1CJEA

Adrenodoxin from bovine
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
b'KITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADRENODOXIN
publication title The tertiary structure of full-length bovine adrenodoxin suggests functional dimers.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
total genus 26
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1cjeA00
1DOXA 1DGJA 2PVGC 3NVVA 3AM9A 1QLBB 3AH7A 3L4PA 3AE5B 3NVWA 3P4RB 1L5PA 1TKGA 3AE4B 2BS3B 3HVZA 4ZHPA 3SFEB 2H89B 3W5VB 1L0VB 4YSXB 3AEAB 2PVOD 2BT6A 1RM6C 4JWUC 1J7AA 3P4PB 3EUB2 2JQRB 3AE8B 3HUIA 1FMAD 1NYRA 1QOFA 1KF6B 3AEGB 1YJJA 3ETRA 3P4QB 1YQ3B 4WWMA 3VR8B 1XO3A 1YJIA 2MJDA 1WXQA 1JW9D 2EKIA 2FBWB 2WP9B 3P1MA 1ZOYB 1E0ZA 1N61A 3ZYYX 1NENB 5G5GA 3AV8A 5EE3A 1TKEA 1FRDA 1N63A 1JWAD 1QOGA 2W3SA 3AE7B 1XLOA 5EE1A 1AYFA 4YSYB 1CJEA 1AWDA 2CJNA 4YTMB 4US9A 3CIRB 4HROA 2W54A 1PDXA 2JX5A 1GAQB 2BS2B 2QJLA 1WRIA 3BIID 1FFUA 3DWMA 4YT0B 2QIEB 1JQ4A 2KAJA 1FFVA 1RFKA 3NS1A 1VLBA 2DBYA 4ITKA 2M56B 3LXFA 1RWSA 3W5UB 2PKOA 1OQQA 2G1EA 2K9XA 1NI3A 5AUKA 3SR6A 1J7CA 2KMMA 3AE1B 2AX5A 1N5WA 2WDRB 1I7HA 3AEFB 1CZPA 1QOBA 3NVZA 1T3QA 1B9RA 2OHFA 2WQYB 3B2GA 1JALA 4P6VF 5MPOA 1SF0A 3VRBB 3B9JA 3AEDB 1N60A 1TYGB 1KRHA 2H88B 4LTUA 4US8A 5H8YE 2MH7A 5GXGB 1QT9A 1TJEA 2WDQB 5C2TB 1QF6A 3VRAB 3B2FA 4C7ZA 2MJEA 1VJKA 4YXDB 1TKYA 2Q5WD 3NVYA 2ACZB 2BS4B 2E3TA 2CU3A 1EWYC 3AMZA 1FM0D 1PUTA 1YQ4B 2WU2B 3AE9B 1ROEA 1UWMA 1OQRA 1FRRA 3CWIA 1JROA 4JWSC 3AECB 4JX1C 1L6UA 4YSZB 3AE6B 2PIAA 4HRSA 5C3JB 4WQMA 4N6EB 3AE3B 4C80A 3VR9B 4YTPB 1FXAA 2DWQA 1ZXIA 1JWBD 1ZUD2 1E7PB 2M19A 1VDVA 4KX6B 1E9MA 5EE0A 3NRZA 5H92C 4A9AA 4ZHOA 3P63A 2WDVB 1R7SA 1E10A 1SB3C 2CJOA 2HTME 2WS3B 1DOIA 1L6VA 1ZP0B 5EE9A 1DOYA 4N59A 1KFYB 1E6EB 2W55A 2N0SB 2W3RA 1WGKA 3FAHA 3SFDB 1A70A 3P4SB 4USAA 1V8CA 3AEBB 3AB5A 3RPFC 1QOAA 3W9CB 1J7BA 3PO0A 2K22A 1WWTA 2L83A 2MJ3A 2WU5B 1JRPA 3AN1A 3KWLA 1GPXA 2K5PA 1FO4A 3LB8C 1IUEA 1NYQA 1PFDA 3AEEB 2LEKA 1N62A 1FXIA 3AE2B 1XLNA 4ZOHC 2B76B 1NVID 1SIJA 1XLPA 5G5HA 1N5XA 2Y5CA 4IDIA 4C7YA 2L52A 3ABVB 4FXCA 3FC4A 5AUIA 1RYJA 2WLBA 3DWGC 1OFFA 1NEKB 1V97A 4N58A 4YTNB 3WCQA 3HRDD 1F0ZA 1WYGA 1XLQA 1FIQA
chains in the Genus database with same CATH superfamily
2HTHA 2PVGC 2KYWA 3NVWA 1UD7A 3TEYA 1HQRD 3VXWA 1Z2MA 1M94A 2V3PA 1GC6A 4S0RA 2WHIA 3EUB2 2RMMA 1H8CA 2WXIA 2O6VB 1YJIA 1GG3A 5HI1A 1KH0A 3PS6A 3OLMD 4C56C 1UBIA 1TS2A 2XN9C 5EE1A 2VH1A 1BT0A 2KTRA 3UGBB 4ARCA 5JHBA 1HZ5A 2X8XX 3PRPB 4DHJB 2HJ8A 1FFUA 4GLSC 1WR6E 1ZW7A 4GMVA 1TTNA 4CHKA 1ZXHA 1J7CA 4A6QA 3U30A 1WM3A 2O2VA 1QF6A 2MBOA 3BYYB 2KFKA 2LHEA 2LRWA 3OJ3A 4GB9A 4C7ZA 3TJPA 4KSLC 3WIMA 1LFDA 3T9LA 1EWYC 3AMZA 1VZ7A 4E3CA 1GB1A 2SEBD 1T5XD 2WXLA 2AWTA 3N1YC 2HE7A 1JWUD 4N6EB 2LRUA 4JL9A 2D10A 2KWVB 2O2VB 3LJ3A 2DZIA 2M19A 4EZJA 2KFKB 4RFBA 2WDVB 4ZHOA 2J52A 2N9XA 1XD3B 1TBEA 2MQJA 3U7ZA 2EMTA 1YX6B 4W9JA 3Q14C 2NMQA 2RSUA 4EKUA 4GGQA 2R2OA 4RGTA 4OVUA 2K6DB 3VQIA 3DOWA 3IG3A 3RNGC 1FCCC 1WX7A 1YN4A 2KT7A 3I63C 3P4RB 4MSMB 2WXJA 1WGHA 1P0RA 1SXTA 1QOFA 4LJOB 1ZOYB 1N61A 4JIOU 1L0XB 2BGFA 3AE7B 4YSYB 1CJEA 1WJNA 2JZZA 4ACFA 4EOYA 2OEDA 5BMIA 2JX5A 2WXHA 3O65B 2QC8A 1BXTA 2JZPA 1V2YA 1WH3A 4M02A 4F7ZA 3I9V1 2J7QB 1OQQA 3KWVA 1NI3A 5AUKA 4F1SA 3R3MA 2PPHA 4X57B 5JXVA 4P6VF 2PJHA 4US8A 3QJZA 3N1XC 4ANUA 1XF5L 3ECIA 1OQRA 1FRRA 3OWEB 4W9IA 3KUZA 3LDZE 1PGXA 4HDOA 2IGHA 4Q2JA 3P63A 4ZYSA 2QHOA 3H8HA 4CO7A 1E6EB 1K52A 2D2QA 1SIFA 2ZCCA 5D6JB 1YN5A 1J7BA 2J42A 2WXNA 4A3PA 2HJ1A 3DHHC 1C3TA 3AEEB 2ON8A 3U2SC 2NTSA 1LXDA 1SEBD 3C8YA 3ZDMC 4WAAA 2QCZA 1T6BX 3DHGC 2LWPA 2V0GA 3WAPA 3HUIA 3ENEA 1YJJA 2XEWA 2CKHB 1UGMA 2E6XA 3ZJUA 3PVLA 5D3IB 1TY0A 1K53A 3RULA 5J18A 1F1HA 2FCQA 2NR2A 1MFWA 3QX1A 2UWQA 2D3GA 1HTOA 1UH6A 1PDXA 4DDGD 4C00A 2KN5A 3LXFA 2PKOA 3TBLD 2G1EA 4OZCA 1C9FA 3DVGX 4HVBA 1V1PB 2QMTA 3EC8A 1RFAA 1WJ4A 2KDMA 1L7YA 2K8HA 1KJTA 3B9JA 2H88B 2WDQB 3APFA 1FNUA 5J2RA 2KKCA 3B2FA 2BWES 4PYZA 1WGDA 1NDDA 2E3TA 1SJED 2ZCBA 3AECB 3ZGZA 4WWOA 4XDCA 5TSSA 1V1OA 3IAM1 1QQRA 3WANA 1SE4A 5IO9A 2CJOA 1L6VA 3C0RB 1C4AA 3ZNGC 1Q0WB 1PQSA 3RZWC 2KX0A 5IAAC 1IBXA 1E8WA 1WWTA 3QIJA 1JRPA 4XDDA 4MH0E 4E71A 1ET6A 5D7GA 2KWCA 3JSVA 4IDIA 1ET9A 3QARA 4AP4C 3Q3NC 2KQ4X 4EUTA 3GZNI 1F0ZA 4IM3A 2N9KA 2JWUA 4ZRQA 1IBXB 2KC1A 3TIXA 2BW2A 4ZHPA 3SFEB 3AU5A 3VUYA 3PPAA 3VTWA 3JSVB 2BT6A 1F77A 1MPEA 1KF6B 3AEGB 4MSQB 1WXQA 3H7SA 2WP9B 2QILA 1H4RA 3QAQA 2KANA 1XCQL 2N7DA 3N32A 3J9CA 3IVFA 3ZXVA 3SDLC 3DWMA 1JCKB 1FFVA 4B6WA 4K81A 1GNUA 4MACA 2BB6A 4MH8A 2ZVOA 5LXHA 2WXKA 5CTRC 1K50A 3ZNID 4K3CA 2LVQA 3UQAA 2D5GA 2OHFA 3RNEC 1YN3A 2MP2A 1MG4A 5H8YE 1YD8U 2DAFA 2MJEA 1TS4A 4OW0A 4KSKC 1FM0D 4WWPA 1F2RI 1ROEA 1V86A 3CMMB 3V6CB 3CWIA 5DPWA 3B0AA 2ZVNA 3L17A 4HDQA 4P1CC 4HRSA 4WQMA 1CK1A 2YVCA 3HK0A 4W9FA 2MP2B 3EFCA 5EE0A 2OOBB 4NAMA 2HTME 2QEJC 3MC0B 4PS8A 4N59A 1YMHE 1LQBA 1E90A 4USAA 4TUUA 4G0NB 3RPFC 2DZMA 1WI0A 2ZJDA 4FA6A 1I35A 2LXCA 4FBJB 1OEYJ 1EWCA 2BYTA 1GC7A 2NCNA 4IWOA 2INCC 4ICUA 3CSFA 3VUWA 1D6EC 3TEZA 4IG7B 4C7YA 2G3QB 2LVPA 5E6PA 1RYJA 1V97A 3O13A 4XE0A 1F52A 3GP7A 3V60A 3IT6B 5AEKB 2D11A 3P4PB 4E74A 2KN4A 3ETRA 4LDTD 1R4MI 1YQ3B 2K39A 3ZQ4A 1XO3A 1P7FA 5BYQA 3BZDB 1HE8A 5EE3A 3V05A 1JWAD 1ZDXA 2D3CA 2GBNA 2L32A 1J8CA 4G11A 2LJIA 1VLBA 3EHVA 2M56B 2DZJA 4RF1A 2ICIA 3PRZA 4PS7A 2K9XA 2Z0EB 2UU7A 3GE3C 1YX5B 2ZNVB 3NVZA 4LK0M 1ZGUB 3VRBB 2ZPNA 3VHTC 1ENFA 2L0TA 4BKGA 2KK8A 1KLUD 4DQOC 2VRRB 2MBQA 4WJQA 1PUTA 2LJ5A 2A4ZA 2K0PA 1D5ZC 3EGRA 2GOWA 4RNAA 1WRDB 3NHEB 1ZUD2 4KX6B 4JE3B 3E9SA 4K7WA 3L13A 4P7IA 1ACCA 1MJDA 1TS5A 2LGIA 5D3DA 5L83A 2LEKA 2J0KA 3UIOB 2GBKA 1UWXA 3ZXRA 1STEA 1SBBB 2IY0B 3WCQA 1NEKB 2GRIA 2WXOA 4B95A 1HTQA 3HRDD 1RLFA 3M63B 1MHXA 3QK0A 2DENB 1HXYD 2BYFA 4IM2A 2JPHA 4B0EA 1V80A 4RGNA 2JY6A 2M4NA 4W9CA 4ASWC 4DHZB 4JWUC 1LM8B 2Y5BB 4IWPA 1K51A 1TIFA 4G3XB 4DBGA 5HFYA 2EKIA 5AZFA 3PZ7A 1I42A 1XLOA 3SD5A 3GZNB 4G50A 2PTLA 2KAJA 4W9KA 3ZRCA 3QCAA 4TSSA 2K3UA 3KVFB 3VAWA 4AOFA 3HM3A 2WDRB 2O6VD 1QILA 5JH5C 5IKCM 3DQVA 2IPKD 1JALA 1TYGB 3H7PA 1Q5WB 1S1QB 1QZEA 3VRAB 1VJKA 3PGEA 1OQYA 4IKGA 1E7UA 3HHMA 5IOIA 4DHJD 2FIFA 3AE9B 3A9KA 2N9LA 1WM2A 2MRPA 5C3JB 2KWUB 3H7PB 1JWBD 3Q3FA 1E9MA 3EA6A 4N9F4 1ZP0B 2KTRB 4KIKA 2N1WA 4D2KA 2L76A 4FHKA 5C23A 3PSEB 2Y3AA 1WX9A 3A9KB 3P4SB 5D2MB 2V3NA 3AN1A 4A20A 5G55A 3W1YA 1IUEA 2FE8A 4NPNA 2B76B 2UYZB 3VTUA 2L52A 2KFJA 4KIKB 3MHZA 2GI9A 5AUIA 5FR3A 3PLUA 1KM7A 1XEEA 2AQ1B 3NVVA 3AH7A 1L4DB 2HD5B 5G2NA 1I4PA 2PE9A 2OJRA 2PW9A 5DPTA 4YSXB 1RM6C 1EF5A 4NQKE 2D3BA 3JYUA 3VR8B 2LGXA 2MJDA 5IA7A 3OJ4B 3APCA 3BK1A 4JQWC 2DAJA 2W9NA 2FNJB 2DNFA 2DZKA 3RNCC 3Q8AA 2WGSA 2NS5A 3VH4B 2CHWA 4YT0B 4MGZE 2QIEB 2I2YA 3TL5A 1JWMD 4KDIC 1VD2A 1WXVA 3AU4A 1RWSA 3W5UB 5D94A 4IOIE 3AE1B 1E8XA 2AX5A 1R4MB 1T3QA 3ZIMA 4FULA 5CHWA 4W9HA 2BF8B 1PGBA 2JYTA 1TJEA 1WGRA 4I6NB 2BYVE 3I5JC 2MBBB 3RMKC 1G6JA 2QDFA 3NJTA 4TQ0A 5C1ZA 2K6QA 4I6PA 3X0WA 5EDSA 3A1QA 3RZFA 3NZ3A 2BYEA 3T3OA 3RI7C 4K7UA 2QSDA 2RDBC 3FAHA 2G4SA 2PLPA 2W3RA 2N9EB 3SU8X 2BQQA 3M95A 3I57A 1E5WA 3A1QB 1NYQA 1UF0A 3W1SC 1SIJA 2DYMA 3KYCD 2INPE 4BOZB 4GDKA 4JLCA 3IBEA 3NZSA 2WLBA 4MGYE 4BAXA 2JRIB 2KQ7A 5AZHA 5BMGA 4J6IA 3L4PA 3AE5B 4GIVA 2NBVB 2JT4B 3PTFC 1L5PA 2BS3B 1XXGA 2H89B 4UDUC 2FAZA 3KUCB 3JW0X 4KGSA 2C7NB 2JZ3B 1ESFA 4DWFA 1NYRA 5J17A 3PHXB 2VZKB 2GLSA 4TKNA 3X23A 5L95C 4ZRJA 5E6JA 3N1ZC 1C76A 3CIRB 1VZ6A 2LVOA 5E6NA 2NVUI 2FUHB 4LJPB 2WDTB 4AWJA 3DVNV 2KMMA 3UF8A 4IC7B 1T0QC 1OTRB 3SEBA 1KLGD 1VZ8A 2FIDA 2MH7A 4HWIB 3T3NA 1CQVA 4ZRKA 3R8BA 2IO2B 4W9GA 3A4RA 2INDC 1X1MA 3NZUA 1WF9A 4HEA1 1JWSD 1YOVB 3Q3MC 4C80A 1SGHA 3R7RA 1Y8RC 4RGMA 3QA8A 1KTKA 1DOYA 5EE9A 3DVGY 2IO0B 1YJ1A 1EM7A 1PYWD 4FJYA 4EZKA 1PGAA 1GPXA 3NG0A 3VTVA 3R7QA 2NBWB 2SAKA 1FNWA 3DBRI 1YNTE 3NUHB 2WXPA 4FXCA 1V9JA 2BWFA 4YTNB 3W1SA 4W9LA 4O1NA 1WYGA 3OG5A 5E6OA 3C19A 1E8YA 1DGJA 2REXA 3L16A 4RF0A 1Y56A 2MBEA 3VH3B 3GS2A 2WX0A 2WXFA 4ANXA 2WXMA 2JSVX 4WWMA 1E7VA 1LO5D 1E0ZA 1M4VA 2LHDA 1FRDA 1SE3A 2LGYA 3KH0A 2EMSA 5DPSA 2CHZA 3EECA 1YQBA 1JQ4A 2KJ6A 4FLHA 2D3AA 4KVGB 4BOSC 2X38A 2KXJA 1P98A 4HK2A 2XBBC 1R4NB 4K7SA 2I1JA 1OEYA 5HKHA 4K1RB 1I4QA 1L4ZB 4YWGG 2IO3B 3LYYA 1FEHA 5LLIA 1HZ6A 1MHHE 3ZDTA 3IHPC 2Q5WD 1WZ3A 2YEPF 2ACZB 4EEWA 3TEXA 2V9HA 3BY4B 2PIAA 4KDLB 4KKIA 1WE6A 2KMAA 2ZEQA 3RD2A 3AE3B 2D07B 5CHVC 3JVZX 2DWQA 4REZA 3R2IA 4J3OD 1VDVA 1E10A 3QWZB 4JPSA 4ARIA 3B08A 5BYSA 2KTFA 1JMLA 2FCMA 3ZNZB 1V8CA 3AEBB 4BKSA 1XQQA 3DBHB 2DHZA 1B1ZA 1MVKA 1IYFA 1CMXB 1FXIA 4NZLB 2LMCA 1XLPA 3IXSA 1ZPSA 2JXTA 4N58A 2ONQA 1HEZE 1MI0A 3S2AA 1DOXA 3NY5A 2C9WB 2WYQA 3IFWB 1FXTB 1C79A 2WX1A 3ZTDA 1ZDVA 4XYCA 4I6LB 1P1AA 2XNAC 2IDYA 2L1AA 3ZYYX 2LASA 3AV8A 5KHOA 1N63A 4K3BA 4LNIA 1AWDA 3Q3JA 1TZOA 1GAQB 3ZJVA 2RDGA 2G45B 2LUEA 2DYOA 3SR6A 2ZPYA 3FILA 4GXBA 2EKEC 1WGGA 1K8RB 5MPOA 1EU3A 2LD9A 2IYDB 4PT5A 1EU4A 2TSSA 4M8NA 2ZW1A 2KX3A 4JGHB 5TR5A 4P16A 3NS8A 4LCDE 4JWSC 2K8CA 3FILB 5BMHA 3VDZA 3BVGA 3GE8C 4YTPB 3Q69A 4R3DA 4KZ0A 1UNSA 2HDEA 3VFKA 3RNAC 1WR1A 4GOCA 2Z0DB 3AB5A 4HPPA 1QOAA 4XZ4A 1C78A 2L0FA 4MELA 4ZOHC 4MGKE 4FJZA 1N5XA 3ABVB 2M8SA 3FC4A 2BBCA 3TEWA 1OFFA 3BINA 1XLQA 2LFIA 1KOTA 2Z8LA 2FCNA 2KOXA 3WA0A 3IAS1 3P2BA 4DK5A 2L00B 4HXDA 1SJHD 2MA9B 3WAOA 4RGOS 3IT4B 3DBRB 4WQOB 3KW5B 4MEMA 2KVZA 1QOGA 2W3SA 1P3QU 2CS4A 5I4DA 2CJNA 4YTMB 4RM9A 4KKJA 3UI3A 3GOEA 1V6EA 3PV1A 1AN8A 4TMAB 3V3XA 2J0JA 3HM6X 3K9OB 1AW7A 2BPSA 1GOZA 2WQYB 3B2GA 3AEDB 3DBLB 3VUXA 1UZXB 1KLVA 4LLGM 3N30A 4EZLA 3RFZB 1P7EA 1T0RC 5BO4B 3ZNHB 3MP9A 3WAMA 3B1LX 3TMPB 4XC2A 1L6UA 1OGWA 3DDCB 2L05A 1EF1A 4LNOA 4TV3A 1ZXIA 3NOBA 1E7PB 1BUIC 1SB3C 2WS3B 4DXFA 3P42A 3W2DA 3QQ8B 3KLSX 3SFDB 2VH2A 1UBQA 1Z5SB 4RMAA 2LZ6A 2RR9A 2L83A 3KWLA 4HKZE 2JVCA 1NVID 5G5HA 5FKAC 2Y5CA 3L10B 2AL3A 3TSSA 2LI5A 1J0GA 2I38A 3BVMA 2K25A 4HCPB 2ZZPB 2ZW0A 1FIQA 2GMIC 2G4DB 2RDHA 4NNJB 3RNFC 3MFGA 3ALBA 2KQSA 4A55A 5GMVA 1N6ZA 4IUMB 1IP9A 1C4PA 2JQRB 3AE8B 3UIPB 3P4QB 4KV2A 2MBHA 2FBWB 3P1MA 1V5OA 1SE2A 2KNBA 1ISNA 1T0SC 1NENB 1WFYA 5CX3A 1U4AA 4BFRA 3AXCA 3HVDA 4MJSA 4QAYA 3ZLZA 1P9DU 3Q8EA 1R4NI 1V5TA 2MX2A 2J53A 3MC9A 5DCNA 3ZVVA 1B9RA 3A33B 4KGTA 2G9HD 1T0YA 3M3JA 3N9YC 3R66C 1FPYA 1KRHA 4MJSB 4H2AA 3NVYA 4S17A 3BK2A 4ICVA 3PZ8A 2CHXA 5DPRA 5T8IA 1L0YB 2J0MA 4W9EA 1MG8A 4XGAB 4YSZB 3E56A 3H9DA 4WWNA 4GDLA 3ZRFA 2KLGA 1WSPA 3PREA 4A9AA 3DHIC 1D4BA 2N9PC 1LGRA 4KZCA 1DOIA 4NJ7A 1GUAB 1IGCA 1WGKA 1WMHA 1DYQA 4XWWA 2YLMA 3DBHI 3A9JA 4L23A 1FO4A 4GDLB 3LB8C 4C4VA 3ONSA 3MHSD 4FJVB 3ZO5B 4LNFA 4CYEA 5AZGA 4OHJA 2EELA 5HHDG 1WMHB 3Q6BA 4HLEA 2PEAA 1QLBB 1WYWB 3A9JB 4TQ1A 3BVZA 3MJ5A 4C4VB 4ANVA 3HVZA 1FD6A 3DBSA 4MGIE 2DYBA 5JZEB 3BYTB 4HJKA 1JW9D 5CHFA 1SE9A 2WXQA 1YIWA 2K1FA 5G5GA 4HPLB 1TKEA 1V81A 2JRHA 1AYFA 4DXAB 4US9A 4HROA 2W54A 1I4GA 2QJLA 3NS1A 2V1YA 1A5RA 2DBYA 1I4HA 3N20C 5IN7A 2V4LA 2JU6X 4GDKB 1EUVB 1I7HA 1WGYA 4WJNA 4AUQC 1D5XC 2AYOB 3CF6E 3MTNB 2VZKD 1N60A 4LTUA 5C2TB 3DCGA 2N4FA 2RPQA 2N1VA 1TKYA 4ZYNA 4PYUA 1YQ4B 2WU2B 1BMLC 2KJRA 3H1UA 1C4CA 1NI2A 3RT3B 4ZRIA 1F9JA 3URYA 2LGDA 3VR9B 3I3TB 4M00A 4A8XC 3R2TA 1WJ6A 5H92C 4AJYB 3NRZA 4B9KA 2NPTA 3RYTA 1SSNA 4RH6A 4OZBA 4IW0A 4M01A 2KDBA 2R2QA 2N0SB 4A90A 2LXAA 2MLBA 2ASQA 2K22A 2WWZA 2K5PA 2FUG1 4ZRPA 4AS1A 4B0MA 1VCBA 3ZTCA 2L3ZA 2NPTB 1V1PA 2BB5A 3QC8B 2M0AA 3DVNU 4NJ6A 3D32A 4LNNA 3N3KB 4ANWA 3MJWA 3SHQA 3HIZA 2N7EA 3TUOA 2C7HA 1L0VB 3AEAB 3T8MA 1JRUA 2KJHB 1WXMA 1FMAD 4AJWA 4XWTA 1TGZB 3VVWB 4II2B 2IJ0A 2KC2A 4OVVA 3A4SC 3M62B 3BIID 2BS2B 3PRMB 3Q8FA 2MW5A 4ITKA 4NJCA 1WY8A 1Q10A 3GB1A 1I4RA 1N5WA 3AEFB 2J4XA 1WXSA 2KD0A 2RD0A 4LNKA 2LUMA 2DLBA 1SF0A 3DBLI 4EE2A 5GXGB 1QT9A 2JXXA 1C77A 4YXDB 2GBJA 4RM8A 2BS4B 3U52E 1UGJA 1IPGA 2K8BA 4NQLB 2MSED 4DXGA 2C7MB 2WXRA 3U7DA 2L8JA 1AARA 1R7SA 4WJOA 4HPMB 3QHTA 4BBNF 1WXAA 4GN1A 3TCAA 1QKZA 2W55A 4BVUC 2V4IB 1TS3A 4PK1A 2KWDA 4HCNB 3PO0A 3RNBC 2WU5B 3V6EB 4GSWA 4OZAA 1IGDA 4HJGE 2PE6B 3AI5A 2ZNVC 3AE2B 1XLNA 1FCLA 3L54A 1I4XA 2IY1B 2M17A 1VRAB 1D3ZA 4II3B 2PMVA 3AM9A 3PZDA 4MM3A 2INNE 1TKGA 3WALA 3W5VB 5KHQA 4WIPA 2KDIA 2PVOD 2JF5A 1ZE3D 2KMCA 4FADA 3RCZA 1E8ZA 4L2YA 3KQ4A 3EFUA 1TZ1A 3AULA 3KYDD 2JWZA 4MM3B 2N7JA 2BKFA 4BKSD 2MCNB 3ML8A 2KLCA 2KDEB 3BWUD 1FNVA 4MT5A 1RRBA 2L7RA 1TT5B 1RAXA 2DX5B 1CZPA 4DDID 1QOBA 1WJUA 3ML9A 3Q2AC 2MEKA 2WXGA 3UINB 2FCSA 3Q8CA 1C1YB 4PS3A 1JROA 4F8CB 3Q8BA 2V3SA 2IZVB 3AE6B 4BBNC 2RPVA 3KUDB 2BTEA 1FXAA 4WURA 1UELA 4URKA 4WAFA 4NY0A 5HG2A 4AQ7A 3RUIB 3APDA 2M1MA 4RCOA 3PLVA 4A3OA 3DPDA 1KFYB 5BYRA 4IM0A 3PHWB 3W9CB 5LNK1 2MJ3A 2KDFB 4BZAA 5IP4D 3PT2B 3L08A 1N62A 4LDTB 1VR9A 1EO6A 2JYEA 2RGFA 4YL8A 5LXIB 2CU1A 3DWGC 4FHJA 2AEHA 1J19A 4BKTA 4FN2A 1WIAA 3ZW3A 4XX5A 2AQ2B 3AE4B 2KVRA 4L1BA 1TY2A 2Y5PA 2NTTA 2GB1A 1J7AA 4M8MA 1S3SG 1XT9B 2XK5A 2IGDA 2LGSA 2A5UA 4NAWA 4W9DA 2I1KA 2KACA 3Q3OC 3H6NA 2R61A 3U4EG 2GBMA 5JHAA 4HKQA 1GB4A 1F2RC 2C5LC 5FK9C 4CQNA 1WRIA 2CR5A 1WE7A 4MDKE 1HA5A 1NBFC 1RFKA 2MWSB 2WNMA 2XK5B 2Z59B 1V49A 4NAWB 3U8ZA 1WZ0A 4WJPA 2MHJA 2OJWA 1ZKHA 3K9PB 3ZUNA 4DHZE 4P1BC 4M0WA 2C60A 2AQ3B 3FKYA 2CU3A 4OVZA 1UWMA 2GBRA 2M0XA 2KZRA 3UQBA 1WX8A 4JX1C 4ZDVA 1XCTL 5FR6A 2IO1B 4M0WB 3V61A 2IBIB 2AL6A 1Q1OA 3L0WB 1UUPA 4EFOA 2NBUA 1A70A 2BKRB 2W82A 1D5MC 4KGRA 4GU2A 4IWQA 2BVCA 2JUOA 3ZJTA 3OAWA 1PFDA 2IGGA 2KO3A 3V62A 2B3AA 3MC8A 3ZKJC 2YEPB 2O6VA 3RN9C 1GJZA 4WH4A 3CSTA 1L2NA 2KHWB
chains in the Genus database with same CATH topology
1DGJA 2PVGC 1QLBB 3NVWA 3GP7A 4RF0A 4TQ1A 3TEYA 1HQRD 3BVZA 1Y56A 3MJ5A 3GS2A 3HVZA 2V3PA 3IT6B 1FD6A 2WXFA 3P4PB 3EUB2 2WXMA 2RMMA 2WXIA 2JSVX 2KN4A 3ETRA 1YQ3B 3BYTB 3ZQ4A 4WWMA 1XO3A 1YJIA 1JW9D 5HI1A 1LO5D 1KH0A 1E0ZA 1P7FA 1M4VA 2WXQA 5BYQA 3BZDB 5G5GA 4C56C 5EE3A 1TKEA 1FRDA 1SE3A 1JWAD 1TS2A 2LHDA 3V05A 2XN9C 5EE1A 1AYFA 1ZDXA 4US9A 4HROA 4ARCA 2W54A 1I4GA 1HZ5A 2L32A 2QJLA 1FFUA 1JQ4A 2LJIA 4GLSC 3NS1A 1VLBA 2DBYA 1I4HA 2M56B 2X38A 4RF1A 2ICIA 2JU6X 2K9XA 1ZXHA 1J7CA 4GDKB 1I7HA 4A6QA 3NVZA 4LK0M 1I4QA 1D5XC 1L4ZB 4YWGG 3LYYA 2VZKD 1FEHA 3VRBB 1N60A 1ENFA 4LTUA 1HZ6A 4DQOC 1KLUD 5C2TB 1MHHE 1QF6A 3BYYB 2LHEA 4C7ZA 1TKYA 2Q5WD 2YEPF 2ACZB 3TEXA 1EWYC 3AMZA 1PUTA 1YQ4B 2WU2B 1VZ7A 1GB1A 2K0PA 2SEBD 1BMLC 1T5XD 2WXLA 1C4CA 1D5ZC 3EGRA 4RNAA 2PIAA 4KKIA 1JWUD 4N6EB 3URYA 3AE3B 3VR9B 2DWQA 4REZA 3R2IA 4J3OD 4A8XC 3R2TA 1ZUD2 4KX6B 2M19A 1VDVA 5H92C 4JE3B 3E9SA 3NRZA 4ZHOA 4RFBA 2WDVB 1E10A 1ACCA 2J52A 1SSNA 1TS5A 4RH6A 4OZBA 2LGIA 4JPSA 4ARIA 5BYSA 2N0SB 4A90A 5D3DA 1JMLA 1V8CA 3AEBB 2K22A 3U7ZA 2K5PA 1B1ZA 2FUG1 2LEKA 4ZRPA 4AS1A 1MVKA 1FXIA 4B0MA 4NZLB 2LMCA 2NMQA 1UWXA 1XLPA 3IXSA 1STEA 1SBBB 1V1PA 4RGTA 1ZPSA 2BB5A 2JXTA 3VQIA 3WCQA 4N58A 1NEKB 2M0AA 2GRIA 2WXOA 1FCCC 2ONQA 3HRDD 1YN4A 1HEZE 1MI0A 1DOXA 1MHXA 1HXYD 3P4RB 3TUOA 4B0EA 2WXJA 1C79A 4RGNA 1L0VB 3AEAB 4JWUC 1ZDVA 1SXTA 1FMAD 1QOFA 1K51A 2XNAC 5HFYA 4XWTA 2IDYA 2L1AA 2EKIA 1ZOYB 1N61A 3ZYYX 3PZ7A 1L0XB 3AV8A 2IJ0A 1N63A 3AE7B 1XLOA 4YSYB 1CJEA 1AWDA 5BMIA 2OEDA 1TZOA 2JX5A 1GAQB 2BS2B 2WXHA 3BIID 2PTLA 3ZJVA 2RDGA 2KAJA 1BXTA 3Q8FA 2JZPA 4TSSA 4ITKA 4NJCA 2K3UA 3I9V1 1OQQA 3KWVA 2DYOA 1NI3A 5AUKA 3SR6A 3FILA 1Q10A 3GB1A 1I4RA 1N5WA 2WDRB 3AEFB 2J4XA 1QILA 2DLBA 2LUMA 2IPKD 1JALA 4P6VF 1EU3A 5JXVA 1SF0A 5MPOA 4US8A 4EE2A 1TYGB 4PT5A 5GXGB 1QT9A 1C77A 1EU4A 3VRAB 2TSSA 1VJKA 2ZW1A 4YXDB 4IKGA 2BS4B 3U52E 1XF5L 4P16A 1UGJA 3AE9B 1OQRA 1FRRA 2N9LA 3OWEB 4JWSC 3FILB 4DXGA 5BMHA 2WXRA 5C3JB 1PGXA 3BVGA 4YTPB 3Q69A 1JWBD 4R3DA 1E9MA 2IGHA 4Q2JA 3P63A 1R7SA 3EA6A 4ZYSA 1ZP0B 1UNSA 3H8HA 4D2KA 2HDEA 1E6EB 1K52A 2Y3AA 1QKZA 2W55A 2V4IB 1TS3A 3P4SB 3AB5A 1QOAA 1YN5A 2KWDA 2V3NA 1J7BA 2J42A 3PO0A 2WU5B 1C78A 2WXNA 3AN1A 4OZAA 1IUEA 1IGDA 3AEEB 2FE8A 2ON8A 4HJGE 3U2SC 2NTSA 3AE2B 1XLNA 4ZOHC 1FCLA 2B76B 1SEBD 1N5XA 3C8YA 2L52A 3ABVB 3MHZA 3FC4A 2BBCA 2GI9A 1I4XA 5AUIA 5FR3A 1OFFA 3TEWA 1VRAB 1XEEA 1XLQA 2LFIA 1T6BX 2PMVA 2AQ1B 2Z8LA 3NVVA 3AM9A 3AH7A 1L4DB 3IAS1 2INNE 2V0GA 1I4PA 1TKGA 2PW9A 3W5VB 1SJHD 4YSXB 4WIPA 2PVOD 1RM6C 1ZE3D 4RGOS 3HUIA 3IT4B 1YJJA 3VR8B 2MJDA 2E6XA 3ZJUA 4L2YA 3KQ4A 5D3IB 1K53A 1TY0A 3BK1A 1QOGA 2W3SA 5I4DA 4MM3B 2CJNA 4YTMB 2N7JA 3Q8AA 1PDXA 4KKJA 3UI3A 4YT0B 2I2YA 2QIEB 4TMAB 1AN8A 1JWMD 3BWUD 3V3XA 1FNVA 3LXFA 1RWSA 4MT5A 3W5UB 2PKOA 1AW7A 2G1EA 4IOIE 4OZCA 1C9FA 3AE1B 1V1PB 2QMTA 2AX5A 1CZPA 1QOBA 1T3QA 1GOZA 2WQYB 3B2GA 2KDMA 2MEKA 1PGBA 2WXGA 3AEDB 3B9JA 2H88B 2JYTA 2WDQB 1TJEA 1FNUA 4LLGM 3B2FA 3RFZB 1P7EA 3MP9A 2E3TA 1SJED 3Q8CA 4TQ0A 1JROA 3Q8BA 3AECB 1L6UA 3AE6B 3ZGZA 2RPVA 3NZ3A 2BTEA 3T3OA 4XDCA 5TSSA 1FXAA 1V1OA 1ZXIA 3IAM1 1QQRA 4WURA 1E7PB 1SE4A 4WAFA 1BUIC 5HG2A 4AQ7A 1SB3C 2CJOA 2WS3B 4RCOA 1L6VA 4DXFA 1C4AA 1KFYB 2QSDA 3P42A 3W2DA 3FAHA 2PLPA 2W3RA 3KLSX 5BYRA 3SFDB 1IBXA 3W9CB 5LNK1 2L83A 1WWTA 2MJ3A 3I57A 3KWLA 1JRPA 4HKZE 4XDDA 1NYQA 1N62A 1ET6A 1NVID 1VR9A 1SIJA 2DYMA 2JYEA 5D7GA 5G5HA 5FKAC 2Y5CA 4IDIA 1ET9A 2INPE 3TSSA 2I38A 2WLBA 3BVMA 3DWGC 2KQ4X 1F0ZA 2N9KA 2ZW0A 1FIQA 2RDHA 5BMGA 2JWUA 4ZRQA 1IBXB 3MFGA 3L4PA 3AE5B 4A55A 1L5PA 2BW2A 4ZHPA 2AQ2B 2BS3B 1XXGA 3AE4B 4L1BA 3SFEB 2H89B 4UDUC 1TY2A 2Y5PA 2NTTA 4KGSA 2BT6A 1F77A 2GB1A 1J7AA 1ESFA 1C4PA 1MPEA 2JQRB 3AE8B 2IGDA 1NYRA 1KF6B 3AEGB 3P4QB 1WXQA 2KACA 2FBWB 2VZKB 2WP9B 3P1MA 1SE2A 2QILA 2R61A 1NENB 3U4EG 1XCQL 5E6JA 3J9CA 1C76A 3CIRB 1VZ6A 4HKQA 1GB4A 1F2RC 3HVDA 5FK9C 3DWMA 1WRIA 4CQNA 1JCKB 1FFVA 1HA5A 1RFKA 2WNMA 4NAWB 3Q8EA 4MACA 2BB6A 2J53A 4MH8A 2KMMA 2WXKA 1K50A 2D5GA 1B9RA 4KGTA 2G9HD 2OHFA 4M0WA 1YN3A 3N9YC 1KRHA 3SEBA 5H8YE 1KLGD 1VZ8A 2MH7A 2MJEA 1TS4A 2AQ3B 4H2AA 3NVYA 3BK2A 4OW0A 2CU3A 3T3NA 1FM0D 3PZ8A 1CQVA 1F2RI 4OVZA 3R8BA 5T8IA 1L0YB 1ROEA 1UWMA 3CWIA 4JX1C 4YSZB 3E56A 1XCTL 4HRSA 4HEA1 4WQMA 1JWSD 1CK1A 4C80A 1WSPA 4RGMA 5EE0A 4A9AA 1D4BA 4NAMA 2HTME 2QEJC 1KTKA 1DOIA 3MC0B 5EE9A 1DOYA 4N59A 1YMHE 1UUPA 1EM7A 1IGCA 1PYWD 1WGKA 1A70A 4USAA 3RPFC 1DYQA 2W82A 1D5MC 1PGAA 4XWWA 4KGRA 1GPXA 4L23A 1EWCA 1FO4A 4GDLB 3ZJTA 3LB8C 2BYTA 1PFDA 2IGGA 2SAKA 1FNWA 1YNTE 3TEZA 1D6EC 4C7YA 3NUHB 2WXPA 4FXCA 1RYJA 2YEPB 4OHJA 1V97A 4YTNB 3W1SA 2EELA 5HHDG 4O1NA 3O13A 4WH4A 1WYGA 4XE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOX A;  1DGJ A;  2PVG C;  3NVV A;  3AM9 A;  1QLB B;  3AH7 A;  3L4P A;  3AE5 B;  3NVW A;  3P4R B;  1L5P A;  1TKG A;  3AE4 B;  2BS3 B;  3HVZ A;  4ZHP A;  3SFE B;  2H89 B;  3W5V B;  1L0V B;  4YSX B;  3AEA B;  2PVO D;  2BT6 A;  1RM6 C;  4JWU C;  1J7A A;  3P4P B;  3EUB 2;  2JQR B;  3AE8 B;  3HUI A;  1FMA D;  1NYR A;  1QOF A;  1KF6 B;  3AEG B;  1YJJ A;  3ETR A;  3P4Q B;  1YQ3 B;  4WWM A;  3VR8 B;  1XO3 A;  1YJI A;  2MJD A;  1WXQ A;  1JW9 D;  2EKI A;  2FBW B;  2WP9 B;  3P1M A;  1ZOY B;  1E0Z A;  1N61 A;  3ZYY X;  1NEN B;  5G5G A;  3AV8 A;  5EE3 A;  1TKE A;  1FRD A;  1N63 A;  1JWA D;  1QOG A;  2W3S A;  3AE7 B;  1XLO A;  5EE1 A;  1AYF A;  4YSY B;  1CJE A;  1AWD A;  2CJN A;  4YTM B;  4US9 A;  3CIR B;  4HRO A;  2W54 A;  1PDX A;  2JX5 A;  1GAQ B;  2BS2 B;  2QJL A;  1WRI A;  3BII D;  1FFU A;  3DWM A;  4YT0 B;  2QIE B;  1JQ4 A;  2KAJ A;  1FFV A;  1RFK A;  3NS1 A;  1VLB A;  2DBY A;  4ITK A;  2M56 B;  3LXF A;  1RWS A;  3W5U B;  2PKO A;  1OQQ A;  2G1E A;  2K9X A;  1NI3 A;  5AUK A;  3SR6 A;  1J7C A;  2KMM A;  3AE1 B;  2AX5 A;  1N5W A;  2WDR B;  1I7H A;  3AEF B;  1CZP A;  1QOB A;  3NVZ A;  1T3Q A;  1B9R A;  2OHF A;  2WQY B;  3B2G A;  1JAL A;  4P6V F;  5MPO A;  1SF0 A;  3VRB B;  3B9J A;  3AED B;  1N60 A;  1TYG B;  1KRH A;  2H88 B;  4LTU A;  4US8 A;  5H8Y E;  2MH7 A;  5GXG B;  1QT9 A;  1TJE A;  2WDQ B;  5C2T B;  1QF6 A;  3VRA B;  3B2F A;  4C7Z A;  2MJE A;  1VJK A;  4YXD B;  1TKY A;  2Q5W D;  3NVY A;  2ACZ B;  2BS4 B;  2E3T A;  2CU3 A;  1EWY C;  3AMZ A;  1FM0 D;  1PUT A;  1YQ4 B;  2WU2 B;  3AE9 B;  1ROE A;  1UWM A;  1OQR A;  1FRR A;  3CWI A;  1JRO A;  4JWS C;  3AEC B;  4JX1 C;  1L6U A;  4YSZ B;  3AE6 B;  2PIA A;  4HRS A;  5C3J B;  4WQM A;  4N6E B;  3AE3 B;  4C80 A;  3VR9 B;  4YTP B;  1FXA A;  2DWQ A;  1ZXI A;  1JWB D;  1ZUD 2;  1E7P B;  2M19 A;  1VDV A;  4KX6 B;  1E9M A;  5EE0 A;  3NRZ A;  5H92 C;  4A9A A;  4ZHO A;  3P63 A;  2WDV B;  1R7S A;  1E10 A;  1SB3 C;  2CJO A;  2HTM E;  2WS3 B;  1DOI A;  1L6V A;  1ZP0 B;  5EE9 A;  1DOY A;  4N59 A;  1KFY B;  1E6E B;  2W55 A;  2N0S B;  2W3R A;  1WGK A;  3FAH A;  3SFD B;  1A70 A;  3P4S B;  4USA A;  1V8C A;  3AEB B;  3AB5 A;  3RPF C;  1QOA A;  3W9C B;  1J7B A;  3PO0 A;  2K22 A;  1WWT A;  2L83 A;  2MJ3 A;  2WU5 B;  1JRP A;  3AN1 A;  3KWL A;  1GPX A;  2K5P A;  1FO4 A;  3LB8 C;  1IUE A;  1NYQ A;  1PFD A;  3AEE B;  2LEK A;  1N62 A;  1FXI A;  3AE2 B;  1XLN A;  4ZOH C;  2B76 B;  1NVI D;  1SIJ A;  1XLP A;  5G5H A;  1N5X A;  2Y5C A;  4IDI A;  4C7Y A;  2L52 A;  3ABV B;  4FXC A;  3FC4 A;  5AUI A;  1RYJ A;  2WLB A;  3DWG C;  1OFF A;  1NEK B;  1V97 A;  4N58 A;  4YTN B;  3WCQ A;  3HRD D;  1F0Z A;  1WYG A;  1XLQ A;  1FIQ A; 
#chains in the Genus database with same CATH topology
 2HTH A;  2PVG C;  2KYW A;  3NVW A;  1UD7 A;  3TEY A;  1HQR D;  3VXW A;  1Z2M A;  1M94 A;  2V3P A;  1GC6 A;  4S0R A;  2WHI A;  3EUB 2;  2RMM A;  1H8C A;  2WXI A;  2O6V B;  1YJI A;  1GG3 A;  5HI1 A;  1KH0 A;  3PS6 A;  3OLM D;  4C56 C;  1UBI A;  1TS2 A;  2XN9 C;  5EE1 A;  2VH1 A;  1BT0 A;  2KTR A;  3UGB B;  4ARC A;  5JHB A;  1HZ5 A;  2X8X X;  3PRP B;  4DHJ B;  2HJ8 A;  1FFU A;  4GLS C;  1WR6 E;  1ZW7 A;  4GMV A;  1TTN A;  4CHK A;  1ZXH A;  1J7C A;  4A6Q A;  3U30 A;  1WM3 A;  2O2V A;  1QF6 A;  2MBO A;  3BYY B;  2KFK A;  2LHE A;  2LRW A;  3OJ3 A;  4GB9 A;  4C7Z A;  3TJP A;  4KSL C;  3WIM A;  1LFD A;  3T9L A;  1EWY C;  3AMZ A;  1VZ7 A;  4E3C A;  1GB1 A;  2SEB D;  1T5X D;  2WXL A;  2AWT A;  3N1Y C;  2HE7 A;  1JWU D;  4N6E B;  2LRU A;  4JL9 A;  2D10 A;  2KWV B;  2O2V B;  3LJ3 A;  2DZI A;  2M19 A;  4EZJ A;  2KFK B;  4RFB A;  2WDV B;  4ZHO A;  2J52 A;  2N9X A;  1XD3 B;  1TBE A;  2MQJ A;  3U7Z A;  2EMT A;  1YX6 B;  4W9J A;  3Q14 C;  2NMQ A;  2RSU A;  4EKU A;  4GGQ A;  2R2O A;  4RGT A;  4OVU A;  2K6D B;  3VQI A;  3DOW A;  3IG3 A;  3RNG C;  1FCC C;  1WX7 A;  1YN4 A;  2KT7 A;  3I63 C;  3P4R B;  4MSM B;  2WXJ A;  1WGH A;  1P0R A;  1SXT A;  1QOF A;  4LJO B;  1ZOY B;  1N61 A;  4JIO U;  1L0X B;  2BGF A;  3AE7 B;  4YSY B;  1CJE A;  1WJN A;  2JZZ A;  4ACF A;  4EOY A;  2OED A;  5BMI A;  2JX5 A;  2WXH A;  3O65 B;  2QC8 A;  1BXT A;  2JZP A;  1V2Y A;  1WH3 A;  4M02 A;  4F7Z A;  3I9V 1;  2J7Q B;  1OQQ A;  3KWV A;  1NI3 A;  5AUK A;  4F1S A;  3R3M A;  2PPH A;  4X57 B;  5JXV A;  4P6V F;  2PJH A;  4US8 A;  3QJZ A;  3N1X C;  4ANU A;  1XF5 L;  3ECI A;  1OQR A;  1FRR A;  3OWE B;  4W9I A;  3KUZ A;  3LDZ E;  1PGX A;  4HDO A;  2IGH A;  4Q2J A;  3P63 A;  4ZYS A;  2QHO A;  3H8H A;  4CO7 A;  1E6E B;  1K52 A;  2D2Q A;  1SIF A;  2ZCC A;  5D6J B;  1YN5 A;  1J7B A;  2J42 A;  2WXN A;  4A3P A;  2HJ1 A;  3DHH C;  1C3T A;  3AEE B;  2ON8 A;  3U2S C;  2NTS A;  1LXD A;  1SEB D;  3C8Y A;  3ZDM C;  4WAA A;  2QCZ A;  1T6B X;  3DHG C;  2LWP A;  2V0G A;  3WAP A;  3HUI A;  3ENE A;  1YJJ A;  2XEW A;  2CKH B;  1UGM A;  2E6X A;  3ZJU A;  3PVL A;  5D3I B;  1TY0 A;  1K53 A;  3RUL A;  5J18 A;  1F1H A;  2FCQ A;  2NR2 A;  1MFW A;  3QX1 A;  2UWQ A;  2D3G A;  1HTO A;  1UH6 A;  1PDX A;  4DDG D;  4C00 A;  2KN5 A;  3LXF A;  2PKO A;  3TBL D;  2G1E A;  4OZC A;  1C9F A;  3DVG X;  4HVB A;  1V1P B;  2QMT A;  3EC8 A;  1RFA A;  1WJ4 A;  2KDM A;  1L7Y A;  2K8H A;  1KJT A;  3B9J A;  2H88 B;  2WDQ B;  3APF A;  1FNU A;  5J2R A;  2KKC A;  3B2F A;  2BWE S;  4PYZ A;  1WGD A;  1NDD A;  2E3T A;  1SJE D;  2ZCB A;  3AEC B;  3ZGZ A;  4WWO A;  4XDC A;  5TSS A;  1V1O A;  3IAM 1;  1QQR A;  3WAN A;  1SE4 A;  5IO9 A;  2CJO A;  1L6V A;  3C0R B;  1C4A A;  3ZNG C;  1Q0W B;  1PQS A;  3RZW C;  2KX0 A;  5IAA C;  1IBX A;  1E8W A;  1WWT A;  3QIJ A;  1JRP A;  4XDD A;  4MH0 E;  4E71 A;  1ET6 A;  5D7G A;  2KWC A;  3JSV A;  4IDI A;  1ET9 A;  3QAR A;  4AP4 C;  3Q3N C;  2KQ4 X;  4EUT A;  3GZN I;  1F0Z A;  4IM3 A;  2N9K A;  2JWU A;  4ZRQ A;  1IBX B;  2KC1 A;  3TIX A;  2BW2 A;  4ZHP A;  3SFE B;  3AU5 A;  3VUY A;  3PPA A;  3VTW A;  3JSV B;  2BT6 A;  1F77 A;  1MPE A;  1KF6 B;  3AEG B;  4MSQ B;  1WXQ A;  3H7S A;  2WP9 B;  2QIL A;  1H4R A;  3QAQ A;  2KAN A;  1XCQ L;  2N7D A;  3N32 A;  3J9C A;  3IVF A;  3ZXV A;  3SDL C;  3DWM A;  1JCK B;  1FFV A;  4B6W A;  4K81 A;  1GNU A;  4MAC A;  2BB6 A;  4MH8 A;  2ZVO A;  5LXH A;  2WXK A;  5CTR C;  1K50 A;  3ZNI D;  4K3C A;  2LVQ A;  3UQA A;  2D5G A;  2OHF A;  3RNE C;  1YN3 A;  2MP2 A;  1MG4 A;  5H8Y E;  1YD8 U;  2DAF A;  2MJE A;  1TS4 A;  4OW0 A;  4KSK C;  1FM0 D;  4WWP A;  1F2R I;  1ROE A;  1V86 A;  3CMM B;  3V6C B;  3CWI A;  5DPW A;  3B0A A;  2ZVN A;  3L17 A;  4HDQ A;  4P1C C;  4HRS A;  4WQM A;  1CK1 A;  2YVC A;  3HK0 A;  4W9F A;  2MP2 B;  3EFC A;  5EE0 A;  2OOB B;  4NAM A;  2HTM E;  2QEJ C;  3MC0 B;  4PS8 A;  4N59 A;  1YMH E;  1LQB A;  1E90 A;  4USA A;  4TUU A;  4G0N B;  3RPF C;  2DZM A;  1WI0 A;  2ZJD A;  4FA6 A;  1I35 A;  2LXC A;  4FBJ B;  1OEY J;  1EWC A;  2BYT A;  1GC7 A;  2NCN A;  4IWO A;  2INC C;  4ICU A;  3CSF A;  3VUW A;  1D6E C;  3TEZ A;  4IG7 B;  4C7Y A;  2G3Q B;  2LVP A;  5E6P A;  1RYJ A;  1V97 A;  3O13 A;  4XE0 A;  1F52 A;  3GP7 A;  3V60 A;  3IT6 B;  5AEK B;  2D11 A;  3P4P B;  4E74 A;  2KN4 A;  3ETR A;  4LDT D;  1R4M I;  1YQ3 B;  2K39 A;  3ZQ4 A;  1XO3 A;  1P7F A;  5BYQ A;  3BZD B;  1HE8 A;  5EE3 A;  3V05 A;  1JWA D;  1ZDX A;  2D3C A;  2GBN A;  2L32 A;  1J8C A;  4G11 A;  2LJI A;  1VLB A;  3EHV A;  2M56 B;  2DZJ A;  4RF1 A;  2ICI A;  3PRZ A;  4PS7 A;  2K9X A;  2Z0E B;  2UU7 A;  3GE3 C;  1YX5 B;  2ZNV B;  3NVZ A;  4LK0 M;  1ZGU B;  3VRB B;  2ZPN A;  3VHT C;  1ENF A;  2L0T A;  4BKG A;  2KK8 A;  1KLU D;  4DQO C;  2VRR B;  2MBQ A;  4WJQ A;  1PUT A;  2LJ5 A;  2A4Z A;  2K0P A;  1D5Z C;  3EGR A;  2GOW A;  4RNA A;  1WRD B;  3NHE B;  1ZUD 2;  4KX6 B;  4JE3 B;  3E9S A;  4K7W A;  3L13 A;  4P7I A;  1ACC A;  1MJD A;  1TS5 A;  2LGI A;  5D3D A;  5L83 A;  2LEK A;  2J0K A;  3UIO B;  2GBK A;  1UWX A;  3ZXR A;  1STE A;  1SBB B;  2IY0 B;  3WCQ A;  1NEK B;  2GRI A;  2WXO A;  4B95 A;  1HTQ A;  3HRD D;  1RLF A;  3M63 B;  1MHX A;  3QK0 A;  2DEN B;  1HXY D;  2BYF A;  4IM2 A;  2JPH A;  4B0E A;  1V80 A;  4RGN A;  2JY6 A;  2M4N A;  4W9C A;  4ASW C;  4DHZ B;  4JWU C;  1LM8 B;  2Y5B B;  4IWP A;  1K51 A;  1TIF A;  4G3X B;  4DBG A;  5HFY A;  2EKI A;  5AZF A;  3PZ7 A;  1I42 A;  1XLO A;  3SD5 A;  3GZN B;  4G50 A;  2PTL A;  2KAJ A;  4W9K A;  3ZRC A;  3QCA A;  4TSS A;  2K3U A;  3KVF B;  3VAW A;  4AOF A;  3HM3 A;  2WDR B;  2O6V D;  1QIL A;  5JH5 C;  5IKC M;  3DQV A;  2IPK D;  1JAL A;  1TYG B;  3H7P A;  1Q5W B;  1S1Q B;  1QZE A;  3VRA B;  1VJK A;  3PGE A;  1OQY A;  4IKG A;  1E7U A;  3HHM A;  5IOI A;  4DHJ D;  2FIF A;  3AE9 B;  3A9K A;  2N9L A;  1WM2 A;  2MRP A;  5C3J B;  2KWU B;  3H7P B;  1JWB D;  3Q3F A;  1E9M A;  3EA6 A;  4N9F 4;  1ZP0 B;  2KTR B;  4KIK A;  2N1W A;  4D2K A;  2L76 A;  4FHK A;  5C23 A;  3PSE B;  2Y3A A;  1WX9 A;  3A9K B;  3P4S B;  5D2M B;  2V3N A;  3AN1 A;  4A20 A;  5G55 A;  3W1Y A;  1IUE A;  2FE8 A;  4NPN A;  2B76 B;  2UYZ B;  3VTU A;  2L52 A;  2KFJ A;  4KIK B;  3MHZ A;  2GI9 A;  5AUI A;  5FR3 A;  3PLU A;  1KM7 A;  1XEE A;  2AQ1 B;  3NVV A;  3AH7 A;  1L4D B;  2HD5 B;  5G2N A;  1I4P A;  2PE9 A;  2OJR A;  2PW9 A;  5DPT A;  4YSX B;  1RM6 C;  1EF5 A;  4NQK E;  2D3B A;  3JYU A;  3VR8 B;  2LGX A;  2MJD A;  5IA7 A;  3OJ4 B;  3APC A;  3BK1 A;  4JQW C;  2DAJ A;  2W9N A;  2FNJ B;  2DNF A;  2DZK A;  3RNC C;  3Q8A A;  2WGS A;  2NS5 A;  3VH4 B;  2CHW A;  4YT0 B;  4MGZ E;  2QIE B;  2I2Y A;  3TL5 A;  1JWM D;  4KDI C;  1VD2 A;  1WXV A;  3AU4 A;  1RWS A;  3W5U B;  5D94 A;  4IOI E;  3AE1 B;  1E8X A;  2AX5 A;  1R4M B;  1T3Q A;  3ZIM A;  4FUL A;  5CHW A;  4W9H A;  2BF8 B;  1PGB A;  2JYT A;  1TJE A;  1WGR A;  4I6N B;  2BYV E;  3I5J C;  2MBB B;  3RMK C;  1G6J A;  2QDF A;  3NJT A;  4TQ0 A;  5C1Z A;  2K6Q A;  4I6P A;  3X0W A;  5EDS A;  3A1Q A;  3RZF A;  3NZ3 A;  2BYE A;  3T3O A;  3RI7 C;  4K7U A;  2QSD A;  2RDB C;  3FAH A;  2G4S A;  2PLP A;  2W3R A;  2N9E B;  3SU8 X;  2BQQ A;  3M95 A;  3I57 A;  1E5W A;  3A1Q B;  1NYQ A;  1UF0 A;  3W1S C;  1SIJ A;  2DYM A;  3KYC D;  2INP E;  4BOZ B;  4GDK A;  4JLC A;  3IBE A;  3NZS A;  2WLB A;  4MGY E;  4BAX A;  2JRI B;  2KQ7 A;  5AZH A;  5BMG A;  4J6I A;  3L4P A;  3AE5 B;  4GIV A;  2NBV B;  2JT4 B;  3PTF C;  1L5P A;  2BS3 B;  1XXG A;  2H89 B;  4UDU C;  2FAZ A;  3KUC B;  3JW0 X;  4KGS A;  2C7N B;  2JZ3 B;  1ESF A;  4DWF A;  1NYR A;  5J17 A;  3PHX B;  2VZK B;  2GLS A;  4TKN A;  3X23 A;  5L95 C;  4ZRJ A;  5E6J A;  3N1Z C;  1C76 A;  3CIR B;  1VZ6 A;  2LVO A;  5E6N A;  2NVU I;  2FUH B;  4LJP B;  2WDT B;  4AWJ A;  3DVN V;  2KMM A;  3UF8 A;  4IC7 B;  1T0Q C;  1OTR B;  3SEB A;  1KLG D;  1VZ8 A;  2FID A;  2MH7 A;  4HWI B;  3T3N A;  1CQV A;  4ZRK A;  3R8B A;  2IO2 B;  4W9G A;  3A4R A;  2IND C;  1X1M A;  3NZU A;  1WF9 A;  4HEA 1;  1JWS D;  1YOV B;  3Q3M C;  4C80 A;  1SGH A;  3R7R A;  1Y8R C;  4RGM A;  3QA8 A;  1KTK A;  1DOY A;  5EE9 A;  3DVG Y;  2IO0 B;  1YJ1 A;  1EM7 A;  1PYW D;  4FJY A;  4EZK A;  1PGA A;  1GPX A;  3NG0 A;  3VTV A;  3R7Q A;  2NBW B;  2SAK A;  1FNW A;  3DBR I;  1YNT E;  3NUH B;  2WXP A;  4FXC A;  1V9J A;  2BWF A;  4YTN B;  3W1S A;  4W9L A;  4O1N A;  1WYG A;  3OG5 A;  5E6O A;  3C19 A;  1E8Y A;  1DGJ A;  2REX A;  3L16 A;  4RF0 A;  1Y56 A;  2MBE A;  3VH3 B;  3GS2 A;  2WX0 A;  2WXF A;  4ANX A;  2WXM A;  2JSV X;  4WWM A;  1E7V A;  1LO5 D;  1E0Z A;  1M4V A;  2LHD A;  1FRD A;  1SE3 A;  2LGY A;  3KH0 A;  2EMS A;  5DPS A;  2CHZ A;  3EEC A;  1YQB A;  1JQ4 A;  2KJ6 A;  4FLH A;  2D3A A;  4KVG B;  4BOS C;  2X38 A;  2KXJ A;  1P98 A;  4HK2 A;  2XBB C;  1R4N B;  4K7S A;  2I1J A;  1OEY A;  5HKH A;  4K1R B;  1I4Q A;  1L4Z B;  4YWG G;  2IO3 B;  3LYY A;  1FEH A;  5LLI A;  1HZ6 A;  1MHH E;  3ZDT A;  3IHP C;  2Q5W D;  1WZ3 A;  2YEP F;  2ACZ B;  4EEW A;  3TEX A;  2V9H A;  3BY4 B;  2PIA A;  4KDL B;  4KKI A;  1WE6 A;  2KMA A;  2ZEQ A;  3RD2 A;  3AE3 B;  2D07 B;  5CHV C;  3JVZ X;  2DWQ A;  4REZ A;  3R2I A;  4J3O D;  1VDV A;  1E10 A;  3QWZ B;  4JPS A;  4ARI A;  3B08 A;  5BYS A;  2KTF A;  1JML A;  2FCM A;  3ZNZ B;  1V8C A;  3AEB B;  4BKS A;  1XQQ A;  3DBH B;  2DHZ A;  1B1Z A;  1MVK A;  1IYF A;  1CMX B;  1FXI A;  4NZL B;  2LMC A;  1XLP A;  3IXS A;  1ZPS A;  2JXT A;  4N58 A;  2ONQ A;  1HEZ E;  1MI0 A;  3S2A A;  1DOX A;  3NY5 A;  2C9W B;  2WYQ A;  3IFW B;  1FXT B;  1C79 A;  2WX1 A;  3ZTD A;  1ZDV A;  4XYC A;  4I6L B;  1P1A A;  2XNA C;  2IDY A;  2L1A A;  3ZYY X;  2LAS A;  3AV8 A;  5KHO A;  1N63 A;  4K3B A;  4LNI A;  1AWD A;  3Q3J A;  1TZO A;  1GAQ B;  3ZJV A;  2RDG A;  2G45 B;  2LUE A;  2DYO A;  3SR6 A;  2ZPY A;  3FIL A;  4GXB A;  2EKE C;  1WGG A;  1K8R B;  5MPO A;  1EU3 A;  2LD9 A;  2IYD B;  4PT5 A;  1EU4 A;  2TSS A;  4M8N A;  2ZW1 A;  2KX3 A;  4JGH B;  5TR5 A;  4P16 A;  3NS8 A;  4LCD E;  4JWS C;  2K8C A;  3FIL B;  5BMH A;  3VDZ A;  3BVG A;  3GE8 C;  4YTP B;  3Q69 A;  4R3D A;  4KZ0 A;  1UNS A;  2HDE A;  3VFK A;  3RNA C;  1WR1 A;  4GOC A;  2Z0D B;  3AB5 A;  4HPP A;  1QOA A;  4XZ4 A;  1C78 A;  2L0F A;  4MEL A;  4ZOH C;  4MGK E;  4FJZ A;  1N5X A;  3ABV B;  2M8S A;  3FC4 A;  2BBC A;  3TEW A;  1OFF A;  3BIN A;  1XLQ A;  2LFI A;  1KOT A;  2Z8L A;  2FCN A;  2KOX A;  3WA0 A;  3IAS 1;  3P2B A;  4DK5 A;  2L00 B;  4HXD A;  1SJH D;  2MA9 B;  3WAO A;  4RGO S;  3IT4 B;  3DBR B;  4WQO B;  3KW5 B;  4MEM A;  2KVZ A;  1QOG A;  2W3S A;  1P3Q U;  2CS4 A;  5I4D A;  2CJN A;  4YTM B;  4RM9 A;  4KKJ A;  3UI3 A;  3GOE A;  1V6E A;  3PV1 A;  1AN8 A;  4TMA B;  3V3X A;  2J0J A;  3HM6 X;  3K9O B;  1AW7 A;  2BPS A;  1GOZ A;  2WQY B;  3B2G A;  3AED B;  3DBL B;  3VUX A;  1UZX B;  1KLV A;  4LLG M;  3N30 A;  4EZL A;  3RFZ B;  1P7E A;  1T0R C;  5BO4 B;  3ZNH B;  3MP9 A;  3WAM A;  3B1L X;  3TMP B;  4XC2 A;  1L6U A;  1OGW A;  3DDC B;  2L05 A;  1EF1 A;  4LNO A;  4TV3 A;  1ZXI A;  3NOB A;  1E7P B;  1BUI C;  1SB3 C;  2WS3 B;  4DXF A;  3P42 A;  3W2D A;  3QQ8 B;  3KLS X;  3SFD B;  2VH2 A;  1UBQ A;  1Z5S B;  4RMA A;  2LZ6 A;  2RR9 A;  2L83 A;  3KWL A;  4HKZ E;  2JVC A;  1NVI D;  5G5H A;  5FKA C;  2Y5C A;  3L10 B;  2AL3 A;  3TSS A;  2LI5 A;  1J0G A;  2I38 A;  3BVM A;  2K25 A;  4HCP B;  2ZZP B;  2ZW0 A;  1FIQ A;  2GMI C;  2G4D B;  2RDH A;  4NNJ B;  3RNF C;  3MFG A;  3ALB A;  2KQS A;  4A55 A;  5GMV A;  1N6Z A;  4IUM B;  1IP9 A;  1C4P A;  2JQR B;  3AE8 B;  3UIP B;  3P4Q B;  4KV2 A;  2MBH A;  2FBW B;  3P1M A;  1V5O A;  1SE2 A;  2KNB A;  1ISN A;  1T0S C;  1NEN B;  1WFY A;  5CX3 A;  1U4A A;  4BFR A;  3AXC A;  3HVD A;  4MJS A;  4QAY A;  3ZLZ A;  1P9D U;  3Q8E A;  1R4N I;  1V5T A;  2MX2 A;  2J53 A;  3MC9 A;  5DCN A;  3ZVV A;  1B9R A;  3A33 B;  4KGT A;  2G9H D;  1T0Y A;  3M3J A;  3N9Y C;  3R66 C;  1FPY A;  1KRH A;  4MJS B;  4H2A A;  3NVY A;  4S17 A;  3BK2 A;  4ICV A;  3PZ8 A;  2CHX A;  5DPR A;  5T8I A;  1L0Y B;  2J0M A;  4W9E A;  1MG8 A;  4XGA B;  4YSZ B;  3E56 A;  3H9D A;  4WWN A;  4GDL A;  3ZRF A;  2KLG A;  1WSP A;  3PRE A;  4A9A A;  3DHI C;  1D4B A;  2N9P C;  1LGR A;  4KZC A;  1DOI A;  4NJ7 A;  1GUA B;  1IGC A;  1WGK A;  1WMH A;  1DYQ A;  4XWW A;  2YLM A;  3DBH I;  3A9J A;  4L23 A;  1FO4 A;  4GDL B;  3LB8 C;  4C4V A;  3ONS A;  3MHS D;  4FJV B;  3ZO5 B;  4LNF A;  4CYE A;  5AZG A;  4OHJ A;  2EEL A;  5HHD G;  1WMH B;  3Q6B A;  4HLE A;  2PEA A;  1QLB B;  1WYW B;  3A9J B;  4TQ1 A;  3BVZ A;  3MJ5 A;  4C4V B;  4ANV A;  3HVZ A;  1FD6 A;  3DBS A;  4MGI E;  2DYB A;  5JZE B;  3BYT B;  4HJK A;  1JW9 D;  5CHF A;  1SE9 A;  2WXQ A;  1YIW A;  2K1F A;  5G5G A;  4HPL B;  1TKE A;  1V81 A;  2JRH A;  1AYF A;  4DXA B;  4US9 A;  4HRO A;  2W54 A;  1I4G A;  2QJL A;  3NS1 A;  2V1Y A;  1A5R A;  2DBY A;  1I4H A;  3N20 C;  5IN7 A;  2V4L A;  2JU6 X;  4GDK B;  1EUV B;  1I7H A;  1WGY A;  4WJN A;  4AUQ C;  1D5X C;  2AYO B;  3CF6 E;  3MTN B;  2VZK D;  1N60 A;  4LTU A;  5C2T B;  3DCG A;  2N4F A;  2RPQ A;  2N1V A;  1TKY A;  4ZYN A;  4PYU A;  1YQ4 B;  2WU2 B;  1BML C;  2KJR A;  3H1U A;  1C4C A;  1NI2 A;  3RT3 B;  4ZRI A;  1F9J A;  3URY A;  2LGD A;  3VR9 B;  3I3T B;  4M00 A;  4A8X C;  3R2T A;  1WJ6 A;  5H92 C;  4AJY B;  3NRZ A;  4B9K A;  2NPT A;  3RYT A;  1SSN A;  4RH6 A;  4OZB A;  4IW0 A;  4M01 A;  2KDB A;  2R2Q A;  2N0S B;  4A90 A;  2LXA A;  2MLB A;  2ASQ A;  2K22 A;  2WWZ A;  2K5P A;  2FUG 1;  4ZRP A;  4AS1 A;  4B0M A;  1VCB A;  3ZTC A;  2L3Z A;  2NPT B;  1V1P A;  2BB5 A;  3QC8 B;  2M0A A;  3DVN U;  4NJ6 A;  3D32 A;  4LNN A;  3N3K B;  4ANW A;  3MJW A;  3SHQ A;  3HIZ A;  2N7E A;  3TUO A;  2C7H A;  1L0V B;  3AEA B;  3T8M A;  1JRU A;  2KJH B;  1WXM A;  1FMA D;  4AJW A;  4XWT A;  1TGZ B;  3VVW B;  4II2 B;  2IJ0 A;  2KC2 A;  4OVV A;  3A4S C;  3M62 B;  3BII D;  2BS2 B;  3PRM B;  3Q8F A;  2MW5 A;  4ITK A;  4NJC A;  1WY8 A;  1Q10 A;  3GB1 A;  1I4R A;  1N5W A;  3AEF B;  2J4X A;  1WXS A;  2KD0 A;  2RD0 A;  4LNK A;  2LUM A;  2DLB A;  1SF0 A;  3DBL I;  4EE2 A;  5GXG B;  1QT9 A;  2JXX A;  1C77 A;  4YXD B;  2GBJ A;  4RM8 A;  2BS4 B;  3U52 E;  1UGJ A;  1IPG A;  2K8B A;  4NQL B;  2MSE D;  4DXG A;  2C7M B;  2WXR A;  3U7D A;  2L8J A;  1AAR A;  1R7S A;  4WJO A;  4HPM B;  3QHT A;  4BBN F;  1WXA A;  4GN1 A;  3TCA A;  1QKZ A;  2W55 A;  4BVU C;  2V4I B;  1TS3 A;  4PK1 A;  2KWD A;  4HCN B;  3PO0 A;  3RNB C;  2WU5 B;  3V6E B;  4GSW A;  4OZA A;  1IGD A;  4HJG E;  2PE6 B;  3AI5 A;  2ZNV C;  3AE2 B;  1XLN A;  1FCL A;  3L54 A;  1I4X A;  2IY1 B;  2M17 A;  1VRA B;  1D3Z A;  4II3 B;  2PMV A;  3AM9 A;  3PZD A;  4MM3 A;  2INN E;  1TKG A;  3WAL A;  3W5V B;  5KHQ A;  4WIP A;  2KDI A;  2PVO D;  2JF5 A;  1ZE3 D;  2KMC A;  4FAD A;  3RCZ A;  1E8Z A;  4L2Y A;  3KQ4 A;  3EFU A;  1TZ1 A;  3AUL A;  3KYD D;  2JWZ A;  4MM3 B;  2N7J A;  2BKF A;  4BKS D;  2MCN B;  3ML8 A;  2KLC A;  2KDE B;  3BWU D;  1FNV A;  4MT5 A;  1RRB A;  2L7R A;  1TT5 B;  1RAX A;  2DX5 B;  1CZP A;  4DDI D;  1QOB A;  1WJU A;  3ML9 A;  3Q2A C;  2MEK A;  2WXG A;  3UIN B;  2FCS A;  3Q8C A;  1C1Y B;  4PS3 A;  1JRO A;  4F8C B;  3Q8B A;  2V3S A;  2IZV B;  3AE6 B;  4BBN C;  2RPV A;  3KUD B;  2BTE A;  1FXA A;  4WUR A;  1UEL A;  4URK A;  4WAF A;  4NY0 A;  5HG2 A;  4AQ7 A;  3RUI B;  3APD A;  2M1M A;  4RCO A;  3PLV A;  4A3O A;  3DPD A;  1KFY B;  5BYR A;  4IM0 A;  3PHW B;  3W9C B;  5LNK 1;  2MJ3 A;  2KDF B;  4BZA A;  5IP4 D;  3PT2 B;  3L08 A;  1N62 A;  4LDT B;  1VR9 A;  1EO6 A;  2JYE A;  2RGF A;  4YL8 A;  5LXI B;  2CU1 A;  3DWG C;  4FHJ A;  2AEH A;  1J19 A;  4BKT A;  4FN2 A;  1WIA A;  3ZW3 A;  4XX5 A;  2AQ2 B;  3AE4 B;  2KVR A;  4L1B A;  1TY2 A;  2Y5P A;  2NTT A;  2GB1 A;  1J7A A;  4M8M A;  1S3S G;  1XT9 B;  2XK5 A;  2IGD A;  2LGS A;  2A5U A;  4NAW A;  4W9D A;  2I1K A;  2KAC A;  3Q3O C;  3H6N A;  2R61 A;  3U4E G;  2GBM A;  5JHA A;  4HKQ A;  1GB4 A;  1F2R C;  2C5L C;  5FK9 C;  4CQN A;  1WRI A;  2CR5 A;  1WE7 A;  4MDK E;  1HA5 A;  1NBF C;  1RFK A;  2MWS B;  2WNM A;  2XK5 B;  2Z59 B;  1V49 A;  4NAW B;  3U8Z A;  1WZ0 A;  4WJP A;  2MHJ A;  2OJW A;  1ZKH A;  3K9P B;  3ZUN A;  4DHZ E;  4P1B C;  4M0W A;  2C60 A;  2AQ3 B;  3FKY A;  2CU3 A;  4OVZ A;  1UWM A;  2GBR A;  2M0X A;  2KZR A;  3UQB A;  1WX8 A;  4JX1 C;  4ZDV A;  1XCT L;  5FR6 A;  2IO1 B;  4M0W B;  3V61 A;  2IBI B;  2AL6 A;  1Q1O A;  3L0W B;  1UUP A;  4EFO A;  2NBU A;  1A70 A;  2BKR B;  2W82 A;  1D5M C;  4KGR A;  4GU2 A;  4IWQ A;  2BVC A;  2JUO A;  3ZJT A;  3OAW A;  1PFD A;  2IGG A;  2KO3 A;  3V62 A;  2B3A A;  3MC8 A;  3ZKJ C;  2YEP B;  2O6V A;  3RN9 C;  1GJZ A;  4WH4 A;  3CST A;  1L2N A;  2KHW B; 
#chains in the Genus database with same CATH homology
 1DGJ A;  2PVG C;  1QLB B;  3NVW A;  3GP7 A;  4RF0 A;  4TQ1 A;  3TEY A;  1HQR D;  3BVZ A;  1Y56 A;  3MJ5 A;  3GS2 A;  3HVZ A;  2V3P A;  3IT6 B;  1FD6 A;  2WXF A;  3P4P B;  3EUB 2;  2WXM A;  2RMM A;  2WXI A;  2JSV X;  2KN4 A;  3ETR A;  1YQ3 B;  3BYT B;  3ZQ4 A;  4WWM A;  1XO3 A;  1YJI A;  1JW9 D;  5HI1 A;  1LO5 D;  1KH0 A;  1E0Z A;  1P7F A;  1M4V A;  2WXQ A;  5BYQ A;  3BZD B;  5G5G A;  4C56 C;  5EE3 A;  1TKE A;  1FRD A;  1SE3 A;  1JWA D;  1TS2 A;  2LHD A;  3V05 A;  2XN9 C;  5EE1 A;  1AYF A;  1ZDX A;  4US9 A;  4HRO A;  4ARC A;  2W54 A;  1I4G A;  1HZ5 A;  2L32 A;  2QJL A;  1FFU A;  1JQ4 A;  2LJI A;  4GLS C;  3NS1 A;  1VLB A;  2DBY A;  1I4H A;  2M56 B;  2X38 A;  4RF1 A;  2ICI A;  2JU6 X;  2K9X A;  1ZXH A;  1J7C A;  4GDK B;  1I7H A;  4A6Q A;  3NVZ A;  4LK0 M;  1I4Q A;  1D5X C;  1L4Z B;  4YWG G;  3LYY A;  2VZK D;  1FEH A;  3VRB B;  1N60 A;  1ENF A;  4LTU A;  1HZ6 A;  4DQO C;  1KLU D;  5C2T B;  1MHH E;  1QF6 A;  3BYY B;  2LHE A;  4C7Z A;  1TKY A;  2Q5W D;  2YEP F;  2ACZ B;  3TEX A;  1EWY C;  3AMZ A;  1PUT A;  1YQ4 B;  2WU2 B;  1VZ7 A;  1GB1 A;  2K0P A;  2SEB D;  1BML C;  1T5X D;  2WXL A;  1C4C A;  1D5Z C;  3EGR A;  4RNA A;  2PIA A;  4KKI A;  1JWU D;  4N6E B;  3URY A;  3AE3 B;  3VR9 B;  2DWQ A;  4REZ A;  3R2I A;  4J3O D;  4A8X C;  3R2T A;  1ZUD 2;  4KX6 B;  2M19 A;  1VDV A;  5H92 C;  4JE3 B;  3E9S A;  3NRZ A;  4ZHO A;  4RFB A;  2WDV B;  1E10 A;  1ACC A;  2J52 A;  1SSN A;  1TS5 A;  4RH6 A;  4OZB A;  2LGI A;  4JPS A;  4ARI A;  5BYS A;  2N0S B;  4A90 A;  5D3D A;  1JML A;  1V8C A;  3AEB B;  2K22 A;  3U7Z A;  2K5P A;  1B1Z A;  2FUG 1;  2LEK A;  4ZRP A;  4AS1 A;  1MVK A;  1FXI A;  4B0M A;  4NZL B;  2LMC A;  2NMQ A;  1UWX A;  1XLP A;  3IXS A;  1STE A;  1SBB B;  1V1P A;  4RGT A;  1ZPS A;  2BB5 A;  2JXT A;  3VQI A;  3WCQ A;  4N58 A;  1NEK B;  2M0A A;  2GRI A;  2WXO A;  1FCC C;  2ONQ A;  3HRD D;  1YN4 A;  1HEZ E;  1MI0 A;  1DOX A;  1MHX A;  1HXY D;  3P4R B;  3TUO A;  4B0E A;  2WXJ A;  1C79 A;  4RGN A;  1L0V B;  3AEA B;  4JWU C;  1ZDV A;  1SXT A;  1FMA D;  1QOF A;  1K51 A;  2XNA C;  5HFY A;  4XWT A;  2IDY A;  2L1A A;  2EKI A;  1ZOY B;  1N61 A;  3ZYY X;  3PZ7 A;  1L0X B;  3AV8 A;  2IJ0 A;  1N63 A;  3AE7 B;  1XLO A;  4YSY B;  1CJE A;  1AWD A;  5BMI A;  2OED A;  1TZO A;  2JX5 A;  1GAQ B;  2BS2 B;  2WXH A;  3BII D;  2PTL A;  3ZJV A;  2RDG A;  2KAJ A;  1BXT A;  3Q8F A;  2JZP A;  4TSS A;  4ITK A;  4NJC A;  2K3U A;  3I9V 1;  1OQQ A;  3KWV A;  2DYO A;  1NI3 A;  5AUK A;  3SR6 A;  3FIL A;  1Q10 A;  3GB1 A;  1I4R A;  1N5W A;  2WDR B;  3AEF B;  2J4X A;  1QIL A;  2DLB A;  2LUM A;  2IPK D;  1JAL A;  4P6V F;  1EU3 A;  5JXV A;  1SF0 A;  5MPO A;  4US8 A;  4EE2 A;  1TYG B;  4PT5 A;  5GXG B;  1QT9 A;  1C77 A;  1EU4 A;  3VRA B;  2TSS A;  1VJK A;  2ZW1 A;  4YXD B;  4IKG A;  2BS4 B;  3U52 E;  1XF5 L;  4P16 A;  1UGJ A;  3AE9 B;  1OQR A;  1FRR A;  2N9L A;  3OWE B;  4JWS C;  3FIL B;  4DXG A;  5BMH A;  2WXR A;  5C3J B;  1PGX A;  3BVG A;  4YTP B;  3Q69 A;  1JWB D;  4R3D A;  1E9M A;  2IGH A;  4Q2J A;  3P63 A;  1R7S A;  3EA6 A;  4ZYS A;  1ZP0 B;  1UNS A;  3H8H A;  4D2K A;  2HDE A;  1E6E B;  1K52 A;  2Y3A A;  1QKZ A;  2W55 A;  2V4I B;  1TS3 A;  3P4S B;  3AB5 A;  1QOA A;  1YN5 A;  2KWD A;  2V3N A;  1J7B A;  2J42 A;  3PO0 A;  2WU5 B;  1C78 A;  2WXN A;  3AN1 A;  4OZA A;  1IUE A;  1IGD A;  3AEE B;  2FE8 A;  2ON8 A;  4HJG E;  3U2S C;  2NTS A;  3AE2 B;  1XLN A;  4ZOH C;  1FCL A;  2B76 B;  1SEB D;  1N5X A;  3C8Y A;  2L52 A;  3ABV B;  3MHZ A;  3FC4 A;  2BBC A;  2GI9 A;  1I4X A;  5AUI A;  5FR3 A;  1OFF A;  3TEW A;  1VRA B;  1XEE A;  1XLQ A;  2LFI A;  1T6B X;  2PMV A;  2AQ1 B;  2Z8L A;  3NVV A;  3AM9 A;  3AH7 A;  1L4D B;  3IAS 1;  2INN E;  2V0G A;  1I4P A;  1TKG A;  2PW9 A;  3W5V B;  1SJH D;  4YSX B;  4WIP A;  2PVO D;  1RM6 C;  1ZE3 D;  4RGO S;  3HUI A;  3IT4 B;  1YJJ A;  3VR8 B;  2MJD A;  2E6X A;  3ZJU A;  4L2Y A;  3KQ4 A;  5D3I B;  1K53 A;  1TY0 A;  3BK1 A;  1QOG A;  2W3S A;  5I4D A;  4MM3 B;  2CJN A;  4YTM B;  2N7J A;  3Q8A A;  1PDX A;  4KKJ A;  3UI3 A;  4YT0 B;  2I2Y A;  2QIE B;  4TMA B;  1AN8 A;  1JWM D;  3BWU D;  3V3X A;  1FNV A;  3LXF A;  1RWS A;  4MT5 A;  3W5U B;  2PKO A;  1AW7 A;  2G1E A;  4IOI E;  4OZC A;  1C9F A;  3AE1 B;  1V1P B;  2QMT A;  2AX5 A;  1CZP A;  1QOB A;  1T3Q A;  1GOZ A;  2WQY B;  3B2G A;  2KDM A;  2MEK A;  1PGB A;  2WXG A;  3AED B;  3B9J A;  2H88 B;  2JYT A;  2WDQ B;  1TJE A;  1FNU A;  4LLG M;  3B2F A;  3RFZ B;  1P7E A;  3MP9 A;  2E3T A;  1SJE D;  3Q8C A;  4TQ0 A;  1JRO A;  3Q8B A;  3AEC B;  1L6U A;  3AE6 B;  3ZGZ A;  2RPV A;  3NZ3 A;  2BTE A;  3T3O A;  4XDC A;  5TSS A;  1FXA A;  1V1O A;  1ZXI A;  3IAM 1;  1QQR A;  4WUR A;  1E7P B;  1SE4 A;  4WAF A;  1BUI C;  5HG2 A;  4AQ7 A;  1SB3 C;  2CJO A;  2WS3 B;  4RCO A;  1L6V A;  4DXF A;  1C4A A;  1KFY B;  2QSD A;  3P42 A;  3W2D A;  3FAH A;  2PLP A;  2W3R A;  3KLS X;  5BYR A;  3SFD B;  1IBX A;  3W9C B;  5LNK 1;  2L83 A;  1WWT A;  2MJ3 A;  3I57 A;  3KWL A;  1JRP A;  4HKZ E;  4XDD A;  1NYQ A;  1N62 A;  1ET6 A;  1NVI D;  1VR9 A;  1SIJ A;  2DYM A;  2JYE A;  5D7G A;  5G5H A;  5FKA C;  2Y5C A;  4IDI A;  1ET9 A;  2INP E;  3TSS A;  2I38 A;  2WLB A;  3BVM A;  3DWG C;  2KQ4 X;  1F0Z A;  2N9K A;  2ZW0 A;  1FIQ A;  2RDH A;  5BMG A;  2JWU A;  4ZRQ A;  1IBX B;  3MFG A;  3L4P A;  3AE5 B;  4A55 A;  1L5P A;  2BW2 A;  4ZHP A;  2AQ2 B;  2BS3 B;  1XXG A;  3AE4 B;  4L1B A;  3SFE B;  2H89 B;  4UDU C;  1TY2 A;  2Y5P A;  2NTT A;  4KGS A;  2BT6 A;  1F77 A;  2GB1 A;  1J7A A;  1ESF A;  1C4P A;  1MPE A;  2JQR B;  3AE8 B;  2IGD A;  1NYR A;  1KF6 B;  3AEG B;  3P4Q B;  1WXQ A;  2KAC A;  2FBW B;  2VZK B;  2WP9 B;  3P1M A;  1SE2 A;  2QIL A;  2R61 A;  1NEN B;  3U4E G;  1XCQ L;  5E6J A;  3J9C A;  1C76 A;  3CIR B;  1VZ6 A;  4HKQ A;  1GB4 A;  1F2R C;  3HVD A;  5FK9 C;  3DWM A;  1WRI A;  4CQN A;  1JCK B;  1FFV A;  1HA5 A;  1RFK A;  2WNM A;  4NAW B;  3Q8E A;  4MAC A;  2BB6 A;  2J53 A;  4MH8 A;  2KMM A;  2WXK A;  1K50 A;  2D5G A;  1B9R A;  4KGT A;  2G9H D;  2OHF A;  4M0W A;  1YN3 A;  3N9Y C;  1KRH A;  3SEB A;  5H8Y E;  1KLG D;  1VZ8 A;  2MH7 A;  2MJE A;  1TS4 A;  2AQ3 B;  4H2A A;  3NVY A;  3BK2 A;  4OW0 A;  2CU3 A;  3T3N A;  1FM0 D;  3PZ8 A;  1CQV A;  1F2R I;  4OVZ A;  3R8B A;  5T8I A;  1L0Y B;  1ROE A;  1UWM A;  3CWI A;  4JX1 C;  4YSZ B;  3E56 A;  1XCT L;  4HRS A;  4HEA 1;  4WQM A;  1JWS D;  1CK1 A;  4C80 A;  1WSP A;  4RGM A;  5EE0 A;  4A9A A;  1D4B A;  4NAM A;  2HTM E;  2QEJ C;  1KTK A;  1DOI A;  3MC0 B;  5EE9 A;  1DOY A;  4N59 A;  1YMH E;  1UUP A;  1EM7 A;  1IGC A;  1PYW D;  1WGK A;  1A70 A;  4USA A;  3RPF C;  1DYQ A;  2W82 A;  1D5M C;  1PGA A;  4XWW A;  4KGR A;  1GPX A;  4L23 A;  1EWC A;  1FO4 A;  4GDL B;  3ZJT A;  3LB8 C;  2BYT A;  1PFD A;  2IGG A;  2SAK A;  1FNW A;  1YNT E;  3TEZ A;  1D6E C;  4C7Y A;  3NUH B;  2WXP A;  4FXC A;  1RYJ A;  2YEP B;  4OHJ A;  1V97 A;  4YTN B;  3W1S A;  2EEL A;  5HHD G;  4O1N A;  3O13 A;  4WH4 A;  1WYG A;  4XE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...