1CJEA

Adrenodoxin from bovine
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
KITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The tertiary structure of full-length bovine adrenodoxin suggests functional dimers.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
molecule keywords ADRENODOXIN
total genus 26
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1cjeA00
1PFDA 5EE1A 4USAA 3AB5A 3AE2B 3B2GA 4YT0B 5C2TB 3AE7B 1J7BA 1N5WA 1VDVA 3CWIA 1ROEA 4P6VF 1JWBD 1V97A 2L83A 5AUIA 1AYFA 1XLQA 1OQQA 3P4PB 1KRHA 1YQ4B 3KWLA 4YSYB 4HRSA 1I7HA 3NVYA 1NYQA 3CIRB 1TYGB 1RWSA 1SB3C 4YXDB 2L52A 4JWUC 3VR8B 5EE9A 1XO3A 1DOYA 2WDQB 1E6EB 1KFYB 3B2FA 1JRPA 1UWMA 4ZOHC 2K5PA 1JROA 1NENB 2MJDA 2H89B 1FMAD 1QLBB 3FC4A 3W5UB 2W3SA 1QF6A 1B9RA 1YJJA 3AECB 1JQ4A 1GAQB 1TKGA 2H88B 3AE5B 2MH7A 4KX6B 4C7ZA 3AEBB 2Y5CA 3P63A 2W55A 1DGJA 1WYGA 1L5PA 3AEEB 1QOBA 1OFFA 1WWTA 2PVGC 1FIQA 2W54A 1SF0A 2HTME 3AE1B 3NVWA 3DWGC 4N58A 1N60A 1PUTA 4WQMA 4LTUA 1JALA 1QOAA 3AH7A 1NVID 2Q5WD 1TKEA 3SFDB 3P4SB 3AMZA 3VRAB 1FO4A 1NYRA 1QT9A 4YTPB 2AX5A 1XLNA 1ZOYB 1YJIA 2MJ3A 2E3TA 3HRDD 5AUKA 1A70A 1CZPA 1FM0D 2G1EA 2CJNA 1XLPA 2M19A 4JX1C 5H92C 1N61A 1TJEA 3AM9A 2B76B 2ACZB 3BIID 1JW9D 1KF6B 2WU2B 2BS3B 5EE3A 2BS2B 1XLOA 1YQ3B 3AE4B 4ITKA 3ETRA 1DOXA 1ZP0B 3DWMA 1T3QA 3B9JA 3P4QB 1VLBA 3AV8A 2WU5B 2M56B 3HVZA 1WXQA 1AWDA 4A9AA 2WLBA 3L4PA 3AEDB 3W5VB 3SFEB 2WDRB 1JWAD 4HROA 3LB8C 1FFUA 3AEFB 1WRIA 5G5HA 1F0ZA 1DOIA 2FBWB 1NEKB 3AEAB 4YTNB 5C3JB 3P4RB 4IDIA 1QOGA 2PKOA 3W9CB 3P1MA 2QIEB 4N59A 1RM6C 1FXAA 4JWSC 5GXGB 3VR9B 2DWQA 2K9XA 3FAHA 3SR6A 4C7YA 2WS3B 1FFVA 1N62A 1IUEA 1SIJA 4C80A 3NS1A 1GPXA 1NI3A 3NRZA 1R7SA 1FRRA 2WDVB 3AE6B 5G5GA 3AE9B 4ZHOA 3WCQA 2W3RA 3HUIA 1TKYA 1EWYC 3AE8B 1RFKA 2KAJA 5H8YE 4YTMB 4YSXB 1N5XA 2WP9B 1L6UA 1VJKA 1J7AA 2JX5A 2EKIA 1E0ZA 1OQRA 2WQYB 4US9A 2LEKA 1CJEA 1V8CA 1PDXA 1L6VA 3NVVA 3RPFC 1ZXIA 3LXFA 5EE0A 3ZYYX 1FXIA 1E10A 2QJLA 2PVOD 1ZUD2 2K22A 2BS4B 2MJEA 1N63A 2JQRB 2BT6A 2PIAA 4YSZB 3AE3B 1WGKA 4US8A 2DBYA 1E7PB 3AEGB 1L0VB 1RYJA 3ABVB 1J7CA 4WWMA 3EUB2 2KMMA 3PO0A 2OHFA 4N6EB 4ZHPA 4FXCA 2CJOA 5MPOA 1E9MA 2CU3A 3AN1A 3VRBB 3NVZA 1FRDA 2N0SB 1QOFA
chains in the Genus database with same CATH superfamily
2C7MB 3Q3NC 1MHHE 4E74A 3Q2AC 1NI2A 2WXNA 2NBUA 3Q3OC 3KWLA 4K81A 3R66C 3PZ7A 2CHWA 3M63B 5GMVA 2BTEA 4KDLB 1E8WA 2K5PA 2R2QA 2V0GA 4BZAA 2JSVX 2N9LA 1WWTA 2W54A 2JF5A 5E6NA 4WQOB 5D6JB 2FCSA 2MJ3A 1YJIA 1YIWA 3R2TA 1WIAA 1P7FA 1CQVA 3AM9A 1JW9D 4KSKC 3A1QB 3RI7C 1VD2A 4S17A 2WXOA 4IWQA 3L4PA 2WDRB 3QIJA 1UNSA 3UIPB 4JLCA 3BWUD 2PKOA 2WXMA 4N59A 1VZ7A 3RUIB 5BYRA 1V9JA 2JYTA 2QMTA 1JWSD 2EMSA 1WRDB 4FJVB 3LYYA 2WXLA 4ASWC 2L1AA 1WYWB 1FNWA 1WE7A 2XN9C 2M0XA 2DAFA 3WAPA 3H9DA 1WF9A 4PYUA 4GSWA 4WAFA 1LGRA 2G9HD 2KWDA 1J8CA 2D5GA 1R4MB 1UBQA 4W9CA 1L0VB 4KVGB 4KGRA 3CMMB 1QOFA 2LD9A 1RLFA 4HJKA 2Y5BB 2UWQA 3V61A 4PS7A 3TEXA 4A6QA 4W9KA 3JVZX 1XO3A 3URYA 1WGHA 2N1WA 1V1PB 4XWTA 3RFZB 1V81A 4EZKA 4AS1A 3AECB 4K3CA 4C7ZA 3W1YA 3A4SC 4RMAA 1TZ1A 3ZXVA 3DWGC 4M0WA 4M00A 2W9NA 4ZDVA 4P1BC 2WXGA 4KDIC 3FKYA 4B9KA 4OZBA 3LJ3A 4JE3B 2O6VA 2BS2B 3HIZA 2FCMA 1ZP0B 1EU4A 3DDCB 4NJ7A 1WXQA 4GDLA 1J0GA 2K6DB 1DOIA 2NPTA 3WAOA 1J19A 2LFIA 3ZDMC 2DWQA 3A9KA 1G6JA 1V49A 2K8HA 1GPXA 1IBXA 1R7SA 2KVRA 4OVVA 2O6VD 1MJDA 1EWYC 1RRBA 4YTMB 2K39A 1F2RC 4TUUA 2BQQA 2V3NA 2KK8A 2JXXA 4MGYE 1V5TA 2LXAA 2CU1A 5DPTA 1T5XD 1RYJA 3L10B 5JZEB 2K8CA 4LLGM 1P1AA 2J7QB 3GZNB 1ISNA 2DZIA 2K25A 3AN1A 1C76A 4MGIE 2N0SB 3PS6A 2ZNVB 1PFDA 3VXWA 1I4QA 3AU4A 2OEDA 3KYCD 1M4VA 3OAWA 3I63C 1XQQA 4HLEA 3VH4B 4YXDB 4PYZA 3S2AA 3Q8AA 3ZJTA 3PRZA 4HXDA 2W3SA 3EFCA 2FIDA 3A9JB 4REZA 3ZTDA 4FBJB 4OZAA 4IM3A 2L0TA 5IP4D 3A4RA 3ECIA 3VTWA 3AMZA 5IO9A 2G1EA 3OJ3A 2NTTA 3R3MA 3BIID 2JRHA 4MH0E 4FA6A 3K9OB 2G3QB 2PEAA 3HVZA 1SIFA 4HROA 2KXJA 1QQRA 3PLVA 5HI1A 3HM6X 3ZGZA 3AEAB 1V1PA 1YD8U 2GBMA 1F9JA 4J6IA 3PV1A 4XGAB 4P16A 4RFBA 2WS3B 2KTFA 3MC8A 2YVCA 3L54A 1MG4A 2J0MA 3ZRCA 3QHTA 4YSXB 4G50A 1T0SC 2WP9B 1HXYD 4W9HA 3OLMD 3PSEB 1L6VA 3QK0A 5HKHA 2LJIA 4LDTD 4C56C 3BVMA 2BS4B 5TSSA 3AE3B 1V1OA 2MBHA 3PTFC 1FPYA 4LK0M 2MCNB 2Y5PA 1FRDA 3I3TB 1HEZE 2WXFA 5LNK1 1BT0A 1N5WA 1FCLA 2GOWA 2ZCBA 1EF1A 3EC8A 2L52A 2J4XA 5FK9C 4DHZB 1UWMA 4ICVA 2INDC 1TBEA 3RCZA 4DK5A 1GC7A 1H4RA 3TJPA 4ARCA 2IYDB 2A4ZA 2MW5A 3AEBB 4CHKA 2Y5CA 1V80A 3O13A 4G0NB 4RM9A 3GP7A 1QOAA 4MM3B 4RH6A 1TKEA 2Z59B 3TMPB 3AU5A 1NYRA 1FO4A 4YTPB 1TS4A 3MTNB 4JX1C 3N1XC 3Q8FA 2WU2B 2FCQA 2C60A 3ZVVA 3B9JA 1D5MC 2ZW0A 1V2YA 3LB8C 2BVCA 5G5HA 2IGHA 1WXVA 5BO4B 4OVUA 3VUYA 5C3JB 3KLSX 4EUTA 4IKGA 1E90A 1YN4A 2K9XA 2DAJA 5D3IB 1WR6E 4C4VA 2WX0A 1TS2A 3NS1A 2D11A 4K7SA 3ZW3A 3AE6B 2MSED 2L0FA 1IYFA 3D32A 3L16A 3AE8B 3VDZA 2VH1A 4IM0A 3WIMA 2ZEQA 1IGCA 2YLMA 4AJWA 1JCKB 4HJGE 1TIFA 4UDUC 2RGFA 4W9FA 2BKRB 3HHMA 2WXHA 2BF8B 2CKHB 4TV3A 4NNJB 2AYOB 4X57B 5C23A 4YSZB 1VZ6A 1WMHA 1QILA 1OTRB 2JZZA 1SSNA 2B3AA 4ARIA 2M4NA 4ZHPA 4YWGG 2KDIA 2LJ5A 2R2OA 5DPWA 2LHDA 1HTQA 3O65B 2NVUI 2KDBA 2LGDA 1VDVA 2BW2A 2KWUB 2UYZB 3L13A 1NYQA 2D3AA 3NS8A 5J17A 2JVCA 2CR5A 4RNAA 3W5UB 2D3BA 1EWCA 2L8JA 2JT4B 1GAQB 4GN1A 1WH3A 3TL5A 4DHJD 5D3DA 2Z8LA 2PVGC 2ZNVC 4FJZA 2N4FA 3JSVB 1QT9A 2L7RA 1WX7A 3L17A 2WDTB 4W9IA 3T3NA 3VQIA 4ITKA 2WNMA 5IKCM 2C7HA 2IO3B 4FN2A 3M62B 1D4BA 4B95A 1WRIA 3NZSA 3T3OA 2GRIA 4A3PA 3APDA 2KWCA 1ET6A 3Q8CA 2KT7A 5CHVC 3VUWA 3KW5B 3SR6A 4M02A 3PHXB 4HPPA 3ZNZB 3DVNV 2PE6B 4ZHOA 2MBBB 2GMIC 2KAJA 2AQ2B 3OG5A 2FUHB 4Q2JA 1PGAA 2N7EA 2HE7A 3NUHB 1N6ZA 1KM7A 2HTHA 2Y3AA 2ON8A 3N1ZC 3U7ZA 3QX1A 2LZ6A 3ML8A 4NAWB 4DHJB 2LGSA 3N20C 2QEJC 2N7DA 1S1QB 5JH5C 3W2DA 3IT4B 2KLCA 4C4VB 3UI3A 5EE1A 3AE2B 3B2GA 1YX6B 3NHEB 3ONSA 4EE2A 3A9KB 4XE0A 2KJRA 1E6EB 4ZOHC 2MWSB 1BUIC 2RR9A 3DVGY 2GBRA 2RDBC 1TGZB 1TS3A 1TKGA 2H88B 1E8ZA 2IDYA 3SD5A 3Q3MC 4HWIB 2GB1A 2ZW1A 1DGJA 1QOBA 4A20A 2WXQA 1XEEA 1N60A 1Z5SB 3AH7A 3P4SB 2BYTA 3QCAA 4MM3A 2E3TA 1BXTA 2KC1A 2ZJDA 1TJEA 4BKGA 1SE3A 4RGMA 1XLOA 4AQ7A 4IC7B 3NJTA 3ETRA 5IA7A 3PPAA 3KUZA 4GU2A 1AWDA 4AWJA 1JWAD 2C9WB 3M95A 3AEFB 3NG0A 4IWPA 2XK5B 3P4RB 2BWES 1FXTB 3W9CB 2AL6A 1T0RC 2I1JA 3FAHA 1HE8A 4TQ0A 1WX9A 2QHOA 2KD0A 3OWEB 3RD2A 2PW9A 3E56A 1RFKA 1ZXHA 2GBNA 4IOIE 3Q3JA 2ZVNA 2FNJB 1J7AA 1OQRA 5BYQA 3TIXA 4S0RA 3APCA 2GI9A 2L05A 1ZXIA 1WR1A 2BYFA 4J3OD 4HVBA 3QWZB 2MP2A 3BVGA 4US8A 4LNKA 4KGSA 3WAMA 3ABVB 1Q0WB 1VRAB 5HHDG 1GB4A 1UWXA 2G45B 3CF6E 4CYEA 1FCCC 5KHQA 2CS4A 3L08A 3IXSA 2MBOA 4ZRKA 1JWBD 4I6PA 1P98A 4L1BA 4JGHB 1UBIA 3DVGX 4FULA 3VTVA 3NVYA 4FLHA 1JRPA 4ZYNA 2FIFA 3WANA 3APFA 1P3QU 2DZMA 4HCNB 2MH7A 4BOZB 4AUQC 3M3JA 2MX2A 4ACFA 1TY2A 1YJ1A 3A1QA 3T8MA 2AX5A 1S3SG 4NAMA 3GB1A 2B76B 1SGHA 2BYEA 2DYBA 5CHFA 1WXSA 2KWVB 4XDDA 4IWOA 3MHZA 4DHZE 1NDDA 4WAAA 2WXJA 4RF0A 1WGRA 3VAWA 5D7GA 1T0YA 5AZFA 3UQBA 3EHVA 2VH2A 4EZLA 2LVPA 3Q14C 4W9LA 3UGBB 4M8NA 2LUEA 2V4LA 2N9EB 1ACCA 3GS2A 4TKNA 3ZXRA 3KUDB 1E10A 1MHXA 2LGYA 2QJLA 2UU7A 1C4CA 4RM8A 3VVWB 4NZLB 3ZKJC 4XZ4A 2KQ4X 3EUB2 3UQAA 2V4IB 5MPOA 2QSDA 2ZPYA 3RYTA 3MP9A 4AP4C 5CX3A 3VHTC 1NBFC 4MELA 1AYFA 1C78A 4RCOA 2I38A 2KFJA 3ZQ4A 5DPRA 2WXIA 4FHJA 3IFWB 3PZDA 3BZDB 4GDLB 4LDTB 1MFWA 2N7JA 4PK1A 1NENB 2DYOA 2H89B 4OVZA 3TEZA 3C19A 1VCBA 2IJ0A 2LWPA 3ZJVA 3RMKC 1SJHD 3DBHI 2M8SA 3RNEC 1WGDA 3NVWA 4NJ6A 4LTUA 4BFRA 2N9KA 2K8BA 3VRAB 1ZDXA 3HRDD 3LDZE 4TSSA 4M0WB 5D94A 3SDLC 3DBRB 4GLSC 4DXGA 1PYWD 1X1MA 1GG3A 1VLBA 3AV8A 3PT2B 4P1CC 1CK1A 2LMCA 3FILA 4F7ZA 2L76A 2N9XA 1D5ZC 3Q8BA 2M0AA 1NEKB 4II2B 1L0XB 2K3UA 1P0RA 2KZRA 2QIEB 1F1HA 2MEKA 1SIJA 3MJ5A 2DHZA 2LVOA 2NTSA 2IBIB 4WH4A 2G4SA 2JX5A 4PT5A 3V6CB 4BVUC 4JQWC 4NAWA 5BMIA 1V8CA 3V05A 4WJPA 3IHPC 2NMQA 1OEYJ 3RZWC 3H8HA 2XNAC 5FR3A 2GLSA 2D07B 4WWOA 2RDHA 4ANUA 4N6EB 2ZVOA 4HPLB 1HTOA 4EZJA 2MRPA 4MGZE 1K50A 4FJYA 3V6EB 4DDID 2KFKA 1WSPA 1C79A 1T6BX 2X38A 3T9LA 2O2VA 3P4PB 4W9JA 2FCNA 1F2RI 1DYQA 1RWSA 2ZZPB 2WDQB 2ZCCA 4URKA 1R4NB 2L3ZA 3NZUA 1U4AA 2IY1B 1F52A 2KN5A 4DXAB 2LRWA 3Q3FA 2WXKA 1SF0A 2HTME 4N58A 4WQMA 1KOTA 4WIPA 2QC8A 2CJNA 3RNAC 4G3XB 5E6PA 3KQ4A 3DOWA 4M01A 2IGGA 2WU5B 5DCNA 1I4XA 2VRRB 3DBSA 3W5VB 3V3XA 3SFEB 4BKSD 2A5UA 2SAKA 4WJQA 1AN8A 4L2YA 2OOBB 2XEWA 2K1FA 4EEWA 3VR9B 5GXGB 3WALA 4C7YA 1D3ZA 1NI3A 3TEWA 5G5GA 3AE9B 1JRUA 3I5JC 4HKZE 3L0WB 4O1NA 3P42A 2Z0EB 1N5XA 2MP2B 1L6UA 3U4EG 4HCPB 2LEKA 1LXDA 4WJNA 4NQLB 2KO3A 2KJHB 4K1RB 5BMHA 1FXIA 2BBCA 2GBKA 2MJEA 1FEHA 2BT6A 1R4MI 1V6EA 4LNNA 3HM3A 4IW0A 4WWMA 4LNFA 1L0YB 2CU3A 2HDEA 1ENFA 4JL9A 5IN7A 3CSTA 3ML9A 1AW7A 5C2TB 2IO2B 2KVZA 2X8XX 1KRHA 2HD5B 5IOIA 4G11A 3BK2A 3KVFB 5EE9A 1SXTA 3UIOB 3ALBA 1C9FA 5DPSA 1K53A 4F8CB 2K0PA 1TS5A 2W55A 1L5PA 5JHBA 1KH0A 2WXRA 1C4PA 3SFDB 4GDKA 1GB1A 1ZOYB 1A70A 1XLPA 3IVFA 4DXFA 2ACZB 3A9JA 1YQ3B 3AE4B 3DWMA 4GXBA 1YQBA 3I9V1 2M56B 3IAS1 1WZ0A 2BB6A 4LJPB 5AZHA 2IO1B 1SE9A 1OEYA 3N3KB 1IGDA 1RM6C 2OJWA 3GE3C 3RT3B 1HZ5A 3GZNI 3H1UA 4C80A 2L32A 4YL8A 2WWZA 4DWFA 2KACA 2HJ8A 1Q10A 1ZGUB 4HPMB 2NCNA 1UZXB 1E7UA 1HZ6A 4N9F4 3PVLA 1B1ZA 3K9PB 3GE8C 3DBLB 1BMLC 3BINA 4P7IA 2YEPB 1YMHE 5LXIB 5G2NA 1FD6A 3DVNU 1EU3A 4RGNA 1WE6A 2JY6A 4FXCA 4EKUA 2D3CA 2PE9A 2RPVA 3VRBB 2FAZA 1T0QC 2ZPNA 2QCZA 3AE7B 3P2BA 3JYUA 3C8YA 2DLBA 2NPTB 2XBBC 1YQ4B 4BAXA 1SB3C 1KFYB 3KH0A 5C1ZA 2MJDA 1FMAD 1QLBB 1YJJA 1C4AA 5T8IA 3Q8EA 4ZRPA 3RNFC 4HRSA 1FIQA 4TMAB 1PUTA 2Q5WD 4BKTA 1CZPA 2KDEB 4OW0A 4MGKE 2BS3B 4GDKB 1LQBA 1OGWA 1WGGA 3DBRI 2RDGA 3ZNHB 4A9AA 3AEDB 4RGTA 5JHAA 2DENB 4RGOS 4D2KA 1I42A 2AQ3B 3PLUA 2BKFA 4PS8A 2JWUA 4FHKA 4LNIA 4IDIA 3V62A 2IPKD 2KNBA 2D2QA 3PZ8A 4MACA 4MSMB 4JWSC 1QZEA 1WI0A 3BVZA 3ZNGC 3RNBC 1IUEA 3DBHB 2JRIB 1EM7A 2RSUA 2J52A 3R7QA 1TKYA 1E8XA 4A55A 3HVDA 4KZCA 1SJED 2NBVB 1VJKA 2DX5B 3PHWB 1RAXA 5G55A 3MC9A 4K3BA 2INNE 5BMGA 1ZE3D 1VZ8A 3ZIMA 4MJSB 2K6QA 4GMVA 1GC6A 2DBYA 1STEA 2RPQA 1M94A 3NVZA 1K51A 3KWVA 3H7PA 4YT0B 2DZKA 5JXVA 1HA5A 2WX1A 3H7SA 5AUIA 3AULA 2G4DB 4IG7B 3CIRB 5TR5A 1PGBA 3W1SC 4B6WA 3B08A 3B2FA 4XDCA 1JQ4A 1UELA 1ZDVA 3KUCB 3AE5B 1YN3A 3TSSA 2KDMA 3P63A 1ZW7A 1DOYA 2QDFA 3DHHC 3QAQA 4WJOA 1XLNA 5AZGA 3DPDA 2J0JA 1N61A 3N1YC 4NQKE 1ESFA 3DBLI 1MPEA 4AOFA 1T3QA 1E5WA 3R7RA 1KLUD 2WLBA 1ZKHA 3ZRFA 2IY0B 2VZKD 4YTNB 2AWTA 2NS5A 2YEPF 4TQ1A 3B0AA 1WGYA 3VTUA 2KQSA 1JWMD 2I1KA 3SEBA 3BY4B 1I4GA 1FRRA 2WDVB 2EELA 3DHIC 5L83A 1L4DB 4JPSA 4XC2A 1WXMA 3AXCA 1YOVB 2LASA 3QQ8B 3J9CA 4GB9A 4A3OA 1XCTL 1D6EC 1KJTA 1A5RA 4QAYA 1FNVA 1K52A 1XT9B 2DNFA 3MFGA 4HDOA 4E71A 2BGFA 3IAM1 4NY0A 1UGMA 4MJSA 2PVOD 4MSQB 3TCAA 1WZ3A 3PREA 2WGSA 2LHEA 3U7DA 5J2RA 1J7CA 3PO0A 2BB5A 2CJOA 1XF5L 2L00B 4US9A 3SHQA 2GBJA 3TBLD 1UGJA 3X0WA 4P6VF 3MJWA 2KQ7A 1V97A 4W9GA 1XLQA 1OQQA 3QA8A 4BBNF 1YNTE 4W9EA 4YSYB 2XK5A 1I7HA 1Q5WB 5FKAC 2BPSA 1Y56A 4JWUC 2KDFB 4R3DA 4HKQA 1WX8A 4HDQA 2LVQA 3AE1B 3HK0A 2REXA 1OQYA 3E9SA 3NY5A 2E6XA 1NVID 3RNGC 3W1SA 2M19A 5H92C 1UD7A 4WURA 2WYQA 4NJCA 1KTKA 1MVKA 4GOCA 1SE4A 3N32A 1Y8RC 2KMAA 3N30A 1V5OA 5BYSA 3VUXA 1EUVB 1I4HA 3P1MA 3BYTB 2KANA 1FFVA 1N62A 3N9YC 3SU8X 2JPHA 3NRZA 2KX0A 4EFOA 4KV2A 4MEMA 5H8YE 4I6NB 1YN5A 4C00A 1YX5B 1VR9A 2EKIA 5LXHA 1CMXB 3NVVA 4DDGD 3OJ4B 5IAAC 2RMMA 2KHWB 5AEKB 1ET9A 1WGKA 2I2YA 2INPE 5FR6A 4ICUA 4KKIA 2HJ1A 4W9DA 2MQJA 2KMMA 1WJNA 1IBXB 3PRPB 1KLGD 3AB5A 3ZTCA 3QC8B 4XYCA 2WXPA 1E8YA 2PMVA 3GOEA 4RF1A 1LO5D 3WA0A 2MA9B 3IT6B 4LNOA 3VH3B 4K7UA 1JROA 3FC4A 3H6NA 1TY0A 2BYVE 4EOYA 2O6VB 3AEEB 4MT5A 4LJOB 1B9RA 3EA6A 4MH8A 1I35A 1TT5B 1Q1OA 3AI5A 1MG8A 4CQNA 2LGIA 2AEHA 3QJZA 5AUKA 1FM0D 4AJYB 1C77A 4GIVA 1WM2A 3EGRA 1C3TA 2MHJA 1L4ZB 1MI0A 1GUAB 2JUOA 2LRUA 1DOXA 1XCQL 1E7VA 2V1YA 1Z2MA 1FFUA 5LLIA 3U2SC 3RZFA 4MDKE 2JYEA 4CO7A 3MHSD 1D5XC 3IBEA 3H7PB 5EDSA 3ENEA 4DQOC 2KKCA 3DHGC 3HUIA 2FUG1 2JWZA 1C1YB 2D10A 3RPFC 3A33B 3UINB 3LXFA 5EE0A 5E6JA 3DQVA 3VFKA 1L2NA 3KYDD 1P9DU 2JQRB 4GGQA 2PIAA 2MLBA 2AQ1B 2IZVB 3AEGB 3Q6BA 4A90A 5CTRC 3EECA 2OHFA 5HG2A 4IM2A 2PJHA 1KF6B 2ONQA 3NOBA 4USAA 3ZUNA 2BWFA 1J7BA 3CWIA 4IUMB 1L7YA 2L83A 3TUOA 2LXCA 2AL3A 3DCGA 3JW0X 3MC0B 4KIKA 1KLVA 3ZO5B 4HEA1 2ASQA 2Z0DB 1SBBB 2KLGA 2ICIA 1I4RA 2JXTA 2TSSA 1WYGA 1WY8A 1XD3B 3U8ZA 1AARA 1JALA 2KJ6A 4I6LB 3R8BA 4ANWA 5KHOA 3X23A 2NR2A 2N1VA 3RN9C 3TEYA 2SEBD 4KSLC 1SE2A 2RD0A 2V3PA 4ZRQA 2PLPA 1F0ZA 2FBWB 3CSFA 1GOZA 4WWPA 1WJ6A 1R4NI 1FXAA 4KIKB 4FADA 3QARA 1I4PA 1HQRD 1P7EA 2M17A 1TTNA 2O2VB 1UH6A 4KKJA 1GJZA 2NBWB 3B1LX 2C7NB 1SEBD 2W3RA 4OZCA 3WCQA 4DBGA 2KFKB 5E6OA 4PS3A 4ANXA 1IPGA 2DYMA 1FNUA 1JMLA 4OHJA 3R2IA 1H8CA 5J18A 2IO0B 2LGXA 1PDXA 2PTLA 1LFDA 2EMTA 3ZYYX 3PRMB 1ZUD2 3PGEA 1N63A 1GNUA 2W82A 3UF8A 1JWUD 1E7PB 1EF5A 4HK2A 2MBQA 1WJ4A 4BKSA 1E9MA 5CHWA 2KMCA 1QKZA 1PQSA 1XXGA 2KTRA 4KGTA 1ROEA 4II3B 3U30A 1WM3A 2D3GA 3BYYB 4E3CA 2VZKB 2V3SA 3V60A 3RNCC 2V9HA 4A8XC 1TYGB 4WWNA 3VR8B 3I57A 4JIOU 3RULA 1F77A 2KN4A 2M1MA 1QF6A 2C5LC 1EO6A 1WJUA 4KX6B 1WFYA 4B0EA 3FILB 3IG3A 3EFUA 1OFFA 5HFYA 3ZNID 2J0KA 4H2AA 5D2MB 3BK1A 4XX5A 2LI5A 2KYWA 5L95C 5EE3A 2DZJA 1PGXA 1WXAA 2JZ3B 3JSVA 3P4QB 1ZPSA 3U52E 4ZRJA 2KX3A 4M8MA 4ZRIA 4K7WA 2J53A 3ZJUA 2J42A 3C0RB 2EKEC 2WHIA 2CHZA 3ZLZA 1QOGA 2MBEA 4LCDE 2KTRB 4BOSC 1RFAA 2LUMA 1IP9A 1UUPA 4NPNA 3NZ3A 4ZYSA 2JZPA 1UF0A 2KC2A 2KOXA 5I4DA 2R61A 2OJRA 2PPHA 4L23A 1E0ZA 2INCC 2WQYB 2FE8A 1CJEA 4F1SA 1V86A 1K8RB 4XWWA 1WMHB 2IGDA 3Q69A 2N9PC 1TZOA 2K22A 4ANVA 2QILA 4B0MA 4KZ0A 2JU6X 4BBNC 2CHXA 1LM8B 3ZDTA
chains in the Genus database with same CATH topology
1UGJA 1VDVA 4P6VF 1WSPA 1MHHE 1C79A 1T6BX 1V97A 2X38A 2WXNA 1XLQA 1OQQA 3P4PB 2BW2A 1YNTE 3KWLA 4YSYB 1I7HA 3PZ7A 1NYQA 1F2RI 5FKAC 1DYQA 1Y56A 1RWSA 4JWUC 2WDQB 2BTEA 4RNAA 4R3DA 4HKQA 2K5PA 3W5UB 1EWCA 2V0GA 1GAQB 2JSVX 5D3DA 2N9LA 1WWTA 2PVGC 2W54A 2WXKA 2Z8LA 3AE1B 1SF0A 2HTME 4N58A 3E9SA 4WQMA 2E6XA 1NVID 3W1SA 1QT9A 4WIPA 2MJ3A 1YJIA 2CJNA 2M19A 3R2TA 5H92C 1P7FA 3T3NA 1CQVA 3AM9A 4WURA 3VQIA 1JW9D 4ITKA 3KQ4A 4NJCA 1KTKA 2WNMA 2IGGA 1MVKA 2WU5B 1I4XA 1SE4A 2WXOA 3L4PA 3W5VB 3V3XA 3SFEB 2WDRB 1UNSA 2SAKA 1D4BA 1WRIA 1AN8A 2GRIA 4L2YA 3T3OA 3BWUD 5BYSA 1ET6A 2PKOA 1I4HA 2WXMA 3P1MA 4N59A 3BYTB 1VZ7A 3Q8CA 3VR9B 5GXGB 3SR6A 4C7YA 1FFVA 1N62A 5BYRA 3N9YC 1NI3A 3NRZA 3TEWA 5G5GA 2JYTA 2QMTA 3AE9B 4ZHOA 4HKZE 2KAJA 5H8YE 1YN5A 4O1NA 1JWSD 3P42A 2AQ2B 1N5XA 2WXLA 3LYYA 2L1AA 1L6UA 1VR9A 3U4EG 1FNWA 2EKIA 4Q2JA 2LEKA 2XN9C 3NVVA 1PGAA 5BMHA 1FXIA 3NUHB 2BBCA 2RMMA 4WAFA 2MJEA 1FEHA 2G9HD 1ET9A 2KWDA 2Y3AA 2BT6A 2ON8A 1WGKA 2D5GA 3U7ZA 2I2YA 2INPE 1L0VB 4KKIA 4WWMA 4NAWB 2KMMA 2QEJC 1L0YB 4KGRA 1IBXB 2CU3A 2HDEA 1ENFA 3W2DA 1QOFA 3IT4B 3UI3A 1KLGD 5EE1A 3AB5A 3AE2B 3B2GA 1AW7A 5C2TB 2WXPA 2PMVA 4EE2A 4RF1A 1KRHA 4XE0A 3TEXA 4A6QA 1LO5D 3IT6B 3BK2A 5EE9A 1XO3A 3URYA 1SXTA 1E6EB 4ZOHC 1C9FA 1BUIC 1V1PB 4XWTA 1JROA 3RFZB 3FC4A 1TS3A 1K53A 3AECB 1TY0A 4AS1A 1TKGA 2H88B 2IDYA 2K0PA 4C7ZA 1TS5A 2GB1A 2W55A 2ZW1A 1DGJA 1L5PA 3AEEB 1QOBA 4MT5A 1B9RA 3EA6A 2WXQA 4MH8A 1XEEA 3DWGC 1N60A 4M0WA 1KH0A 3AH7A 2WXRA 4CQNA 1C4PA 3SFDB 3P4SB 2BYTA 2LGIA 2WXGA 1GB1A 1ZOYB 2E3TA 5AUKA 1BXTA 1A70A 1FM0D 4OZBA 1C77A 1XLPA 1TJEA 4JE3B 4DXFA 2ACZB 3EGRA 1SE3A 2BS2B 4RGMA 1XLOA 1YQ3B 4AQ7A 3AE4B 1L4ZB 1MI0A 3ETRA 1DOXA 1ZP0B 3DWMA 3I9V1 1EU4A 1XCQL 2M56B 3IAS1 1WXQA 1AWDA 2BB6A 1JWAD 1FFUA 3AEFB 3U2SC 1DOIA 3P4RB 2JYEA 1IGDA 3W9CB 1RM6C 1D5XC 2LFIA 2DWQA 3FAHA 1HZ5A 4TQ0A 4C80A 2L32A 1GPXA 1IBXA 1R7SA 4DQOC 2KACA 3OWEB 1Q10A 3HUIA 2PW9A 2FUG1 3E56A 1EWYC 1RFKA 4YTMB 1ZXHA 1HZ6A 4IOIE 1B1ZA 1J7AA 1F2RC 1OQRA 5BYQA 2GI9A 2V3NA 3RPFC 1ZXIA 1BMLC 3LXFA 5EE0A 5E6JA 4J3OD 2YEPB 1YMHE 2JQRB 2PIAA 3BVGA 1FD6A 4US8A 1T5XD 2AQ1B 3AEGB 4KGSA 1RYJA 3ABVB 4LLGM 4A90A 1EU3A 4RGNA 2OHFA 5HG2A 4FXCA 1VRAB 5HHDG 1GB4A 1UWXA 2RPVA 1C76A 3AN1A 3VRBB 2N0SB 1KF6B 2ONQA 1PFDA 1FCCC 4USAA 1I4QA 3AE7B 1J7BA 3IXSA 3CWIA 1JWBD 2OEDA 2L83A 3C8YA 1M4VA 2DLBA 3TUOA 4L1BA 1YQ4B 3NVYA 3MC0B 1SB3C 4HEA1 4YXDB 1SBBB 1KFYB 1JRPA 3Q8AA 2MJDA 3ZJTA 1FMAD 1QLBB 2ICIA 2W3SA 1YJJA 1I4RA 1C4AA 2MH7A 5T8IA 2JXTA 2TSSA 3Q8EA 4ZRPA 4REZA 1WYGA 4OZAA 4HRSA 1FIQA 4TMAB 1PUTA 1TY2A 1JALA 2Q5WD 3AMZA 3R8BA 2AX5A 4NAMA 1CZPA 2G1EA 2NTTA 3GB1A 4OW0A 2B76B 3BIID 2BS3B 4GDKB 3TEYA 2SEBD 1SE2A 3HVZA 2RDGA 4A9AA 3AEDB 2V3PA 4RGTA 4HROA 4RGOS 4ZRQA 2PLPA 4XDDA 4D2KA 1QQRA 2AQ3B 3MHZA 5HI1A 3ZGZA 2FBWB 3AEAB 1F0ZA 1V1PA 2JWUA 4IDIA 2IPKD 1GOZA 2WXJA 4RF0A 3PZ8A 4MACA 1FXAA 4JWSC 3BVZA 5D7GA 1I4PA 1HQRD 2WS3B 1P7EA 4P16A 1IUEA 4RFBA 4KKJA 1EM7A 1SEBD 2J52A 2W3RA 4OZCA 3WCQA 1TKYA 2DYMA 4A55A 3HVDA 1FNUA 4YSXB 1JMLA 2WP9B 1HXYD 1SJED 4OHJA 3R2IA 1VJKA 1ACCA 3GS2A 1PDXA 1L6VA 2PTLA 3ZYYX 2LJIA 1MHXA 2INNE 1E10A 2QJLA 1ZUD2 1ZE3D 3BVMA 5BMGA 4C56C 1VZ8A 2BS4B 1C4CA 1N63A 4NZLB 5TSSA 2W82A 3AE3B 1V1OA 1JWUD 2DBYA 1E7PB 2KQ4X 1STEA 3EUB2 4LK0M 2V4IB 5MPOA 2QSDA 2Y5PA 1E9MA 3NVZA 1FRDA 1QKZA 1K51A 3KWVA 1HEZE 2WXFA 4YT0B 3MP9A 5LNK1 1N5WA 1XXGA 5JXVA 4KGTA 1ROEA 1FCLA 1HA5A 5AUIA 3BYYB 1AYFA 1C78A 2VZKB 4RCOA 2I38A 4A8XC 3ZQ4A 3CIRB 1TYGB 2WXIA 1PGBA 2J4XA 2L52A 5FK9C 3BZDB 3I57A 4GDLB 3VR8B 3B2FA 1F77A 1UWMA 2KN4A 2N7JA 1NENB 2DYOA 2H89B 4XDCA 4OVZA 3TEZA 1QF6A 1JQ4A 1ZDVA 4ARCA 3AE5B 2IJ0A 4KX6B 3ZJVA 1YN3A 3AEBB 3TSSA 2KDMA 4B0EA 2Y5CA 3P63A 1SJHD 3FILB 1DOYA 1OFFA 3O13A 3NVWA 3GP7A 5HFYA 4LTUA 1QOAA 2N9KA 4MM3B 4RH6A 1TKEA 3VRAB 1FO4A 1NYRA 4YTPB 4H2AA 1TS4A 1XLNA 1ZDXA 3HRDD 4TSSA 3BK1A 4JX1C 1N61A 4GLSC 4DXGA 3Q8FA 1PYWD 1ESFA 2WU2B 5EE3A 1PGXA 1MPEA 1T3QA 3B9JA 3P4QB 1VLBA 1ZPSA 3AV8A 1CK1A 2LMCA 3FILA 1D5MC 2ZW0A 1KLUD 2WLBA 3U52E 3LB8C 2VZKD 1D5ZC 3Q8BA 3ZJUA 2J53A 5G5HA 2IGHA 2M0AA 4YTNB 1NEKB 2J42A 5C3JB 3KLSX 4IKGA 1L0XB 1QOGA 2K3UA 2YEPF 2QIEB 4TQ1A 1YN4A 2LUMA 2K9XA 2MEKA 1UUPA 3NZ3A 5D3IB 4ZYSA 1SIJA 1JWMD 3MJ5A 1TS2A 3NS1A 3SEBA 2JZPA 1I4GA 1FRRA 2WDVB 3AE6B 2EELA 1L4DB 2NTSA 4JPSA 2R61A 5I4DA 3AE8B 1IGCA 4WH4A 4L23A 1JCKB 4HJGE 2JX5A 4PT5A 1E0ZA 3J9CA 1XCTL 1D6EC 2WQYB 4UDUC 4US9A 2FE8A 5BMIA 1CJEA 1FNVA 1K52A 1V8CA 3V05A 3MFGA 4XWWA 2NMQA 3IAM1 2WXHA 2IGDA 3Q69A 2PVOD 1TZOA 2K22A 3H8HA 2XNAC 5FR3A 4YSZB 1VZ6A 1QILA 2RDHA 2LHEA 2QILA 1SSNA 1J7CA 4B0MA 4ARIA 3PO0A 4ZHPA 2BB5A 4N6EB 4YWGG 2CJOA 2JU6X 1XF5L 2LHDA 1K50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFD A;  5EE1 A;  4USA A;  3AB5 A;  3AE2 B;  3B2G A;  4YT0 B;  5C2T B;  3AE7 B;  1J7B A;  1N5W A;  1VDV A;  3CWI A;  1ROE A;  4P6V F;  1JWB D;  1V97 A;  2L83 A;  5AUI A;  1AYF A;  1XLQ A;  1OQQ A;  3P4P B;  1KRH A;  1YQ4 B;  3KWL A;  4YSY B;  4HRS A;  1I7H A;  3NVY A;  1NYQ A;  3CIR B;  1TYG B;  1RWS A;  1SB3 C;  4YXD B;  2L52 A;  4JWU C;  3VR8 B;  5EE9 A;  1XO3 A;  1DOY A;  2WDQ B;  1E6E B;  1KFY B;  3B2F A;  1JRP A;  1UWM A;  4ZOH C;  2K5P A;  1JRO A;  1NEN B;  2MJD A;  2H89 B;  1FMA D;  1QLB B;  3FC4 A;  3W5U B;  2W3S A;  1QF6 A;  1B9R A;  1YJJ A;  3AEC B;  1JQ4 A;  1GAQ B;  1TKG A;  2H88 B;  3AE5 B;  2MH7 A;  4KX6 B;  4C7Z A;  3AEB B;  2Y5C A;  3P63 A;  2W55 A;  1DGJ A;  1WYG A;  1L5P A;  3AEE B;  1QOB A;  1OFF A;  1WWT A;  2PVG C;  1FIQ A;  2W54 A;  1SF0 A;  2HTM E;  3AE1 B;  3NVW A;  3DWG C;  4N58 A;  1N60 A;  1PUT A;  4WQM A;  4LTU A;  1JAL A;  1QOA A;  3AH7 A;  1NVI D;  2Q5W D;  1TKE A;  3SFD B;  3P4S B;  3AMZ A;  3VRA B;  1FO4 A;  1NYR A;  1QT9 A;  4YTP B;  2AX5 A;  1XLN A;  1ZOY B;  1YJI A;  2MJ3 A;  2E3T A;  3HRD D;  5AUK A;  1A70 A;  1CZP A;  1FM0 D;  2G1E A;  2CJN A;  1XLP A;  2M19 A;  4JX1 C;  5H92 C;  1N61 A;  1TJE A;  3AM9 A;  2B76 B;  2ACZ B;  3BII D;  1JW9 D;  1KF6 B;  2WU2 B;  2BS3 B;  5EE3 A;  2BS2 B;  1XLO A;  1YQ3 B;  3AE4 B;  4ITK A;  3ETR A;  1DOX A;  1ZP0 B;  3DWM A;  1T3Q A;  3B9J A;  3P4Q B;  1VLB A;  3AV8 A;  2WU5 B;  2M56 B;  3HVZ A;  1WXQ A;  1AWD A;  4A9A A;  2WLB A;  3L4P A;  3AED B;  3W5V B;  3SFE B;  2WDR B;  1JWA D;  4HRO A;  3LB8 C;  1FFU A;  3AEF B;  1WRI A;  5G5H A;  1F0Z A;  1DOI A;  2FBW B;  1NEK B;  3AEA B;  4YTN B;  5C3J B;  3P4R B;  4IDI A;  1QOG A;  2PKO A;  3W9C B;  3P1M A;  2QIE B;  4N59 A;  1RM6 C;  1FXA A;  4JWS C;  5GXG B;  3VR9 B;  2DWQ A;  2K9X A;  3FAH A;  3SR6 A;  4C7Y A;  2WS3 B;  1FFV A;  1N62 A;  1IUE A;  1SIJ A;  4C80 A;  3NS1 A;  1GPX A;  1NI3 A;  3NRZ A;  1R7S A;  1FRR A;  2WDV B;  3AE6 B;  5G5G A;  3AE9 B;  4ZHO A;  3WCQ A;  2W3R A;  3HUI A;  1TKY A;  1EWY C;  3AE8 B;  1RFK A;  2KAJ A;  5H8Y E;  4YTM B;  4YSX B;  1N5X A;  2WP9 B;  1L6U A;  1VJK A;  1J7A A;  2JX5 A;  2EKI A;  1E0Z A;  1OQR A;  2WQY B;  4US9 A;  2LEK A;  1CJE A;  1V8C A;  1PDX A;  1L6V A;  3NVV A;  3RPF C;  1ZXI A;  3LXF A;  5EE0 A;  3ZYY X;  1FXI A;  1E10 A;  2QJL A;  2PVO D;  1ZUD 2;  2K22 A;  2BS4 B;  2MJE A;  1N63 A;  2JQR B;  2BT6 A;  2PIA A;  4YSZ B;  3AE3 B;  1WGK A;  4US8 A;  2DBY A;  1E7P B;  3AEG B;  1L0V B;  1RYJ A;  3ABV B;  1J7C A;  4WWM A;  3EUB 2;  2KMM A;  3PO0 A;  2OHF A;  4N6E B;  4ZHP A;  4FXC A;  2CJO A;  5MPO A;  1E9M A;  2CU3 A;  3AN1 A;  3VRB B;  3NVZ A;  1FRD A;  2N0S B;  1QOF A; 
#chains in the Genus database with same CATH topology
 2C7M B;  3Q3N C;  1MHH E;  4E74 A;  3Q2A C;  1NI2 A;  2WXN A;  2NBU A;  3Q3O C;  3KWL A;  4K81 A;  3R66 C;  3PZ7 A;  2CHW A;  3M63 B;  5GMV A;  2BTE A;  4KDL B;  1E8W A;  2K5P A;  2R2Q A;  2V0G A;  4BZA A;  2JSV X;  2N9L A;  1WWT A;  2W54 A;  2JF5 A;  5E6N A;  4WQO B;  5D6J B;  2FCS A;  2MJ3 A;  1YJI A;  1YIW A;  3R2T A;  1WIA A;  1P7F A;  1CQV A;  3AM9 A;  1JW9 D;  4KSK C;  3A1Q B;  3RI7 C;  1VD2 A;  4S17 A;  2WXO A;  4IWQ A;  3L4P A;  2WDR B;  3QIJ A;  1UNS A;  3UIP B;  4JLC A;  3BWU D;  2PKO A;  2WXM A;  4N59 A;  1VZ7 A;  3RUI B;  5BYR A;  1V9J A;  2JYT A;  2QMT A;  1JWS D;  2EMS A;  1WRD B;  4FJV B;  3LYY A;  2WXL A;  4ASW C;  2L1A A;  1WYW B;  1FNW A;  1WE7 A;  2XN9 C;  2M0X A;  2DAF A;  3WAP A;  3H9D A;  1WF9 A;  4PYU A;  4GSW A;  4WAF A;  1LGR A;  2G9H D;  2KWD A;  1J8C A;  2D5G A;  1R4M B;  1UBQ A;  4W9C A;  1L0V B;  4KVG B;  4KGR A;  3CMM B;  1QOF A;  2LD9 A;  1RLF A;  4HJK A;  2Y5B B;  2UWQ A;  3V61 A;  4PS7 A;  3TEX A;  4A6Q A;  4W9K A;  3JVZ X;  1XO3 A;  3URY A;  1WGH A;  2N1W A;  1V1P B;  4XWT A;  3RFZ B;  1V81 A;  4EZK A;  4AS1 A;  3AEC B;  4K3C A;  4C7Z A;  3W1Y A;  3A4S C;  4RMA A;  1TZ1 A;  3ZXV A;  3DWG C;  4M0W A;  4M00 A;  2W9N A;  4ZDV A;  4P1B C;  2WXG A;  4KDI C;  3FKY A;  4B9K A;  4OZB A;  3LJ3 A;  4JE3 B;  2O6V A;  2BS2 B;  3HIZ A;  2FCM A;  1ZP0 B;  1EU4 A;  3DDC B;  4NJ7 A;  1WXQ A;  4GDL A;  1J0G A;  2K6D B;  1DOI A;  2NPT A;  3WAO A;  1J19 A;  2LFI A;  3ZDM C;  2DWQ A;  3A9K A;  1G6J A;  1V49 A;  2K8H A;  1GPX A;  1IBX A;  1R7S A;  2KVR A;  4OVV A;  2O6V D;  1MJD A;  1EWY C;  1RRB A;  4YTM B;  2K39 A;  1F2R C;  4TUU A;  2BQQ A;  2V3N A;  2KK8 A;  2JXX A;  4MGY E;  1V5T A;  2LXA A;  2CU1 A;  5DPT A;  1T5X D;  1RYJ A;  3L10 B;  5JZE B;  2K8C A;  4LLG M;  1P1A A;  2J7Q B;  3GZN B;  1ISN A;  2DZI A;  2K25 A;  3AN1 A;  1C76 A;  4MGI E;  2N0S B;  3PS6 A;  2ZNV B;  1PFD A;  3VXW A;  1I4Q A;  3AU4 A;  2OED A;  3KYC D;  1M4V A;  3OAW A;  3I63 C;  1XQQ A;  4HLE A;  3VH4 B;  4YXD B;  4PYZ A;  3S2A A;  3Q8A A;  3ZJT A;  3PRZ A;  4HXD A;  2W3S A;  3EFC A;  2FID A;  3A9J B;  4REZ A;  3ZTD A;  4FBJ B;  4OZA A;  4IM3 A;  2L0T A;  5IP4 D;  3A4R A;  3ECI A;  3VTW A;  3AMZ A;  5IO9 A;  2G1E A;  3OJ3 A;  2NTT A;  3R3M A;  3BII D;  2JRH A;  4MH0 E;  4FA6 A;  3K9O B;  2G3Q B;  2PEA A;  3HVZ A;  1SIF A;  4HRO A;  2KXJ A;  1QQR A;  3PLV A;  5HI1 A;  3HM6 X;  3ZGZ A;  3AEA B;  1V1P A;  1YD8 U;  2GBM A;  1F9J A;  4J6I A;  3PV1 A;  4XGA B;  4P16 A;  4RFB A;  2WS3 B;  2KTF A;  3MC8 A;  2YVC A;  3L54 A;  1MG4 A;  2J0M A;  3ZRC A;  3QHT A;  4YSX B;  4G50 A;  1T0S C;  2WP9 B;  1HXY D;  4W9H A;  3OLM D;  3PSE B;  1L6V A;  3QK0 A;  5HKH A;  2LJI A;  4LDT D;  4C56 C;  3BVM A;  2BS4 B;  5TSS A;  3AE3 B;  1V1O A;  2MBH A;  3PTF C;  1FPY A;  4LK0 M;  2MCN B;  2Y5P A;  1FRD A;  3I3T B;  1HEZ E;  2WXF A;  5LNK 1;  1BT0 A;  1N5W A;  1FCL A;  2GOW A;  2ZCB A;  1EF1 A;  3EC8 A;  2L52 A;  2J4X A;  5FK9 C;  4DHZ B;  1UWM A;  4ICV A;  2IND C;  1TBE A;  3RCZ A;  4DK5 A;  1GC7 A;  1H4R A;  3TJP A;  4ARC A;  2IYD B;  2A4Z A;  2MW5 A;  3AEB B;  4CHK A;  2Y5C A;  1V80 A;  3O13 A;  4G0N B;  4RM9 A;  3GP7 A;  1QOA A;  4MM3 B;  4RH6 A;  1TKE A;  2Z59 B;  3TMP B;  3AU5 A;  1NYR A;  1FO4 A;  4YTP B;  1TS4 A;  3MTN B;  4JX1 C;  3N1X C;  3Q8F A;  2WU2 B;  2FCQ A;  2C60 A;  3ZVV A;  3B9J A;  1D5M C;  2ZW0 A;  1V2Y A;  3LB8 C;  2BVC A;  5G5H A;  2IGH A;  1WXV A;  5BO4 B;  4OVU A;  3VUY A;  5C3J B;  3KLS X;  4EUT A;  4IKG A;  1E90 A;  1YN4 A;  2K9X A;  2DAJ A;  5D3I B;  1WR6 E;  4C4V A;  2WX0 A;  1TS2 A;  3NS1 A;  2D11 A;  4K7S A;  3ZW3 A;  3AE6 B;  2MSE D;  2L0F A;  1IYF A;  3D32 A;  3L16 A;  3AE8 B;  3VDZ A;  2VH1 A;  4IM0 A;  3WIM A;  2ZEQ A;  1IGC A;  2YLM A;  4AJW A;  1JCK B;  4HJG E;  1TIF A;  4UDU C;  2RGF A;  4W9F A;  2BKR B;  3HHM A;  2WXH A;  2BF8 B;  2CKH B;  4TV3 A;  4NNJ B;  2AYO B;  4X57 B;  5C23 A;  4YSZ B;  1VZ6 A;  1WMH A;  1QIL A;  1OTR B;  2JZZ A;  1SSN A;  2B3A A;  4ARI A;  2M4N A;  4ZHP A;  4YWG G;  2KDI A;  2LJ5 A;  2R2O A;  5DPW A;  2LHD A;  1HTQ A;  3O65 B;  2NVU I;  2KDB A;  2LGD A;  1VDV A;  2BW2 A;  2KWU B;  2UYZ B;  3L13 A;  1NYQ A;  2D3A A;  3NS8 A;  5J17 A;  2JVC A;  2CR5 A;  4RNA A;  3W5U B;  2D3B A;  1EWC A;  2L8J A;  2JT4 B;  1GAQ B;  4GN1 A;  1WH3 A;  3TL5 A;  4DHJ D;  5D3D A;  2Z8L A;  2PVG C;  2ZNV C;  4FJZ A;  2N4F A;  3JSV B;  1QT9 A;  2L7R A;  1WX7 A;  3L17 A;  2WDT B;  4W9I A;  3T3N A;  3VQI A;  4ITK A;  2WNM A;  5IKC M;  2C7H A;  2IO3 B;  4FN2 A;  3M62 B;  1D4B A;  4B95 A;  1WRI A;  3NZS A;  3T3O A;  2GRI A;  4A3P A;  3APD A;  2KWC A;  1ET6 A;  3Q8C A;  2KT7 A;  5CHV C;  3VUW A;  3KW5 B;  3SR6 A;  4M02 A;  3PHX B;  4HPP A;  3ZNZ B;  3DVN V;  2PE6 B;  4ZHO A;  2MBB B;  2GMI C;  2KAJ A;  2AQ2 B;  3OG5 A;  2FUH B;  4Q2J A;  1PGA A;  2N7E A;  2HE7 A;  3NUH B;  1N6Z A;  1KM7 A;  2HTH A;  2Y3A A;  2ON8 A;  3N1Z C;  3U7Z A;  3QX1 A;  2LZ6 A;  3ML8 A;  4NAW B;  4DHJ B;  2LGS A;  3N20 C;  2QEJ C;  2N7D A;  1S1Q B;  5JH5 C;  3W2D A;  3IT4 B;  2KLC A;  4C4V B;  3UI3 A;  5EE1 A;  3AE2 B;  3B2G A;  1YX6 B;  3NHE B;  3ONS A;  4EE2 A;  3A9K B;  4XE0 A;  2KJR A;  1E6E B;  4ZOH C;  2MWS B;  1BUI C;  2RR9 A;  3DVG Y;  2GBR A;  2RDB C;  1TGZ B;  1TS3 A;  1TKG A;  2H88 B;  1E8Z A;  2IDY A;  3SD5 A;  3Q3M C;  4HWI B;  2GB1 A;  2ZW1 A;  1DGJ A;  1QOB A;  4A20 A;  2WXQ A;  1XEE A;  1N60 A;  1Z5S B;  3AH7 A;  3P4S B;  2BYT A;  3QCA A;  4MM3 A;  2E3T A;  1BXT A;  2KC1 A;  2ZJD A;  1TJE A;  4BKG A;  1SE3 A;  4RGM A;  1XLO A;  4AQ7 A;  4IC7 B;  3NJT A;  3ETR A;  5IA7 A;  3PPA A;  3KUZ A;  4GU2 A;  1AWD A;  4AWJ A;  1JWA D;  2C9W B;  3M95 A;  3AEF B;  3NG0 A;  4IWP A;  2XK5 B;  3P4R B;  2BWE S;  1FXT B;  3W9C B;  2AL6 A;  1T0R C;  2I1J A;  3FAH A;  1HE8 A;  4TQ0 A;  1WX9 A;  2QHO A;  2KD0 A;  3OWE B;  3RD2 A;  2PW9 A;  3E56 A;  1RFK A;  1ZXH A;  2GBN A;  4IOI E;  3Q3J A;  2ZVN A;  2FNJ B;  1J7A A;  1OQR A;  5BYQ A;  3TIX A;  4S0R A;  3APC A;  2GI9 A;  2L05 A;  1ZXI A;  1WR1 A;  2BYF A;  4J3O D;  4HVB A;  3QWZ B;  2MP2 A;  3BVG A;  4US8 A;  4LNK A;  4KGS A;  3WAM A;  3ABV B;  1Q0W B;  1VRA B;  5HHD G;  1GB4 A;  1UWX A;  2G45 B;  3CF6 E;  4CYE A;  1FCC C;  5KHQ A;  2CS4 A;  3L08 A;  3IXS A;  2MBO A;  4ZRK A;  1JWB D;  4I6P A;  1P98 A;  4L1B A;  4JGH B;  1UBI A;  3DVG X;  4FUL A;  3VTV A;  3NVY A;  4FLH A;  1JRP A;  4ZYN A;  2FIF A;  3WAN A;  3APF A;  1P3Q U;  2DZM A;  4HCN B;  2MH7 A;  4BOZ B;  4AUQ C;  3M3J A;  2MX2 A;  4ACF A;  1TY2 A;  1YJ1 A;  3A1Q A;  3T8M A;  2AX5 A;  1S3S G;  4NAM A;  3GB1 A;  2B76 B;  1SGH A;  2BYE A;  2DYB A;  5CHF A;  1WXS A;  2KWV B;  4XDD A;  4IWO A;  3MHZ A;  4DHZ E;  1NDD A;  4WAA A;  2WXJ A;  4RF0 A;  1WGR A;  3VAW A;  5D7G A;  1T0Y A;  5AZF A;  3UQB A;  3EHV A;  2VH2 A;  4EZL A;  2LVP A;  3Q14 C;  4W9L A;  3UGB B;  4M8N A;  2LUE A;  2V4L A;  2N9E B;  1ACC A;  3GS2 A;  4TKN A;  3ZXR A;  3KUD B;  1E10 A;  1MHX A;  2LGY A;  2QJL A;  2UU7 A;  1C4C A;  4RM8 A;  3VVW B;  4NZL B;  3ZKJ C;  4XZ4 A;  2KQ4 X;  3EUB 2;  3UQA A;  2V4I B;  5MPO A;  2QSD A;  2ZPY A;  3RYT A;  3MP9 A;  4AP4 C;  5CX3 A;  3VHT C;  1NBF C;  4MEL A;  1AYF A;  1C78 A;  4RCO A;  2I38 A;  2KFJ A;  3ZQ4 A;  5DPR A;  2WXI A;  4FHJ A;  3IFW B;  3PZD A;  3BZD B;  4GDL B;  4LDT B;  1MFW A;  2N7J A;  4PK1 A;  1NEN B;  2DYO A;  2H89 B;  4OVZ A;  3TEZ A;  3C19 A;  1VCB A;  2IJ0 A;  2LWP A;  3ZJV A;  3RMK C;  1SJH D;  3DBH I;  2M8S A;  3RNE C;  1WGD A;  3NVW A;  4NJ6 A;  4LTU A;  4BFR A;  2N9K A;  2K8B A;  3VRA B;  1ZDX A;  3HRD D;  3LDZ E;  4TSS A;  4M0W B;  5D94 A;  3SDL C;  3DBR B;  4GLS C;  4DXG A;  1PYW D;  1X1M A;  1GG3 A;  1VLB A;  3AV8 A;  3PT2 B;  4P1C C;  1CK1 A;  2LMC A;  3FIL A;  4F7Z A;  2L76 A;  2N9X A;  1D5Z C;  3Q8B A;  2M0A A;  1NEK B;  4II2 B;  1L0X B;  2K3U A;  1P0R A;  2KZR A;  2QIE B;  1F1H A;  2MEK A;  1SIJ A;  3MJ5 A;  2DHZ A;  2LVO A;  2NTS A;  2IBI B;  4WH4 A;  2G4S A;  2JX5 A;  4PT5 A;  3V6C B;  4BVU C;  4JQW C;  4NAW A;  5BMI A;  1V8C A;  3V05 A;  4WJP A;  3IHP C;  2NMQ A;  1OEY J;  3RZW C;  3H8H A;  2XNA C;  5FR3 A;  2GLS A;  2D07 B;  4WWO A;  2RDH A;  4ANU A;  4N6E B;  2ZVO A;  4HPL B;  1HTO A;  4EZJ A;  2MRP A;  4MGZ E;  1K50 A;  4FJY A;  3V6E B;  4DDI D;  2KFK A;  1WSP A;  1C79 A;  1T6B X;  2X38 A;  3T9L A;  2O2V A;  3P4P B;  4W9J A;  2FCN A;  1F2R I;  1DYQ A;  1RWS A;  2ZZP B;  2WDQ B;  2ZCC A;  4URK A;  1R4N B;  2L3Z A;  3NZU A;  1U4A A;  2IY1 B;  1F52 A;  2KN5 A;  4DXA B;  2LRW A;  3Q3F A;  2WXK A;  1SF0 A;  2HTM E;  4N58 A;  4WQM A;  1KOT A;  4WIP A;  2QC8 A;  2CJN A;  3RNA C;  4G3X B;  5E6P A;  3KQ4 A;  3DOW A;  4M01 A;  2IGG A;  2WU5 B;  5DCN A;  1I4X A;  2VRR B;  3DBS A;  3W5V B;  3V3X A;  3SFE B;  4BKS D;  2A5U A;  2SAK A;  4WJQ A;  1AN8 A;  4L2Y A;  2OOB B;  2XEW A;  2K1F A;  4EEW A;  3VR9 B;  5GXG B;  3WAL A;  4C7Y A;  1D3Z A;  1NI3 A;  3TEW A;  5G5G A;  3AE9 B;  1JRU A;  3I5J C;  4HKZ E;  3L0W B;  4O1N A;  3P42 A;  2Z0E B;  1N5X A;  2MP2 B;  1L6U A;  3U4E G;  4HCP B;  2LEK A;  1LXD A;  4WJN A;  4NQL B;  2KO3 A;  2KJH B;  4K1R B;  5BMH A;  1FXI A;  2BBC A;  2GBK A;  2MJE A;  1FEH A;  2BT6 A;  1R4M I;  1V6E A;  4LNN A;  3HM3 A;  4IW0 A;  4WWM A;  4LNF A;  1L0Y B;  2CU3 A;  2HDE A;  1ENF A;  4JL9 A;  5IN7 A;  3CST A;  3ML9 A;  1AW7 A;  5C2T B;  2IO2 B;  2KVZ A;  2X8X X;  1KRH A;  2HD5 B;  5IOI A;  4G11 A;  3BK2 A;  3KVF B;  5EE9 A;  1SXT A;  3UIO B;  3ALB A;  1C9F A;  5DPS A;  1K53 A;  4F8C B;  2K0P A;  1TS5 A;  2W55 A;  1L5P A;  5JHB A;  1KH0 A;  2WXR A;  1C4P A;  3SFD B;  4GDK A;  1GB1 A;  1ZOY B;  1A70 A;  1XLP A;  3IVF A;  4DXF A;  2ACZ B;  3A9J A;  1YQ3 B;  3AE4 B;  3DWM A;  4GXB A;  1YQB A;  3I9V 1;  2M56 B;  3IAS 1;  1WZ0 A;  2BB6 A;  4LJP B;  5AZH A;  2IO1 B;  1SE9 A;  1OEY A;  3N3K B;  1IGD A;  1RM6 C;  2OJW A;  3GE3 C;  3RT3 B;  1HZ5 A;  3GZN I;  3H1U A;  4C80 A;  2L32 A;  4YL8 A;  2WWZ A;  4DWF A;  2KAC A;  2HJ8 A;  1Q10 A;  1ZGU B;  4HPM B;  2NCN A;  1UZX B;  1E7U A;  1HZ6 A;  4N9F 4;  3PVL A;  1B1Z A;  3K9P B;  3GE8 C;  3DBL B;  1BML C;  3BIN A;  4P7I A;  2YEP B;  1YMH E;  5LXI B;  5G2N A;  1FD6 A;  3DVN U;  1EU3 A;  4RGN A;  1WE6 A;  2JY6 A;  4FXC A;  4EKU A;  2D3C A;  2PE9 A;  2RPV A;  3VRB B;  2FAZ A;  1T0Q C;  2ZPN A;  2QCZ A;  3AE7 B;  3P2B A;  3JYU A;  3C8Y A;  2DLB A;  2NPT B;  2XBB C;  1YQ4 B;  4BAX A;  1SB3 C;  1KFY B;  3KH0 A;  5C1Z A;  2MJD A;  1FMA D;  1QLB B;  1YJJ A;  1C4A A;  5T8I A;  3Q8E A;  4ZRP A;  3RNF C;  4HRS A;  1FIQ A;  4TMA B;  1PUT A;  2Q5W D;  4BKT A;  1CZP A;  2KDE B;  4OW0 A;  4MGK E;  2BS3 B;  4GDK B;  1LQB A;  1OGW A;  1WGG A;  3DBR I;  2RDG A;  3ZNH B;  4A9A A;  3AED B;  4RGT A;  5JHA A;  2DEN B;  4RGO S;  4D2K A;  1I42 A;  2AQ3 B;  3PLU A;  2BKF A;  4PS8 A;  2JWU A;  4FHK A;  4LNI A;  4IDI A;  3V62 A;  2IPK D;  2KNB A;  2D2Q A;  3PZ8 A;  4MAC A;  4MSM B;  4JWS C;  1QZE A;  1WI0 A;  3BVZ A;  3ZNG C;  3RNB C;  1IUE A;  3DBH B;  2JRI B;  1EM7 A;  2RSU A;  2J52 A;  3R7Q A;  1TKY A;  1E8X A;  4A55 A;  3HVD A;  4KZC A;  1SJE D;  2NBV B;  1VJK A;  2DX5 B;  3PHW B;  1RAX A;  5G55 A;  3MC9 A;  4K3B A;  2INN E;  5BMG A;  1ZE3 D;  1VZ8 A;  3ZIM A;  4MJS B;  2K6Q A;  4GMV A;  1GC6 A;  2DBY A;  1STE A;  2RPQ A;  1M94 A;  3NVZ A;  1K51 A;  3KWV A;  3H7P A;  4YT0 B;  2DZK A;  5JXV A;  1HA5 A;  2WX1 A;  3H7S A;  5AUI A;  3AUL A;  2G4D B;  4IG7 B;  3CIR B;  5TR5 A;  1PGB A;  3W1S C;  4B6W A;  3B08 A;  3B2F A;  4XDC A;  1JQ4 A;  1UEL A;  1ZDV A;  3KUC B;  3AE5 B;  1YN3 A;  3TSS A;  2KDM A;  3P63 A;  1ZW7 A;  1DOY A;  2QDF A;  3DHH C;  3QAQ A;  4WJO A;  1XLN A;  5AZG A;  3DPD A;  2J0J A;  1N61 A;  3N1Y C;  4NQK E;  1ESF A;  3DBL I;  1MPE A;  4AOF A;  1T3Q A;  1E5W A;  3R7R A;  1KLU D;  2WLB A;  1ZKH A;  3ZRF A;  2IY0 B;  2VZK D;  4YTN B;  2AWT A;  2NS5 A;  2YEP F;  4TQ1 A;  3B0A A;  1WGY A;  3VTU A;  2KQS A;  1JWM D;  2I1K A;  3SEB A;  3BY4 B;  1I4G A;  1FRR A;  2WDV B;  2EEL A;  3DHI C;  5L83 A;  1L4D B;  4JPS A;  4XC2 A;  1WXM A;  3AXC A;  1YOV B;  2LAS A;  3QQ8 B;  3J9C A;  4GB9 A;  4A3O A;  1XCT L;  1D6E C;  1KJT A;  1A5R A;  4QAY A;  1FNV A;  1K52 A;  1XT9 B;  2DNF A;  3MFG A;  4HDO A;  4E71 A;  2BGF A;  3IAM 1;  4NY0 A;  1UGM A;  4MJS A;  2PVO D;  4MSQ B;  3TCA A;  1WZ3 A;  3PRE A;  2WGS A;  2LHE A;  3U7D A;  5J2R A;  1J7C A;  3PO0 A;  2BB5 A;  2CJO A;  1XF5 L;  2L00 B;  4US9 A;  3SHQ A;  2GBJ A;  3TBL D;  1UGJ A;  3X0W A;  4P6V F;  3MJW A;  2KQ7 A;  1V97 A;  4W9G A;  1XLQ A;  1OQQ A;  3QA8 A;  4BBN F;  1YNT E;  4W9E A;  4YSY B;  2XK5 A;  1I7H A;  1Q5W B;  5FKA C;  2BPS A;  1Y56 A;  4JWU C;  2KDF B;  4R3D A;  4HKQ A;  1WX8 A;  4HDQ A;  2LVQ A;  3AE1 B;  3HK0 A;  2REX A;  1OQY A;  3E9S A;  3NY5 A;  2E6X A;  1NVI D;  3RNG C;  3W1S A;  2M19 A;  5H92 C;  1UD7 A;  4WUR A;  2WYQ A;  4NJC A;  1KTK A;  1MVK A;  4GOC A;  1SE4 A;  3N32 A;  1Y8R C;  2KMA A;  3N30 A;  1V5O A;  5BYS A;  3VUX A;  1EUV B;  1I4H A;  3P1M A;  3BYT B;  2KAN A;  1FFV A;  1N62 A;  3N9Y C;  3SU8 X;  2JPH A;  3NRZ A;  2KX0 A;  4EFO A;  4KV2 A;  4MEM A;  5H8Y E;  4I6N B;  1YN5 A;  4C00 A;  1YX5 B;  1VR9 A;  2EKI A;  5LXH A;  1CMX B;  3NVV A;  4DDG D;  3OJ4 B;  5IAA C;  2RMM A;  2KHW B;  5AEK B;  1ET9 A;  1WGK A;  2I2Y A;  2INP E;  5FR6 A;  4ICU A;  4KKI A;  2HJ1 A;  4W9D A;  2MQJ A;  2KMM A;  1WJN A;  1IBX B;  3PRP B;  1KLG D;  3AB5 A;  3ZTC A;  3QC8 B;  4XYC A;  2WXP A;  1E8Y A;  2PMV A;  3GOE A;  4RF1 A;  1LO5 D;  3WA0 A;  2MA9 B;  3IT6 B;  4LNO A;  3VH3 B;  4K7U A;  1JRO A;  3FC4 A;  3H6N A;  1TY0 A;  2BYV E;  4EOY A;  2O6V B;  3AEE B;  4MT5 A;  4LJO B;  1B9R A;  3EA6 A;  4MH8 A;  1I35 A;  1TT5 B;  1Q1O A;  3AI5 A;  1MG8 A;  4CQN A;  2LGI A;  2AEH A;  3QJZ A;  5AUK A;  1FM0 D;  4AJY B;  1C77 A;  4GIV A;  1WM2 A;  3EGR A;  1C3T A;  2MHJ A;  1L4Z B;  1MI0 A;  1GUA B;  2JUO A;  2LRU A;  1DOX A;  1XCQ L;  1E7V A;  2V1Y A;  1Z2M A;  1FFU A;  5LLI A;  3U2S C;  3RZF A;  4MDK E;  2JYE A;  4CO7 A;  3MHS D;  1D5X C;  3IBE A;  3H7P B;  5EDS A;  3ENE A;  4DQO C;  2KKC A;  3DHG C;  3HUI A;  2FUG 1;  2JWZ A;  1C1Y B;  2D10 A;  3RPF C;  3A33 B;  3UIN B;  3LXF A;  5EE0 A;  5E6J A;  3DQV A;  3VFK A;  1L2N A;  3KYD D;  1P9D U;  2JQR B;  4GGQ A;  2PIA A;  2MLB A;  2AQ1 B;  2IZV B;  3AEG B;  3Q6B A;  4A90 A;  5CTR C;  3EEC A;  2OHF A;  5HG2 A;  4IM2 A;  2PJH A;  1KF6 B;  2ONQ A;  3NOB A;  4USA A;  3ZUN A;  2BWF A;  1J7B A;  3CWI A;  4IUM B;  1L7Y A;  2L83 A;  3TUO A;  2LXC A;  2AL3 A;  3DCG A;  3JW0 X;  3MC0 B;  4KIK A;  1KLV A;  3ZO5 B;  4HEA 1;  2ASQ A;  2Z0D B;  1SBB B;  2KLG A;  2ICI A;  1I4R A;  2JXT A;  2TSS A;  1WYG A;  1WY8 A;  1XD3 B;  3U8Z A;  1AAR A;  1JAL A;  2KJ6 A;  4I6L B;  3R8B A;  4ANW A;  5KHO A;  3X23 A;  2NR2 A;  2N1V A;  3RN9 C;  3TEY A;  2SEB D;  4KSL C;  1SE2 A;  2RD0 A;  2V3P A;  4ZRQ A;  2PLP A;  1F0Z A;  2FBW B;  3CSF A;  1GOZ A;  4WWP A;  1WJ6 A;  1R4N I;  1FXA A;  4KIK B;  4FAD A;  3QAR A;  1I4P A;  1HQR D;  1P7E A;  2M17 A;  1TTN A;  2O2V B;  1UH6 A;  4KKJ A;  1GJZ A;  2NBW B;  3B1L X;  2C7N B;  1SEB D;  2W3R A;  4OZC A;  3WCQ A;  4DBG A;  2KFK B;  5E6O A;  4PS3 A;  4ANX A;  1IPG A;  2DYM A;  1FNU A;  1JML A;  4OHJ A;  3R2I A;  1H8C A;  5J18 A;  2IO0 B;  2LGX A;  1PDX A;  2PTL A;  1LFD A;  2EMT A;  3ZYY X;  3PRM B;  1ZUD 2;  3PGE A;  1N63 A;  1GNU A;  2W82 A;  3UF8 A;  1JWU D;  1E7P B;  1EF5 A;  4HK2 A;  2MBQ A;  1WJ4 A;  4BKS A;  1E9M A;  5CHW A;  2KMC A;  1QKZ A;  1PQS A;  1XXG A;  2KTR A;  4KGT A;  1ROE A;  4II3 B;  3U30 A;  1WM3 A;  2D3G A;  3BYY B;  4E3C A;  2VZK B;  2V3S A;  3V60 A;  3RNC C;  2V9H A;  4A8X C;  1TYG B;  4WWN A;  3VR8 B;  3I57 A;  4JIO U;  3RUL A;  1F77 A;  2KN4 A;  2M1M A;  1QF6 A;  2C5L C;  1EO6 A;  1WJU A;  4KX6 B;  1WFY A;  4B0E A;  3FIL B;  3IG3 A;  3EFU A;  1OFF A;  5HFY A;  3ZNI D;  2J0K A;  4H2A A;  5D2M B;  3BK1 A;  4XX5 A;  2LI5 A;  2KYW A;  5L95 C;  5EE3 A;  2DZJ A;  1PGX A;  1WXA A;  2JZ3 B;  3JSV A;  3P4Q B;  1ZPS A;  3U52 E;  4ZRJ A;  2KX3 A;  4M8M A;  4ZRI A;  4K7W A;  2J53 A;  3ZJU A;  2J42 A;  3C0R B;  2EKE C;  2WHI A;  2CHZ A;  3ZLZ A;  1QOG A;  2MBE A;  4LCD E;  2KTR B;  4BOS C;  1RFA A;  2LUM A;  1IP9 A;  1UUP A;  4NPN A;  3NZ3 A;  4ZYS A;  2JZP A;  1UF0 A;  2KC2 A;  2KOX A;  5I4D A;  2R61 A;  2OJR A;  2PPH A;  4L23 A;  1E0Z A;  2INC C;  2WQY B;  2FE8 A;  1CJE A;  4F1S A;  1V86 A;  1K8R B;  4XWW A;  1WMH B;  2IGD A;  3Q69 A;  2N9P C;  1TZO A;  2K22 A;  4ANV A;  2QIL A;  4B0M A;  4KZ0 A;  2JU6 X;  4BBN C;  2CHX A;  1LM8 B;  3ZDT A; 
#chains in the Genus database with same CATH homology
 1UGJ A;  1VDV A;  4P6V F;  1WSP A;  1MHH E;  1C79 A;  1T6B X;  1V97 A;  2X38 A;  2WXN A;  1XLQ A;  1OQQ A;  3P4P B;  2BW2 A;  1YNT E;  3KWL A;  4YSY B;  1I7H A;  3PZ7 A;  1NYQ A;  1F2R I;  5FKA C;  1DYQ A;  1Y56 A;  1RWS A;  4JWU C;  2WDQ B;  2BTE A;  4RNA A;  4R3D A;  4HKQ A;  2K5P A;  3W5U B;  1EWC A;  2V0G A;  1GAQ B;  2JSV X;  5D3D A;  2N9L A;  1WWT A;  2PVG C;  2W54 A;  2WXK A;  2Z8L A;  3AE1 B;  1SF0 A;  2HTM E;  4N58 A;  3E9S A;  4WQM A;  2E6X A;  1NVI D;  3W1S A;  1QT9 A;  4WIP A;  2MJ3 A;  1YJI A;  2CJN A;  2M19 A;  3R2T A;  5H92 C;  1P7F A;  3T3N A;  1CQV A;  3AM9 A;  4WUR A;  3VQI A;  1JW9 D;  4ITK A;  3KQ4 A;  4NJC A;  1KTK A;  2WNM A;  2IGG A;  1MVK A;  2WU5 B;  1I4X A;  1SE4 A;  2WXO A;  3L4P A;  3W5V B;  3V3X A;  3SFE B;  2WDR B;  1UNS A;  2SAK A;  1D4B A;  1WRI A;  1AN8 A;  2GRI A;  4L2Y A;  3T3O A;  3BWU D;  5BYS A;  1ET6 A;  2PKO A;  1I4H A;  2WXM A;  3P1M A;  4N59 A;  3BYT B;  1VZ7 A;  3Q8C A;  3VR9 B;  5GXG B;  3SR6 A;  4C7Y A;  1FFV A;  1N62 A;  5BYR A;  3N9Y C;  1NI3 A;  3NRZ A;  3TEW A;  5G5G A;  2JYT A;  2QMT A;  3AE9 B;  4ZHO A;  4HKZ E;  2KAJ A;  5H8Y E;  1YN5 A;  4O1N A;  1JWS D;  3P42 A;  2AQ2 B;  1N5X A;  2WXL A;  3LYY A;  2L1A A;  1L6U A;  1VR9 A;  3U4E G;  1FNW A;  2EKI A;  4Q2J A;  2LEK A;  2XN9 C;  3NVV A;  1PGA A;  5BMH A;  1FXI A;  3NUH B;  2BBC A;  2RMM A;  4WAF A;  2MJE A;  1FEH A;  2G9H D;  1ET9 A;  2KWD A;  2Y3A A;  2BT6 A;  2ON8 A;  1WGK A;  2D5G A;  3U7Z A;  2I2Y A;  2INP E;  1L0V B;  4KKI A;  4WWM A;  4NAW B;  2KMM A;  2QEJ C;  1L0Y B;  4KGR A;  1IBX B;  2CU3 A;  2HDE A;  1ENF A;  3W2D A;  1QOF A;  3IT4 B;  3UI3 A;  1KLG D;  5EE1 A;  3AB5 A;  3AE2 B;  3B2G A;  1AW7 A;  5C2T B;  2WXP A;  2PMV A;  4EE2 A;  4RF1 A;  1KRH A;  4XE0 A;  3TEX A;  4A6Q A;  1LO5 D;  3IT6 B;  3BK2 A;  5EE9 A;  1XO3 A;  3URY A;  1SXT A;  1E6E B;  4ZOH C;  1C9F A;  1BUI C;  1V1P B;  4XWT A;  1JRO A;  3RFZ B;  3FC4 A;  1TS3 A;  1K53 A;  3AEC B;  1TY0 A;  4AS1 A;  1TKG A;  2H88 B;  2IDY A;  2K0P A;  4C7Z A;  1TS5 A;  2GB1 A;  2W55 A;  2ZW1 A;  1DGJ A;  1L5P A;  3AEE B;  1QOB A;  4MT5 A;  1B9R A;  3EA6 A;  2WXQ A;  4MH8 A;  1XEE A;  3DWG C;  1N60 A;  4M0W A;  1KH0 A;  3AH7 A;  2WXR A;  4CQN A;  1C4P A;  3SFD B;  3P4S B;  2BYT A;  2LGI A;  2WXG A;  1GB1 A;  1ZOY B;  2E3T A;  5AUK A;  1BXT A;  1A70 A;  1FM0 D;  4OZB A;  1C77 A;  1XLP A;  1TJE A;  4JE3 B;  4DXF A;  2ACZ B;  3EGR A;  1SE3 A;  2BS2 B;  4RGM A;  1XLO A;  1YQ3 B;  4AQ7 A;  3AE4 B;  1L4Z B;  1MI0 A;  3ETR A;  1DOX A;  1ZP0 B;  3DWM A;  3I9V 1;  1EU4 A;  1XCQ L;  2M56 B;  3IAS 1;  1WXQ A;  1AWD A;  2BB6 A;  1JWA D;  1FFU A;  3AEF B;  3U2S C;  1DOI A;  3P4R B;  2JYE A;  1IGD A;  3W9C B;  1RM6 C;  1D5X C;  2LFI A;  2DWQ A;  3FAH A;  1HZ5 A;  4TQ0 A;  4C80 A;  2L32 A;  1GPX A;  1IBX A;  1R7S A;  4DQO C;  2KAC A;  3OWE B;  1Q10 A;  3HUI A;  2PW9 A;  2FUG 1;  3E56 A;  1EWY C;  1RFK A;  4YTM B;  1ZXH A;  1HZ6 A;  4IOI E;  1B1Z A;  1J7A A;  1F2R C;  1OQR A;  5BYQ A;  2GI9 A;  2V3N A;  3RPF C;  1ZXI A;  1BML C;  3LXF A;  5EE0 A;  5E6J A;  4J3O D;  2YEP B;  1YMH E;  2JQR B;  2PIA A;  3BVG A;  1FD6 A;  4US8 A;  1T5X D;  2AQ1 B;  3AEG B;  4KGS A;  1RYJ A;  3ABV B;  4LLG M;  4A90 A;  1EU3 A;  4RGN A;  2OHF A;  5HG2 A;  4FXC A;  1VRA B;  5HHD G;  1GB4 A;  1UWX A;  2RPV A;  1C76 A;  3AN1 A;  3VRB B;  2N0S B;  1KF6 B;  2ONQ A;  1PFD A;  1FCC C;  4USA A;  1I4Q A;  3AE7 B;  1J7B A;  3IXS A;  3CWI A;  1JWB D;  2OED A;  2L83 A;  3C8Y A;  1M4V A;  2DLB A;  3TUO A;  4L1B A;  1YQ4 B;  3NVY A;  3MC0 B;  1SB3 C;  4HEA 1;  4YXD B;  1SBB B;  1KFY B;  1JRP A;  3Q8A A;  2MJD A;  3ZJT A;  1FMA D;  1QLB B;  2ICI A;  2W3S A;  1YJJ A;  1I4R A;  1C4A A;  2MH7 A;  5T8I A;  2JXT A;  2TSS A;  3Q8E A;  4ZRP A;  4REZ A;  1WYG A;  4OZA A;  4HRS A;  1FIQ A;  4TMA B;  1PUT A;  1TY2 A;  1JAL A;  2Q5W D;  3AMZ A;  3R8B A;  2AX5 A;  4NAM A;  1CZP A;  2G1E A;  2NTT A;  3GB1 A;  4OW0 A;  2B76 B;  3BII D;  2BS3 B;  4GDK B;  3TEY A;  2SEB D;  1SE2 A;  3HVZ A;  2RDG A;  4A9A A;  3AED B;  2V3P A;  4RGT A;  4HRO A;  4RGO S;  4ZRQ A;  2PLP A;  4XDD A;  4D2K A;  1QQR A;  2AQ3 B;  3MHZ A;  5HI1 A;  3ZGZ A;  2FBW B;  3AEA B;  1F0Z A;  1V1P A;  2JWU A;  4IDI A;  2IPK D;  1GOZ A;  2WXJ A;  4RF0 A;  3PZ8 A;  4MAC A;  1FXA A;  4JWS C;  3BVZ A;  5D7G A;  1I4P A;  1HQR D;  2WS3 B;  1P7E A;  4P16 A;  1IUE A;  4RFB A;  4KKJ A;  1EM7 A;  1SEB D;  2J52 A;  2W3R A;  4OZC A;  3WCQ A;  1TKY A;  2DYM A;  4A55 A;  3HVD A;  1FNU A;  4YSX B;  1JML A;  2WP9 B;  1HXY D;  1SJE D;  4OHJ A;  3R2I A;  1VJK A;  1ACC A;  3GS2 A;  1PDX A;  1L6V A;  2PTL A;  3ZYY X;  2LJI A;  1MHX A;  2INN E;  1E10 A;  2QJL A;  1ZUD 2;  1ZE3 D;  3BVM A;  5BMG A;  4C56 C;  1VZ8 A;  2BS4 B;  1C4C A;  1N63 A;  4NZL B;  5TSS A;  2W82 A;  3AE3 B;  1V1O A;  1JWU D;  2DBY A;  1E7P B;  2KQ4 X;  1STE A;  3EUB 2;  4LK0 M;  2V4I B;  5MPO A;  2QSD A;  2Y5P A;  1E9M A;  3NVZ A;  1FRD A;  1QKZ A;  1K51 A;  3KWV A;  1HEZ E;  2WXF A;  4YT0 B;  3MP9 A;  5LNK 1;  1N5W A;  1XXG A;  5JXV A;  4KGT A;  1ROE A;  1FCL A;  1HA5 A;  5AUI A;  3BYY B;  1AYF A;  1C78 A;  2VZK B;  4RCO A;  2I38 A;  4A8X C;  3ZQ4 A;  3CIR B;  1TYG B;  2WXI A;  1PGB A;  2J4X A;  2L52 A;  5FK9 C;  3BZD B;  3I57 A;  4GDL B;  3VR8 B;  3B2F A;  1F77 A;  1UWM A;  2KN4 A;  2N7J A;  1NEN B;  2DYO A;  2H89 B;  4XDC A;  4OVZ A;  3TEZ A;  1QF6 A;  1JQ4 A;  1ZDV A;  4ARC A;  3AE5 B;  2IJ0 A;  4KX6 B;  3ZJV A;  1YN3 A;  3AEB B;  3TSS A;  2KDM A;  4B0E A;  2Y5C A;  3P63 A;  1SJH D;  3FIL B;  1DOY A;  1OFF A;  3O13 A;  3NVW A;  3GP7 A;  5HFY A;  4LTU A;  1QOA A;  2N9K A;  4MM3 B;  4RH6 A;  1TKE A;  3VRA B;  1FO4 A;  1NYR A;  4YTP B;  4H2A A;  1TS4 A;  1XLN A;  1ZDX A;  3HRD D;  4TSS A;  3BK1 A;  4JX1 C;  1N61 A;  4GLS C;  4DXG A;  3Q8F A;  1PYW D;  1ESF A;  2WU2 B;  5EE3 A;  1PGX A;  1MPE A;  1T3Q A;  3B9J A;  3P4Q B;  1VLB A;  1ZPS A;  3AV8 A;  1CK1 A;  2LMC A;  3FIL A;  1D5M C;  2ZW0 A;  1KLU D;  2WLB A;  3U52 E;  3LB8 C;  2VZK D;  1D5Z C;  3Q8B A;  3ZJU A;  2J53 A;  5G5H A;  2IGH A;  2M0A A;  4YTN B;  1NEK B;  2J42 A;  5C3J B;  3KLS X;  4IKG A;  1L0X B;  1QOG A;  2K3U A;  2YEP F;  2QIE B;  4TQ1 A;  1YN4 A;  2LUM A;  2K9X A;  2MEK A;  1UUP A;  3NZ3 A;  5D3I B;  4ZYS A;  1SIJ A;  1JWM D;  3MJ5 A;  1TS2 A;  3NS1 A;  3SEB A;  2JZP A;  1I4G A;  1FRR A;  2WDV B;  3AE6 B;  2EEL A;  1L4D B;  2NTS A;  4JPS A;  2R61 A;  5I4D A;  3AE8 B;  1IGC A;  4WH4 A;  4L23 A;  1JCK B;  4HJG E;  2JX5 A;  4PT5 A;  1E0Z A;  3J9C A;  1XCT L;  1D6E C;  2WQY B;  4UDU C;  4US9 A;  2FE8 A;  5BMI A;  1CJE A;  1FNV A;  1K52 A;  1V8C A;  3V05 A;  3MFG A;  4XWW A;  2NMQ A;  3IAM 1;  2WXH A;  2IGD A;  3Q69 A;  2PVO D;  1TZO A;  2K22 A;  3H8H A;  2XNA C;  5FR3 A;  4YSZ B;  1VZ6 A;  1QIL A;  2RDH A;  2LHE A;  2QIL A;  1SSN A;  1J7C A;  4B0M A;  4ARI A;  3PO0 A;  4ZHP A;  2BB5 A;  4N6E B;  4YWG G;  2CJO A;  2JU6 X;  1XF5 L;  2LHD A;  1K50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...