A;  1V8C A;  1E9M A;  4NAW A;  1D5Z C;  1K51 A;  2MP2 A;  3N1Z C;  4JPS A;  3ABV B;  3A9K B;  1XCQ L;  1WRI A;  2DYO A;  1N60 A;  2Q5W D;  1WGG A;  4M0W A;  2JXX A;  1T0Q C;  1WXA A;  2BTE A;  1Y56 A;  2KDB A;  4G0N B;  4NNJ B;  4BKS A;  5CX3 A;  5L83 A;  1P7E A;  2WXN A;  4XWW A;  4I6L B;  5AZG A;  2GBJ A;  2K8C A;  3LXF A;  4LJO B;  1N5X A;  2IGG A;  1QT9 A;  2Z0D B;  4GXB A;  3ZGZ A;  4MAC A;  2WXH A;  2ZEQ A;  1EWC A;  4IM2 A;  2DAJ A;  2KMA A;  1YD8 U;  4W9E A;  3ZTC A;  2WXR A;  2FIF A;  3AM9 A;  1HA5 A;  1IYF A;  1DOX A;  4ZHP A;  1OTR B;  1WI0 A;  1UD7 A;  4NAM A;  1L6U A;  2NPT B;  3W5U B;  3PRZ A;  2V4I B;  4BKT A;  2WGS A;  2LGI A;  3KWV A;  3N20 C;  3V05 A;  3AEB B;  4W9G A;  1D5M C;  1FXI A;  2X8X X;  5BO4 B;  4K7U A;  4TV3 A;  1HZ5 A;  1EU3 A;  2V3S A;  2NBW B;  2KK8 A;  2V4L A;  1JRP A;  2MSE D;  2L76 A;  2JZZ A;  2GMI C;  2VZK D;  1TT5 B;  2WDV B;  1Q10 A;  2WXM A;  1GC7 A;  2LUM A;  4DXA B;  2FBW B;  1KJT A;  3ZDM C;  4BBN C;  1ENF A;  1QOA A;  4J3O D;  5KHQ A;  2M19 A;  2WXL A;  4ZOH C;  5JH5 C;  3SD5 A;  4JX1 C;  3H7P B;  1C4A A;  3EEC A;  3Q8F A;  4GU2 A;  1MI0 A;  1YIW A;  3T9L A;  2KAC A;  3J9C A;  3M63 B;  4YTN B;  2I1K A;  1F9J A;  4W9C A;  4JLC A;  1C76 A;  4EZJ A;  1ZP0 B;  3WAM A;  3DBH I;  2KJR A;  2WXJ A;  2KLC A;  2JZP A;  2LWP A;  1T0Y A;  3R7R A;  4NJ7 A;  3ZRF A;  4NPN A;  4A3O A;  2INP E;  3QC8 B;  4YT0 B;  3IG3 A;  2HTH A;  2N1V A;  3AV8 A;  2K25 A;  2NBU A;  3PRM B;  1J7A A;  3ZIM A;  3RFZ B;  2V1Y A;  3MHS D;  1V80 A;  3APD A;  4YTP B;  1CZP A;  1E8Z A;  2ON8 A;  3DVN U;  4KX6 B;  2D3B A;  3QA8 A;  1B9R A;  5TR5 A;  2MWS B;  1ZXH A;  2KQ4 X;  2K8B A;  2ZNV C;  2BKR B;  1G6J A;  1NYQ A;  1Z2M A;  2M0A A;  3CIR B;  3APC A;  3PV1 A;  4K7S A;  4KDL B;  4TQ1 A;  4WAA A;  4KDI C;  2KHW B;  1MHX A;  4E3C A;  1SSN A;  1T5X D;  4IDI A;  1AWD A;  3N9Y C;  2BB5 A;  2DEN B;  3PSE B;  5G55 A;  4M8M A;  4XDC A;  4DK5 A;  4JQW C;  4Q2J A;  5FR6 A;  5JXV A;  4JGH B;  5AZF A;  2IPK D;  1JQ4 A;  1UGJ A;  2BS3 B;  2J7Q B;  1V81 A;  2CU1 A;  2DZI A;  2D3G A;  1RLF A;  2KAN A;  3M62 B;  1YMH E;  3ML9 A;  1WE7 A;  5JZE B;  1L2N A;  1TZ1 A;  3EFC A;  1S1Q B;  1XF5 L;  3H9D A;  4N9F 4;  3TL5 A;  1N5W A;  1WGY A;  2WHI A;  2KQ7 A;  1T6B X;  3VR8 B;  2WXP A;  4XX5 A;  1AYF A;  2EMT A;  1X1M A;  3CSF A;  1GB4 A;  4ZRJ A;  4KIK A;  2NS5 A;  3KWL A;  1SJE D;  2HE7 A;  1AW7 A;  4ANV A;  3AEG B;  4LK0 M;  3MP9 A;  3Q3M C;  2EKE C;  2L3Z A;  5H8Y E;  1XT9 B;  3VVW B;  1LFD A;  5IKC M;  5IA7 A;  2KX3 A;  4DQO C;  2JYT A;  2CKH B;  3DWM A;  4FLH A;  4LJP B;  2L0F A;  4WJP A;  3C8Y A;  3MTN B;  4C7Z A;  2O2V B;  1M4V A;  4QAY A;  1VCB A;  4YSZ B;  1WF9 A;  2H88 B;  4NAW B;  1SXT A;  2IO2 B;  4BAX A;  5CHF A;  3ZO5 B;  1E6E B;  1L5P A;  3GB1 A;  3TSS A;  2JX5 A;  2ONQ A;  2BWF A;  2J0J A;  2BB6 A;  1FM0 D;  2RDG A;  5FKA C;  1P7F A;  2HJ8 A;  1D6E C;  2CS4 A;  2XBB C;  4IUM B;  2QMT A;  3Q14 C;  3LJ3 A;  4IM0 A;  4FUL A;  5D94 A;  3L0W B;  3UIP B;  3C0R B;  3QWZ B;  3A1Q A;  3X23 A;  2AEH A;  1V6E A;  1XLQ A;  2LXA A;  4FA6 A;  1GOZ A;  2FCN A;  2DWQ A;  2IDY A;  3KQ4 A;  5BMG A;  4REZ A;  3IAS 1;  2UYZ B;  3AEA B;  4RNA A;  3IAM 1;  1WJ6 A;  1ISN A;  1QOB A;  1IBX A;  2B3A A;  3ZYY X;  5DPW A;  1P9D U;  2K8H A;  2N9P C;  1UNS A;  2KWC A;  2CJO A;  2MBQ A;  3IFW B;  2H89 B;  2E6X A;  1YJI A;  2KXJ A;  3BYY B;  4MGY E;  2XK5 B;  3TJP A;  3TEW A;  2OJR A;  4WAF A;  1MHH E;  3WAN A;  4KKJ A;  3VUX A;  4G3X B;  1OQR A;  2MBH A;  4BKS D;  1F0Z A;  3PHX B;  4HPL B;  4FJV B;  4OZA A;  3IBE A;  2O6V D;  1FCC C;  4C00 A;  4A55 A;  1R7S A;  1QZE A;  1XCT L;  5IN7 A;  2N7J A;  1WH3 A;  3N3K B;  1R4M B;  4KZC A;  4MM3 A;  3P4Q B;  2KX0 A;  2KDI A;  1Q0W B;  2IND C;  1TKE A;  2J42 A;  4IC7 B;  3GOE A;  4P1B C;  3HM6 X;  4ZYN A;  2INC C;  4HRO A;  4RCO A;  1H4R A;  2IBI B;  2D3C A;  3L4P A;  2IO0 B;  4DHJ B;  2QIE B;  3NJT A;  1GC6 A;  3VUY A;  2I2Y A;  2W55 A;  1N61 A;  3TMP B;  2KYW A;  3ZTD A;  2L00 B;  5C2T B;  5C23 A;  2N7D A;  4HWI B;  4C56 C;  5FR3 A;  2C7M B;  4M02 A;  3RNE C;  4JWU C;  3BII D;  4MJS B;  3TEX A;  2N9E B;  4II3 B;  3SU8 X;  2GBN A;  1HEZ E;  4W9L A;  4XE0 A;  2LHD A;  2KOX A;  3CMM B;  4AQ7 A;  4FAD A;  2KTF A;  3O13 A;  3ZLZ A;  4RF1 A;  3PRP B;  3RNB C;  2JU6 X;  2G4S A;  2G45 B;  3AN1 A;  4HJK A;  5EE3 A;  2G1E A;  3RI7 C;  2L05 A;  4CO7 A;  3KYC D;  4RGM A;  4JE3 B;  2ZW1 A;  3U7Z A;  1D3Z A;  3ZJT A;  3Q8E A;  3ZXV A;  2L7R A;  1KLV A;  3PPA A;  2R61 A;  3V60 A;  2J53 A;  4IM3 A;  3ZDT A;  1K53 A;  1SEB D;  4W9J A;  1V1O A;  1WMH A;  3DVN V;  3NVV A;  4YSX B;  1I7H A;  2RSU A;  4KGS A;  2M8S A;  3RUL A;  4GOC A;  3AED B;  3TCA A;  2NCN A;  3IHP C;  3H6N A;  4MEM A;  4PYZ A;  2A4Z A;  5JHB A;  3PZD A;  3ECI A;  2NBV B;  2GB1 A;  2PJH A;  2LVP A;  2KFK B;  2K1F A;  2WQY B;  4PS3 A;  4I6P A;  1TYG B;  1JRO A;  3AE9 B;  3TBL D;  2BPS A;  2WXF A;  4AS1 A;  1QOF A;  1GAQ B;  1EO6 A;  3V6C B;  2LJ5 A;  1XD3 B;  1V49 A;  4EEW A;  1WGR A;  3QIJ A;  3S2A A;  1IGD A;  4CYE A;  1F1H A;  2E3T A;  1BUI C;  3U8Z A;  2J52 A;  1LO5 D;  2FCS A;  2EMS A;  4RGO S;  1D4B A;  1WJU A;  2MEK A;  3AI5 A;  4XC2 A;  1F52 A;  4IWQ A;  2IJ0 A;  2DBY A;  1LQB A;  5AUI A;  5LXH A;  2L0T A;  3KUZ A;  3PVL A;  3MJW A;  2GLS A;  4PS7 A;  4ASW C;  3Q8A A;  3RCZ A;  5C1Z A;  4DXG A;  4WUR A;  1TS2 A;  2D3A A;  5FK9 C;  2J0K A;  3MC0 B;  3ZRC A;  4FJZ A;  2QJL A;  3R2I A;  1YN4 A;  2PE6 B;  3MHZ A;  3Q6B A;  1YQ4 B;  1ESF A;  5AUK A;  3GZN I;  4UDU C;  3PZ8 A;  4X57 B;  1KOT A;  2VRR B;  1FXT B;  3KYD D;  2QDF A;  3Q8C A;  3PGE A;  4MJS A;  3L08 A;  3T8M A;  4NJ6 A;  2KWD A;  5E6O A;  1JWS D;  1OEY A;  1PDX A;  1CMX B;  3DBL I;  2IYD B;  1ET6 A;  3IVF A;  2CR5 A;  1WM2 A;  5C3J B;  3Q2A C;  3HHM A;  2WS3 B;  4IWO A;  4MH8 A;  1EF1 A;  5GMV A;  4GDL A;  4BVU C;  2JT4 B;  2AQ1 B;  1F77 A;  1WWT A;  2DYB A;  2WWZ A;  1UH6 A;  2M0X A;  3A33 B;  3U30 A;  4IWP A;  4RGT A;  4GN1 A;  5CHW A;  2WDT B;  1RRB A;  1BT0 A;  1E8W A;  1RFK A;  2BKF A;  3RYT A;  4ANX A;  4DHJ D;  3Q3O C;  1QQR A;  3TUO A;  1K52 A;  1P3Q U;  3VH3 B;  2M4N A;  2IGH A;  1K50 A;  2D07 B;  4LNN A;  3CWI A;  1FEH A;  3RZW C;  2FCM A;  5J17 A;  3HRD D;  4YSY B;  2FUH B;  2MBO A;  4GLS C;  2W54 A;  1JW9 D;  3DOW A;  4M8N A;  3VUW A;  5BYR A;  3KVF B;  1ZE3 D;  2MH7 A;  3C19 A;  1YJJ A;  3P63 A;  3Q69 A;  3PTF C;  1HTQ A;  2GBK A;  3P42 A;  4KGR A;  1FIQ A;  3W5V B;  1JWU D;  1BML C;  1H8C A;  2KMC A;  4M01 A;  3E56 A;  3DBS A;  4PS8 A;  3VDZ A;  3TEY A;  1WX9 A;  3B08 A;  1P1A A;  4NQL B;  1C9F A;  4N6E B;  3NVW A;  4WJN A;  4HXD A;  2CHW A;  4BFR A;  1L7Y A;  2K3U A;  2MX2 A;  3D32 A;  4HK2 A;  4K1R B;  1SE9 A;  2KNB A;  2HD5 B;  1E90 A;  3PZ7 A;  1MG4 A;  2LD9 A;  2YEP B;  3VAW A;  1KFY B;  2JXT A;  3BK1 A;  3DVG X;  3NZS A;  3VTV A;  4MT5 A;  2RDH A;  2KVR A;  2K5P A;  1I4Q A;  2NPT A;  3V62 A;  2LRW A;  3T3N A;  3H1U A;  2ZVN A;  1XLP A;  1YJ1 A;  4K3C A;  1WMH B;  1SF0 A;  2V0G A;  4FJY A;  1N63 A;  2JRH A;  3PHW B;  1IUE A;  1UBQ A;  4WWN A;  1L4Z B;  1YQB A;  2K39 A;  1TKY A;  1WXV A;  2D5G A;  2TSS A;  1WYG A;  2G9H D;  3RN9 C;  1EM7 A;  1PQS A;  1WRD B;  1JWB D;  2OOB B;  3KH0 A;  1STE A;  4DWF A;  1FXA A;  2L1A A;  1JWM D;  2AYO B;  2K6D B;  2ZVO A;  4JL9 A;  1YN3 A;  2NVU I;  2WXK A;  3AEE B;  2W82 A;  2G3Q B;  5LXI B;  4IG7 B;  2MBE A;  4OVZ A;  5G5H A;  2KJ6 A;  2LGD A;  1GJZ A;  4EFO A;  2N1W A;  2ASQ A;  1IGC A;  5D3I B;  3U4E G;  3V61 A;  4HPP A;  4LNO A;  3I3T B;  1DOY A;  3GE8 C;  4KIK B;  5D7G A;  1N6Z A;  1FRR A;  5HKH A;  3Q3J A;  2WX0 A;  1E7U A;  1VZ6 A;  1WR1 A;  1FFU A;  1HE8 A;  4DDG D;  1FPY A;  4LLG M;  4M0W B;  5EE0 A;  5IOI A;  4ZHO A;  4YXD B;  4F8C B;  1SBB B;  3PS6 A;  3W1S A;  2C60 A;  4GIV A;  5DPR A;  1DGJ A;  1EUV B;  2HTM E;  1L0X B;  1SB3 C;  3DPD A;  4LTU A;  2OJW A;  4MM3 B;  3BY4 B;  5DPT A;  4L2Y A;  4BOZ B;  4D2K A;  3NRZ A;  2FAZ A;  1E5W A;  3W1Y A;  4KZ0 A;  1V5T A;  3DBL B;  3K9O B;  2LHE A;  2Z8L A;  2JYE A;  1PUT A;  4ANU A;  1ZGU B;  4YL8 A;  1GUA B;  4EZL A;  3I57 A;  1OQQ A;  1WY8 A;  4W9F A;  1QLB B;  3W1S C;  1LM8 B;  2M1M A;  2FID A;  2ZJD A;  5HI1 A;  1GPX A;  2PE9 A;  3DDC B;  2RMM A;  1V2Y A;  2JQR B;  1WGK A;  3ALB A;  2KC2 A;  2RD0 A;  2LGS A;  1V9J A;  2JUO A;  1FNU A;  5BYQ A;  3W9C B;  3OG5 A;  2JWU A;  3B1L X;  5EE1 A;  4NJC A;  4HDQ A;  1XO3 A;  4IW0 A;  2UWQ A;  3BYT B;  3O65 B;  1YN5 A;  5CHV C;  4AJW A;  2BYV E;  2CU3 A;  4OZC A;  1TY0 A;  2REX A;  1VLB A;  3VXW A;  1N62 A;  4ZRQ A;  3A9J A;  3W2D A;  2CHZ A;  2BQQ A;  2L8J A;  3JSV A;  1C4C A;  2KVZ A;  2Y5P A;  1CJE A;  2KN5 A;  3Q3F A;  4BBN F;  3BIN A;  2MHJ A;  4P6V F;  3ZKJ C;  1EU4 A;  1JRU A;  1FD6 A;  3R66 C;  2FE8 A;  1PYW D;  1ACC A;  1NDD A;  3A9K A;  2O6V B;  1ZKH A;  5HHD G;  3BVZ A;  1QIL A;  2JY6 A;  4NQK E;  1E10 A;  2LVQ A;  1KLU D;  4PYU A;  1TTN A;  1HTO A;  2LMC A;  4FN2 A;  2IY0 B;  3P4S B;  3OAW A;  3SR6 A;  1JWA D;  4AWJ A;  1AN8 A;  3L16 A;  1L0V B;  2KLG A;  2KMM A;  2HDE A;  1C78 A;  1VDV A;  4ANW A;  2ACZ B;  2DLB A;  4LCD E;  2DAF A;  2PMV A;  5LLI A;  4DBG A;  4WQM A;  3UF8 A;  3NY5 A;  1WXS A;  4P1C C;  4ZRI A;  2BYE A;  2QCZ A;  4GB9 A;  2GRI A;  4RGN A;  5J18 A;  2FCQ A;  4NY0 A;  1NI2 A;  1T3Q A;  3X0W A;  3NS1 A;  1J8C A;  4WQO B;  1KH0 A;  3EUB 2;  1WZ0 A;  1E8Y A;  1TS4 A;  4KSL C;  2WXI A;  1V1P A;  4WH4 A;  2JSV X;  1YX5 B;  2AL6 A;  2CJN A;  5E6P A;  2OED A;  4WWO A;  3SDL C;  2IY1 B;  3A1Q B;  2K6Q A;  2CHX A;  4BKG A;  2LGX A;  1WJN A;  1L6V A;  3GS2 A;  1RYJ A;  3P4R B;  1IBX B;  2YEP F;  1VJK A;  4GDK A;  2MA9 B;  1R4N B;  2N9L A;  2WDR B;  3QAR A;  4WJQ A;  3H8H A;  3FIL A;  2I1J A;  3V6E B;  4B0M A;  3PO0 A;  3NHE B;  5EE9 A;  1MG8 A;  3L17 A;  3JW0 X;  4OVV A;  1R4M I;  2DYM A;  5I4D A;  5IAA C;  3QJZ A;  2KD0 A;  1OFF A;  2NR2 A;  3ZQ4 A;  5AZH A;  2VH2 A;  4O1N A;  2ZCB A;  5HG2 A;  4P7I A;  1E0Z A;  1FNV A;  1JML A;  3MC9 A;  4A90 A;  2JZ3 B;  4AOF A;  5D2M B;  1PFD A;  2DZJ A;  2BT6 A;  3DBR B;  3AEC B;  1R4N I;  2KFJ A;  1LGR A;  3AU5 A;  4AJY B;  2Z59 B;  1VR9 A;  1C1Y B;  3WCQ A;  2N0S B;  3UIN B;  1WYW B;  2K9X A;  1D5X C;  3AE6 B;  3N1Y C;  3AE5 B;  3WAL A;  2O6V A;  2PW9 A;  2B76 B;  4HDO A;  4BZA A;  1WE6 A;  2L32 A;  2C5L C;  3P4P B;  3M95 A;  2BF8 B;  1KM7 A;  2LJI A;  3VTW A;  3OJ4 B;  4HKZ E;  2LVO A;  2BWE S;  3B9J A;  3QK0 A;  3UQB A;  3MFG A;  2IGD A;  1EF5 A;  1IPG A;  3HK0 A;  2C7N B;  3I5J C;  3CST A;  4RM8 A;  1RFA A;  3AMZ A;  2IZV B;  2N7E A;  3HUI A;  4OVU A;  3ETR A;  4C80 A;  3R3M A;  1KLG D;  2MJD A;  2WXQ A;  3BVG A;  4S0R A;  2JRI B;  3EFU A;  3AU4 A;  1FCL A;  3OJ3 A;  5D6J B;  3UI3 A;  2J0M A;  2LI5 A;  2WNM A;  2MCN B;  2LAS A;  3ZW3 A;  3UQA A;  3ZNH B;  3TEZ A;  3NS8 A;  5BMI A;  4HKQ A;  4W9I A;  1P0R A;  2ZCC A;  3DVG Y;  3RD2 A;  4L23 A;  2KDF B;  1KF6 B;  1KTK A;  3DQV A;  1M94 A;  4ZRP A;  3FAH A;  4YTM B;  3Q3N C;  2HJ1 A;  4LNI A;  2QIL A;  4RF0 A;  4URK A;  2DNF A;  2KAJ A;  3IXS A;  4ARI A;  4K7W A;  2BGF A;  4XGA B;  3JYU A;  2N9X A;  2BVC A;  4LNK A;  4W9D A;  3U7D A;  4LDT D;  1S3S G;  3RZF A;  1C4P A;  3GP7 A;  4G50 A;  4KSK C;  1RM6 C;  3VR9 B;  2KDE B;  5H92 C;  2KO3 A;  4GDK B;  4LDT B;  3RUI B;  2O2V A;  4EE2 A;  1L4D B;  4HPM B;  1C77 A;  3ONS A;  3PRE A;  1XQQ A;  3VRA B;  1YX6 B;  5DCN A;  1HXY D;  3AXC A;  2Y5B B;  4HVB A;  3SFD B;  1NBF C;  1U4A A;  1WSP A;  1YQ3 B;  4E74 A;  3OLM D;  4HJG E;  1GG3 A;  2ZW0 A;  1SIF A;  4II2 B;  4TQ0 A;  1C3T A;  1YNT E;  1IP9 A;  3AE2 B;  3DHH C;  2DZM A;  1KRH A;  1ZPS A;  4C4V A;  1A5R A;  2MQJ A;  3GZN B;  1FFV A;  3VQI A;  4HCN B;  3JVZ X;  1E7P B;  2KT7 A;  1WX8 A;  4GMV A;  1B1Z A;  2A5U A;  2VZK B;  3QCA A;  1TS5 A;  1I35 A;  2LGY A;  4TUU A;  1VZ7 A;  5GXG B;  4IOI E;  4A6Q A;  1TJE A;  2KQS A;  3L54 A;  3U2S C;  3RNA C;  3N1X C;  4AUQ C;  5L95 C;  3SHQ A;  2KJH B;  2ZNV B;  2LZ6 A;  4US9 A;  1SE4 A;  1ZDV A;  1FRD A;  2SAK A;  3HIZ A;  4XZ4 A;  1YOV B;  4B9K A;  4RM9 A;  4HCP B;  2XK5 A;  2IO1 B;  3WIM A;  1EWY C;  4TKN A;  4EUT A;  1Q5W B;  1WM3 A;  4ZYS A;  1DYQ A;  4P16 A;  2JF5 A;  2LEK A;  3ENE A;  4A9A A;  2AX5 A;  1UWX A;  3SEB A;  1QKZ A;  4HLE A;  2DZK A;  1Z5S B;  3VTU A;  3WAO A;  1TS3 A;  1WGH A;  4C7Y A;  2R2O A;  2KTR A;  2R2Q A;  4USA A;  3LB8 C;  5DPS A;  2Y5C A;  1NEK B;  1JCK B;  4XDD A;  3VRB B;  4EZK A;  2MJ3 A;  4N58 A;  2W9N A;  1SIJ A;  4B95 A;  2PIA A;  3L10 B;  2ICI A;  3MC8 A;  1J0G A;  2QC8 A;  2GBM A;  2JWZ A;  1OEY J;  2YLM A;  2V3N A;  1P98 A;  1V5O A;  3URY A;  3FKY A;  3B0A A;  1VZ8 A;  3A9J B;  1UF0 A;  1WR6 E;  1WX7 A;  1HZ6 A;  2M17 A;  1K8R B;  4RMA A;  2QEJ C;  3ZNI D;  4XWT A;  1GB1 A;  2SEB D;  3ZJU A;  1NEN B;  4WJO A;  2PLP A;  5D3D A;  2D2Q A;  1T0R C;  4MEL A;  1J7C A;  1TY2 A;  3RNC C;  2RR9 A;  3KW5 B;  3R7Q A;  4W9H A;  5LNK 1;  2BYF A;  3AE1 B;  3AUL A;  2RPQ A;  3AB5 A;  2JVC A;  2ZPY A;  2FNJ B;  1XEE A;  3NZU A;  2L83 A;  2PVO D;  1PGX A;  1HQR D;  1PGB A;  4A8X C;  1QOG A;  1NVI D;  3ZUN A;  1I4R A;  2YVC A;  3FIL B;  1TBE A;  3QHT A;  1TKG A;  4H2A A;  4ITK A;  3B2F A;  1ROE A;  4PT5 A;  1WZ3 A;  5T8I A;  1WIA A;  1CK1 A;  4EOY A;  3PLV A;  4DXF A;  4ARC A;  3I63 C;  4KGT A;  1I4P A;  2MJE A;  4B0E A;  1E8X A;  3K9P B;  2AQ3 B;  2AWT A;  2J4X A;  4DHZ B;  1JAL A;  4J6I A;  1I42 A;  1RWS A;  2KWV B;  2D10 A;  1I4X A;  2WLB A;  3DHI C;  1MFW A;  2DHZ A;  2ZPN A;  4FXC A;  4K81 A;  1ZDX A;  2MP2 B;  3ML8 A;  1J7B A;  4XYC A;  3ZXR A;  4K3B A;  3T3O A;  2DX5 B;  4FBJ B;  2M56 B;  4TSS A;  3BVM A;  2KN4 A;  3ZNZ B;  1GNU A;  2V9H A;  4ZRK A;  2EKI A;  2LUE A;  1VRA B;  2ZZP B;  2X38 A;  2L52 A;  4TMA B;  2PKO A;  2WXG A;  2GI9 A;  4E71 A;  4KKI A;  4N59 A;  1WXM A;  4MGK E;  1A70 A;  1F2R C;  2KFK A;  4BOS C;  1WFY A;  2WU2 B;  3A4S C;  3L13 A;  3GE3 C;  2Y3A A;  3RPF C;  2BYT A;  2NTS A;  3AEF B; 
#chains in the Genus database with same CATH homology
 5I4D A;  3EA6 A;  4TQ1 A;  4RGT A;  2NTT A;  3SFE B;  1MHX A;  3AE7 B;  1ZXI A;  4CQN A;  1SSN A;  1XXG A;  1RFK A;  1OFF A;  1T5X D;  2QSD A;  4IDI A;  3ZQ4 A;  2BS4 B;  4O1N A;  3NVZ A;  4OW0 A;  1AWD A;  3N9Y C;  5HG2 A;  3NUH B;  2BB5 A;  4OZB A;  2XNA C;  3AE8 B;  1E0Z A;  1FNV A;  2WU5 B;  2W3R A;  1JML A;  4A90 A;  1QQR A;  4XDC A;  3TUO A;  1PFD A;  1K52 A;  3BZD B;  4Q2J A;  5JXV A;  2IPK D;  2BT6 A;  3AEC B;  2IGH A;  3EGR A;  3KLS X;  1JQ4 A;  1K50 A;  3CWI A;  1FEH A;  1UGJ A;  4OHJ A;  2BS3 B;  1VR9 A;  3WCQ A;  1SE2 A;  2N0S B;  3HRD D;  1BXT A;  2K9X A;  1D5X C;  1TZO A;  3AE6 B;  4YSY B;  5BYS A;  1YMH E;  3ZJV A;  3AE5 B;  4GLS C;  2W54 A;  1JW9 D;  1XF5 L;  2PW9 A;  5BYR A;  2B76 B;  4HRS A;  1N5W A;  2L32 A;  1ZE3 D;  2LFI A;  3P4P B;  2MH7 A;  1T6B X;  3VR8 B;  2WXP A;  4HEA 1;  1YJJ A;  2KDM A;  2WXO A;  3P63 A;  2LJI A;  3Q69 A;  3BK2 A;  1AYF A;  1UWM A;  2PTL A;  4HKZ E;  1GB4 A;  3P42 A;  3KWL A;  3B9J A;  4KGR A;  1FIQ A;  2INN E;  1SJE D;  3W5V B;  1JWU D;  3MFG A;  2IGD A;  2N9K A;  1BML C;  1AW7 A;  3AEG B;  4LK0 M;  3MP9 A;  3E56 A;  3AMZ A;  3R2T A;  3HUI A;  5H8Y E;  4C80 A;  3ETR A;  3V3X A;  1KLG D;  3NVY A;  3TEY A;  2MJD A;  2WXQ A;  3BVG A;  4YWG G;  1C9F A;  2AQ2 B;  1FCL A;  4N6E B;  3NVW A;  3UI3 A;  3AH7 A;  4DQO C;  1FMA D;  2WNM A;  2K3U A;  2JYT A;  1C79 A;  2K0P A;  3DWG C;  3DWM A;  2WDQ B;  3FC4 A;  3TEZ A;  5BMI A;  4HKQ A;  3PZ7 A;  3C8Y A;  2YEP B;  4C7Z A;  1KFY B;  1MPE A;  2JXT A;  1M4V A;  3BK1 A;  1UUP A;  4YSZ B;  4WWM A;  1FO4 A;  1SJH D;  4MT5 A;  2RDH A;  4L23 A;  2K5P A;  4JWS C;  2H88 B;  4NAW B;  1I4Q A;  1SXT A;  1KF6 B;  1KTK A;  4ZRP A;  3FAH A;  4YTM B;  1ET9 A;  1E6E B;  1L5P A;  2QIL A;  4RF0 A;  3GB1 A;  3TSS A;  3T3N A;  2JX5 A;  2ONQ A;  1MVK A;  1XLP A;  4RFB A;  1I4H A;  2BB6 A;  1FM0 D;  2BW2 A;  2RDG A;  5FKA C;  1P7F A;  1D6E C;  2KAJ A;  1SF0 A;  2RPV A;  2WP9 B;  3IXS A;  2V0G A;  4ARI A;  2QMT A;  3AE3 B;  1ZOY B;  1N63 A;  1IUE A;  1L4Z B;  3R8B A;  1C4P A;  1TKY A;  2D5G A;  2TSS A;  1WYG A;  2G9H D;  3GP7 A;  1EM7 A;  1RM6 C;  3VR9 B;  5H92 C;  4GDK B;  1JWB D;  5G5G A;  1STE A;  4R3D A;  1XLQ A;  1GOZ A;  1L4D B;  4EE2 A;  1FXA A;  2DWQ A;  2IDY A;  3KQ4 A;  5BMG A;  4REZ A;  2L1A A;  1JWM D;  1C77 A;  3IAS 1;  3AEA B;  4RNA A;  3IAM 1;  3VRA B;  1YN3 A;  1HXY D;  2WXK A;  3AEE B;  1QOB A;  3B2G A;  1IBX A;  2W82 A;  3ZYY X;  3SFD B;  1FNW A;  1SE3 A;  5E6J A;  1WSP A;  1UNS A;  2CJO A;  1YQ3 B;  1QF6 A;  1WXQ A;  2H89 B;  2E6X A;  1YJI A;  3BYY B;  3E9S A;  4OVZ A;  4HJG E;  3I9V 1;  3U52 E;  2ZW0 A;  5G5H A;  4WIP A;  1DOI A;  2XN9 C;  4TQ0 A;  1YNT E;  3TEW A;  2W3S A;  3HVZ A;  1IGC A;  4WAF A;  4GDL B;  3AE2 B;  1MHH E;  2EEL A;  5D3I B;  1KRH A;  1ZPS A;  3U4E G;  4KKJ A;  1NI3 A;  1DOY A;  5HFY A;  1V1P B;  1FFV A;  3IT6 B;  3HVD A;  2FUG 1;  3VQI A;  1E7P B;  4US8 A;  1OQR A;  2OHF A;  5D7G A;  1F0Z A;  5TSS A;  2NMQ A;  1B1Z A;  1FRR A;  2VZK B;  5MPO A;  1NYR A;  4RH6 A;  4OZA A;  1VZ6 A;  1PGA A;  3NZ3 A;  1FFU A;  3Q8B A;  1TS5 A;  4LLG M;  5EE0 A;  4ZHO A;  4YXD B;  1FCC C;  1SBB B;  1VZ7 A;  3W1S A;  4A55 A;  1R7S A;  1XCT L;  1DGJ A;  3MJ5 A;  1V97 A;  2N7J A;  3BWU D;  5GXG B;  4IOI E;  4A6Q A;  3P1M A;  3AE4 B;  2HTM E;  1L0X B;  1SB3 C;  1XLO A;  1TJE A;  3LYY A;  1XLN A;  4LTU A;  3U2S C;  4L1B A;  3P4Q B;  4MM3 B;  2V3P A;  4NZL B;  2PVG C;  4L2Y A;  1TKE A;  4D2K A;  2J42 A;  3NRZ A;  4US9 A;  1SE4 A;  1ZDV A;  1FRD A;  1ZUD 2;  2SAK A;  4HRO A;  1F2R I;  4RCO A;  3L4P A;  3IT4 B;  2I38 A;  2LHE A;  2QIE B;  2Z8L A;  2BS2 B;  2JYE A;  1EWY C;  1PUT A;  2K22 A;  2I2Y A;  3OWE B;  2W55 A;  1N61 A;  3I57 A;  1OQQ A;  4ZYS A;  1L0Y B;  5C2T B;  1QLB B;  1DYQ A;  4P16 A;  2BBC A;  2LEK A;  4A9A A;  4IKG A;  5BMH A;  2AX5 A;  1UWX A;  3SEB A;  5HI1 A;  4C56 C;  5FR3 A;  1QKZ A;  1GPX A;  1I4G A;  2RMM A;  4JWU C;  1CQV A;  1V8C A;  2JQR B;  3BII D;  1TS3 A;  3TEX A;  1E9M A;  1WGK A;  1D5Z C;  4C7Y A;  1HEZ E;  1K51 A;  4XE0 A;  2LHD A;  4USA A;  3LB8 C;  2Y5C A;  1NEK B;  3ABV B;  4JPS A;  1JCK B;  1XCQ L;  4XDD A;  1WRI A;  4AQ7 A;  1FNU A;  1N60 A;  2DYO A;  2Q5W D;  5BYQ A;  3W9C B;  3O13 A;  3VRB B;  2JWU A;  5EE1 A;  2MJ3 A;  4N58 A;  4NJC A;  1SIJ A;  4RF1 A;  4M0W A;  2JU6 X;  1XO3 A;  2PIA A;  3BYT B;  1YN5 A;  3AN1 A;  2ICI A;  2G1E A;  5EE3 A;  2BTE A;  1Y56 A;  1P7E A;  2CU3 A;  2WXN A;  4OZC A;  1TY0 A;  2V3N A;  1VLB A;  4RGM A;  3U7Z A;  4JE3 B;  2ZW1 A;  3URY A;  1N62 A;  4ZRQ A;  4XWW A;  3W2D A;  3ZJT A;  1VZ8 A;  3Q8E A;  1C4C A;  1HZ6 A;  2Y5P A;  1CJE A;  3LXF A;  2R61 A;  1N5X A;  2IGG A;  1QT9 A;  2J53 A;  1K53 A;  1SEB D;  3ZGZ A;  2QEJ C;  4P6V F;  4MAC A;  1EU4 A;  2WXH A;  1EWC A;  1V1O A;  1FD6 A;  4XWT A;  1GB1 A;  2SEB D;  3NVV A;  4YSX B;  3ZJU A;  1I7H A;  2FE8 A;  1PYW D;  1ACC A;  1NEN B;  2WXR A;  3AM9 A;  4KGS A;  1HA5 A;  2PLP A;  1DOX A;  3AED B;  5D3D A;  1J7C A;  5HHD G;  4ZHP A;  1TY2 A;  1QIL A;  3BVZ A;  1E10 A;  1KLU D;  2LMC A;  1L6U A;  4NAM A;  5LNK 1;  3W5U B;  3AE1 B;  3P4S B;  3AB5 A;  2GB1 A;  2V4I B;  3SR6 A;  1JWA D;  1XEE A;  2LGI A;  3KWV A;  2L83 A;  3V05 A;  1AN8 A;  2PVO D;  1PGX A;  3AEB B;  1HQR D;  1D5M C;  1FXI A;  1L0V B;  1PGB A;  2WQY B;  1HZ5 A;  1EU3 A;  2KMM A;  4A8X C;  1QOG A;  2HDE A;  1C78 A;  1JRO A;  1NVI D;  1TYG B;  3AE9 B;  2WXF A;  4AS1 A;  1VDV A;  1JRP A;  1QOF A;  1GAQ B;  1I4R A;  2ACZ B;  2DLB A;  3FIL B;  2PMV A;  4WQM A;  1TKG A;  1IGD A;  4H2A A;  2VZK D;  2E3T A;  1BUI C;  4ITK A;  2J52 A;  1LO5 D;  2WDV B;  1ROE A;  3B2F A;  4PT5 A;  4RGO S;  1Q10 A;  2WXM A;  1D4B A;  5T8I A;  2MEK A;  1CK1 A;  2LUM A;  2FBW B;  4DXF A;  4ARC A;  2IJ0 A;  2GRI A;  2DBY A;  4RGN A;  1ENF A;  5AUI A;  1QOA A;  4J3O D;  4KGT A;  1I4P A;  2MJE A;  4B0E A;  1T3Q A;  2AQ3 B;  2J4X A;  2M19 A;  2WXL A;  3NS1 A;  4ZOH C;  3Q8A A;  4JX1 C;  1KH0 A;  1JAL A;  3EUB 2;  1C4A A;  4DXG A;  3Q8F A;  1MI0 A;  4WUR A;  1TS4 A;  1TS2 A;  5FK9 C;  1RWS A;  3MC0 B;  2KAC A;  3J9C A;  4YTN B;  2QJL A;  3R2I A;  1I4X A;  1YN4 A;  3MHZ A;  2WLB A;  2WXI A;  1YQ4 B;  1V1P A;  4WH4 A;  2JSV X;  1ESF A;  1C76 A;  4FXC A;  1ZP0 B;  5AUK A;  4UDU C;  1ZDX A;  2CJN A;  2WXJ A;  1J7B A;  3PZ8 A;  2OED A;  3T3O A;  2JZP A;  2M56 B;  3Q8C A;  4TSS A;  3BVM A;  2INP E;  4YT0 B;  2KN4 A;  2KWD A;  3AV8 A;  1L6V A;  3GS2 A;  2EKI A;  1JWS D;  1J7A A;  1RYJ A;  3P4R B;  1PDX A;  3RFZ B;  1IBX B;  2YEP F;  1VJK A;  1VRA B;  1ET6 A;  2X38 A;  2L52 A;  2N9L A;  2WDR B;  4TMA B;  4YTP B;  1CZP A;  2PKO A;  2ON8 A;  3H8H A;  4KX6 B;  5C3J B;  2WXG A;  2GI9 A;  3FIL A;  2WS3 B;  4KKI A;  4N59 A;  1B9R A;  1A70 A;  4MH8 A;  1ZXH A;  4B0M A;  2KQ4 X;  3PO0 A;  1F2R C;  5EE9 A;  1NYQ A;  2WU2 B;  2AQ1 B;  1F77 A;  3RPF C;  2DYM A;  1WWT A;  2Y3A A;  2M0A A;  2BYT A;  2NTS A;  3CIR B;  3AEF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...