1CJEA

Adrenodoxin from bovine
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
KITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The tertiary structure of full-length bovine adrenodoxin suggests functional dimers.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
molecule keywords ADRENODOXIN
total genus 26
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1cjeA00
4N6EB 1AYFA 1A70A 1FXIA 1NENB 2PVGC 3AE5B 3B9JA 1TJEA 1OFFA 2BS2B 2W3RA 4HROA 5EE9A 3VR8B 2K9XA 4ITKA 3AEAB 2WU5B 3SFEB 2DBYA 2PKOA 1N63A 1E0ZA 4US8A 1UWMA 2WLBA 1XO3A 5GXGB 3DWMA 4ZHOA 1RYJA 3VRAB 1DOXA 2AX5A 1ZP0B 3ETRA 1L6VA 2CJNA 1JW9D 3AH7A 3NRZA 1YJIA 1AWDA 1N5WA 3AE6B 1FRRA 1V97A 1N61A 2WDRB 1J7AA 3AV8A 1VDVA 1WXQA 3WCQA 1F0ZA 1OQRA 4ZOHC 2N0SB 2PVOD 1NEKB 4YSZB 3NVYA 1VJKA 4C7ZA 3ABVB 2BT6A 3P4SB 1FFVA 3P4PB 2DWQA 2MH7A 4JWUC 2WS3B 3AE2B 2EKIA 2PIAA 2CU3A 1XLNA 4HRSA 1JROA 3LB8C 1TKGA 4YSXB 1E9MA 3AE1B 3ZYYX 3AEFB 3L4PA 2Q5WD 4YTMB 3W5VB 1YQ3B 1L0VB 1TYGB 1L6UA 3CIRB 1PFDA 4N58A 4YT0B 2WDVB 3AE3B 1NVID 4WWMA 4ZHPA 4N59A 4WQMA 1XLQA 1EWYC 1VLBA 3EUB2 1XLOA 3AEGB 1TKYA 3AN1A 3NS1A 1KFYB 1WGKA 3B2GA 1DGJA 2WU2B 1KF6B 2M19A 1GAQB 4JX1C 2WDQB 3PO0A 1JALA 1ZUD2 5H92C 2JX5A 1FIQA 1FMAD 1R7SA 1KRHA 2L52A 3AEDB 2B76B 3AE9B 2FBWB 3DWGC 3W9CB 1WYGA 3RPFC 1RM6C 4YXDB 1JWAD 1PUTA 1L5PA 2K5PA 1N60A 1QT9A 1SB3C 5AUKA 2QIEB 2KMMA 4USAA 4A9AA 1FO4A 4YTNB 1WWTA 1GPXA 1QF6A 3SR6A 4C80A 1RFKA 1SF0A 3AMZA 1JWBD 3B2FA 1WRIA 1CZPA 3FC4A 5MPOA 1DOIA 2BS4B 2G1EA 5AUIA 1IUEA 1CJEA 1NYQA 1DOYA 3VR9B 1FFUA 3HVZA 1ROEA 1FXAA 1E6EB 1QOGA 2KAJA 2Y5CA 4JWSC 2OHFA 1T3QA 2L83A 1OQQA 2CJOA 2W54A 3NVZA 5EE0A 3SFDB 2W3SA 3NVWA 2H88B 2K22A 1E10A 2BS3B 5EE3A 5C3JB 1E7PB 2W55A 3P4RB 1B9RA 1NI3A 1SIJA 1QOFA 1YJJA 1ZOYB 2LEKA 4US9A 3AEEB 4YTPB 4C7YA 3HRDD 2MJ3A 2QJLA 3P4QB 1N62A 5G5HA 4FXCA 3AE4B 3AECB 2WQYB 1XLPA 3BIID 1N5XA 1YQ4B 1FM0D 2MJEA 1J7CA 4LTUA 2ACZB 1QLBB 1JRPA 2MJDA 2WP9B 3HUIA 1TKEA 5H8YE 5EE1A 4KX6B 3P63A 4YSYB 1NYRA 2HTME 1QOAA 3AM9A 1PDXA 4P6VF 1JQ4A 1V8CA 1QOBA 5C2TB 3W5UB 3AE8B 5G5GA 3FAHA 1J7BA 3KWLA 2H89B 3CWIA 3VRBB 1FRDA 1ZXIA 3AEBB 3NVVA 2E3TA 3AE7B 3LXFA 4IDIA 1I7HA 1RWSA 2JQRB 2M56B 3AB5A 3P1MA
chains in the Genus database with same CATH superfamily
1XF5L 4KIKA 1YJ1A 4JL9A 2LGIA 2WXLA 4GXBA 3W1YA 4FHJA 5GXGB 3MC0B 3R8BA 1E90A 3V62A 2LJIA 1KJTA 4RCOA 1I4PA 4LNKA 1FNUA 1VZ7A 1VDVA 2PVOD 4G11A 3AU5A 2C5LC 4AOFA 1EO6A 2PIAA 3ZRFA 2M4NA 4YTMB 3PZ8A 3PRZA 4N58A 3Q8BA 2JWZA 2Y3AA 3PV1A 2DX5B 1IP9A 1J19A 2KX0A 1EF5A 2KNBA 2N1WA 1JALA 1ZUD2 2LXCA 3QQ8B 3LJ3A 3W9CB 1UD7A 2QDFA 1ET9A 4ASWC 1K50A 3IT6B 1PGBA 2LVPA 2SEBD 3OLMD 1WX8A 2C60A 2XK5B 2VZKB 4USAA 4YTNB 1WI0A 3W1SA 2KTRA 2BYEA 5BYQA 3Q14C 1WX7A 3M63B 1SE2A 4LDTB 1R4NI 1UUPA 3VUYA 2BS3B 1QQRA 4FJYA 3T3NA 3PPAA 4XC2A 2N9LA 4MSQB 4IM2A 4C7YA 1WMHA 3RMKC 3ZVVA 4KKIA 1C3TA 1XLPA 3BIID 3FKYA 1T0RC 1E8YA 1P7EA 1NYRA 1QOAA 1IGDA 4HPPA 2L76A 1WE6A 3ZUNA 4S0RA 4DXFA 4IWQA 4W9JA 2K25A 2WXOA 1YQBA 3FAHA 2C9WB 3MHSD 3KWLA 3AE7B 1F9JA 2ZJDA 4IDIA 2RR9A 4GDKA 1WXSA 2BB6A 3AE5B 4KIKB 1TJEA 2W3RA 1L0XB 4BOSC 1UZXB 2RMMA 2D3BA 3PRMB 5G2NA 4M8NA 2IGDA 1WGRA 3RNEC 4HXDA 4UDUC 4AS1A 4RF1A 2J4XA 1G6JA 1FNWA 4HLEA 4RM8A 3HHMA 3L10B 3ZRCA 2DLBA 2QSDA 1XXGA 2KTFA 2BWFA 2WS3B 3EA6A 2LJ5A 3KW5B 3DBLI 4URKA 4II2B 1TS4A 4DQOC 3Q69A 2M17A 3GZNI 2LASA 4TKNA 2GBMA 1TBEA 4WJNA 4K3CA 2N7EA 3I57A 4NAWA 2INCC 1JWMD 1WM2A 4XYCA 1ESFA 1KRHA 1GOZA 1WYGA 2WHIA 5AZHA 2D3GA 2PMVA 4N9F4 3I5JC 1QT9A 4P1CC 2QIEB 4BBNF 1VCBA 1WXVA 3DHIC 2FCNA 1MHXA 2KQ7A 4EZJA 4FLHA 4JGHB 4B0EA 1OQQA 2RDBC 1I4XA 5DPWA 3DBHB 3WALA 2C7HA 3IAM1 3T9LA 1MI0A 4KDLB 2C7NB 2KMAA 2BW2A 3BK1A 4FXCA 2YEPF 1V5TA 3TBLD 1TY2A 3N30A 2LGSA 2KC2A 1TKEA 4DK5A 4P6VF 4XX5A 3ZTCA 1WJNA 2NPTB 4EKUA 1P7FA 2KJHB 2WXJA 1V1OA 4RF0A 4ZRJA 1J7BA 1ZXIA 2KANA 2M56B 2UYZB 2ZW1A 3P1MA 4L23A 4W9DA 1UGMA 1S1QB 3GZNB 1XO3A 2CHXA 2KWDA 4MGIE 4DDID 1MVKA 4G3XB 1F1HA 3ZTDA 1Q10A 1UWXA 3SDLC 2MWSB 2N9EB 1AARA 1SSNA 1OGWA 2V1YA 3A1QA 3P4SB 3KUZA 1ZGUB 2GBKA 4JQWC 2N9XA 1E7UA 3ZJVA 2KX3A 3OG5A 1FPYA 4MSMB 1HZ6A 1UBIA 2WU2B 3PRPB 2AQ3B 1WSPA 2JX5A 2WXGA 3N1ZC 3DBSA 2WYQA 2J7QB 4PS7A 2V0GA 4LNOA 3GE8C 1CZPA 3ECIA 2RGFA 1TGZB 1VZ6A 3QX1A 1FXAA 3R3MA 2ONQA 2BKFA 2EMTA 3ML8A 1YD8U 1HEZE 3RUIB 2REXA 4GIVA 1D5XC 1K53A 1LM8B 2D2QA 4P7IA 3HRDD 1TS2A 2IO2B 5LLIA 3AXCA 1GC6A 3A9KB 4FULA 1X1MA 1WXAA 4BBNC 1EWCA 3BWUD 2PJHA 1JQ4A 3AM9A 3QC8B 3NUHB 3NG0A 2OJRA 3AE8B 4GB9A 3A9KA 1XT9B 2KLGA 2PEAA 2ZCCA 4ZYNA 1U4AA 2K1FA 1TIFA 2EKEC 3BVMA 2BB5A 2MP2A 2JRHA 5JHBA 2BPSA 2X38A 1FRRA 1TZOA 3RYTA 1WZ0A 2CU1A 2BT6A 3H7SA 4JWUC 3AE2B 4I6NB 2CU3A 2D10A 1XLNA 4D2KA 1UH6A 1T6BX 2KDIA 2PE6B 3CIRB 2KXJA 2LRWA 4FA6A 3DQVA 2JF5A 5BYSA 1GNUA 3NY5A 1FCCC 2JVCA 4HDQA 4HWIB 3R2TA 4FBJB 4M00A 2ICIA 2JXTA 3B0AA 4ZRKA 2Y5BB 2FBWB 4W9LA 4BZAA 3M3JA 4WWOA 2D07B 1WH3A 3VH3B 1HXYD 1WWTA 1SBBB 4K1RB 4WJQA 1FNVA 1T0QC 1WXMA 3IFWB 3LYYA 2GB1A 2LXAA 2K22A 3GE3C 4HKQA 4AQ7A 2LGXA 1B9RA 2LEKA 3EFUA 4US9A 3AEEB 4HK2A 1C4AA 3UGBB 2WQYB 4J6IA 2M8SA 4OHJA 2SAKA 4MGYE 1FD6A 1YMHE 1XQQA 3BK2A 2H89B 4MACA 4ANUA 3N9YC 2W9NA 4XWWA 3H6NA 2K9XA 4US8A 2KVRA 1SE9A 3EHVA 1DOXA 1RRBA 3ETRA 3NRZA 3UF8A 4RH6A 3BZDB 5JH5C 2DHZA 5CTRC 3V6EB 3TUOA 2EKIA 3IHPC 3AE1B 1EF1A 4C4VB 4NJ7A 1XLOA 1WRDB 2AL6A 2KDEB 2KWVB 5BYRA 1WZ3A 1I35A 1WGKA 3WAMA 3K9PB 1GAQB 2X8XX 1MJDA 4KZ0A 2B3AA 4TQ1A 3HM6X 1VD2A 2MBHA 3DBLB 1PUTA 1L5PA 1Y56A 3Q8AA 2WXNA 4K7UA 1FO4A 1T5XD 3A9JA 5E6JA 1SGHA 4LJOB 2BS4B 1PYWD 1FXTB 1GC7A 4W9HA 1T3QA 1TZ1A 4KSKC 4MT5A 4MH0E 3QARA 4JIOU 4DBGA 4ACFA 1NI3A 1QOFA 2JYTA 5G5HA 3P4QB 2HDEA 2WXKA 1V1PA 4HEA1 5EE1A 5H8YE 4YSYB 1PGAA 1AW7A 3P42A 2J42A 3H9DA 3U4EG 4G50A 2ZVNA 3CWIA 1YN5A 2E3TA 4EZLA 2J0KA 1QF6A 3Q8CA 1AYFA 3ZO5B 3E56A 3VR8B 2RPQA 4PK1A 2JZZA 2K8CA 1K51A 1N63A 4ANXA 4A90A 3AH7A 4IG7B 5JZEB 2D11A 1F77A 1J7AA 2K6DB 4IW0A 1OQRA 1I4HA 3JSVA 5DPSA 4WH4A 5BO4B 3V3XA 2DWQA 3IAS1 3J9CA 4B0MA 2CHWA 2LHEA 2GI9A 2I1KA 2FNJB 3NS8A 1L6UA 1TS5A 3AE3B 3K9OB 2G4DB 3WA0A 1PQSA 1C79A 3APFA 1JCKB 1ZDXA 2AQ1B 3L17A 3PO0A 2PTLA 2L52A 3VH4B 2YEPB 1S3SG 1ZKHA 1RM6C 2FIDA 2AL3A 2XBBC 1IBXB 3GS2A 3VTUA 1Z2MA 2WXFA 3VTVA 4BAXA 1RFKA 2AQ2B 5HI1A 4IWOA 1DOIA 1CJEA 4P1BC 4TV3A 4GSWA 4REZA 3PTFC 1M94A 3BYTB 4GDLB 1V9JA 3L0WB 3MHZA 4RMAA 1IYFA 1HE8A 1LQBA 5J17A 4LDTD 1WJUA 4LNIA 2LGYA 5FK9C 2KZRA 2L05A 2QJLA 4NJ6A 4K81A 3JW0X 5KHOA 3ML9A 2RPVA 1FM0D 2MJEA 3VFKA 1JRPA 2L3ZA 1NDDA 3BVZA 2KJRA 2DYOA 3TSSA 1SEBD 5C2TB 2KD0A 2V3PA 5G5GA 1H8CA 5BMIA 1J0GA 5EDSA 4H2AA 4WWNA 3VUWA 3GB1A 1OFFA 4ITKA 5G55A 3A1QB 1GUAB 2CR5A 4PYUA 3DBRB 2ZEQA 3Q8FA 1WE7A 1D5ZC 1ACCA 3PZDA 2JUOA 1JMLA 4K7WA 1N5WA 4BKGA 2FUG1 3PHXB 3A4RA 4IWPA 2ZVOA 3N32A 3EGRA 1HTOA 3P2BA 3X0WA 1GB4A 4WAAA 4NQKE 4DDGD 2KDBA 1WJ6A 3L13A 2KFKA 2VRRB 1J8CA 3MP9A 3IVFA 3PSEB 3UQBA 2FE8A 5IOIA 3IBEA 2EMSA 1WM3A 2KACA 4ANVA 4FADA 4OZAA 1ZW7A 1TY0A 3V05A 2NMQA 3NS1A 4ZRIA 1FCLA 4RGOS 2MW5A 3DWGC 2WXPA 1LXDA 4KGRA 5E6NA 3DCGA 4YXDB 1JWAD 4A9AA 1R4MB 3TEYA 5IP4D 5T8IA 2K8HA 2UWQA 2G1EA 3QCAA 3O65B 3DVNU 4KV2A 1V1PB 4JPSA 1E7PB 3Q3OC 2OOBB 3OJ3A 4FHKA 1N62A 4IM3A 1Z5SB 2NTTA 1H4RA 1QLBB 1E8XA 2OJWA 4IOIE 3KYCD 3AEBB 1YX5B 4F7ZA 4HKZE 3U2SC 4HROA 4XE0A 1WX9A 4MJSA 3ZDTA 1UWMA 3ZJUA 2WXHA 4WJPA 2JWUA 2PLPA 4ZOHC 5LXHA 3MTNB 2DYBA 3RNBC 3CSFA 2MSED 4P16A 4F8CB 2MH7A 1ENFA 4EEWA 2WXRA 2L00B 2QCZA 2KDMA 5E6OA 2PE9A 1TS3A 3V60A 3HM3A 4YT0B 1PFDA 2WDVB 1VZ8A 4L1BA 2QC8A 3EUB2 1V80A 2ZW0A 4ZYSA 3UINB 5JHAA 3VXWA 3ALBA 1IBXA 3TMPB 1OQYA 3N20C 1YN3A 2Z59B 1FMAD 1R7SA 4IM0A 2UU7A 2WXMA 3U8ZA 3DBRI 3VQIA 4GMVA 2KMCA 5D7GA 1EM7A 4GGQA 4PYZA 3KUCB 1YOVB 2GLSA 4LNNA 3JYUA 2L83A 1GG3A 1KM7A 3RNCC 1TT5B 2GOWA 2N1VA 2IPKD 2GRIA 4NNJB 2Z0DB 2WNMA 3QIJA 2NBUA 3P4RB 4DXGA 4MELA 2IO3B 4FJZA 3AE4B 3TEZA 1I4QA 1OEYA 3N3KB 3MJ5A 1P9DU 1T0SC 2MJDA 5D6JB 1SIFA 1Q5WB 2HJ1A 3KQ4A 4WURA 3U7ZA 3KH0A 3UIOB 2NR2A 2KWCA 2LD9A 4KDIC 4OVVA 1IPGA 3AE6B 1KLUD 1YN4A 5HG2A 4MH8A 2WDRB 4HJKA 3VTWA 2KHWB 2DZJA 4KVGB 1GJZA 1WF9A 3H7PA 2BGFA 4CYEA 2V4LA 3RT3B 4J3OD 3CF6E 2AEHA 3Q8EA 4EUTA 5JXVA 3D32A 4A8XC 3ZJTA 2MQJA 3R7RA 4WQMA 4LJPB 1QZEA 1P3QU 3RD2A 3A9JB 3EC8A 1EU3A 1KFYB 1I4RA 4I6PA 4KSLC 3JVZX 2WDQB 1WY8A 3U52E 2IO1B 2K0PA 3PS6A 4E3CA 4CQNA 3PGEA 1KLGD 1GPXA 1RLFA 5CHVC 4DWFA 2KOXA 2LZ6A 4C4VA 2WX1A 3X23A 5KHQA 2BTEA 1P0RA 5BMGA 1ZOYB 2JZ3B 3H7PB 3R7QA 2RSUA 4RGMA 2AWTA 3DVGY 2JRIB 1YQ4B 3ZNZB 1HA5A 3HUIA 4FJVB 2O6VD 3C0RB 4BOZB 2FCMA 2LHDA 2IY0B 3PZ7A 1BXTA 4LCDE 2N4FA 2LGDA 1T0YA 4XWTA 3LXFA 2JQRB 5EE0A 4C7ZA 3ZDMC 1WMHB 4W9CA 2KWUB 2CHZA 3IXSA 3AI5A 4ZDVA 1C77A 3PT2B 1E0ZA 2MX2A 2MBQA 4PT5A 3S2AA 4M02A 2YLMA 2BQQA 1PGXA 2KYWA 5D3IB 1V97A 2ZNVB 1F0ZA 4O1NA 1E5WA 1RAXA 4EFOA 3NJTA 3ENEA 1R4NB 2XK5A 2KKCA 1MG8A 1ZPSA 2LVOA 2WXIA 2KFKB 4JLCA 2ASQA 2NBVB 3C8YA 3DPDA 1HQRD 4L2YA 4WWPA 4HRSA 4YSXB 3RULA 4WWMA 3MFGA 3GOEA 2IJ0A 3SEBA 1EWYC 1Q1OA 3QA8A 4LNFA 2L8JA 3A33B 3PREA 2M19A 2JPHA 2TSSA 2D3AA 3AE9B 4WQOB 1ZDVA 1UNSA 2PPHA 1B1ZA 1WGYA 5IKCM 3B2FA 2MBEA 3FC4A 5AUIA 2O6VB 5IN7A 3VR9B 4IC7B 2KAJA 2G45B 3T3OA 2JXXA 1CMXB 3H1UA 4XDDA 3OWEB 2VH2A 1V81A 2YVCA 1KLVA 2W55A 3BYYB 1CK1A 1WR6E 3ZQ4A 3BVGA 4AWJA 3BY4B 1SXTA 4ARIA 2N7JA 2NCNA 4MGZE 4XGAB 1C76A 3LDZE 4NZLB 5IA7A 3W5UB 4R3DA 4OZBA 3L16A 2ZPNA 1ET6A 2KN4A 1LO5D 4N6EB 3ZXRA 1FXIA 3Q3NC 3QJZA 2WU5B 2M1MA 4II3B 4HPLB 3ZLZA 2O2VB 3VRAB 3GP7A 3V61A 3C19A 3RNGC 4BKTA 3AV8A 2O2VA 2N0SB 2RD0A 4TQ0A 2MA9B 1V49A 3P4PB 4OVZA 2MHJA 2RDHA 2N7DA 3RN9C 2A4ZA 5AZFA 1E8WA 2V9HA 3RNAC 4JE3B 1WGGA 3IG3A 3RZWC 3SD5A 4MEMA 3DVNV 2Y5PA 4XDCA 2K3UA 4W9GA 3FILB 2V3NA 4RGTA 2IY1B 2LMCA 2L1AA 4HCNB 2BYFA 1C9FA 1WRIA 4LLGM 5DPRA 2IDYA 4GLSC 1QOGA 2J0MA 2LWPA 2W54A 3UIPB 2DAJA 1E10A 1UBQA 2KJ6A 1D3ZA 4BKSA 3EFCA 4YTPB 1C4PA 3AECB 2BBCA 4LTUA 1N6ZA 2FUHB 2NTSA 3N1YC 1IGCA 1V8CA 3TIXA 2LUMA 3V6CB 1HTQA 2E6XA 1MG4A 3IT4B 1I7HA 4OZCA 1OTRB 1BT0A 1VR9A 4MM3A 1XCTL 2WLBA 4ZHOA 1C4CA 3URYA 4KKJA 1SE4A 3NZSA 1AWDA 2I1JA 2GMIC 2KQ4X 1NEKB 4NPNA 5GMVA 3VVWB 2WGSA 3R66C 2JSVX 3WANA 4DXAB 1QILA 4AJYB 3LB8C 3TEXA 2JY6A 4LK0M 1SE3A 1YQ3B 3I9V1 1TYGB 3U30A 2KFJA 4C00A 4MGKE 1L4ZB 1TKYA 3B2GA 4RNAA 1SJED 3I63C 1L7YA 3ZNHB 1L2NA 4OVUA 1JRUA 2XN9C 4ANWA 4AP4C 5AUKA 4NJCA 5FKAC 4C80A 1BMLC 1ZE3D 3MC8A 1CQVA 4B9KA 1MHHE 3PHWB 2Y5CA 3B1LX 5J18A 2W3SA 2KN5A 1VRAB 3B08A 5C3JB 1KTKA 1WIAA 3OJ4B 2KC1A 2N9PC 3RZFA 3CSTA 1YIWA 1N5XA 4EZKA 3JSVB 4HCPB 4W9FA 1XEEA 4FN2A 4YL8A 1JWSD 3ZXVA 1P98A 3PLVA 3O13A 4ZRQA 3ZNID 2DZIA 3EECA 1OEYJ 3T8MA 2KVZA 1P1AA 3Q3FA 1NBFC 3Q3JA 3RFZB 4E74A 2PVGC 3DHHC 3B9JA 4ARCA 1TTNA 4GDKB 3AEAB 1EU4A 1A5RA 4K3BA 3U7DA 5CHFA 4HVBA 3DWMA 3SHQA 1ZP0B 1K52A 2FCQA 1YJIA 5E6PA 1WR1A 3WCQA 4DHZB 3NVYA 5AEKB 3I3TB 3M62B 2HE7A 3ZYYX 4PS3A 4M01A 2Z8LA 3QWZB 3VHTC 4EOYA 1NVID 1XLQA 3QHTA 2I2YA 1VLBA 3QAQA 2KTRB 3HK0A 3AN1A 2INDC 2K8BA 2ZNVC 3M95A 2LFIA 4BFRA 3E9SA 1YX6B 4OW0A 2R2QA 2MCNB 3RPFC 5DCNA 1JWUD 2WX0A 2K5PA 4ICVA 2JZPA 1SF0A 3AMZA 4A3PA 1IUEA 4RFBA 1ROEA 4WAFA 2L32A 4A20A 1FEHA 5HFYA 4EE2A 1L0YB 1C1YB 3RCZA 1STEA 2R61A 4B6WA 2LVQA 2LUEA 2LI5A 1NI2A 2ACZB 4ZRPA 3KUDB 3P63A 2Z0EB 3ZKJC 4DHJD 1RFAA 1WFYA 5BMHA 2HTHA 2DAFA 1WJ4A 1D6EC 2MLBA 2QEJC 2IYDB 4A55A 3MC9A 3W5VB 2WDTB 2INPE 1A70A 2DYMA 5EE9A 1Y8RC 2DBYA 2JT4B 4BVUC 2FAZA 4E71A 1UGJA 1MPEA 3OAWA 1WXQA 3NOBA 1VJKA 2BKRB 1YNTE 3N1XC 4RM9A 5L95C 3ABVB 3TEWA 4QAYA 1FFVA 4MM3B 1K8RB 3TCAA 2G9HD 2L7RA 5LXIB 5D3DA 2BWES 1AN8A 2DNFA 1JROA 1TKGA 1E9MA 2Q5WD 3APDA 1L0VB 2KLCA 2N9KA 3HIZA 3KLSX 4F1SA 1UELA 2W82A 4CO7A 2GBRA 2XNAC 3KVFB 5HKHA 4KGTA 3Q6BA 5AZGA 5H92C 2ZZPB 2B76B 1E8ZA 2M0XA 3A4SC 1N60A 1I4GA 1SB3C 2KMMA 3KWVA 4M0WB 1WGHA 3RI7C 1JWBD 2QILA 4YWGG 1NYQA 1FFUA 2A5UA 1E6EB 4JWSC 2CKHB 5CHWA 4I6LB 4GU2A 3NVZA 4A3OA 3NVWA 2BYVE 2ZPYA 3AU4A 4HJGE 2MJ3A 3FILA 5L83A 1R4MI 4GN1A 4B95A 1L4DB 3QK0A 2WP9B 4DHZE 2BVCA 4A6QA 2HTME 4X57B 3WAOA 1QOBA 5J2RA 1V86A 3VAWA 3NZUA 1I42A 2WXQA 1FRDA 4BKSD 2MP2B 4GOCA 2GBJA 2XEWA 1NENB 4XZ4A 2BS2B 3ZNGC 3DBHI 2FIFA 2KT7A 3SFEB 2PKOA 2ZCBA 2G3QB 3WAPA 3UQAA 2HJ8A 2AX5A 2VH1A 1L6VA 4MDKE 1GB1A 1JW9D 3VUXA 5C23A 2WWZA 4M8MA 4KZCA 4TUUA 4AJWA 1KH0A 2DZMA 2DZKA 4NQLB 4KGSA 2MBBB 4CHKA 3TJPA 3AEFB 4TMAB 4WIPA 1SJHD 3W1SC 4TSSA 4N59A 5D94A 4JX1C 2J52A 1FIQA 3AEDB 1XCQL 1QKZA 2K6QA 3CMMB 3DOWA 2IGHA 3SR6A 4DHJB 4G0NB 3WIMA 3VDZA 3ZIMA 4GDLA 1DOYA 4IKGA 3HVZA 4HPMB 2O6VA 2ON8A 2K39A 2OHFA 1KOTA 2IGGA 4NAMA 3SFDB 3Q3MC 2H88B 2IZVB 5FR3A 4MJSB 1YJJA 1M4VA 3NZ3A 3W2DA 2CS4A 4K7SA 2IO0B 3DDCB 2RDGA 3L54A 2BF8B 2JU6X 3BINA 2PW9A 5CX3A 2AYOB 1V5OA 1WYWB 3PLUA 4ZHPA 4PS8A 2FCSA 3NHEB 2NBWB 5LNK1 3HVDA 5HHDG 4IUMB 2L0TA 2D5GA 5IO9A 2D3CA 2IBIB 1EUVB 3H8HA 1RYJA 3R2IA 1WGDA 3RNFC 2CJNA 1ISNA 2NPTA 2NS5A 1N61A 1F2RI 1D4BA 2KK8A 4WJOA 2VZKD 4YSZB 3APCA 5TR5A 3AULA 2NVUI 1XD3B 2HD5B 3ZGZA 5I4DA 2V3SA 2BYTA 3DVGX 1V6EA 3TL5A 2KQSA 1MFWA 4W9KA 3L4PA 2I38A 3ZW3A 1C78A 2R2OA 1ZXHA 1UF0A 4RGNA 4NY0A 2V4IB 2KDFB 1LGRA 2QMTA 3AEGB 3DHGC 4ICUA 4M0WA 1DGJA 1KF6B 1Q0WB 4HDOA 1F2RC 3MJWA 2DENB 1E7VA 4NAWB 2M0AA 2JYEA 4Q2JA 1D5MC 2J0JA 5FR6A 4W9EA 1LFDA 4S17A 5TSSA 5MPOA 5D2MB 2OEDA 3SU8X 2INNE 2CJOA 2MBOA 1F52A 5IAAC 5C1ZA 3Q2AC 5EE3A 2G4SA 1SIJA 4W9IA 1DYQA 2KO3A 4C56C 3UI3A 1V2YA 3PVLA 2MEKA 3KYDD 1J7CA 2QHOA 4AUQC 4KX6B 1PDXA 2MRPA 2L0FA 1HZ5A 2LRUA 3L08A 2GBNA 2J53A 3ONSA 3VRBB 3NVVA 5DPTA 2EELA 1RWSA 1BUIC 3AB5A 2C7MB
chains in the Genus database with same CATH topology
2PVGC 1XF5L 3B9JA 4ARCA 2K9XA 4GDKB 3AEAB 1EU4A 2LGIA 2WXLA 4US8A 5GXGB 3MC0B 3DWMA 3R8BA 2LJIA 1DOXA 4RCOA 1ZP0B 1K52A 3ETRA 1I4PA 3NRZA 1YJIA 3AE6B 4RH6A 1KLUD 1YN4A 5HG2A 4MH8A 2WDRB 1FNUA 1VZ7A 1VDVA 3WCQA 3BZDB 2PVOD 3NVYA 3TUOA 2EKIA 2PIAA 4J3OD 3AE1B 3ZYYX 4YTMB 3Q8EA 3PZ8A 5JXVA 2Z8LA 4N58A 3Q8BA 1NVID 4A8XC 3ZJTA 4WQMA 1XLQA 2Y3AA 2I2YA 1VLBA 1XLOA 5BYRA 3AN1A 1EU3A 1KFYB 1WGKA 1I4RA 2LFIA 1GAQB 2WDQB 1JALA 1ZUD2 3E9SA 3U52E 4OW0A 4TQ1A 3W9CB 1ET9A 2K0PA 3RPFC 1K50A 3IT6B 1JWUD 1L5PA 1PGBA 1PUTA 2K5PA 1Y56A 2SEBD 3Q8AA 4CQNA 2WXNA 4USAA 2VZKB 1FO4A 2JZPA 1KLGD 4YTNB 1GPXA 1T5XD 3W1SA 1SF0A 3AMZA 5E6JA 5BYQA 2BS4B 1IUEA 4RFBA 1SE2A 1PYWD 1ROEA 1UUPA 1T3QA 4WAFA 2L32A 4MT5A 1FEHA 5HFYA 2BTEA 2BS3B 4EE2A 1QQRA 3T3NA 5BMGA 1L0YB 1NI3A 1QOFA 1ZOYB 2JYTA 1STEA 2N9LA 4C7YA 5G5HA 3P4QB 2R61A 2HDEA 4KKIA 2WXKA 4RGMA 1V1PA 1XLPA 3BIID 1YQ4B 2ACZB 1HA5A 3HUIA 4ZRPA 4HEA1 5EE1A 5H8YE 1P7EA 3P63A 4YSYB 1NYRA 1PGAA 1QOAA 1AW7A 1IGDA 3P42A 2J42A 2LHDA 3PZ7A 3U4EG 4DXFA 1BXTA 2WXOA 5BMHA 3FAHA 3KWLA 3CWIA 1D6EC 1YN5A 4XWTA 2E3TA 2QEJC 3AE7B 3LXFA 4A55A 4IDIA 2JQRB 5EE0A 3W5VB 4C7ZA 3Q8CA 1QF6A 2INPE 1AYFA 1A70A 2BB6A 2DYMA 3AE5B 1TJEA 2W3RA 3E56A 5EE9A 3VR8B 1L0XB 3IXSA 1K51A 2DBYA 1C77A 1N63A 1E0ZA 2RMMA 4PT5A 2IGDA 1UGJA 4A90A 1PGXA 3AH7A 5D3IB 4UDUC 1MPEA 1F77A 1V97A 1J7AA 1WXQA 4AS1A 4RF1A 1F0ZA 2J4XA 1OQRA 4O1NA 1FNWA 1I4HA 1VJKA 1YNTE 2DLBA 4WH4A 3ABVB 1ZPSA 3TEWA 2QSDA 1XXGA 1FFVA 2WXIA 2DWQA 4MM3B 3V3XA 2G9HD 3IAS1 2WS3B 3J9CA 3EA6A 4B0MA 3C8YA 1HQRD 5D3DA 2LHEA 4L2YA 2GI9A 4HRSA 1AN8A 1JROA 1TKGA 1TS4A 4DQOC 1E9MA 3Q69A 4YSXB 2Q5WD 1L0VB 1L6UA 1TS5A 3AE3B 2N9KA 3MFGA 4WWMA 3KLSX 2IJ0A 2W82A 3SEBA 1EWYC 2XNAC 1C79A 4KGTA 1JCKB 1ZDXA 3I57A 2AQ1B 2M19A 3PO0A 5H92C 1JWMD 2TSSA 2PTLA 1ESFA 1KRHA 2L52A 3AE9B 2B76B 2YEPB 1GOZA 1WYGA 1RM6C 2PMVA 1N60A 1I4GA 1QT9A 1SB3C 1ZDVA 2QIEB 2KMMA 3KWVA 1UNSA 1IBXB 3GS2A 2WXFA 1B1ZA 1RFKA 2AQ2B 5HI1A 1JWBD 2QILA 3B2FA 4YWGG 3FC4A 1DOIA 5AUIA 1MHXA 1CJEA 1NYQA 3VR9B 1FFUA 4REZA 4GDLB 3BYTB 2KAJA 1E6EB 4JWSC 4B0EA 3T3OA 1OQQA 3MHZA 3NVZA 3NVWA 4XDDA 1I4XA 3OWEB 2W55A 3BYYB 4HJGE 1CK1A 3IAM1 1MI0A 5FK9C 3ZQ4A 2MJ3A 2QJLA 3BVGA 2BW2A 3BK1A 3FILA 4FXCA 2YEPF 1L4DB 1TY2A 2RPVA 1FM0D 2MJEA 1JRPA 2WP9B 1TKEA 1SXTA 3BVZA 4ARIA 2N7JA 4A6QA 4P6VF 2HTME 2DYOA 3TSSA 1P7FA 1C76A 4NZLB 1QOBA 1SEBD 5C2TB 4R3DA 3W5UB 2WXJA 1V1OA 2V3PA 5G5GA 4OZBA 4RF0A 1J7BA 2WXQA 1FRDA 1ZXIA 1ET6A 5BMIA 2M56B 2KN4A 2ZW1A 3P1MA 4H2AA 1LO5D 4L23A 4N6EB 1FXIA 1NENB 3GB1A 2BS2B 1OFFA 4ITKA 2WU5B 3SFEB 2PKOA 1XO3A 3Q8FA 3VRAB 1D5ZC 2AX5A 3GP7A 1ACCA 1L6VA 1JMLA 2KWDA 1JW9D 1GB1A 1MVKA 1N5WA 2FUG1 3AV8A 3EGRA 2N0SB 1Q10A 1UWXA 1GB4A 4TQ0A 1SSNA 3P4SB 3P4PB 4OVZA 1KH0A 4KGSA 2RDHA 3MP9A 3AEFB 4TMAB 4WIPA 1SJHD 2FE8A 3ZJVA 4TSSA 4N59A 2KACA 4OZAA 1HZ6A 1TY0A 3V05A 2NMQA 3NS1A 4JE3B 1FCLA 2WU2B 4JX1C 4RGOS 2Y5PA 2AQ3B 1WSPA 2J52A 2JX5A 1FIQA 2K3UA 4XDCA 2WXGA 2V3NA 3AEDB 3FILB 1XCQL 4RGTA 1QKZA 3DWGC 2WXPA 4KGRA 2LMCA 4YXDB 1JWAD 2L1AA 2V0GA 1C9FA 4A9AA 2IGHA 3TEYA 5T8IA 3SR6A 1WRIA 1CZPA 4LLGM 2G1EA 1DOYA 1VZ6A 2IDYA 4IKGA 3HVZA 4GLSC 1FXAA 1QOGA 2ON8A 2ONQA 2OHFA 2IGGA 4NAMA 2W54A 3SFDB 2H88B 1HEZE 1E10A 1V1PB 4JPSA 1E7PB 5FR3A 1D5XC 1YJJA 1K53A 1M4VA 3NZ3A 4YTPB 3HRDD 3W2DA 1TS2A 1N62A 1C4PA 3AECB 2RDGA 2BBCA 2NTTA 4LTUA 1QLBB 1EWCA 2JU6X 3BWUD 2NTSA 1JQ4A 3AM9A 1IGCA 4IOIE 2PW9A 3NUHB 1V8CA 2LUMA 3AE8B 2E6XA 3AEBB 3IT4B 1I7HA 4ZHPA 4HKZE 4OZCA 3U2SC 5LNK1 4HROA 4XE0A 3HVDA 5HHDG 1VR9A 1XCTL 3BVMA 2D5GA 2BB5A 1UWMA 2WLBA 3ZJUA 2WXHA 3H8HA 2JWUA 4ZHOA 1C4CA 1RYJA 3R2IA 3URYA 4KKJA 1SE4A 2X38A 2CJNA 1AWDA 2PLPA 1FRRA 1TZOA 1N61A 1F2RI 1D4BA 2VZKD 4ZOHC 2KQ4X 1NEKB 4YSZB 2BT6A 2JSVX 4P16A 2MH7A 4JWUC 5I4DA 1ENFA 3ZGZA 2BYTA 2WXRA 3AE2B 1QILA 2CU3A 1XLNA 3LB8C 2KDMA 3TEXA 4D2KA 4LK0M 1T6BX 3L4PA 1TS3A 1SE3A 1YQ3B 3I9V1 1TYGB 2I38A 3CIRB 1PFDA 4YT0B 2WDVB 1C78A 5BYSA 1ZXHA 1VZ8A 4L1BA 4RGNA 2V4IB 1FCCC 3EUB2 2QMTA 3AEGB 2ZW0A 1L4ZB 1TKYA 4ZYSA 3R2TA 4M0WA 1IBXA 3B2GA 1DGJA 4RNAA 1SJED 1KF6B 1F2RC 2JXTA 1YN3A 2ICIA 1FMAD 1R7SA 2FBWB 2WXMA 2XN9C 5AUKA 4NAWB 2M0AA 3VQIA 2JYEA 1HXYD 1D5MC 4NJCA 4Q2JA 5D7GA 1WWTA 1SBBB 5FKAC 1EM7A 4C80A 1BMLC 5TSSA 5MPOA 1FNVA 1ZE3D 2OEDA 1CQVA 1MHHE 2Y5CA 3LYYA 2L83A 2GB1A 2INNE 2CJOA 2W3SA 2K22A 2IPKD 1VRAB 2GRIA 4HKQA 4AQ7A 2WNMA 5EE3A 1KTKA 5C3JB 1B9RA 3P4RB 4DXGA 1SIJA 2LEKA 4US9A 4C56C 1DYQA 3AEEB 3UI3A 1C4AA 3AE4B 2MEKA 2WQYB 3TEZA 1I4QA 4OHJA 1N5XA 2SAKA 1J7CA 3MJ5A 2MJDA 1XEEA 4KX6B 1YMHE 1FD6A 1JWSD 3BK2A 1PDXA 3O13A 3KQ4A 4WURA 4ZRQA 1HZ5A 3U7ZA 2H89B 2J53A 3VRBB 4MACA 3NVVA 2EELA 1RWSA 3N9YC 1BUIC 3AB5A 3RFZB 4XWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6E B;  1AYF A;  1A70 A;  1FXI A;  1NEN B;  2PVG C;  3AE5 B;  3B9J A;  1TJE A;  1OFF A;  2BS2 B;  2W3R A;  4HRO A;  5EE9 A;  3VR8 B;  2K9X A;  4ITK A;  3AEA B;  2WU5 B;  3SFE B;  2DBY A;  2PKO A;  1N63 A;  1E0Z A;  4US8 A;  1UWM A;  2WLB A;  1XO3 A;  5GXG B;  3DWM A;  4ZHO A;  1RYJ A;  3VRA B;  1DOX A;  2AX5 A;  1ZP0 B;  3ETR A;  1L6V A;  2CJN A;  1JW9 D;  3AH7 A;  3NRZ A;  1YJI A;  1AWD A;  1N5W A;  3AE6 B;  1FRR A;  1V97 A;  1N61 A;  2WDR B;  1J7A A;  3AV8 A;  1VDV A;  1WXQ A;  3WCQ A;  1F0Z A;  1OQR A;  4ZOH C;  2N0S B;  2PVO D;  1NEK B;  4YSZ B;  3NVY A;  1VJK A;  4C7Z A;  3ABV B;  2BT6 A;  3P4S B;  1FFV A;  3P4P B;  2DWQ A;  2MH7 A;  4JWU C;  2WS3 B;  3AE2 B;  2EKI A;  2PIA A;  2CU3 A;  1XLN A;  4HRS A;  1JRO A;  3LB8 C;  1TKG A;  4YSX B;  1E9M A;  3AE1 B;  3ZYY X;  3AEF B;  3L4P A;  2Q5W D;  4YTM B;  3W5V B;  1YQ3 B;  1L0V B;  1TYG B;  1L6U A;  3CIR B;  1PFD A;  4N58 A;  4YT0 B;  2WDV B;  3AE3 B;  1NVI D;  4WWM A;  4ZHP A;  4N59 A;  4WQM A;  1XLQ A;  1EWY C;  1VLB A;  3EUB 2;  1XLO A;  3AEG B;  1TKY A;  3AN1 A;  3NS1 A;  1KFY B;  1WGK A;  3B2G A;  1DGJ A;  2WU2 B;  1KF6 B;  2M19 A;  1GAQ B;  4JX1 C;  2WDQ B;  3PO0 A;  1JAL A;  1ZUD 2;  5H92 C;  2JX5 A;  1FIQ A;  1FMA D;  1R7S A;  1KRH A;  2L52 A;  3AED B;  2B76 B;  3AE9 B;  2FBW B;  3DWG C;  3W9C B;  1WYG A;  3RPF C;  1RM6 C;  4YXD B;  1JWA D;  1PUT A;  1L5P A;  2K5P A;  1N60 A;  1QT9 A;  1SB3 C;  5AUK A;  2QIE B;  2KMM A;  4USA A;  4A9A A;  1FO4 A;  4YTN B;  1WWT A;  1GPX A;  1QF6 A;  3SR6 A;  4C80 A;  1RFK A;  1SF0 A;  3AMZ A;  1JWB D;  3B2F A;  1WRI A;  1CZP A;  3FC4 A;  5MPO A;  1DOI A;  2BS4 B;  2G1E A;  5AUI A;  1IUE A;  1CJE A;  1NYQ A;  1DOY A;  3VR9 B;  1FFU A;  3HVZ A;  1ROE A;  1FXA A;  1E6E B;  1QOG A;  2KAJ A;  2Y5C A;  4JWS C;  2OHF A;  1T3Q A;  2L83 A;  1OQQ A;  2CJO A;  2W54 A;  3NVZ A;  5EE0 A;  3SFD B;  2W3S A;  3NVW A;  2H88 B;  2K22 A;  1E10 A;  2BS3 B;  5EE3 A;  5C3J B;  1E7P B;  2W55 A;  3P4R B;  1B9R A;  1NI3 A;  1SIJ A;  1QOF A;  1YJJ A;  1ZOY B;  2LEK A;  4US9 A;  3AEE B;  4YTP B;  4C7Y A;  3HRD D;  2MJ3 A;  2QJL A;  3P4Q B;  1N62 A;  5G5H A;  4FXC A;  3AE4 B;  3AEC B;  2WQY B;  1XLP A;  3BII D;  1N5X A;  1YQ4 B;  1FM0 D;  2MJE A;  1J7C A;  4LTU A;  2ACZ B;  1QLB B;  1JRP A;  2MJD A;  2WP9 B;  3HUI A;  1TKE A;  5H8Y E;  5EE1 A;  4KX6 B;  3P63 A;  4YSY B;  1NYR A;  2HTM E;  1QOA A;  3AM9 A;  1PDX A;  4P6V F;  1JQ4 A;  1V8C A;  1QOB A;  5C2T B;  3W5U B;  3AE8 B;  5G5G A;  3FAH A;  1J7B A;  3KWL A;  2H89 B;  3CWI A;  3VRB B;  1FRD A;  1ZXI A;  3AEB B;  3NVV A;  2E3T A;  3AE7 B;  3LXF A;  4IDI A;  1I7H A;  1RWS A;  2JQR B;  2M56 B;  3AB5 A;  3P1M A; 
#chains in the Genus database with same CATH topology
 1XF5 L;  4KIK A;  1YJ1 A;  4JL9 A;  2LGI A;  2WXL A;  4GXB A;  3W1Y A;  4FHJ A;  5GXG B;  3MC0 B;  3R8B A;  1E90 A;  3V62 A;  2LJI A;  1KJT A;  4RCO A;  1I4P A;  4LNK A;  1FNU A;  1VZ7 A;  1VDV A;  2PVO D;  4G11 A;  3AU5 A;  2C5L C;  4AOF A;  1EO6 A;  2PIA A;  3ZRF A;  2M4N A;  4YTM B;  3PZ8 A;  3PRZ A;  4N58 A;  3Q8B A;  2JWZ A;  2Y3A A;  3PV1 A;  2DX5 B;  1IP9 A;  1J19 A;  2KX0 A;  1EF5 A;  2KNB A;  2N1W A;  1JAL A;  1ZUD 2;  2LXC A;  3QQ8 B;  3LJ3 A;  3W9C B;  1UD7 A;  2QDF A;  1ET9 A;  4ASW C;  1K50 A;  3IT6 B;  1PGB A;  2LVP A;  2SEB D;  3OLM D;  1WX8 A;  2C60 A;  2XK5 B;  2VZK B;  4USA A;  4YTN B;  1WI0 A;  3W1S A;  2KTR A;  2BYE A;  5BYQ A;  3Q14 C;  1WX7 A;  3M63 B;  1SE2 A;  4LDT B;  1R4N I;  1UUP A;  3VUY A;  2BS3 B;  1QQR A;  4FJY A;  3T3N A;  3PPA A;  4XC2 A;  2N9L A;  4MSQ B;  4IM2 A;  4C7Y A;  1WMH A;  3RMK C;  3ZVV A;  4KKI A;  1C3T A;  1XLP A;  3BII D;  3FKY A;  1T0R C;  1E8Y A;  1P7E A;  1NYR A;  1QOA A;  1IGD A;  4HPP A;  2L76 A;  1WE6 A;  3ZUN A;  4S0R A;  4DXF A;  4IWQ A;  4W9J A;  2K25 A;  2WXO A;  1YQB A;  3FAH A;  2C9W B;  3MHS D;  3KWL A;  3AE7 B;  1F9J A;  2ZJD A;  4IDI A;  2RR9 A;  4GDK A;  1WXS A;  2BB6 A;  3AE5 B;  4KIK B;  1TJE A;  2W3R A;  1L0X B;  4BOS C;  1UZX B;  2RMM A;  2D3B A;  3PRM B;  5G2N A;  4M8N A;  2IGD A;  1WGR A;  3RNE C;  4HXD A;  4UDU C;  4AS1 A;  4RF1 A;  2J4X A;  1G6J A;  1FNW A;  4HLE A;  4RM8 A;  3HHM A;  3L10 B;  3ZRC A;  2DLB A;  2QSD A;  1XXG A;  2KTF A;  2BWF A;  2WS3 B;  3EA6 A;  2LJ5 A;  3KW5 B;  3DBL I;  4URK A;  4II2 B;  1TS4 A;  4DQO C;  3Q69 A;  2M17 A;  3GZN I;  2LAS A;  4TKN A;  2GBM A;  1TBE A;  4WJN A;  4K3C A;  2N7E A;  3I57 A;  4NAW A;  2INC C;  1JWM D;  1WM2 A;  4XYC A;  1ESF A;  1KRH A;  1GOZ A;  1WYG A;  2WHI A;  5AZH A;  2D3G A;  2PMV A;  4N9F 4;  3I5J C;  1QT9 A;  4P1C C;  2QIE B;  4BBN F;  1VCB A;  1WXV A;  3DHI C;  2FCN A;  1MHX A;  2KQ7 A;  4EZJ A;  4FLH A;  4JGH B;  4B0E A;  1OQQ A;  2RDB C;  1I4X A;  5DPW A;  3DBH B;  3WAL A;  2C7H A;  3IAM 1;  3T9L A;  1MI0 A;  4KDL B;  2C7N B;  2KMA A;  2BW2 A;  3BK1 A;  4FXC A;  2YEP F;  1V5T A;  3TBL D;  1TY2 A;  3N30 A;  2LGS A;  2KC2 A;  1TKE A;  4DK5 A;  4P6V F;  4XX5 A;  3ZTC A;  1WJN A;  2NPT B;  4EKU A;  1P7F A;  2KJH B;  2WXJ A;  1V1O A;  4RF0 A;  4ZRJ A;  1J7B A;  1ZXI A;  2KAN A;  2M56 B;  2UYZ B;  2ZW1 A;  3P1M A;  4L23 A;  4W9D A;  1UGM A;  1S1Q B;  3GZN B;  1XO3 A;  2CHX A;  2KWD A;  4MGI E;  4DDI D;  1MVK A;  4G3X B;  1F1H A;  3ZTD A;  1Q10 A;  1UWX A;  3SDL C;  2MWS B;  2N9E B;  1AAR A;  1SSN A;  1OGW A;  2V1Y A;  3A1Q A;  3P4S B;  3KUZ A;  1ZGU B;  2GBK A;  4JQW C;  2N9X A;  1E7U A;  3ZJV A;  2KX3 A;  3OG5 A;  1FPY A;  4MSM B;  1HZ6 A;  1UBI A;  2WU2 B;  3PRP B;  2AQ3 B;  1WSP A;  2JX5 A;  2WXG A;  3N1Z C;  3DBS A;  2WYQ A;  2J7Q B;  4PS7 A;  2V0G A;  4LNO A;  3GE8 C;  1CZP A;  3ECI A;  2RGF A;  1TGZ B;  1VZ6 A;  3QX1 A;  1FXA A;  3R3M A;  2ONQ A;  2BKF A;  2EMT A;  3ML8 A;  1YD8 U;  1HEZ E;  3RUI B;  2REX A;  4GIV A;  1D5X C;  1K53 A;  1LM8 B;  2D2Q A;  4P7I A;  3HRD D;  1TS2 A;  2IO2 B;  5LLI A;  3AXC A;  1GC6 A;  3A9K B;  4FUL A;  1X1M A;  1WXA A;  4BBN C;  1EWC A;  3BWU D;  2PJH A;  1JQ4 A;  3AM9 A;  3QC8 B;  3NUH B;  3NG0 A;  2OJR A;  3AE8 B;  4GB9 A;  3A9K A;  1XT9 B;  2KLG A;  2PEA A;  2ZCC A;  4ZYN A;  1U4A A;  2K1F A;  1TIF A;  2EKE C;  3BVM A;  2BB5 A;  2MP2 A;  2JRH A;  5JHB A;  2BPS A;  2X38 A;  1FRR A;  1TZO A;  3RYT A;  1WZ0 A;  2CU1 A;  2BT6 A;  3H7S A;  4JWU C;  3AE2 B;  4I6N B;  2CU3 A;  2D10 A;  1XLN A;  4D2K A;  1UH6 A;  1T6B X;  2KDI A;  2PE6 B;  3CIR B;  2KXJ A;  2LRW A;  4FA6 A;  3DQV A;  2JF5 A;  5BYS A;  1GNU A;  3NY5 A;  1FCC C;  2JVC A;  4HDQ A;  4HWI B;  3R2T A;  4FBJ B;  4M00 A;  2ICI A;  2JXT A;  3B0A A;  4ZRK A;  2Y5B B;  2FBW B;  4W9L A;  4BZA A;  3M3J A;  4WWO A;  2D07 B;  1WH3 A;  3VH3 B;  1HXY D;  1WWT A;  1SBB B;  4K1R B;  4WJQ A;  1FNV A;  1T0Q C;  1WXM A;  3IFW B;  3LYY A;  2GB1 A;  2LXA A;  2K22 A;  3GE3 C;  4HKQ A;  4AQ7 A;  2LGX A;  1B9R A;  2LEK A;  3EFU A;  4US9 A;  3AEE B;  4HK2 A;  1C4A A;  3UGB B;  2WQY B;  4J6I A;  2M8S A;  4OHJ A;  2SAK A;  4MGY E;  1FD6 A;  1YMH E;  1XQQ A;  3BK2 A;  2H89 B;  4MAC A;  4ANU A;  3N9Y C;  2W9N A;  4XWW A;  3H6N A;  2K9X A;  4US8 A;  2KVR A;  1SE9 A;  3EHV A;  1DOX A;  1RRB A;  3ETR A;  3NRZ A;  3UF8 A;  4RH6 A;  3BZD B;  5JH5 C;  2DHZ A;  5CTR C;  3V6E B;  3TUO A;  2EKI A;  3IHP C;  3AE1 B;  1EF1 A;  4C4V B;  4NJ7 A;  1XLO A;  1WRD B;  2AL6 A;  2KDE B;  2KWV B;  5BYR A;  1WZ3 A;  1I35 A;  1WGK A;  3WAM A;  3K9P B;  1GAQ B;  2X8X X;  1MJD A;  4KZ0 A;  2B3A A;  4TQ1 A;  3HM6 X;  1VD2 A;  2MBH A;  3DBL B;  1PUT A;  1L5P A;  1Y56 A;  3Q8A A;  2WXN A;  4K7U A;  1FO4 A;  1T5X D;  3A9J A;  5E6J A;  1SGH A;  4LJO B;  2BS4 B;  1PYW D;  1FXT B;  1GC7 A;  4W9H A;  1T3Q A;  1TZ1 A;  4KSK C;  4MT5 A;  4MH0 E;  3QAR A;  4JIO U;  4DBG A;  4ACF A;  1NI3 A;  1QOF A;  2JYT A;  5G5H A;  3P4Q B;  2HDE A;  2WXK A;  1V1P A;  4HEA 1;  5EE1 A;  5H8Y E;  4YSY B;  1PGA A;  1AW7 A;  3P42 A;  2J42 A;  3H9D A;  3U4E G;  4G50 A;  2ZVN A;  3CWI A;  1YN5 A;  2E3T A;  4EZL A;  2J0K A;  1QF6 A;  3Q8C A;  1AYF A;  3ZO5 B;  3E56 A;  3VR8 B;  2RPQ A;  4PK1 A;  2JZZ A;  2K8C A;  1K51 A;  1N63 A;  4ANX A;  4A90 A;  3AH7 A;  4IG7 B;  5JZE B;  2D11 A;  1F77 A;  1J7A A;  2K6D B;  4IW0 A;  1OQR A;  1I4H A;  3JSV A;  5DPS A;  4WH4 A;  5BO4 B;  3V3X A;  2DWQ A;  3IAS 1;  3J9C A;  4B0M A;  2CHW A;  2LHE A;  2GI9 A;  2I1K A;  2FNJ B;  3NS8 A;  1L6U A;  1TS5 A;  3AE3 B;  3K9O B;  2G4D B;  3WA0 A;  1PQS A;  1C79 A;  3APF A;  1JCK B;  1ZDX A;  2AQ1 B;  3L17 A;  3PO0 A;  2PTL A;  2L52 A;  3VH4 B;  2YEP B;  1S3S G;  1ZKH A;  1RM6 C;  2FID A;  2AL3 A;  2XBB C;  1IBX B;  3GS2 A;  3VTU A;  1Z2M A;  2WXF A;  3VTV A;  4BAX A;  1RFK A;  2AQ2 B;  5HI1 A;  4IWO A;  1DOI A;  1CJE A;  4P1B C;  4TV3 A;  4GSW A;  4REZ A;  3PTF C;  1M94 A;  3BYT B;  4GDL B;  1V9J A;  3L0W B;  3MHZ A;  4RMA A;  1IYF A;  1HE8 A;  1LQB A;  5J17 A;  4LDT D;  1WJU A;  4LNI A;  2LGY A;  5FK9 C;  2KZR A;  2L05 A;  2QJL A;  4NJ6 A;  4K81 A;  3JW0 X;  5KHO A;  3ML9 A;  2RPV A;  1FM0 D;  2MJE A;  3VFK A;  1JRP A;  2L3Z A;  1NDD A;  3BVZ A;  2KJR A;  2DYO A;  3TSS A;  1SEB D;  5C2T B;  2KD0 A;  2V3P A;  5G5G A;  1H8C A;  5BMI A;  1J0G A;  5EDS A;  4H2A A;  4WWN A;  3VUW A;  3GB1 A;  1OFF A;  4ITK A;  5G55 A;  3A1Q B;  1GUA B;  2CR5 A;  4PYU A;  3DBR B;  2ZEQ A;  3Q8F A;  1WE7 A;  1D5Z C;  1ACC A;  3PZD A;  2JUO A;  1JML A;  4K7W A;  1N5W A;  4BKG A;  2FUG 1;  3PHX B;  3A4R A;  4IWP A;  2ZVO A;  3N32 A;  3EGR A;  1HTO A;  3P2B A;  3X0W A;  1GB4 A;  4WAA A;  4NQK E;  4DDG D;  2KDB A;  1WJ6 A;  3L13 A;  2KFK A;  2VRR B;  1J8C A;  3MP9 A;  3IVF A;  3PSE B;  3UQB A;  2FE8 A;  5IOI A;  3IBE A;  2EMS A;  1WM3 A;  2KAC A;  4ANV A;  4FAD A;  4OZA A;  1ZW7 A;  1TY0 A;  3V05 A;  2NMQ A;  3NS1 A;  4ZRI A;  1FCL A;  4RGO S;  2MW5 A;  3DWG C;  2WXP A;  1LXD A;  4KGR A;  5E6N A;  3DCG A;  4YXD B;  1JWA D;  4A9A A;  1R4M B;  3TEY A;  5IP4 D;  5T8I A;  2K8H A;  2UWQ A;  2G1E A;  3QCA A;  3O65 B;  3DVN U;  4KV2 A;  1V1P B;  4JPS A;  1E7P B;  3Q3O C;  2OOB B;  3OJ3 A;  4FHK A;  1N62 A;  4IM3 A;  1Z5S B;  2NTT A;  1H4R A;  1QLB B;  1E8X A;  2OJW A;  4IOI E;  3KYC D;  3AEB B;  1YX5 B;  4F7Z A;  4HKZ E;  3U2S C;  4HRO A;  4XE0 A;  1WX9 A;  4MJS A;  3ZDT A;  1UWM A;  3ZJU A;  2WXH A;  4WJP A;  2JWU A;  2PLP A;  4ZOH C;  5LXH A;  3MTN B;  2DYB A;  3RNB C;  3CSF A;  2MSE D;  4P16 A;  4F8C B;  2MH7 A;  1ENF A;  4EEW A;  2WXR A;  2L00 B;  2QCZ A;  2KDM A;  5E6O A;  2PE9 A;  1TS3 A;  3V60 A;  3HM3 A;  4YT0 B;  1PFD A;  2WDV B;  1VZ8 A;  4L1B A;  2QC8 A;  3EUB 2;  1V80 A;  2ZW0 A;  4ZYS A;  3UIN B;  5JHA A;  3VXW A;  3ALB A;  1IBX A;  3TMP B;  1OQY A;  3N20 C;  1YN3 A;  2Z59 B;  1FMA D;  1R7S A;  4IM0 A;  2UU7 A;  2WXM A;  3U8Z A;  3DBR I;  3VQI A;  4GMV A;  2KMC A;  5D7G A;  1EM7 A;  4GGQ A;  4PYZ A;  3KUC B;  1YOV B;  2GLS A;  4LNN A;  3JYU A;  2L83 A;  1GG3 A;  1KM7 A;  3RNC C;  1TT5 B;  2GOW A;  2N1V A;  2IPK D;  2GRI A;  4NNJ B;  2Z0D B;  2WNM A;  3QIJ A;  2NBU A;  3P4R B;  4DXG A;  4MEL A;  2IO3 B;  4FJZ A;  3AE4 B;  3TEZ A;  1I4Q A;  1OEY A;  3N3K B;  3MJ5 A;  1P9D U;  1T0S C;  2MJD A;  5D6J B;  1SIF A;  1Q5W B;  2HJ1 A;  3KQ4 A;  4WUR A;  3U7Z A;  3KH0 A;  3UIO B;  2NR2 A;  2KWC A;  2LD9 A;  4KDI C;  4OVV A;  1IPG A;  3AE6 B;  1KLU D;  1YN4 A;  5HG2 A;  4MH8 A;  2WDR B;  4HJK A;  3VTW A;  2KHW B;  2DZJ A;  4KVG B;  1GJZ A;  1WF9 A;  3H7P A;  2BGF A;  4CYE A;  2V4L A;  3RT3 B;  4J3O D;  3CF6 E;  2AEH A;  3Q8E A;  4EUT A;  5JXV A;  3D32 A;  4A8X C;  3ZJT A;  2MQJ A;  3R7R A;  4WQM A;  4LJP B;  1QZE A;  1P3Q U;  3RD2 A;  3A9J B;  3EC8 A;  1EU3 A;  1KFY B;  1I4R A;  4I6P A;  4KSL C;  3JVZ X;  2WDQ B;  1WY8 A;  3U52 E;  2IO1 B;  2K0P A;  3PS6 A;  4E3C A;  4CQN A;  3PGE A;  1KLG D;  1GPX A;  1RLF A;  5CHV C;  4DWF A;  2KOX A;  2LZ6 A;  4C4V A;  2WX1 A;  3X23 A;  5KHQ A;  2BTE A;  1P0R A;  5BMG A;  1ZOY B;  2JZ3 B;  3H7P B;  3R7Q A;  2RSU A;  4RGM A;  2AWT A;  3DVG Y;  2JRI B;  1YQ4 B;  3ZNZ B;  1HA5 A;  3HUI A;  4FJV B;  2O6V D;  3C0R B;  4BOZ B;  2FCM A;  2LHD A;  2IY0 B;  3PZ7 A;  1BXT A;  4LCD E;  2N4F A;  2LGD A;  1T0Y A;  4XWT A;  3LXF A;  2JQR B;  5EE0 A;  4C7Z A;  3ZDM C;  1WMH B;  4W9C A;  2KWU B;  2CHZ A;  3IXS A;  3AI5 A;  4ZDV A;  1C77 A;  3PT2 B;  1E0Z A;  2MX2 A;  2MBQ A;  4PT5 A;  3S2A A;  4M02 A;  2YLM A;  2BQQ A;  1PGX A;  2KYW A;  5D3I B;  1V97 A;  2ZNV B;  1F0Z A;  4O1N A;  1E5W A;  1RAX A;  4EFO A;  3NJT A;  3ENE A;  1R4N B;  2XK5 A;  2KKC A;  1MG8 A;  1ZPS A;  2LVO A;  2WXI A;  2KFK B;  4JLC A;  2ASQ A;  2NBV B;  3C8Y A;  3DPD A;  1HQR D;  4L2Y A;  4WWP A;  4HRS A;  4YSX B;  3RUL A;  4WWM A;  3MFG A;  3GOE A;  2IJ0 A;  3SEB A;  1EWY C;  1Q1O A;  3QA8 A;  4LNF A;  2L8J A;  3A33 B;  3PRE A;  2M19 A;  2JPH A;  2TSS A;  2D3A A;  3AE9 B;  4WQO B;  1ZDV A;  1UNS A;  2PPH A;  1B1Z A;  1WGY A;  5IKC M;  3B2F A;  2MBE A;  3FC4 A;  5AUI A;  2O6V B;  5IN7 A;  3VR9 B;  4IC7 B;  2KAJ A;  2G45 B;  3T3O A;  2JXX A;  1CMX B;  3H1U A;  4XDD A;  3OWE B;  2VH2 A;  1V81 A;  2YVC A;  1KLV A;  2W55 A;  3BYY B;  1CK1 A;  1WR6 E;  3ZQ4 A;  3BVG A;  4AWJ A;  3BY4 B;  1SXT A;  4ARI A;  2N7J A;  2NCN A;  4MGZ E;  4XGA B;  1C76 A;  3LDZ E;  4NZL B;  5IA7 A;  3W5U B;  4R3D A;  4OZB A;  3L16 A;  2ZPN A;  1ET6 A;  2KN4 A;  1LO5 D;  4N6E B;  3ZXR A;  1FXI A;  3Q3N C;  3QJZ A;  2WU5 B;  2M1M A;  4II3 B;  4HPL B;  3ZLZ A;  2O2V B;  3VRA B;  3GP7 A;  3V61 A;  3C19 A;  3RNG C;  4BKT A;  3AV8 A;  2O2V A;  2N0S B;  2RD0 A;  4TQ0 A;  2MA9 B;  1V49 A;  3P4P B;  4OVZ A;  2MHJ A;  2RDH A;  2N7D A;  3RN9 C;  2A4Z A;  5AZF A;  1E8W A;  2V9H A;  3RNA C;  4JE3 B;  1WGG A;  3IG3 A;  3RZW C;  3SD5 A;  4MEM A;  3DVN V;  2Y5P A;  4XDC A;  2K3U A;  4W9G A;  3FIL B;  2V3N A;  4RGT A;  2IY1 B;  2LMC A;  2L1A A;  4HCN B;  2BYF A;  1C9F A;  1WRI A;  4LLG M;  5DPR A;  2IDY A;  4GLS C;  1QOG A;  2J0M A;  2LWP A;  2W54 A;  3UIP B;  2DAJ A;  1E10 A;  1UBQ A;  2KJ6 A;  1D3Z A;  4BKS A;  3EFC A;  4YTP B;  1C4P A;  3AEC B;  2BBC A;  4LTU A;  1N6Z A;  2FUH B;  2NTS A;  3N1Y C;  1IGC A;  1V8C A;  3TIX A;  2LUM A;  3V6C B;  1HTQ A;  2E6X A;  1MG4 A;  3IT4 B;  1I7H A;  4OZC A;  1OTR B;  1BT0 A;  1VR9 A;  4MM3 A;  1XCT L;  2WLB A;  4ZHO A;  1C4C A;  3URY A;  4KKJ A;  1SE4 A;  3NZS A;  1AWD A;  2I1J A;  2GMI C;  2KQ4 X;  1NEK B;  4NPN A;  5GMV A;  3VVW B;  2WGS A;  3R66 C;  2JSV X;  3WAN A;  4DXA B;  1QIL A;  4AJY B;  3LB8 C;  3TEX A;  2JY6 A;  4LK0 M;  1SE3 A;  1YQ3 B;  3I9V 1;  1TYG B;  3U30 A;  2KFJ A;  4C00 A;  4MGK E;  1L4Z B;  1TKY A;  3B2G A;  4RNA A;  1SJE D;  3I63 C;  1L7Y A;  3ZNH B;  1L2N A;  4OVU A;  1JRU A;  2XN9 C;  4ANW A;  4AP4 C;  5AUK A;  4NJC A;  5FKA C;  4C80 A;  1BML C;  1ZE3 D;  3MC8 A;  1CQV A;  4B9K A;  1MHH E;  3PHW B;  2Y5C A;  3B1L X;  5J18 A;  2W3S A;  2KN5 A;  1VRA B;  3B08 A;  5C3J B;  1KTK A;  1WIA A;  3OJ4 B;  2KC1 A;  2N9P C;  3RZF A;  3CST A;  1YIW A;  1N5X A;  4EZK A;  3JSV B;  4HCP B;  4W9F A;  1XEE A;  4FN2 A;  4YL8 A;  1JWS D;  3ZXV A;  1P98 A;  3PLV A;  3O13 A;  4ZRQ A;  3ZNI D;  2DZI A;  3EEC A;  1OEY J;  3T8M A;  2KVZ A;  1P1A A;  3Q3F A;  1NBF C;  3Q3J A;  3RFZ B;  4E74 A;  2PVG C;  3DHH C;  3B9J A;  4ARC A;  1TTN A;  4GDK B;  3AEA B;  1EU4 A;  1A5R A;  4K3B A;  3U7D A;  5CHF A;  4HVB A;  3DWM A;  3SHQ A;  1ZP0 B;  1K52 A;  2FCQ A;  1YJI A;  5E6P A;  1WR1 A;  3WCQ A;  4DHZ B;  3NVY A;  5AEK B;  3I3T B;  3M62 B;  2HE7 A;  3ZYY X;  4PS3 A;  4M01 A;  2Z8L A;  3QWZ B;  3VHT C;  4EOY A;  1NVI D;  1XLQ A;  3QHT A;  2I2Y A;  1VLB A;  3QAQ A;  2KTR B;  3HK0 A;  3AN1 A;  2IND C;  2K8B A;  2ZNV C;  3M95 A;  2LFI A;  4BFR A;  3E9S A;  1YX6 B;  4OW0 A;  2R2Q A;  2MCN B;  3RPF C;  5DCN A;  1JWU D;  2WX0 A;  2K5P A;  4ICV A;  2JZP A;  1SF0 A;  3AMZ A;  4A3P A;  1IUE A;  4RFB A;  1ROE A;  4WAF A;  2L32 A;  4A20 A;  1FEH A;  5HFY A;  4EE2 A;  1L0Y B;  1C1Y B;  3RCZ A;  1STE A;  2R61 A;  4B6W A;  2LVQ A;  2LUE A;  2LI5 A;  1NI2 A;  2ACZ B;  4ZRP A;  3KUD B;  3P63 A;  2Z0E B;  3ZKJ C;  4DHJ D;  1RFA A;  1WFY A;  5BMH A;  2HTH A;  2DAF A;  1WJ4 A;  1D6E C;  2MLB A;  2QEJ C;  2IYD B;  4A55 A;  3MC9 A;  3W5V B;  2WDT B;  2INP E;  1A70 A;  2DYM A;  5EE9 A;  1Y8R C;  2DBY A;  2JT4 B;  4BVU C;  2FAZ A;  4E71 A;  1UGJ A;  1MPE A;  3OAW A;  1WXQ A;  3NOB A;  1VJK A;  2BKR B;  1YNT E;  3N1X C;  4RM9 A;  5L95 C;  3ABV B;  3TEW A;  4QAY A;  1FFV A;  4MM3 B;  1K8R B;  3TCA A;  2G9H D;  2L7R A;  5LXI B;  5D3D A;  2BWE S;  1AN8 A;  2DNF A;  1JRO A;  1TKG A;  1E9M A;  2Q5W D;  3APD A;  1L0V B;  2KLC A;  2N9K A;  3HIZ A;  3KLS X;  4F1S A;  1UEL A;  2W82 A;  4CO7 A;  2GBR A;  2XNA C;  3KVF B;  5HKH A;  4KGT A;  3Q6B A;  5AZG A;  5H92 C;  2ZZP B;  2B76 B;  1E8Z A;  2M0X A;  3A4S C;  1N60 A;  1I4G A;  1SB3 C;  2KMM A;  3KWV A;  4M0W B;  1WGH A;  3RI7 C;  1JWB D;  2QIL A;  4YWG G;  1NYQ A;  1FFU A;  2A5U A;  1E6E B;  4JWS C;  2CKH B;  5CHW A;  4I6L B;  4GU2 A;  3NVZ A;  4A3O A;  3NVW A;  2BYV E;  2ZPY A;  3AU4 A;  4HJG E;  2MJ3 A;  3FIL A;  5L83 A;  1R4M I;  4GN1 A;  4B95 A;  1L4D B;  3QK0 A;  2WP9 B;  4DHZ E;  2BVC A;  4A6Q A;  2HTM E;  4X57 B;  3WAO A;  1QOB A;  5J2R A;  1V86 A;  3VAW A;  3NZU A;  1I42 A;  2WXQ A;  1FRD A;  4BKS D;  2MP2 B;  4GOC A;  2GBJ A;  2XEW A;  1NEN B;  4XZ4 A;  2BS2 B;  3ZNG C;  3DBH I;  2FIF A;  2KT7 A;  3SFE B;  2PKO A;  2ZCB A;  2G3Q B;  3WAP A;  3UQA A;  2HJ8 A;  2AX5 A;  2VH1 A;  1L6V A;  4MDK E;  1GB1 A;  1JW9 D;  3VUX A;  5C23 A;  2WWZ A;  4M8M A;  4KZC A;  4TUU A;  4AJW A;  1KH0 A;  2DZM A;  2DZK A;  4NQL B;  4KGS A;  2MBB B;  4CHK A;  3TJP A;  3AEF B;  4TMA B;  4WIP A;  1SJH D;  3W1S C;  4TSS A;  4N59 A;  5D94 A;  4JX1 C;  2J52 A;  1FIQ A;  3AED B;  1XCQ L;  1QKZ A;  2K6Q A;  3CMM B;  3DOW A;  2IGH A;  3SR6 A;  4DHJ B;  4G0N B;  3WIM A;  3VDZ A;  3ZIM A;  4GDL A;  1DOY A;  4IKG A;  3HVZ A;  4HPM B;  2O6V A;  2ON8 A;  2K39 A;  2OHF A;  1KOT A;  2IGG A;  4NAM A;  3SFD B;  3Q3M C;  2H88 B;  2IZV B;  5FR3 A;  4MJS B;  1YJJ A;  1M4V A;  3NZ3 A;  3W2D A;  2CS4 A;  4K7S A;  2IO0 B;  3DDC B;  2RDG A;  3L54 A;  2BF8 B;  2JU6 X;  3BIN A;  2PW9 A;  5CX3 A;  2AYO B;  1V5O A;  1WYW B;  3PLU A;  4ZHP A;  4PS8 A;  2FCS A;  3NHE B;  2NBW B;  5LNK 1;  3HVD A;  5HHD G;  4IUM B;  2L0T A;  2D5G A;  5IO9 A;  2D3C A;  2IBI B;  1EUV B;  3H8H A;  1RYJ A;  3R2I A;  1WGD A;  3RNF C;  2CJN A;  1ISN A;  2NPT A;  2NS5 A;  1N61 A;  1F2R I;  1D4B A;  2KK8 A;  4WJO A;  2VZK D;  4YSZ B;  3APC A;  5TR5 A;  3AUL A;  2NVU I;  1XD3 B;  2HD5 B;  3ZGZ A;  5I4D A;  2V3S A;  2BYT A;  3DVG X;  1V6E A;  3TL5 A;  2KQS A;  1MFW A;  4W9K A;  3L4P A;  2I38 A;  3ZW3 A;  1C78 A;  2R2O A;  1ZXH A;  1UF0 A;  4RGN A;  4NY0 A;  2V4I B;  2KDF B;  1LGR A;  2QMT A;  3AEG B;  3DHG C;  4ICU A;  4M0W A;  1DGJ A;  1KF6 B;  1Q0W B;  4HDO A;  1F2R C;  3MJW A;  2DEN B;  1E7V A;  4NAW B;  2M0A A;  2JYE A;  4Q2J A;  1D5M C;  2J0J A;  5FR6 A;  4W9E A;  1LFD A;  4S17 A;  5TSS A;  5MPO A;  5D2M B;  2OED A;  3SU8 X;  2INN E;  2CJO A;  2MBO A;  1F52 A;  5IAA C;  5C1Z A;  3Q2A C;  5EE3 A;  2G4S A;  1SIJ A;  4W9I A;  1DYQ A;  2KO3 A;  4C56 C;  3UI3 A;  1V2Y A;  3PVL A;  2MEK A;  3KYD D;  1J7C A;  2QHO A;  4AUQ C;  4KX6 B;  1PDX A;  2MRP A;  2L0F A;  1HZ5 A;  2LRU A;  3L08 A;  2GBN A;  2J53 A;  3ONS A;  3VRB B;  3NVV A;  5DPT A;  2EEL A;  1RWS A;  1BUI C;  3AB5 A;  2C7M B; 
#chains in the Genus database with same CATH homology
 2PVG C;  1XF5 L;  3B9J A;  4ARC A;  2K9X A;  4GDK B;  3AEA B;  1EU4 A;  2LGI A;  2WXL A;  4US8 A;  5GXG B;  3MC0 B;  3DWM A;  3R8B A;  2LJI A;  1DOX A;  4RCO A;  1ZP0 B;  1K52 A;  3ETR A;  1I4P A;  3NRZ A;  1YJI A;  3AE6 B;  4RH6 A;  1KLU D;  1YN4 A;  5HG2 A;  4MH8 A;  2WDR B;  1FNU A;  1VZ7 A;  1VDV A;  3WCQ A;  3BZD B;  2PVO D;  3NVY A;  3TUO A;  2EKI A;  2PIA A;  4J3O D;  3AE1 B;  3ZYY X;  4YTM B;  3Q8E A;  3PZ8 A;  5JXV A;  2Z8L A;  4N58 A;  3Q8B A;  1NVI D;  4A8X C;  3ZJT A;  4WQM A;  1XLQ A;  2Y3A A;  2I2Y A;  1VLB A;  1XLO A;  5BYR A;  3AN1 A;  1EU3 A;  1KFY B;  1WGK A;  1I4R A;  2LFI A;  1GAQ B;  2WDQ B;  1JAL A;  1ZUD 2;  3E9S A;  3U52 E;  4OW0 A;  4TQ1 A;  3W9C B;  1ET9 A;  2K0P A;  3RPF C;  1K50 A;  3IT6 B;  1JWU D;  1L5P A;  1PGB A;  1PUT A;  2K5P A;  1Y56 A;  2SEB D;  3Q8A A;  4CQN A;  2WXN A;  4USA A;  2VZK B;  1FO4 A;  2JZP A;  1KLG D;  4YTN B;  1GPX A;  1T5X D;  3W1S A;  1SF0 A;  3AMZ A;  5E6J A;  5BYQ A;  2BS4 B;  1IUE A;  4RFB A;  1SE2 A;  1PYW D;  1ROE A;  1UUP A;  1T3Q A;  4WAF A;  2L32 A;  4MT5 A;  1FEH A;  5HFY A;  2BTE A;  2BS3 B;  4EE2 A;  1QQR A;  3T3N A;  5BMG A;  1L0Y B;  1NI3 A;  1QOF A;  1ZOY B;  2JYT A;  1STE A;  2N9L A;  4C7Y A;  5G5H A;  3P4Q B;  2R61 A;  2HDE A;  4KKI A;  2WXK A;  4RGM A;  1V1P A;  1XLP A;  3BII D;  1YQ4 B;  2ACZ B;  1HA5 A;  3HUI A;  4ZRP A;  4HEA 1;  5EE1 A;  5H8Y E;  1P7E A;  3P63 A;  4YSY B;  1NYR A;  1PGA A;  1QOA A;  1AW7 A;  1IGD A;  3P42 A;  2J42 A;  2LHD A;  3PZ7 A;  3U4E G;  4DXF A;  1BXT A;  2WXO A;  5BMH A;  3FAH A;  3KWL A;  3CWI A;  1D6E C;  1YN5 A;  4XWT A;  2E3T A;  2QEJ C;  3AE7 B;  3LXF A;  4A55 A;  4IDI A;  2JQR B;  5EE0 A;  3W5V B;  4C7Z A;  3Q8C A;  1QF6 A;  2INP E;  1AYF A;  1A70 A;  2BB6 A;  2DYM A;  3AE5 B;  1TJE A;  2W3R A;  3E56 A;  5EE9 A;  3VR8 B;  1L0X B;  3IXS A;  1K51 A;  2DBY A;  1C77 A;  1N63 A;  1E0Z A;  2RMM A;  4PT5 A;  2IGD A;  1UGJ A;  4A90 A;  1PGX A;  3AH7 A;  5D3I B;  4UDU C;  1MPE A;  1F77 A;  1V97 A;  1J7A A;  1WXQ A;  4AS1 A;  4RF1 A;  1F0Z A;  2J4X A;  1OQR A;  4O1N A;  1FNW A;  1I4H A;  1VJK A;  1YNT E;  2DLB A;  4WH4 A;  3ABV B;  1ZPS A;  3TEW A;  2QSD A;  1XXG A;  1FFV A;  2WXI A;  2DWQ A;  4MM3 B;  3V3X A;  2G9H D;  3IAS 1;  2WS3 B;  3J9C A;  3EA6 A;  4B0M A;  3C8Y A;  1HQR D;  5D3D A;  2LHE A;  4L2Y A;  2GI9 A;  4HRS A;  1AN8 A;  1JRO A;  1TKG A;  1TS4 A;  4DQO C;  1E9M A;  3Q69 A;  4YSX B;  2Q5W D;  1L0V B;  1L6U A;  1TS5 A;  3AE3 B;  2N9K A;  3MFG A;  4WWM A;  3KLS X;  2IJ0 A;  2W82 A;  3SEB A;  1EWY C;  2XNA C;  1C79 A;  4KGT A;  1JCK B;  1ZDX A;  3I57 A;  2AQ1 B;  2M19 A;  3PO0 A;  5H92 C;  1JWM D;  2TSS A;  2PTL A;  1ESF A;  1KRH A;  2L52 A;  3AE9 B;  2B76 B;  2YEP B;  1GOZ A;  1WYG A;  1RM6 C;  2PMV A;  1N60 A;  1I4G A;  1QT9 A;  1SB3 C;  1ZDV A;  2QIE B;  2KMM A;  3KWV A;  1UNS A;  1IBX B;  3GS2 A;  2WXF A;  1B1Z A;  1RFK A;  2AQ2 B;  5HI1 A;  1JWB D;  2QIL A;  3B2F A;  4YWG G;  3FC4 A;  1DOI A;  5AUI A;  1MHX A;  1CJE A;  1NYQ A;  3VR9 B;  1FFU A;  4REZ A;  4GDL B;  3BYT B;  2KAJ A;  1E6E B;  4JWS C;  4B0E A;  3T3O A;  1OQQ A;  3MHZ A;  3NVZ A;  3NVW A;  4XDD A;  1I4X A;  3OWE B;  2W55 A;  3BYY B;  4HJG E;  1CK1 A;  3IAM 1;  1MI0 A;  5FK9 C;  3ZQ4 A;  2MJ3 A;  2QJL A;  3BVG A;  2BW2 A;  3BK1 A;  3FIL A;  4FXC A;  2YEP F;  1L4D B;  1TY2 A;  2RPV A;  1FM0 D;  2MJE A;  1JRP A;  2WP9 B;  1TKE A;  1SXT A;  3BVZ A;  4ARI A;  2N7J A;  4A6Q A;  4P6V F;  2HTM E;  2DYO A;  3TSS A;  1P7F A;  1C76 A;  4NZL B;  1QOB A;  1SEB D;  5C2T B;  4R3D A;  3W5U B;  2WXJ A;  1V1O A;  2V3P A;  5G5G A;  4OZB A;  4RF0 A;  1J7B A;  2WXQ A;  1FRD A;  1ZXI A;  1ET6 A;  5BMI A;  2M56 B;  2KN4 A;  2ZW1 A;  3P1M A;  4H2A A;  1LO5 D;  4L23 A;  4N6E B;  1FXI A;  1NEN B;  3GB1 A;  2BS2 B;  1OFF A;  4ITK A;  2WU5 B;  3SFE B;  2PKO A;  1XO3 A;  3Q8F A;  3VRA B;  1D5Z C;  2AX5 A;  3GP7 A;  1ACC A;  1L6V A;  1JML A;  2KWD A;  1JW9 D;  1GB1 A;  1MVK A;  1N5W A;  2FUG 1;  3AV8 A;  3EGR A;  2N0S B;  1Q10 A;  1UWX A;  1GB4 A;  4TQ0 A;  1SSN A;  3P4S B;  3P4P B;  4OVZ A;  1KH0 A;  4KGS A;  2RDH A;  3MP9 A;  3AEF B;  4TMA B;  4WIP A;  1SJH D;  2FE8 A;  3ZJV A;  4TSS A;  4N59 A;  2KAC A;  4OZA A;  1HZ6 A;  1TY0 A;  3V05 A;  2NMQ A;  3NS1 A;  4JE3 B;  1FCL A;  2WU2 B;  4JX1 C;  4RGO S;  2Y5P A;  2AQ3 B;  1WSP A;  2J52 A;  2JX5 A;  1FIQ A;  2K3U A;  4XDC A;  2WXG A;  2V3N A;  3AED B;  3FIL B;  1XCQ L;  4RGT A;  1QKZ A;  3DWG C;  2WXP A;  4KGR A;  2LMC A;  4YXD B;  1JWA D;  2L1A A;  2V0G A;  1C9F A;  4A9A A;  2IGH A;  3TEY A;  5T8I A;  3SR6 A;  1WRI A;  1CZP A;  4LLG M;  2G1E A;  1DOY A;  1VZ6 A;  2IDY A;  4IKG A;  3HVZ A;  4GLS C;  1FXA A;  1QOG A;  2ON8 A;  2ONQ A;  2OHF A;  2IGG A;  4NAM A;  2W54 A;  3SFD B;  2H88 B;  1HEZ E;  1E10 A;  1V1P B;  4JPS A;  1E7P B;  5FR3 A;  1D5X C;  1YJJ A;  1K53 A;  1M4V A;  3NZ3 A;  4YTP B;  3HRD D;  3W2D A;  1TS2 A;  1N62 A;  1C4P A;  3AEC B;  2RDG A;  2BBC A;  2NTT A;  4LTU A;  1QLB B;  1EWC A;  2JU6 X;  3BWU D;  2NTS A;  1JQ4 A;  3AM9 A;  1IGC A;  4IOI E;  2PW9 A;  3NUH B;  1V8C A;  2LUM A;  3AE8 B;  2E6X A;  3AEB B;  3IT4 B;  1I7H A;  4ZHP A;  4HKZ E;  4OZC A;  3U2S C;  5LNK 1;  4HRO A;  4XE0 A;  3HVD A;  5HHD G;  1VR9 A;  1XCT L;  3BVM A;  2D5G A;  2BB5 A;  1UWM A;  2WLB A;  3ZJU A;  2WXH A;  3H8H A;  2JWU A;  4ZHO A;  1C4C A;  1RYJ A;  3R2I A;  3URY A;  4KKJ A;  1SE4 A;  2X38 A;  2CJN A;  1AWD A;  2PLP A;  1FRR A;  1TZO A;  1N61 A;  1F2R I;  1D4B A;  2VZK D;  4ZOH C;  2KQ4 X;  1NEK B;  4YSZ B;  2BT6 A;  2JSV X;  4P16 A;  2MH7 A;  4JWU C;  5I4D A;  1ENF A;  3ZGZ A;  2BYT A;  2WXR A;  3AE2 B;  1QIL A;  2CU3 A;  1XLN A;  3LB8 C;  2KDM A;  3TEX A;  4D2K A;  4LK0 M;  1T6B X;  3L4P A;  1TS3 A;  1SE3 A;  1YQ3 B;  3I9V 1;  1TYG B;  2I38 A;  3CIR B;  1PFD A;  4YT0 B;  2WDV B;  1C78 A;  5BYS A;  1ZXH A;  1VZ8 A;  4L1B A;  4RGN A;  2V4I B;  1FCC C;  3EUB 2;  2QMT A;  3AEG B;  2ZW0 A;  1L4Z B;  1TKY A;  4ZYS A;  3R2T A;  4M0W A;  1IBX A;  3B2G A;  1DGJ A;  4RNA A;  1SJE D;  1KF6 B;  1F2R C;  2JXT A;  1YN3 A;  2ICI A;  1FMA D;  1R7S A;  2FBW B;  2WXM A;  2XN9 C;  5AUK A;  4NAW B;  2M0A A;  3VQI A;  2JYE A;  1HXY D;  1D5M C;  4NJC A;  4Q2J A;  5D7G A;  1WWT A;  1SBB B;  5FKA C;  1EM7 A;  4C80 A;  1BML C;  5TSS A;  5MPO A;  1FNV A;  1ZE3 D;  2OED A;  1CQV A;  1MHH E;  2Y5C A;  3LYY A;  2L83 A;  2GB1 A;  2INN E;  2CJO A;  2W3S A;  2K22 A;  2IPK D;  1VRA B;  2GRI A;  4HKQ A;  4AQ7 A;  2WNM A;  5EE3 A;  1KTK A;  5C3J B;  1B9R A;  3P4R B;  4DXG A;  1SIJ A;  2LEK A;  4US9 A;  4C56 C;  1DYQ A;  3AEE B;  3UI3 A;  1C4A A;  3AE4 B;  2MEK A;  2WQY B;  3TEZ A;  1I4Q A;  4OHJ A;  1N5X A;  2SAK A;  1J7C A;  3MJ5 A;  2MJD A;  1XEE A;  4KX6 B;  1YMH E;  1FD6 A;  1JWS D;  3BK2 A;  1PDX A;  3O13 A;  3KQ4 A;  4WUR A;  4ZRQ A;  1HZ5 A;  3U7Z A;  2H89 B;  2J53 A;  3VRB B;  4MAC A;  3NVV A;  2EEL A;  1RWS A;  3N9Y C;  1BUI C;  3AB5 A;  3RFZ B;  4XWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...