1CJEA

Adrenodoxin from bovine
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
KITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADRENODOXIN
publication title The tertiary structure of full-length bovine adrenodoxin suggests functional dimers.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
total genus 26
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1cjeA00
3AB5A 3LXFA 1JQ4A 1N5XA 2WU2B 1FXIA 4P6VF 1JW9D 2FBWB 1YJIA 2MJEA 2MJDA 4WWMA 1FO4A 4HRSA 3AEEB 2WS3B 2H89B 2N0SB 3NVWA 2W54A 3ZYYX 1FM0D 1E10A 1E7PB 1GAQB 1NYQA 1E0ZA 5G5GA 1RYJA 1F0ZA 2WQYB 3B2GA 2KMMA 1PUTA 4ZOHC 1N61A 1RWSA 3SR6A 1UWMA 1FXAA 2L83A 3AMZA 3P4PB 2MJ3A 1A70A 1YJJA 1VJKA 2M56B 3NVVA 1XO3A 2L52A 3AE9B 3DWGC 1NENB 2K9XA 2H88B 1L5PA 2K5PA 2PVOD 3AE6B 3AEGB 3B2FA 2QIEB 1KFYB 1V8CA 2WLBA 2PKOA 2DBYA 3AE8B 1FRDA 1XLQA 1EWYC 2CU3A 1ROEA 3RPFC 1DOIA 1PDXA 1JALA 3FC4A 3NVZA 3P1MA 1JWBD 3SFEB 2Y5CA 4YSXB 1R7SA 1OQQA 2W55A 3P4RB 4YT0B 3ETRA 3WCQA 1GPXA 5G5HA 1OFFA 1WRIA 1RFKA 3AEBB 1QF6A 4JX1C 4YTPB 3AEFB 3B9JA 1CJEA 1XLOA 1WXQA 1XLNA 3AEDB 4IDIA 4N6EB 5AUIA 5C2TB 3VR9B 1DOXA 1JRPA 1VLBA 4N59A 3AH7A 4USAA 1L6UA 4YSYB 2BS2B 2WP9B 4ZHOA 2QJLA 4LTUA 2JX5A 2BS4B 4JWSC 1FFVA 1QT9A 1WWTA 3LB8C 1L0VB 1PFDA 3P63A 1VDVA 3W9CB 1ZUD2 1TYGB 2BS3B 1TKEA 4US8A 4N58A 3KWLA 2EKIA 3AEAB 4ZHPA 5C3JB 2E3TA 2K22A 3ABVB 1T3QA 1NVID 1DOYA 2OHFA 3VRAB 1AYFA 1N60A 1WYGA 2M19A 2WDQB 4FXCA 5EE1A 3DWMA 1J7AA 1V97A 1SF0A 2W3RA 3AE5B 3P4SB 3NS1A 2PIAA 3AE2B 1N5WA 3PO0A 1FMAD 4YXDB 3AECB 1E6EB 2DWQA 3EUB2 3NVYA 3W5VB 2CJNA 1QOBA 2JQRB 1FFUA 1FRRA 4HROA 4US9A 3AM9A 1FIQA 1QOAA 1ZXIA 3BIID 1I7HA 3HRDD 3SFDB 2PVGC 5EE9A 2MH7A 2CJOA 1QLBB 1OQRA 3AE7B 1YQ4B 2WDRB 2AX5A 1J7CA 2WU5B 1JWAD 1SB3C 3HUIA 5H92C 1NYRA 3AE4B 3L4PA 5EE0A 1E9MA 3VR8B 1N63A 4C7YA 1RM6C 5GXGB 1TKYA 2BT6A 4C80A 4YSZB 2LEKA 1JROA 4KX6B 3AE3B 5EE3A 4A9AA 2G1EA 3CWIA 1IUEA 2KAJA 3FAHA 1TJEA 1ZOYB 1TKGA 1XLPA 2Q5WD 4C7ZA 3P4QB 1CZPA 2ACZB 4YTMB 1L6VA 2B76B 1YQ3B 3NRZA 5MPOA 1KRHA 4JWUC 3AE1B 4WQMA 1NI3A 5H8YE 1DGJA 3HVZA 1SIJA 1B9RA 1QOGA 3W5UB 3AN1A 3CIRB 1ZP0B 1NEKB 4YTNB 3VRBB 3AV8A 2W3SA 2WDVB 1N62A 1WGKA 5AUKA 1KF6B 2HTME 1J7BA 1QOFA 4ITKA 1AWDA
chains in the Genus database with same CATH superfamily
3KWVA 4RM8A 1HA5A 2HDEA 1GC6A 1R4NI 2IO1B 2C5LC 5CHVC 3Q3FA 2CHXA 1STEA 2MJ3A 2K6QA 4M8NA 1VRAB 1YJJA 1XO3A 2NTSA 3CSFA 1D5XC 2QIEB 1XLQA 1EWYC 1P9DU 2CU3A 3B08A 3QAQA 4NZLB 2D5GA 2JRIB 1IPGA 1YN3A 2I1KA 4NNJB 5CHFA 2A5UA 5IO9A 4ZHOA 2QJLA 3NJTA 3FILB 1ZUD2 4KZ0A 4HK2A 3C0RB 3KVFB 5HG2A 5C3JB 3KYDD 4K3BA 2NS5A 1YX6B 1T3QA 3Q14C 3KUCB 4EUTA 3DBLI 2N1WA 1KLUD 3AI5A 1WJ6A 3M63B 3PZ8A 5BYRA 2KO3A 2DZJA 4WWPA 2ON8A 1H8CA 5CHWA 1QOAA 3JVZX 4RGOS 2ICIA 4P7IA 4LNFA 2N9LA 2G45B 3UGBB 3VTVA 2HJ8A 2AEHA 2AL3A 3GE8C 2JVCA 1OGWA 3LJ3A 4KGSA 2NR2A 2LXCA 2KVZA 4KDLB 2LMCA 1V1PA 1C1YB 1YD8U 1PQSA 2AQ1B 4W9JA 4RGTA 2LD9A 3H8HA 1J7BA 4ITKA 3WA0A 1K52A 3PSEB 4MJSB 1E10A 5G5GA 3A9KA 4LNKA 3MHZA 3TIXA 3V05A 4FJZA 2L52A 3Q69A 4A55A 1HTOA 3EC8A 3GZNB 2A4ZA 2IO3B 2KZRA 2XEWA 3SFEB 2IY1B 1VZ6A 4GOCA 1L4DB 4NAWB 1VCBA 2XBBC 4GMVA 4IM0A 5HKHA 2PE6B 5IA7A 3KH0A 3IXSA 4W9LA 2OJWA 4HCPB 4MGZE 1FFVA 3QWZB 1QZEA 2Z8LA 1D5ZC 2CHZA 2NMQA 4DBGA 2QHOA 2JZZA 3NS8A 4PYZA 2JRHA 4RFBA 3SD5A 1G6JA 4B0EA 2JPHA 2HJ1A 1C76A 2LGIA 3P4SB 4MGYE 2KDBA 2RPQA 4TKNA 5J17A 2WXIA 2YEPB 3BINA 4A6QA 2DX5B 3VFKA 2PVGC 4TMAB 5EE9A 3RNBC 1ISNA 2KHWB 2RDHA 1NYRA 3U2SC 4FHKA 4C80A 3CF6E 2MSED 1K8RB 3TEXA 4ZRIA 2GI9A 3APFA 3A9JB 4I6PA 5BMGA 2XK5B 2BQQA 2R2QA 4ARIA 4GSWA 3GB1A 2L32A 2KQSA 1WX8A 3AV8A 2KDEB 1YOVB 2ZNVC 2MLBA 2JF5A 1F0ZA 2OEDA 1I4PA 2MA9B 2D10A 1P7EA 4EFOA 4S0RA 2IGDA 2KLCA 1S1QB 1E5WA 2WXJA 1TT5B 3TUOA 1JWBD 3OG5A 2W55A 1A5RA 3FKYA 1WM2A 2DYMA 3AEDB 2W9NA 3HIZA 3N3KB 3DVNU 3H1UA 2BKRB 3U52E 1FXTB 2ZZPB 4AQ7A 3LB8C 3RYTA 2UYZB 3AU4A 2KWUB 3WAOA 3R3MA 3KLSX 2K22A 2RD0A 2V4IB 3IT6B 4LNIA 1YN4A 3VRAB 1AYFA 1V2YA 3DWMA 2WXPA 2CHWA 2LGXA 4HJGE 3MC8A 2JZ3B 3L13A 2LVPA 2JQRB 2V3PA 1WE6A 2CJOA 2GRIA 4XYCA 5BO4B 2K25A 3QIJA 1JWAD 5DCNA 3AE4B 2PJHA 1TY0A 2WXHA 3MP9A 2D3CA 2M0AA 3VH4B 4FLHA 4K81A 3CWIA 1SGHA 1T0YA 4OVVA 2G4DB 1BT0A 3NRZA 5MPOA 2VRRB 1R4NB 1NI3A 4AJWA 5FKAC 1B9RA 3AN1A 3N1ZC 3CIRB 2ZW1A 3MC9A 1QOFA 2FBWB 2WS3B 2IO0B 3ZYYX 2BWFA 4WJNA 3U7DA 3UQBA 1BMLC 1J8CA 1L4ZB 2Y3AA 3SR6A 3ZDMC 2LVOA 4BKTA 3AE9B 4RM9A 4UDUC 2MHJA 4K1RB 1V49A 1XD3B 3J9CA 3APDA 1JALA 3C19A 2LJ5A 3AEBB 1WY8A 1U4AA 3AEFB 1XLOA 4RH6A 2CS4A 3ZGZA 4USAA 1L6UA 1QILA 3DBLB 2Z0EB 3DBSA 1WYWB 1JMLA 2CU1A 3W1SA 3KUDB 2BS3B 4OW0A 4B95A 1HXYD 1HZ6A 3VUYA 5TSSA 1SJHD 3NZSA 3Q8EA 5D3DA 2X38A 2LGYA 3QK0A 2KD0A 3MC0B 1WXMA 2WDTB 2HTHA 2INDC 1BUIC 4BVUC 1TTNA 2K0PA 5EE0A 2L76A 5HI1A 3VR8B 3DBRI 4TQ1A 2KN5A 3IFWB 1WX7A 3S2AA 3URYA 2G1EA 3WIMA 2O6VA 1KOTA 2GBRA 3A1QB 2IZVB 1KJTA 1RFAA 4DHZB 1WXVA 1E90A 2V4LA 1R4MI 3UQAA 1DGJA 2JXXA 1GB1A 3LDZE 1N62A 4CHKA 4XGAB 4DXGA 3K9OB 2HTME 2WNMA 2LVQA 3RNFC 2BB5A 1FO4A 3MTNB 2N0SB 3NUHB 3Q2AC 2LGDA 2WQYB 4YWGG 1N61A 4P1BC 3VUXA 2NBWB 1FXAA 4AWJA 2L7RA 3U4EG 4E3CA 3OJ4B 1XCQL 1J19A 2LHEA 2BF8B 1UELA 4W9KA 1ROEA 3RPFC 1WGRA 2WX1A 3U8ZA 2Y5CA 4HDOA 4YT0B 4KGRA 3ETRA 1OFFA 3HHMA 4YTPB 1XT9B 3W2DA 2L0FA 3TJPA 3PV1A 4JE3B 4EKUA 2BVCA 2AQ3B 5JXVA 1WI0A 5AZHA 2KTRA 5HHDG 2MBQA 2M8SA 1Q0WB 4WAFA 2W3RA 3GOEA 1CMXB 2KN4A 3QA8A 1QOBA 1FRRA 4KIKA 4GIVA 4DHZE 3RZWC 3NOBA 3N1YC 1V81A 2NBVB 1WF9A 4AUQC 4DHJB 3APCA 3NG0A 4ZYNA 2NBUA 2BT6A 4EZKA 1C4PA 2LEKA 4W9IA 1I35A 1TJEA 3W1SC 1J0GA 5LLIA 1L6VA 3RMKC 4G50A 4JWUC 3NHEB 1VZ8A 5H8YE 3W5UB 1KF6B 3PRPB 2ASQA 3QHTA 3R7RA 4MSQB 1ACCA 4P1CC 2KDMA 1WGGA 1XXGA 2WGSA 4C4VB 4NJ6A 2WHIA 4CYEA 3D32A 3T3NA 3ZLZA 4GDLA 1WFYA 2M56B 2KNBA 3PGEA 4TQ0A 3QCAA 2IDYA 4IM3A 4EE2A 1I4QA 2HD5B 2N9XA 3ZNHB 3U30A 1LQBA 1WE7A 4JX1C 3FILA 4KKIA 1E8WA 1N6ZA 1KLGD 1JRPA 1YMHE 2D2QA 3RN9C 3SU8X 4L23A 5KHQA 1EM7A 3N30A 4WAAA 4KSLC 2JX5A 2ZJDA 5L95C 4LCDE 2N9PC 1IP9A 3LYYA 3PRMB 2VZKB 3ZUNA 3VVWB 2WXOA 1N60A 4WWNA 1ZXHA 1I4XA 3Q3MC 1P1AA 2JZPA 5FR6A 2DENB 1ENFA 1GOZA 1E6EB 2LGSA 3TMPB 5AEKB 3SFDB 3UIPB 2Y5BB 1M94A 3L4PA 1GB4A 2JYTA 1YNTE 2VZKD 3AE3B 4OZCA 3PREA 2KWDA 1UF0A 2IO2B 2XNAC 2J0KA 2GBMA 4KVGB 4MDKE 4EEWA 1GG3A 4XC2A 3H7PB 4KSKC 1SXTA 3HVZA 2K3UA 2J7QB 4MJSA 4YTNB 2KC2A 5AUKA 1WH3A 3ZRCA 3LXFA 2WU2B 4RGNA 1Q1OA 2N1VA 3NVWA 4W9HA 4GB9A 1E0ZA 2ZW0A 1RYJA 3IG3A 2KTFA 2LJIA 4IWPA 4W9GA 2KVRA 5AZFA 3NVVA 2BBCA 1S3SG 2H88B 2PVOD 1TIFA 1UUPA 3UINB 4QAYA 3Q8AA 2UWQA 1GPXA 1BXTA 4N6EB 1MPEA 3VUWA 5J2RA 1V5TA 2KFKA 2KMAA 2WP9B 1WWTA 2N7EA 3ZTCA 2QILA 2LRWA 3CMMB 3W9CB 2QCZA 2Z0DB 1H4RA 2AWTA 3KWLA 2EKIA 4FN2A 1VZ7A 3R2TA 3BVGA 1ZGUB 4JQWC 2DYBA 4B6WA 1WYGA 1WMHB 2EMTA 1UBQA 1WJ4A 2PMVA 3TSSA 3NS1A 4ANUA 1EUVB 2C7MB 1HE8A 3PO0A 4BFRA 4MGKE 3DBRB 1V6EA 2KX3A 2OOBB 4DDID 4HROA 2BW2A 1ZXIA 3BIID 1I7HA 2MCNB 2D3GA 2D11A 2V1YA 3A9JA 3AE7B 1L0XB 5E6OA 1R4MB 2XK5A 1RM6C 1TKYA 3BYYB 3L54A 2JWZA 2JUOA 2KAJA 4HXDA 1XLPA 3ECIA 4BOSC 3X23A 4JIOU 5BYQA 4EOYA 3HM3A 4IW0A 3N9YC 1QOGA 1CQVA 4JLCA 2NTTA 3ML9A 2KJHB 4HPLB 1JW9D 1YJIA 2MJDA 3IBEA 3OAWA 3Q3NC 1Q5WB 2MBOA 1KH0A 2N9KA 1UH6A 2BWES 4DXFA 2QDFA 3UI3A 2EELA 3V61A 3QARA 1TY2A 3M95A 5J18A 3AE6B 2KOXA 4K7WA 3I63C 5JH5C 1FRDA 3RNGC 1I4RA 2GBJA 5LXIB 3AXCA 4REZA 4LNNA 3R2IA 3TEWA 1MFWA 5AUIA 1IBXB 1VLBA 1WJUA 1FNUA 2DHZA 2QSDA 3RD2A 3Q8CA 2WXMA 4A90A 1F2RC 2EKEC 3A4SC 4LJPB 2JU6X 2V0GA 4FXCA 3L08A 1K51A 2BYTA 2R61A 4HVBA 2KANA 4M0WA 3EFCA 3VTUA 1TGZB 2V9HA 3TCAA 2J0JA 2K8CA 5D3IB 1ZDXA 2ZVOA 2LWPA 2WDRB 3IHPC 3NZ3A 4HCNB 3BZDB 3L10B 5EE3A 1P0RA 3U7ZA 3OJ3A 1RRBA 4CO7A 1C4AA 1IGCA 1SIJA 2BYVE 3ZKJC 1WGKA 3VXWA 5JHBA 2L1AA 1YX5B 1Z5SB 2MRPA 2D3AA 5E6JA 2FIFA 1D4BA 5DPRA 3ALBA 2H89B 5GMVA 4ANVA 1MVKA 1LFDA 2M17A 2BGFA 3R8BA 4F7ZA 1T0RC 2L83A 4B0MA 3EA6A 3NZUA 1K50A 2KDIA 2KFJA 2K9XA 2SAKA 5D6JB 3B2FA 3ZNGC 1L0YB 1SBBB 2NVUI 2WLBA 4BKSA 4ARCA 4BBNC 2GOWA 3PLUA 3PZ7A 3P1MA 4YSXB 1YJ1A 1WRIA 1WXQA 2KT7A 3ZQ4A 3MJ5A 1DOXA 4TSSA 4Q2JA 4RF1A 1T5XD 4US8A 1P7FA 1SE2A 2OHFA 3RFZB 3ZJTA 3NY5A 2KYWA 3GE3C 4IUMB 4I6LB 1UNSA 2WXKA 2JSVX 4US9A 3V3XA 3ZDTA 2CKHB 3N32A 4ZRPA 1ET9A 4MH0E 2L05A 2WXGA 3PHWB 4HPMB 4AP4C 1SB3C 3DVGX 3V6EB 3A1QA 1UGMA 1C79A 4A9AA 2KWVB 4JPSA 1Y56A 3Q3OC 2WYQA 1D6EC 4C7ZA 2C60A 3DHIC 4XE0A 2KLGA 1MG4A 2BYEA 2W3SA 2KKCA 3JYUA 4P6VF 1V1OA 3JSVB 4HRSA 1AARA 1MI0A 2W54A 2GBNA 1AW7A 1E7PB 1GAQB 1D5MC 1EF1A 2PPHA 3GZNI 3B2GA 4GDKB 2M1MA 3ZXVA 4K7UA 2TSSA 1GNUA 2MQJA 1FPYA 3H7SA 2J0MA 5BYSA 1P98A 3L0WB 3TEYA 2PKOA 2RR9A 4OHJA 3FC4A 3ZXRA 4D2KA 3I9V1 3B9JA 5HFYA 3PS6A 4FA6A 1FCCC 2J52A 3AH7A 1NI2A 4P16A 2D3BA 3RNAC 1ZDVA 1E8ZA 4LK0M 1HQRD 1ZKHA 2PTLA 2FCQA 3DBHI 2BYFA 2O2VB 1Y8RC 3ABVB 3RNCC 3CSTA 2M19A 1SF0A 3AE5B 2LRUA 3VQIA 1NBFC 4YXDB 3NVYA 3W5VB 2CJNA 2O6VB 2MP2B 1FIQA 1SIFA 2K39A 3IT4B 3DOWA 3UF8A 3WALA 2WXQA 4XX5A 3H9DA 1P3QU 3MJWA 1E7VA 4IM2A 3BVMA 5DPWA 5H92C 1TZOA 1MHHE 3WAMA 4C7YA 3KQ4A 2DNFA 1C77A 4XWTA 3ONSA 2EMSA 3T8MA 3DHHC 4DK5A 2E6XA 1TKGA 2JYEA 2RDBC 1CZPA 2ACZB 3P4QB 2PW9A 4S17A 5L83A 3AE1B 1KTKA 2M0XA 2JXTA 3VRBB 4C4VA 2O6VD 1SSNA 2R2OA 4FJVB 3OLMD 3WANA 4ANXA 1WR1A 1T0SC 1NDDA 1JQ4A 1KLVA 3AEEB 4LDTD 4GLSC 1JWUD 4KV2A 1NYQA 4NAMA 2IYDB 2FCSA 1GC7A 2INNE 3ZVVA 2AYOB 4IOIE 1I4HA 3R66C 5TR5A 1VJKA 2ONQA 4MM3B 4MSMB 5DPTA 3SDLC 1NENB 4WWOA 3QQ8B 4HPPA 1TS2A 1F77A 4GXBA 2NPTB 4A20A 1L2NA 2KTRB 4PK1A 2G9HD 5C2TB 4PS8A 1CK1A 2DAJA 1PGAA 1WIAA 4II2B 3V62A 1T6BX 1UWXA 1C4CA 2JY6A 5LXHA 4G0NB 3RT3B 3BK2A 2KJRA 2KQ4X 1EU3A 1B1ZA 1WXAA 4DXAB 4C56C 1ZPSA 1V86A 2IJ0A 3N20C 3Q6BA 2PIAA 3AE2B 1N5WA 2ZCBA 3WAPA 3DVGY 3ZNZB 2MEKA 1DYQA 3AM9A 4TV3A 1MHXA 4RF0A 1IYFA 2RPVA 2WU5B 2KDFB 1V80A 2K8BA 3H7PA 4LNOA 1AN8A 1PYWD 3QX1A 5JHAA 4N9F4 5I4DA 2XN9C 4YTMB 1FNVA 4W9FA 2K8HA 3I5JC 3C8YA 2Z59B 3HVDA 4GDLB 5E6PA 3V6CB 1PGXA 4E74A 4EZJA 3AULA 4IKGA 3TL5A 4MGIE 2MJEA 4WJPA 1EU4A 1D3ZA 1ET6A 2Y5PA 4WQOB 4KGTA 2MBEA 3R7QA 2GLSA 3PTFC 3AMZA 3DVNV 1WJNA 2V3NA 2G3QB 3ZW3A 2OJRA 1L5PA 3PT2B 5DPSA 3P42A 2ZCCA 1V8CA 2N9EB 2DBYA 2MBBB 3BVZA 3QJZA 1LM8B 3NVZA 2GMIC 2SEBD 3P4RB 1WSPA 4RMAA 4ASWC 4KZCA 2I2YA 4WIPA 3SHQA 2JT4B 3PZDA 3RCZA 4PS3A 1RAXA 2BS2B 1YQBA 4ZRKA 1XF5L 2L00B 1PFDA 5CTRC 3ZJVA 1TKEA 1WMHA 3AEAB 2FCNA 4NAWA 2DZIA 4G3XB 1WXSA 4ACFA 2L8JA 2WXFA 1SEBD 3EFUA 4NQKE 1ESFA 4DQOC 4KDIC 2WWZA 2ZNVB 1WGHA 1JCKB 3DDCB 4IWOA 3VHTC 2KX0A 4W9EA 1WGDA 2LI5A 2BTEA 4XDCA 5JZEB 2N4FA 3B0AA 3DCGA 2AX5A 5G2NA 1N63A 5IOIA 3QC8B 4KX6B 4ANWA 1XQQA 4L2YA 2NCNA 2ZPNA 3GS2A 2Q5WD 1YQ3B 1KRHA 3HK0A 4WQMA 4XWWA 2LXAA 2J53A 1ZP0B 3IVFA 4DDGD 4OVUA 1FEHA 2RSUA 3ML8A 2FIDA 4BAXA 3AB5A 1V1PB 4ZYSA 3IAS1 1FXIA 5FR3A 2I38A 2YLMA 2ZPYA 4GN1A 3PRZA 2KMMA 1C9FA 4ZOHC 4AJYB 2C7HA 2W82A 3ZJUA 3W1YA 3DWGC 4MT5A 4BKGA 3ZRFA 2KFKB 1L7YA 3A9KB 1F9JA 4II3B 1QQRA 3V60A 4MEMA 1IBXA 4B9KA 1DOIA 2FCMA 1OQQA 4URKA 5EDSA 3DPDA 4XDDA 3DBHB 2UU7A 4IDIA 3RZFA 3UIOB 3B1LX 3TBLD 2PE9A 3O13A 3K9PB 2QC8A 4ZDVA 1WR6E 1TYGB 1JWSD 1OQYA 4HJKA 4XZ4A 2C9WB 4BOZB 4ZHPA 1K53A 2D07B 3N1XC 5EE1A 3OWEB 1J7AA 1V97A 1SJED 2GBKA 2FNJB 1FMAD 2WXNA 5IAAC 2KC1A 2KQ7A 1YQ4B 3VAWA 1WRDB 2YEPF 2WXRA 3H6NA 2CR5A 2BB6A 4WH4A 2REXA 2KJ6A 2RGFA 1TS4A 3DHGC 1GJZA 2C7NB 4M00A 4OZAA 1LGRA 3RUIB 3BY4B 4BBNF 1LO5D 3BYTB 2WDVB 4IC7B 1XEEA 3VH3B 2IPKD 4WWMA 2ZVNA 3ENEA 1WZ0A 1FM0D 4KKJA 2INPE 5D2MB 3L17A 2DZKA 1WM3A 2G4SA 4BZAA 1HZ5A 4GU2A 2KMCA 1WGYA 1VD2A 3AE8B 4F8CB 2IBIB 1UD7A 3KYCD 1RLFA 4WURA 2LFIA 4K7SA 5IN7A 3DQVA 4AS1A 3EECA 4A3PA 2YVCA 2K1FA 3A4RA 3VTWA 5BMIA 1Z2MA 4FULA 4M0WB 4HWIB 4JWSC 4HKQA 3I3TB 2JWUA 5LNK1 1F52A 1T0QC 3RULA 2KWCA 5AZGA 2E3TA 2WX0A 4J6IA 2M4NA 4G11A 2X8XX 1ZE3D 3M62B 4GGQA 2DWQA 4I6NB 2IY0B 1V5OA 1GUAB 4FHJA 3PPAA 5E6NA 2MH7A 4OVZA 1QLBB 4DWFA 1E8XA 1IGDA 3I57A 3T9LA 1ZW7A 3VDZA 4A8XC 1OEYA 3P2BA 2V3SA 2IGGA 1IUEA 1ZOYB 1C78A 4M02A 3IAM1 2N7JA 2QMTA 2KACA 4NQLB 1I4GA 3JSVA 1WX9A 1SE3A 4A3OA 3P63A 1VR9A 4GDKA 1N5XA 2FAZA 3PVLA 5D94A 1SE4A 4NJ7A 2VH2A 4E71A 1MJDA 2LUEA 4ICVA 2I1JA 3Q8FA 1RWSA 1UWMA 4W9DA 4YL8A 4AOFA 3E9SA 1TS3A 1SE9A 2K5PA 3AEGB 3HM6X 1KFYB 1UGJA 2QEJC 3O65B 1F2RI 2L0TA 4FADA 1F1HA 1R7SA 5C23A 2J42A 1QF6A 1RFKA 1CJEA 1XLNA 3VR9B 2FUG1 4W9CA 1JWMD 4BKSD 1FD6A 2GB1A 4YSYB 4OZBA 1UBIA 5D7GA 2O2VA 1OEYJ 1TS5A 4N58A 2LASA 4C00A 2WDQB 2ZEQA 2J4XA 2MP2A 2LZ6A 1HEZE 2AQ2B 5CX3A 2K6DB 4ICUA 3T3OA 3EUB2 4EZLA 3JW0X 4HDQA 1FFUA 3GP7A 1OQRA 4X57B 3BK1A 1FNWA 5T8IA 1E9MA 4HLEA 4JGHB 5GXGB 3TEZA 4MH8A 2MW5A 2WXLA 4WJOA 2HE7A 3M3JA 4IWQA 3PHXB 2B76B 5IKCM 2MWSB 1C3TA 1UZXB 2INCC 2VH1A 4RCOA 1E7UA 1MG8A 1Q10A 1NEKB 3E56A 4NY0A 4PT5A 1M4VA 1LXDA 4RNAA 3Q8BA 1EWCA 4IG7B 1YN5A 4RGMA 4LDTB 1X1MA 2KXJA 4MM3A 2FE8A 1PUTA 2FUHB 3P4PB 1A70A 4JL9A 2BPSA 5IP4D 3ZTDA 3EGRA 2B3AA 4PS7A 3ZIMA 5FK9C 2NPTA 3PLVA 1KM7A 5G55A 3ZO5B 5BMHA 2RDGA 2LHDA 4M01A 1PDXA 3RNEC 2PLPA 2MBHA 1E8YA 3WCQA 2DYOA 5G5HA 1QKZA 4O1NA 1PGBA 3L16A 2RMMA 4N59A 4TUUA 1TBEA 3Q3JA 4HEA1 4MELA 2BKFA 4LTUA 2BS4B 1QT9A 3BWUD 1L0VB 1TZ1A 1VDVA 1JRUA 3MHSD 4J3OD 2AL6A 4F1SA 4PYUA 1NVID 1DOYA 1I42A 4L1BA 4FBJB 5C1ZA 2LUMA 1XCTL 2IGHA 4WJQA 2KK8A 1EO6A 3AECB 4MACA 3KW5B 3KUZA 1FCLA 4CQNA 3HRDD 2MX2A 3AU5A 3ZNID 4HKZE 1J7CA 4KIKB 4NJCA 2DZMA 3HUIA 4NPNA 4K3CA 4YSZB 2PEAA 1YIWA 3X0WA 4M8MA 5KHOA 1JROA 4DHJD 4LJOB 3FAHA 1WZ3A 1HTQA 4R3DA 1V9JA 4FJYA 3SEBA 3EHVA 3RI7C 2N7DA 3A33B 4ZRQA 4H2AA 1OTRB 3MFGA 4ZRJA 2DAFA 2L3ZA 4LLGM 2DLBA 1EF5A 1AWDA
chains in the Genus database with same CATH topology
3KWVA 3AB5A 1V1PB 2L1AA 4ZYSA 2BB5A 1FXIA 3IAS1 5E6JA 1FO4A 1D4BA 1HA5A 2H89B 2N0SB 5FR3A 2I38A 2HDEA 1MVKA 3NUHB 3R8BA 2WQYB 2KMMA 1C9FA 4ZOHC 1N61A 4YWGG 2W82A 1FXAA 2L83A 3ZJUA 1STEA 2MJ3A 4B0MA 1VRAB 1YJJA 3EA6A 1XO3A 2NTSA 1K50A 3U4EG 3DWGC 4MT5A 2K9XA 2SAKA 1XCQL 1D5XC 2LHEA 1QQRA 3B2FA 2QIEB 1L0YB 1SBBB 4ARCA 2WLBA 1XLQA 1EWYC 2CU3A 3PZ7A 1ROEA 3RPFC 1IBXA 1DOIA 3P1MA 2Y5CA 4YSXB 4NZLB 1OQQA 4KGRA 2D5GA 4YT0B 3ETRA 4XDDA 1OFFA 1WRIA 4YTPB 1YN3A 1WXQA 4IDIA 3ZQ4A 3MJ5A 1DOXA 3W2DA 3O13A 4TSSA 4JE3B 4ZHOA 2QJLA 4Q2JA 4RF1A 3FILB 1T5XD 1ZUD2 1TYGB 2AQ3B 1JWSD 4US8A 5JXVA 4ZHPA 5HG2A 5C3JB 1P7FA 5HHDG 1SE2A 1T3QA 1K53A 2OHFA 3RFZB 3ZJTA 5EE1A 1KLUD 3OWEB 1J7AA 4WAFA 1V97A 2W3RA 3PZ8A 1SJED 5BYRA 1FMAD 2WXNA 1UNSA 2KN4A 2WXKA 1QOBA 2JSVX 1FRRA 4US9A 2ON8A 3V3XA 1QOAA 4ZRPA 1ET9A 4RGOS 2ICIA 1YQ4B 2WXGA 2YEPF 2N9LA 1SB3C 2WXRA 1C79A 2BT6A 2BB6A 4WH4A 1C4PA 2LEKA 4A9AA 4JPSA 1Y56A 1TJEA 1D6EC 4C7ZA 4KGSA 1TS4A 1L6VA 4XE0A 4OZAA 2LMCA 1V1PA 4JWUC 5H8YE 1VZ8A 3W5UB 2AQ1B 1LO5D 3BYTB 2W3SA 2WDVB 4RGTA 1KF6B 3H8HA 1XEEA 1J7BA 4ITKA 1ACCA 1K52A 4P6VF 2IPKD 2KDMA 4WWMA 1V1OA 4HRSA 1XXGA 1MI0A 2W54A 1FM0D 1E10A 1AW7A 1E7PB 1GAQB 4KKJA 5G5GA 1D5MC 2INPE 4GDKB 3B2GA 3T3NA 2TSSA 3MHZA 3V05A 2M56B 2L52A 3Q69A 5BYSA 4A55A 1HZ5A 4TQ0A 3TEYA 2IDYA 2PKOA 3AE8B 4EE2A 1I4QA 4OHJA 3FC4A 3SFEB 4D2KA 1VZ6A 1L4DB 3I9V1 4WURA 2LFIA 4NAWB 4JX1C 3B9JA 5HFYA 3FILA 4KKIA 4AS1A 1KLGD 1FCCC 1JRPA 1YMHE 2J52A 3AH7A 4L23A 5BMIA 4P16A 1EM7A 3IXSA 1ZDVA 2JX5A 4JWSC 1FFVA 4LK0M 4HKQA 2JWUA 5LNK1 1HQRD 2Z8LA 2PTLA 1D5ZC 2NMQA 3LYYA 2E3TA 3ABVB 2VZKB 2WXOA 4RFBA 1N60A 2M19A 4B0EA 1ZXHA 1I4XA 1SF0A 3AE5B 1C76A 2LGIA 3P4SB 2JZPA 1ZE3D 3VQIA 1ENFA 1GOZA 4YXDB 1E6EB 2DWQA 3NVYA 3W5VB 2CJNA 2WXIA 2YEPB 4A6QA 1FIQA 3IT4B 3SFDB 2PVGC 4TMAB 5EE9A 2MH7A 4OVZA 1QLBB 2WXQA 3BVMA 1IGDA 3I57A 2RDHA 5H92C 1NYRA 1MHHE 1TZOA 3L4PA 3U2SC 4C7YA 3KQ4A 4C80A 3TEXA 1GB4A 1C77A 2JYTA 1YNTE 2GI9A 5BMGA 2VZKD 4A8XC 3AE3B 4OZCA 4XWTA 2IGGA 2KWDA 1IUEA 2XNAC 1ZOYB 2E6XA 1TKGA 1C78A 4ARIA 3IAM1 2JYEA 3GB1A 3P4QB 1CZPA 2ACZB 2N7JA 2L32A 2PW9A 2QMTA 3AE1B 2KACA 1SXTA 3HVZA 1KTKA 2K3UA 1I4GA 2JXTA 3VRBB 4YTNB 3AV8A 1SSNA 1SE3A 5AUKA 3P63A 3LXFA 1VR9A 1JQ4A 1N5XA 2WU2B 4RGNA 3AEEB 1SE4A 3NVWA 4NAMA 4GLSC 1JWUD 1NYQA 3Q8FA 1E0ZA 2ZW0A 1RYJA 1F0ZA 1RWSA 2INNE 1UWMA 4IOIE 2LJIA 1I4HA 2OEDA 1VJKA 1I4PA 2ONQA 3NVVA 2BBCA 3E9SA 4MM3B 1NENB 1TS3A 1P7EA 2H88B 2K5PA 2PVOD 3AEGB 2IGDA 1KFYB 1UGJA 2QEJC 1UUPA 1F2RI 2WXJA 1TS2A 3Q8AA 1F77A 3TUOA 1JWBD 1R7SA 2W55A 1GPXA 2J42A 1BXTA 1QF6A 1RFKA 2G9HD 4N6EB 1CJEA 1MPEA 1XLNA 2DYMA 3AEDB 5C2TB 3VR9B 2FUG1 1JWMD 1CK1A 1FD6A 1PGAA 2GB1A 4YSYB 4OZBA 5D7GA 3U52E 2WP9B 4AQ7A 1T6BX 1WWTA 3LB8C 2QILA 1UWXA 1C4CA 1TS5A 3W9CB 4N58A 3KWLA 2EKIA 3BK2A 1VZ7A 3KLSX 3R2TA 2KQ4X 1EU3A 2K22A 3BVGA 1B1ZA 2V4IB 3IT6B 1YN4A 3VRAB 1AYFA 1WYGA 2WDQB 4C56C 1ZPSA 2WXPA 3DWMA 2IJ0A 2PMVA 2J4XA 4HJGE 3TSSA 3NS1A 1HEZE 2AQ2B 2PIAA 3AE2B 1N5WA 3PO0A 3T3OA 3EUB2 2JQRB 1FFUA 2MEKA 1DYQA 4HROA 3AM9A 2BW2A 1ZXIA 2V3PA 3BIID 1I7HA 3GP7A 1MHXA 2GRIA 2CJOA 1OQRA 3AE7B 1L0XB 4RF0A 3BK1A 1FNWA 2RPVA 1JWAD 2WU5B 5T8IA 3AE4B 1E9MA 1TY0A 2WXHA 3MP9A 2M0AA 1RM6C 5GXGB 1TKYA 3BYYB 3TEZA 1AN8A 1PYWD 4MH8A 3CWIA 2KAJA 2WXLA 1XLPA 5I4DA 2XN9C 4YTMB 1FNVA 5BYQA 2B76B 3NRZA 5MPOA 3N9YC 1NI3A 3C8YA 5FKAC 4RCOA 1QOGA 1B9RA 1CQVA 3CIRB 3AN1A 2NTTA 1Q10A 3HVDA 1NEKB 2ZW1A 4GDLB 3E56A 4PT5A 1PGXA 1QOFA 1M4VA 4RNAA 4IKGA 3Q8BA 1EWCA 1YN5A 1JW9D 2FBWB 1YJIA 1EU4A 2MJEA 2MJDA 4RGMA 2WS3B 1ET6A 2Y5PA 3ZYYX 4KGTA 1KH0A 2FE8A 2N9KA 1BMLC 1L4ZB 2Y3AA 4DXFA 1PUTA 3SR6A 3UI3A 3AMZA 3P4PB 2EELA 1A70A 2V3NA 3EGRA 3AE9B 1TY2A 5FK9C 4UDUC 1L5PA 3AE6B 3P42A 1V8CA 5BMHA 2DBYA 1FRDA 1I4RA 2LHDA 2RDGA 3BVZA 3J9CA 1PDXA 3NVZA 1JALA 4REZA 2PLPA 2SEBD 3R2IA 3P4RB 3WCQA 2DYOA 1WSPA 5G5HA 3AEBB 1QKZA 4O1NA 3TEWA 3AEFB 1PGBA 1XLOA 2I2YA 4WIPA 5AUIA 1IBXB 4RH6A 2RMMA 1VLBA 4N59A 4USAA 3ZGZA 1L6UA 1QILA 4HEA1 2BS2B 1FNUA 2QSDA 1JMLA 3W1SA 4LTUA 1XF5L 2BS4B 1QT9A 3BWUD 3Q8CA 1L0VB 1PFDA 1VDVA 2WXMA 3ZJVA 2BS3B 1TKEA 4A90A 1F2RC 4J3OD 3AEAB 4OW0A 1HXYD 1HZ6A 1NVID 1SJHD 5TSSA 1DOYA 2JU6X 2WXFA 2V0GA 4FXCA 3Q8EA 1SEBD 5D3DA 2X38A 1K51A 1ESFA 4L1BA 2BYTA 2R61A 3MC0B 4M0WA 4DQOC 2LUMA 1XCTL 2IGHA 3AECB 4MACA 1JCKB 1FCLA 4CQNA 2BTEA 1BUIC 3HRDD 5D3IB 4XDCA 1ZDXA 4HKZE 2WDRB 2AX5A 1J7CA 4NJCA 3HUIA 2K0PA 5EE0A 5HI1A 3VR8B 1N63A 3NZ3A 4YSZB 4TQ1A 3BZDB 1JROA 4KX6B 5EE3A 3URYA 4L2YA 2G1EA 3FAHA 3GS2A 2Q5WD 4R3DA 3U7ZA 1YQ3B 3SEBA 1C4AA 1KRHA 4ZRQA 4WQMA 1IGCA 4H2AA 1DGJA 4XWWA 1SIJA 2J53A 1GB1A 3MFGA 1ZP0B 1FEHA 1N62A 1WGKA 4LLGM 4DXGA 2DLBA 2HTME 2WNMA 1AWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB5 A;  3LXF A;  1JQ4 A;  1N5X A;  2WU2 B;  1FXI A;  4P6V F;  1JW9 D;  2FBW B;  1YJI A;  2MJE A;  2MJD A;  4WWM A;  1FO4 A;  4HRS A;  3AEE B;  2WS3 B;  2H89 B;  2N0S B;  3NVW A;  2W54 A;  3ZYY X;  1FM0 D;  1E10 A;  1E7P B;  1GAQ B;  1NYQ A;  1E0Z A;  5G5G A;  1RYJ A;  1F0Z A;  2WQY B;  3B2G A;  2KMM A;  1PUT A;  4ZOH C;  1N61 A;  1RWS A;  3SR6 A;  1UWM A;  1FXA A;  2L83 A;  3AMZ A;  3P4P B;  2MJ3 A;  1A70 A;  1YJJ A;  1VJK A;  2M56 B;  3NVV A;  1XO3 A;  2L52 A;  3AE9 B;  3DWG C;  1NEN B;  2K9X A;  2H88 B;  1L5P A;  2K5P A;  2PVO D;  3AE6 B;  3AEG B;  3B2F A;  2QIE B;  1KFY B;  1V8C A;  2WLB A;  2PKO A;  2DBY A;  3AE8 B;  1FRD A;  1XLQ A;  1EWY C;  2CU3 A;  1ROE A;  3RPF C;  1DOI A;  1PDX A;  1JAL A;  3FC4 A;  3NVZ A;  3P1M A;  1JWB D;  3SFE B;  2Y5C A;  4YSX B;  1R7S A;  1OQQ A;  2W55 A;  3P4R B;  4YT0 B;  3ETR A;  3WCQ A;  1GPX A;  5G5H A;  1OFF A;  1WRI A;  1RFK A;  3AEB B;  1QF6 A;  4JX1 C;  4YTP B;  3AEF B;  3B9J A;  1CJE A;  1XLO A;  1WXQ A;  1XLN A;  3AED B;  4IDI A;  4N6E B;  5AUI A;  5C2T B;  3VR9 B;  1DOX A;  1JRP A;  1VLB A;  4N59 A;  3AH7 A;  4USA A;  1L6U A;  4YSY B;  2BS2 B;  2WP9 B;  4ZHO A;  2QJL A;  4LTU A;  2JX5 A;  2BS4 B;  4JWS C;  1FFV A;  1QT9 A;  1WWT A;  3LB8 C;  1L0V B;  1PFD A;  3P63 A;  1VDV A;  3W9C B;  1ZUD 2;  1TYG B;  2BS3 B;  1TKE A;  4US8 A;  4N58 A;  3KWL A;  2EKI A;  3AEA B;  4ZHP A;  5C3J B;  2E3T A;  2K22 A;  3ABV B;  1T3Q A;  1NVI D;  1DOY A;  2OHF A;  3VRA B;  1AYF A;  1N60 A;  1WYG A;  2M19 A;  2WDQ B;  4FXC A;  5EE1 A;  3DWM A;  1J7A A;  1V97 A;  1SF0 A;  2W3R A;  3AE5 B;  3P4S B;  3NS1 A;  2PIA A;  3AE2 B;  1N5W A;  3PO0 A;  1FMA D;  4YXD B;  3AEC B;  1E6E B;  2DWQ A;  3EUB 2;  3NVY A;  3W5V B;  2CJN A;  1QOB A;  2JQR B;  1FFU A;  1FRR A;  4HRO A;  4US9 A;  3AM9 A;  1FIQ A;  1QOA A;  1ZXI A;  3BII D;  1I7H A;  3HRD D;  3SFD B;  2PVG C;  5EE9 A;  2MH7 A;  2CJO A;  1QLB B;  1OQR A;  3AE7 B;  1YQ4 B;  2WDR B;  2AX5 A;  1J7C A;  2WU5 B;  1JWA D;  1SB3 C;  3HUI A;  5H92 C;  1NYR A;  3AE4 B;  3L4P A;  5EE0 A;  1E9M A;  3VR8 B;  1N63 A;  4C7Y A;  1RM6 C;  5GXG B;  1TKY A;  2BT6 A;  4C80 A;  4YSZ B;  2LEK A;  1JRO A;  4KX6 B;  3AE3 B;  5EE3 A;  4A9A A;  2G1E A;  3CWI A;  1IUE A;  2KAJ A;  3FAH A;  1TJE A;  1ZOY B;  1TKG A;  1XLP A;  2Q5W D;  4C7Z A;  3P4Q B;  1CZP A;  2ACZ B;  4YTM B;  1L6V A;  2B76 B;  1YQ3 B;  3NRZ A;  5MPO A;  1KRH A;  4JWU C;  3AE1 B;  4WQM A;  1NI3 A;  5H8Y E;  1DGJ A;  3HVZ A;  1SIJ A;  1B9R A;  1QOG A;  3W5U B;  3AN1 A;  3CIR B;  1ZP0 B;  1NEK B;  4YTN B;  3VRB B;  3AV8 A;  2W3S A;  2WDV B;  1N62 A;  1WGK A;  5AUK A;  1KF6 B;  2HTM E;  1J7B A;  1QOF A;  4ITK A;  1AWD A; 
#chains in the Genus database with same CATH topology
 3KWV A;  4RM8 A;  1HA5 A;  2HDE A;  1GC6 A;  1R4N I;  2IO1 B;  2C5L C;  5CHV C;  3Q3F A;  2CHX A;  1STE A;  2MJ3 A;  2K6Q A;  4M8N A;  1VRA B;  1YJJ A;  1XO3 A;  2NTS A;  3CSF A;  1D5X C;  2QIE B;  1XLQ A;  1EWY C;  1P9D U;  2CU3 A;  3B08 A;  3QAQ A;  4NZL B;  2D5G A;  2JRI B;  1IPG A;  1YN3 A;  2I1K A;  4NNJ B;  5CHF A;  2A5U A;  5IO9 A;  4ZHO A;  2QJL A;  3NJT A;  3FIL B;  1ZUD 2;  4KZ0 A;  4HK2 A;  3C0R B;  3KVF B;  5HG2 A;  5C3J B;  3KYD D;  4K3B A;  2NS5 A;  1YX6 B;  1T3Q A;  3Q14 C;  3KUC B;  4EUT A;  3DBL I;  2N1W A;  1KLU D;  3AI5 A;  1WJ6 A;  3M63 B;  3PZ8 A;  5BYR A;  2KO3 A;  2DZJ A;  4WWP A;  2ON8 A;  1H8C A;  5CHW A;  1QOA A;  3JVZ X;  4RGO S;  2ICI A;  4P7I A;  4LNF A;  2N9L A;  2G45 B;  3UGB B;  3VTV A;  2HJ8 A;  2AEH A;  2AL3 A;  3GE8 C;  2JVC A;  1OGW A;  3LJ3 A;  4KGS A;  2NR2 A;  2LXC A;  2KVZ A;  4KDL B;  2LMC A;  1V1P A;  1C1Y B;  1YD8 U;  1PQS A;  2AQ1 B;  4W9J A;  4RGT A;  2LD9 A;  3H8H A;  1J7B A;  4ITK A;  3WA0 A;  1K52 A;  3PSE B;  4MJS B;  1E10 A;  5G5G A;  3A9K A;  4LNK A;  3MHZ A;  3TIX A;  3V05 A;  4FJZ A;  2L52 A;  3Q69 A;  4A55 A;  1HTO A;  3EC8 A;  3GZN B;  2A4Z A;  2IO3 B;  2KZR A;  2XEW A;  3SFE B;  2IY1 B;  1VZ6 A;  4GOC A;  1L4D B;  4NAW B;  1VCB A;  2XBB C;  4GMV A;  4IM0 A;  5HKH A;  2PE6 B;  5IA7 A;  3KH0 A;  3IXS A;  4W9L A;  2OJW A;  4HCP B;  4MGZ E;  1FFV A;  3QWZ B;  1QZE A;  2Z8L A;  1D5Z C;  2CHZ A;  2NMQ A;  4DBG A;  2QHO A;  2JZZ A;  3NS8 A;  4PYZ A;  2JRH A;  4RFB A;  3SD5 A;  1G6J A;  4B0E A;  2JPH A;  2HJ1 A;  1C76 A;  2LGI A;  3P4S B;  4MGY E;  2KDB A;  2RPQ A;  4TKN A;  5J17 A;  2WXI A;  2YEP B;  3BIN A;  4A6Q A;  2DX5 B;  3VFK A;  2PVG C;  4TMA B;  5EE9 A;  3RNB C;  1ISN A;  2KHW B;  2RDH A;  1NYR A;  3U2S C;  4FHK A;  4C80 A;  3CF6 E;  2MSE D;  1K8R B;  3TEX A;  4ZRI A;  2GI9 A;  3APF A;  3A9J B;  4I6P A;  5BMG A;  2XK5 B;  2BQQ A;  2R2Q A;  4ARI A;  4GSW A;  3GB1 A;  2L32 A;  2KQS A;  1WX8 A;  3AV8 A;  2KDE B;  1YOV B;  2ZNV C;  2MLB A;  2JF5 A;  1F0Z A;  2OED A;  1I4P A;  2MA9 B;  2D10 A;  1P7E A;  4EFO A;  4S0R A;  2IGD A;  2KLC A;  1S1Q B;  1E5W A;  2WXJ A;  1TT5 B;  3TUO A;  1JWB D;  3OG5 A;  2W55 A;  1A5R A;  3FKY A;  1WM2 A;  2DYM A;  3AED B;  2W9N A;  3HIZ A;  3N3K B;  3DVN U;  3H1U A;  2BKR B;  3U52 E;  1FXT B;  2ZZP B;  4AQ7 A;  3LB8 C;  3RYT A;  2UYZ B;  3AU4 A;  2KWU B;  3WAO A;  3R3M A;  3KLS X;  2K22 A;  2RD0 A;  2V4I B;  3IT6 B;  4LNI A;  1YN4 A;  3VRA B;  1AYF A;  1V2Y A;  3DWM A;  2WXP A;  2CHW A;  2LGX A;  4HJG E;  3MC8 A;  2JZ3 B;  3L13 A;  2LVP A;  2JQR B;  2V3P A;  1WE6 A;  2CJO A;  2GRI A;  4XYC A;  5BO4 B;  2K25 A;  3QIJ A;  1JWA D;  5DCN A;  3AE4 B;  2PJH A;  1TY0 A;  2WXH A;  3MP9 A;  2D3C A;  2M0A A;  3VH4 B;  4FLH A;  4K81 A;  3CWI A;  1SGH A;  1T0Y A;  4OVV A;  2G4D B;  1BT0 A;  3NRZ A;  5MPO A;  2VRR B;  1R4N B;  1NI3 A;  4AJW A;  5FKA C;  1B9R A;  3AN1 A;  3N1Z C;  3CIR B;  2ZW1 A;  3MC9 A;  1QOF A;  2FBW B;  2WS3 B;  2IO0 B;  3ZYY X;  2BWF A;  4WJN A;  3U7D A;  3UQB A;  1BML C;  1J8C A;  1L4Z B;  2Y3A A;  3SR6 A;  3ZDM C;  2LVO A;  4BKT A;  3AE9 B;  4RM9 A;  4UDU C;  2MHJ A;  4K1R B;  1V49 A;  1XD3 B;  3J9C A;  3APD A;  1JAL A;  3C19 A;  2LJ5 A;  3AEB B;  1WY8 A;  1U4A A;  3AEF B;  1XLO A;  4RH6 A;  2CS4 A;  3ZGZ A;  4USA A;  1L6U A;  1QIL A;  3DBL B;  2Z0E B;  3DBS A;  1WYW B;  1JML A;  2CU1 A;  3W1S A;  3KUD B;  2BS3 B;  4OW0 A;  4B95 A;  1HXY D;  1HZ6 A;  3VUY A;  5TSS A;  1SJH D;  3NZS A;  3Q8E A;  5D3D A;  2X38 A;  2LGY A;  3QK0 A;  2KD0 A;  3MC0 B;  1WXM A;  2WDT B;  2HTH A;  2IND C;  1BUI C;  4BVU C;  1TTN A;  2K0P A;  5EE0 A;  2L76 A;  5HI1 A;  3VR8 B;  3DBR I;  4TQ1 A;  2KN5 A;  3IFW B;  1WX7 A;  3S2A A;  3URY A;  2G1E A;  3WIM A;  2O6V A;  1KOT A;  2GBR A;  3A1Q B;  2IZV B;  1KJT A;  1RFA A;  4DHZ B;  1WXV A;  1E90 A;  2V4L A;  1R4M I;  3UQA A;  1DGJ A;  2JXX A;  1GB1 A;  3LDZ E;  1N62 A;  4CHK A;  4XGA B;  4DXG A;  3K9O B;  2HTM E;  2WNM A;  2LVQ A;  3RNF C;  2BB5 A;  1FO4 A;  3MTN B;  2N0S B;  3NUH B;  3Q2A C;  2LGD A;  2WQY B;  4YWG G;  1N61 A;  4P1B C;  3VUX A;  2NBW B;  1FXA A;  4AWJ A;  2L7R A;  3U4E G;  4E3C A;  3OJ4 B;  1XCQ L;  1J19 A;  2LHE A;  2BF8 B;  1UEL A;  4W9K A;  1ROE A;  3RPF C;  1WGR A;  2WX1 A;  3U8Z A;  2Y5C A;  4HDO A;  4YT0 B;  4KGR A;  3ETR A;  1OFF A;  3HHM A;  4YTP B;  1XT9 B;  3W2D A;  2L0F A;  3TJP A;  3PV1 A;  4JE3 B;  4EKU A;  2BVC A;  2AQ3 B;  5JXV A;  1WI0 A;  5AZH A;  2KTR A;  5HHD G;  2MBQ A;  2M8S A;  1Q0W B;  4WAF A;  2W3R A;  3GOE A;  1CMX B;  2KN4 A;  3QA8 A;  1QOB A;  1FRR A;  4KIK A;  4GIV A;  4DHZ E;  3RZW C;  3NOB A;  3N1Y C;  1V81 A;  2NBV B;  1WF9 A;  4AUQ C;  4DHJ B;  3APC A;  3NG0 A;  4ZYN A;  2NBU A;  2BT6 A;  4EZK A;  1C4P A;  2LEK A;  4W9I A;  1I35 A;  1TJE A;  3W1S C;  1J0G A;  5LLI A;  1L6V A;  3RMK C;  4G50 A;  4JWU C;  3NHE B;  1VZ8 A;  5H8Y E;  3W5U B;  1KF6 B;  3PRP B;  2ASQ A;  3QHT A;  3R7R A;  4MSQ B;  1ACC A;  4P1C C;  2KDM A;  1WGG A;  1XXG A;  2WGS A;  4C4V B;  4NJ6 A;  2WHI A;  4CYE A;  3D32 A;  3T3N A;  3ZLZ A;  4GDL A;  1WFY A;  2M56 B;  2KNB A;  3PGE A;  4TQ0 A;  3QCA A;  2IDY A;  4IM3 A;  4EE2 A;  1I4Q A;  2HD5 B;  2N9X A;  3ZNH B;  3U30 A;  1LQB A;  1WE7 A;  4JX1 C;  3FIL A;  4KKI A;  1E8W A;  1N6Z A;  1KLG D;  1JRP A;  1YMH E;  2D2Q A;  3RN9 C;  3SU8 X;  4L23 A;  5KHQ A;  1EM7 A;  3N30 A;  4WAA A;  4KSL C;  2JX5 A;  2ZJD A;  5L95 C;  4LCD E;  2N9P C;  1IP9 A;  3LYY A;  3PRM B;  2VZK B;  3ZUN A;  3VVW B;  2WXO A;  1N60 A;  4WWN A;  1ZXH A;  1I4X A;  3Q3M C;  1P1A A;  2JZP A;  5FR6 A;  2DEN B;  1ENF A;  1GOZ A;  1E6E B;  2LGS A;  3TMP B;  5AEK B;  3SFD B;  3UIP B;  2Y5B B;  1M94 A;  3L4P A;  1GB4 A;  2JYT A;  1YNT E;  2VZK D;  3AE3 B;  4OZC A;  3PRE A;  2KWD A;  1UF0 A;  2IO2 B;  2XNA C;  2J0K A;  2GBM A;  4KVG B;  4MDK E;  4EEW A;  1GG3 A;  4XC2 A;  3H7P B;  4KSK C;  1SXT A;  3HVZ A;  2K3U A;  2J7Q B;  4MJS A;  4YTN B;  2KC2 A;  5AUK A;  1WH3 A;  3ZRC A;  3LXF A;  2WU2 B;  4RGN A;  1Q1O A;  2N1V A;  3NVW A;  4W9H A;  4GB9 A;  1E0Z A;  2ZW0 A;  1RYJ A;  3IG3 A;  2KTF A;  2LJI A;  4IWP A;  4W9G A;  2KVR A;  5AZF A;  3NVV A;  2BBC A;  1S3S G;  2H88 B;  2PVO D;  1TIF A;  1UUP A;  3UIN B;  4QAY A;  3Q8A A;  2UWQ A;  1GPX A;  1BXT A;  4N6E B;  1MPE A;  3VUW A;  5J2R A;  1V5T A;  2KFK A;  2KMA A;  2WP9 B;  1WWT A;  2N7E A;  3ZTC A;  2QIL A;  2LRW A;  3CMM B;  3W9C B;  2QCZ A;  2Z0D B;  1H4R A;  2AWT A;  3KWL A;  2EKI A;  4FN2 A;  1VZ7 A;  3R2T A;  3BVG A;  1ZGU B;  4JQW C;  2DYB A;  4B6W A;  1WYG A;  1WMH B;  2EMT A;  1UBQ A;  1WJ4 A;  2PMV A;  3TSS A;  3NS1 A;  4ANU A;  1EUV B;  2C7M B;  1HE8 A;  3PO0 A;  4BFR A;  4MGK E;  3DBR B;  1V6E A;  2KX3 A;  2OOB B;  4DDI D;  4HRO A;  2BW2 A;  1ZXI A;  3BII D;  1I7H A;  2MCN B;  2D3G A;  2D11 A;  2V1Y A;  3A9J A;  3AE7 B;  1L0X B;  5E6O A;  1R4M B;  2XK5 A;  1RM6 C;  1TKY A;  3BYY B;  3L54 A;  2JWZ A;  2JUO A;  2KAJ A;  4HXD A;  1XLP A;  3ECI A;  4BOS C;  3X23 A;  4JIO U;  5BYQ A;  4EOY A;  3HM3 A;  4IW0 A;  3N9Y C;  1QOG A;  1CQV A;  4JLC A;  2NTT A;  3ML9 A;  2KJH B;  4HPL B;  1JW9 D;  1YJI A;  2MJD A;  3IBE A;  3OAW A;  3Q3N C;  1Q5W B;  2MBO A;  1KH0 A;  2N9K A;  1UH6 A;  2BWE S;  4DXF A;  2QDF A;  3UI3 A;  2EEL A;  3V61 A;  3QAR A;  1TY2 A;  3M95 A;  5J18 A;  3AE6 B;  2KOX A;  4K7W A;  3I63 C;  5JH5 C;  1FRD A;  3RNG C;  1I4R A;  2GBJ A;  5LXI B;  3AXC A;  4REZ A;  4LNN A;  3R2I A;  3TEW A;  1MFW A;  5AUI A;  1IBX B;  1VLB A;  1WJU A;  1FNU A;  2DHZ A;  2QSD A;  3RD2 A;  3Q8C A;  2WXM A;  4A90 A;  1F2R C;  2EKE C;  3A4S C;  4LJP B;  2JU6 X;  2V0G A;  4FXC A;  3L08 A;  1K51 A;  2BYT A;  2R61 A;  4HVB A;  2KAN A;  4M0W A;  3EFC A;  3VTU A;  1TGZ B;  2V9H A;  3TCA A;  2J0J A;  2K8C A;  5D3I B;  1ZDX A;  2ZVO A;  2LWP A;  2WDR B;  3IHP C;  3NZ3 A;  4HCN B;  3BZD B;  3L10 B;  5EE3 A;  1P0R A;  3U7Z A;  3OJ3 A;  1RRB A;  4CO7 A;  1C4A A;  1IGC A;  1SIJ A;  2BYV E;  3ZKJ C;  1WGK A;  3VXW A;  5JHB A;  2L1A A;  1YX5 B;  1Z5S B;  2MRP A;  2D3A A;  5E6J A;  2FIF A;  1D4B A;  5DPR A;  3ALB A;  2H89 B;  5GMV A;  4ANV A;  1MVK A;  1LFD A;  2M17 A;  2BGF A;  3R8B A;  4F7Z A;  1T0R C;  2L83 A;  4B0M A;  3EA6 A;  3NZU A;  1K50 A;  2KDI A;  2KFJ A;  2K9X A;  2SAK A;  5D6J B;  3B2F A;  3ZNG C;  1L0Y B;  1SBB B;  2NVU I;  2WLB A;  4BKS A;  4ARC A;  4BBN C;  2GOW A;  3PLU A;  3PZ7 A;  3P1M A;  4YSX B;  1YJ1 A;  1WRI A;  1WXQ A;  2KT7 A;  3ZQ4 A;  3MJ5 A;  1DOX A;  4TSS A;  4Q2J A;  4RF1 A;  1T5X D;  4US8 A;  1P7F A;  1SE2 A;  2OHF A;  3RFZ B;  3ZJT A;  3NY5 A;  2KYW A;  3GE3 C;  4IUM B;  4I6L B;  1UNS A;  2WXK A;  2JSV X;  4US9 A;  3V3X A;  3ZDT A;  2CKH B;  3N32 A;  4ZRP A;  1ET9 A;  4MH0 E;  2L05 A;  2WXG A;  3PHW B;  4HPM B;  4AP4 C;  1SB3 C;  3DVG X;  3V6E B;  3A1Q A;  1UGM A;  1C79 A;  4A9A A;  2KWV B;  4JPS A;  1Y56 A;  3Q3O C;  2WYQ A;  1D6E C;  4C7Z A;  2C60 A;  3DHI C;  4XE0 A;  2KLG A;  1MG4 A;  2BYE A;  2W3S A;  2KKC A;  3JYU A;  4P6V F;  1V1O A;  3JSV B;  4HRS A;  1AAR A;  1MI0 A;  2W54 A;  2GBN A;  1AW7 A;  1E7P B;  1GAQ B;  1D5M C;  1EF1 A;  2PPH A;  3GZN I;  3B2G A;  4GDK B;  2M1M A;  3ZXV A;  4K7U A;  2TSS A;  1GNU A;  2MQJ A;  1FPY A;  3H7S A;  2J0M A;  5BYS A;  1P98 A;  3L0W B;  3TEY A;  2PKO A;  2RR9 A;  4OHJ A;  3FC4 A;  3ZXR A;  4D2K A;  3I9V 1;  3B9J A;  5HFY A;  3PS6 A;  4FA6 A;  1FCC C;  2J52 A;  3AH7 A;  1NI2 A;  4P16 A;  2D3B A;  3RNA C;  1ZDV A;  1E8Z A;  4LK0 M;  1HQR D;  1ZKH A;  2PTL A;  2FCQ A;  3DBH I;  2BYF A;  2O2V B;  1Y8R C;  3ABV B;  3RNC C;  3CST A;  2M19 A;  1SF0 A;  3AE5 B;  2LRU A;  3VQI A;  1NBF C;  4YXD B;  3NVY A;  3W5V B;  2CJN A;  2O6V B;  2MP2 B;  1FIQ A;  1SIF A;  2K39 A;  3IT4 B;  3DOW A;  3UF8 A;  3WAL A;  2WXQ A;  4XX5 A;  3H9D A;  1P3Q U;  3MJW A;  1E7V A;  4IM2 A;  3BVM A;  5DPW A;  5H92 C;  1TZO A;  1MHH E;  3WAM A;  4C7Y A;  3KQ4 A;  2DNF A;  1C77 A;  4XWT A;  3ONS A;  2EMS A;  3T8M A;  3DHH C;  4DK5 A;  2E6X A;  1TKG A;  2JYE A;  2RDB C;  1CZP A;  2ACZ B;  3P4Q B;  2PW9 A;  4S17 A;  5L83 A;  3AE1 B;  1KTK A;  2M0X A;  2JXT A;  3VRB B;  4C4V A;  2O6V D;  1SSN A;  2R2O A;  4FJV B;  3OLM D;  3WAN A;  4ANX A;  1WR1 A;  1T0S C;  1NDD A;  1JQ4 A;  1KLV A;  3AEE B;  4LDT D;  4GLS C;  1JWU D;  4KV2 A;  1NYQ A;  4NAM A;  2IYD B;  2FCS A;  1GC7 A;  2INN E;  3ZVV A;  2AYO B;  4IOI E;  1I4H A;  3R66 C;  5TR5 A;  1VJK A;  2ONQ A;  4MM3 B;  4MSM B;  5DPT A;  3SDL C;  1NEN B;  4WWO A;  3QQ8 B;  4HPP A;  1TS2 A;  1F77 A;  4GXB A;  2NPT B;  4A20 A;  1L2N A;  2KTR B;  4PK1 A;  2G9H D;  5C2T B;  4PS8 A;  1CK1 A;  2DAJ A;  1PGA A;  1WIA A;  4II2 B;  3V62 A;  1T6B X;  1UWX A;  1C4C A;  2JY6 A;  5LXH A;  4G0N B;  3RT3 B;  3BK2 A;  2KJR A;  2KQ4 X;  1EU3 A;  1B1Z A;  1WXA A;  4DXA B;  4C56 C;  1ZPS A;  1V86 A;  2IJ0 A;  3N20 C;  3Q6B A;  2PIA A;  3AE2 B;  1N5W A;  2ZCB A;  3WAP A;  3DVG Y;  3ZNZ B;  2MEK A;  1DYQ A;  3AM9 A;  4TV3 A;  1MHX A;  4RF0 A;  1IYF A;  2RPV A;  2WU5 B;  2KDF B;  1V80 A;  2K8B A;  3H7P A;  4LNO A;  1AN8 A;  1PYW D;  3QX1 A;  5JHA A;  4N9F 4;  5I4D A;  2XN9 C;  4YTM B;  1FNV A;  4W9F A;  2K8H A;  3I5J C;  3C8Y A;  2Z59 B;  3HVD A;  4GDL B;  5E6P A;  3V6C B;  1PGX A;  4E74 A;  4EZJ A;  3AUL A;  4IKG A;  3TL5 A;  4MGI E;  2MJE A;  4WJP A;  1EU4 A;  1D3Z A;  1ET6 A;  2Y5P A;  4WQO B;  4KGT A;  2MBE A;  3R7Q A;  2GLS A;  3PTF C;  3AMZ A;  3DVN V;  1WJN A;  2V3N A;  2G3Q B;  3ZW3 A;  2OJR A;  1L5P A;  3PT2 B;  5DPS A;  3P42 A;  2ZCC A;  1V8C A;  2N9E B;  2DBY A;  2MBB B;  3BVZ A;  3QJZ A;  1LM8 B;  3NVZ A;  2GMI C;  2SEB D;  3P4R B;  1WSP A;  4RMA A;  4ASW C;  4KZC A;  2I2Y A;  4WIP A;  3SHQ A;  2JT4 B;  3PZD A;  3RCZ A;  4PS3 A;  1RAX A;  2BS2 B;  1YQB A;  4ZRK A;  1XF5 L;  2L00 B;  1PFD A;  5CTR C;  3ZJV A;  1TKE A;  1WMH A;  3AEA B;  2FCN A;  4NAW A;  2DZI A;  4G3X B;  1WXS A;  4ACF A;  2L8J A;  2WXF A;  1SEB D;  3EFU A;  4NQK E;  1ESF A;  4DQO C;  4KDI C;  2WWZ A;  2ZNV B;  1WGH A;  1JCK B;  3DDC B;  4IWO A;  3VHT C;  2KX0 A;  4W9E A;  1WGD A;  2LI5 A;  2BTE A;  4XDC A;  5JZE B;  2N4F A;  3B0A A;  3DCG A;  2AX5 A;  5G2N A;  1N63 A;  5IOI A;  3QC8 B;  4KX6 B;  4ANW A;  1XQQ A;  4L2Y A;  2NCN A;  2ZPN A;  3GS2 A;  2Q5W D;  1YQ3 B;  1KRH A;  3HK0 A;  4WQM A;  4XWW A;  2LXA A;  2J53 A;  1ZP0 B;  3IVF A;  4DDG D;  4OVU A;  1FEH A;  2RSU A;  3ML8 A;  2FID A;  4BAX A;  3AB5 A;  1V1P B;  4ZYS A;  3IAS 1;  1FXI A;  5FR3 A;  2I38 A;  2YLM A;  2ZPY A;  4GN1 A;  3PRZ A;  2KMM A;  1C9F A;  4ZOH C;  4AJY B;  2C7H A;  2W82 A;  3ZJU A;  3W1Y A;  3DWG C;  4MT5 A;  4BKG A;  3ZRF A;  2KFK B;  1L7Y A;  3A9K B;  1F9J A;  4II3 B;  1QQR A;  3V60 A;  4MEM A;  1IBX A;  4B9K A;  1DOI A;  2FCM A;  1OQQ A;  4URK A;  5EDS A;  3DPD A;  4XDD A;  3DBH B;  2UU7 A;  4IDI A;  3RZF A;  3UIO B;  3B1L X;  3TBL D;  2PE9 A;  3O13 A;  3K9P B;  2QC8 A;  4ZDV A;  1WR6 E;  1TYG B;  1JWS D;  1OQY A;  4HJK A;  4XZ4 A;  2C9W B;  4BOZ B;  4ZHP A;  1K53 A;  2D07 B;  3N1X C;  5EE1 A;  3OWE B;  1J7A A;  1V97 A;  1SJE D;  2GBK A;  2FNJ B;  1FMA D;  2WXN A;  5IAA C;  2KC1 A;  2KQ7 A;  1YQ4 B;  3VAW A;  1WRD B;  2YEP F;  2WXR A;  3H6N A;  2CR5 A;  2BB6 A;  4WH4 A;  2REX A;  2KJ6 A;  2RGF A;  1TS4 A;  3DHG C;  1GJZ A;  2C7N B;  4M00 A;  4OZA A;  1LGR A;  3RUI B;  3BY4 B;  4BBN F;  1LO5 D;  3BYT B;  2WDV B;  4IC7 B;  1XEE A;  3VH3 B;  2IPK D;  4WWM A;  2ZVN A;  3ENE A;  1WZ0 A;  1FM0 D;  4KKJ A;  2INP E;  5D2M B;  3L17 A;  2DZK A;  1WM3 A;  2G4S A;  4BZA A;  1HZ5 A;  4GU2 A;  2KMC A;  1WGY A;  1VD2 A;  3AE8 B;  4F8C B;  2IBI B;  1UD7 A;  3KYC D;  1RLF A;  4WUR A;  2LFI A;  4K7S A;  5IN7 A;  3DQV A;  4AS1 A;  3EEC A;  4A3P A;  2YVC A;  2K1F A;  3A4R A;  3VTW A;  5BMI A;  1Z2M A;  4FUL A;  4M0W B;  4HWI B;  4JWS C;  4HKQ A;  3I3T B;  2JWU A;  5LNK 1;  1F52 A;  1T0Q C;  3RUL A;  2KWC A;  5AZG A;  2E3T A;  2WX0 A;  4J6I A;  2M4N A;  4G11 A;  2X8X X;  1ZE3 D;  3M62 B;  4GGQ A;  2DWQ A;  4I6N B;  2IY0 B;  1V5O A;  1GUA B;  4FHJ A;  3PPA A;  5E6N A;  2MH7 A;  4OVZ A;  1QLB B;  4DWF A;  1E8X A;  1IGD A;  3I57 A;  3T9L A;  1ZW7 A;  3VDZ A;  4A8X C;  1OEY A;  3P2B A;  2V3S A;  2IGG A;  1IUE A;  1ZOY B;  1C78 A;  4M02 A;  3IAM 1;  2N7J A;  2QMT A;  2KAC A;  4NQL B;  1I4G A;  3JSV A;  1WX9 A;  1SE3 A;  4A3O A;  3P63 A;  1VR9 A;  4GDK A;  1N5X A;  2FAZ A;  3PVL A;  5D94 A;  1SE4 A;  4NJ7 A;  2VH2 A;  4E71 A;  1MJD A;  2LUE A;  4ICV A;  2I1J A;  3Q8F A;  1RWS A;  1UWM A;  4W9D A;  4YL8 A;  4AOF A;  3E9S A;  1TS3 A;  1SE9 A;  2K5P A;  3AEG B;  3HM6 X;  1KFY B;  1UGJ A;  2QEJ C;  3O65 B;  1F2R I;  2L0T A;  4FAD A;  1F1H A;  1R7S A;  5C23 A;  2J42 A;  1QF6 A;  1RFK A;  1CJE A;  1XLN A;  3VR9 B;  2FUG 1;  4W9C A;  1JWM D;  4BKS D;  1FD6 A;  2GB1 A;  4YSY B;  4OZB A;  1UBI A;  5D7G A;  2O2V A;  1OEY J;  1TS5 A;  4N58 A;  2LAS A;  4C00 A;  2WDQ B;  2ZEQ A;  2J4X A;  2MP2 A;  2LZ6 A;  1HEZ E;  2AQ2 B;  5CX3 A;  2K6D B;  4ICU A;  3T3O A;  3EUB 2;  4EZL A;  3JW0 X;  4HDQ A;  1FFU A;  3GP7 A;  1OQR A;  4X57 B;  3BK1 A;  1FNW A;  5T8I A;  1E9M A;  4HLE A;  4JGH B;  5GXG B;  3TEZ A;  4MH8 A;  2MW5 A;  2WXL A;  4WJO A;  2HE7 A;  3M3J A;  4IWQ A;  3PHX B;  2B76 B;  5IKC M;  2MWS B;  1C3T A;  1UZX B;  2INC C;  2VH1 A;  4RCO A;  1E7U A;  1MG8 A;  1Q10 A;  1NEK B;  3E56 A;  4NY0 A;  4PT5 A;  1M4V A;  1LXD A;  4RNA A;  3Q8B A;  1EWC A;  4IG7 B;  1YN5 A;  4RGM A;  4LDT B;  1X1M A;  2KXJ A;  4MM3 A;  2FE8 A;  1PUT A;  2FUH B;  3P4P B;  1A70 A;  4JL9 A;  2BPS A;  5IP4 D;  3ZTD A;  3EGR A;  2B3A A;  4PS7 A;  3ZIM A;  5FK9 C;  2NPT A;  3PLV A;  1KM7 A;  5G55 A;  3ZO5 B;  5BMH A;  2RDG A;  2LHD A;  4M01 A;  1PDX A;  3RNE C;  2PLP A;  2MBH A;  1E8Y A;  3WCQ A;  2DYO A;  5G5H A;  1QKZ A;  4O1N A;  1PGB A;  3L16 A;  2RMM A;  4N59 A;  4TUU A;  1TBE A;  3Q3J A;  4HEA 1;  4MEL A;  2BKF A;  4LTU A;  2BS4 B;  1QT9 A;  3BWU D;  1L0V B;  1TZ1 A;  1VDV A;  1JRU A;  3MHS D;  4J3O D;  2AL6 A;  4F1S A;  4PYU A;  1NVI D;  1DOY A;  1I42 A;  4L1B A;  4FBJ B;  5C1Z A;  2LUM A;  1XCT L;  2IGH A;  4WJQ A;  2KK8 A;  1EO6 A;  3AEC B;  4MAC A;  3KW5 B;  3KUZ A;  1FCL A;  4CQN A;  3HRD D;  2MX2 A;  3AU5 A;  3ZNI D;  4HKZ E;  1J7C A;  4KIK B;  4NJC A;  2DZM A;  3HUI A;  4NPN A;  4K3C A;  4YSZ B;  2PEA A;  1YIW A;  3X0W A;  4M8M A;  5KHO A;  1JRO A;  4DHJ D;  4LJO B;  3FAH A;  1WZ3 A;  1HTQ A;  4R3D A;  1V9J A;  4FJY A;  3SEB A;  3EHV A;  3RI7 C;  2N7D A;  3A33 B;  4ZRQ A;  4H2A A;  1OTR B;  3MFG A;  4ZRJ A;  2DAF A;  2L3Z A;  4LLG M;  2DLB A;  1EF5 A;  1AWD A; 
#chains in the Genus database with same CATH homology
 3KWV A;  3AB5 A;  1V1P B;  2L1A A;  4ZYS A;  2BB5 A;  1FXI A;  3IAS 1;  5E6J A;  1FO4 A;  1D4B A;  1HA5 A;  2H89 B;  2N0S B;  5FR3 A;  2I38 A;  2HDE A;  1MVK A;  3NUH B;  3R8B A;  2WQY B;  2KMM A;  1C9F A;  4ZOH C;  1N61 A;  4YWG G;  2W82 A;  1FXA A;  2L83 A;  3ZJU A;  1STE A;  2MJ3 A;  4B0M A;  1VRA B;  1YJJ A;  3EA6 A;  1XO3 A;  2NTS A;  1K50 A;  3U4E G;  3DWG C;  4MT5 A;  2K9X A;  2SAK A;  1XCQ L;  1D5X C;  2LHE A;  1QQR A;  3B2F A;  2QIE B;  1L0Y B;  1SBB B;  4ARC A;  2WLB A;  1XLQ A;  1EWY C;  2CU3 A;  3PZ7 A;  1ROE A;  3RPF C;  1IBX A;  1DOI A;  3P1M A;  2Y5C A;  4YSX B;  4NZL B;  1OQQ A;  4KGR A;  2D5G A;  4YT0 B;  3ETR A;  4XDD A;  1OFF A;  1WRI A;  4YTP B;  1YN3 A;  1WXQ A;  4IDI A;  3ZQ4 A;  3MJ5 A;  1DOX A;  3W2D A;  3O13 A;  4TSS A;  4JE3 B;  4ZHO A;  2QJL A;  4Q2J A;  4RF1 A;  3FIL B;  1T5X D;  1ZUD 2;  1TYG B;  2AQ3 B;  1JWS D;  4US8 A;  5JXV A;  4ZHP A;  5HG2 A;  5C3J B;  1P7F A;  5HHD G;  1SE2 A;  1T3Q A;  1K53 A;  2OHF A;  3RFZ B;  3ZJT A;  5EE1 A;  1KLU D;  3OWE B;  1J7A A;  4WAF A;  1V97 A;  2W3R A;  3PZ8 A;  1SJE D;  5BYR A;  1FMA D;  2WXN A;  1UNS A;  2KN4 A;  2WXK A;  1QOB A;  2JSV X;  1FRR A;  4US9 A;  2ON8 A;  3V3X A;  1QOA A;  4ZRP A;  1ET9 A;  4RGO S;  2ICI A;  1YQ4 B;  2WXG A;  2YEP F;  2N9L A;  1SB3 C;  2WXR A;  1C79 A;  2BT6 A;  2BB6 A;  4WH4 A;  1C4P A;  2LEK A;  4A9A A;  4JPS A;  1Y56 A;  1TJE A;  1D6E C;  4C7Z A;  4KGS A;  1TS4 A;  1L6V A;  4XE0 A;  4OZA A;  2LMC A;  1V1P A;  4JWU C;  5H8Y E;  1VZ8 A;  3W5U B;  2AQ1 B;  1LO5 D;  3BYT B;  2W3S A;  2WDV B;  4RGT A;  1KF6 B;  3H8H A;  1XEE A;  1J7B A;  4ITK A;  1ACC A;  1K52 A;  4P6V F;  2IPK D;  2KDM A;  4WWM A;  1V1O A;  4HRS A;  1XXG A;  1MI0 A;  2W54 A;  1FM0 D;  1E10 A;  1AW7 A;  1E7P B;  1GAQ B;  4KKJ A;  5G5G A;  1D5M C;  2INP E;  4GDK B;  3B2G A;  3T3N A;  2TSS A;  3MHZ A;  3V05 A;  2M56 B;  2L52 A;  3Q69 A;  5BYS A;  4A55 A;  1HZ5 A;  4TQ0 A;  3TEY A;  2IDY A;  2PKO A;  3AE8 B;  4EE2 A;  1I4Q A;  4OHJ A;  3FC4 A;  3SFE B;  4D2K A;  1VZ6 A;  1L4D B;  3I9V 1;  4WUR A;  2LFI A;  4NAW B;  4JX1 C;  3B9J A;  5HFY A;  3FIL A;  4KKI A;  4AS1 A;  1KLG D;  1FCC C;  1JRP A;  1YMH E;  2J52 A;  3AH7 A;  4L23 A;  5BMI A;  4P16 A;  1EM7 A;  3IXS A;  1ZDV A;  2JX5 A;  4JWS C;  1FFV A;  4LK0 M;  4HKQ A;  2JWU A;  5LNK 1;  1HQR D;  2Z8L A;  2PTL A;  1D5Z C;  2NMQ A;  3LYY A;  2E3T A;  3ABV B;  2VZK B;  2WXO A;  4RFB A;  1N60 A;  2M19 A;  4B0E A;  1ZXH A;  1I4X A;  1SF0 A;  3AE5 B;  1C76 A;  2LGI A;  3P4S B;  2JZP A;  1ZE3 D;  3VQI A;  1ENF A;  1GOZ A;  4YXD B;  1E6E B;  2DWQ A;  3NVY A;  3W5V B;  2CJN A;  2WXI A;  2YEP B;  4A6Q A;  1FIQ A;  3IT4 B;  3SFD B;  2PVG C;  4TMA B;  5EE9 A;  2MH7 A;  4OVZ A;  1QLB B;  2WXQ A;  3BVM A;  1IGD A;  3I57 A;  2RDH A;  5H92 C;  1NYR A;  1MHH E;  1TZO A;  3L4P A;  3U2S C;  4C7Y A;  3KQ4 A;  4C80 A;  3TEX A;  1GB4 A;  1C77 A;  2JYT A;  1YNT E;  2GI9 A;  5BMG A;  2VZK D;  4A8X C;  3AE3 B;  4OZC A;  4XWT A;  2IGG A;  2KWD A;  1IUE A;  2XNA C;  1ZOY B;  2E6X A;  1TKG A;  1C78 A;  4ARI A;  3IAM 1;  2JYE A;  3GB1 A;  3P4Q B;  1CZP A;  2ACZ B;  2N7J A;  2L32 A;  2PW9 A;  2QMT A;  3AE1 B;  2KAC A;  1SXT A;  3HVZ A;  1KTK A;  2K3U A;  1I4G A;  2JXT A;  3VRB B;  4YTN B;  3AV8 A;  1SSN A;  1SE3 A;  5AUK A;  3P63 A;  3LXF A;  1VR9 A;  1JQ4 A;  1N5X A;  2WU2 B;  4RGN A;  3AEE B;  1SE4 A;  3NVW A;  4NAM A;  4GLS C;  1JWU D;  1NYQ A;  3Q8F A;  1E0Z A;  2ZW0 A;  1RYJ A;  1F0Z A;  1RWS A;  2INN E;  1UWM A;  4IOI E;  2LJI A;  1I4H A;  2OED A;  1VJK A;  1I4P A;  2ONQ A;  3NVV A;  2BBC A;  3E9S A;  4MM3 B;  1NEN B;  1TS3 A;  1P7E A;  2H88 B;  2K5P A;  2PVO D;  3AEG B;  2IGD A;  1KFY B;  1UGJ A;  2QEJ C;  1UUP A;  1F2R I;  2WXJ A;  1TS2 A;  3Q8A A;  1F77 A;  3TUO A;  1JWB D;  1R7S A;  2W55 A;  1GPX A;  2J42 A;  1BXT A;  1QF6 A;  1RFK A;  2G9H D;  4N6E B;  1CJE A;  1MPE A;  1XLN A;  2DYM A;  3AED B;  5C2T B;  3VR9 B;  2FUG 1;  1JWM D;  1CK1 A;  1FD6 A;  1PGA A;  2GB1 A;  4YSY B;  4OZB A;  5D7G A;  3U52 E;  2WP9 B;  4AQ7 A;  1T6B X;  1WWT A;  3LB8 C;  2QIL A;  1UWX A;  1C4C A;  1TS5 A;  3W9C B;  4N58 A;  3KWL A;  2EKI A;  3BK2 A;  1VZ7 A;  3KLS X;  3R2T A;  2KQ4 X;  1EU3 A;  2K22 A;  3BVG A;  1B1Z A;  2V4I B;  3IT6 B;  1YN4 A;  3VRA B;  1AYF A;  1WYG A;  2WDQ B;  4C56 C;  1ZPS A;  2WXP A;  3DWM A;  2IJ0 A;  2PMV A;  2J4X A;  4HJG E;  3TSS A;  3NS1 A;  1HEZ E;  2AQ2 B;  2PIA A;  3AE2 B;  1N5W A;  3PO0 A;  3T3O A;  3EUB 2;  2JQR B;  1FFU A;  2MEK A;  1DYQ A;  4HRO A;  3AM9 A;  2BW2 A;  1ZXI A;  2V3P A;  3BII D;  1I7H A;  3GP7 A;  1MHX A;  2GRI A;  2CJO A;  1OQR A;  3AE7 B;  1L0X B;  4RF0 A;  3BK1 A;  1FNW A;  2RPV A;  1JWA D;  2WU5 B;  5T8I A;  3AE4 B;  1E9M A;  1TY0 A;  2WXH A;  3MP9 A;  2M0A A;  1RM6 C;  5GXG B;  1TKY A;  3BYY B;  3TEZ A;  1AN8 A;  1PYW D;  4MH8 A;  3CWI A;  2KAJ A;  2WXL A;  1XLP A;  5I4D A;  2XN9 C;  4YTM B;  1FNV A;  5BYQ A;  2B76 B;  3NRZ A;  5MPO A;  3N9Y C;  1NI3 A;  3C8Y A;  5FKA C;  4RCO A;  1QOG A;  1B9R A;  1CQV A;  3CIR B;  3AN1 A;  2NTT A;  1Q10 A;  3HVD A;  1NEK B;  2ZW1 A;  4GDL B;  3E56 A;  4PT5 A;  1PGX A;  1QOF A;  1M4V A;  4RNA A;  4IKG A;  3Q8B A;  1EWC A;  1YN5 A;  1JW9 D;  2FBW B;  1YJI A;  1EU4 A;  2MJE A;  2MJD A;  4RGM A;  2WS3 B;  1ET6 A;  2Y5P A;  3ZYY X;  4KGT A;  1KH0 A;  2FE8 A;  2N9K A;  1BML C;  1L4Z B;  2Y3A A;  4DXF A;  1PUT A;  3SR6 A;  3UI3 A;  3AMZ A;  3P4P B;  2EEL A;  1A70 A;  2V3N A;  3EGR A;  3AE9 B;  1TY2 A;  5FK9 C;  4UDU C;  1L5P A;  3AE6 B;  3P42 A;  1V8C A;  5BMH A;  2DBY A;  1FRD A;  1I4R A;  2LHD A;  2RDG A;  3BVZ A;  3J9C A;  1PDX A;  3NVZ A;  1JAL A;  4REZ A;  2PLP A;  2SEB D;  3R2I A;  3P4R B;  3WCQ A;  2DYO A;  1WSP A;  5G5H A;  3AEB B;  1QKZ A;  4O1N A;  3TEW A;  3AEF B;  1PGB A;  1XLO A;  2I2Y A;  4WIP A;  5AUI A;  1IBX B;  4RH6 A;  2RMM A;  1VLB A;  4N59 A;  4USA A;  3ZGZ A;  1L6U A;  1QIL A;  4HEA 1;  2BS2 B;  1FNU A;  2QSD A;  1JML A;  3W1S A;  4LTU A;  1XF5 L;  2BS4 B;  1QT9 A;  3BWU D;  3Q8C A;  1L0V B;  1PFD A;  1VDV A;  2WXM A;  3ZJV A;  2BS3 B;  1TKE A;  4A90 A;  1F2R C;  4J3O D;  3AEA B;  4OW0 A;  1HXY D;  1HZ6 A;  1NVI D;  1SJH D;  5TSS A;  1DOY A;  2JU6 X;  2WXF A;  2V0G A;  4FXC A;  3Q8E A;  1SEB D;  5D3D A;  2X38 A;  1K51 A;  1ESF A;  4L1B A;  2BYT A;  2R61 A;  3MC0 B;  4M0W A;  4DQO C;  2LUM A;  1XCT L;  2IGH A;  3AEC B;  4MAC A;  1JCK B;  1FCL A;  4CQN A;  2BTE A;  1BUI C;  3HRD D;  5D3I B;  4XDC A;  1ZDX A;  4HKZ E;  2WDR B;  2AX5 A;  1J7C A;  4NJC A;  3HUI A;  2K0P A;  5EE0 A;  5HI1 A;  3VR8 B;  1N63 A;  3NZ3 A;  4YSZ B;  4TQ1 A;  3BZD B;  1JRO A;  4KX6 B;  5EE3 A;  3URY A;  4L2Y A;  2G1E A;  3FAH A;  3GS2 A;  2Q5W D;  4R3D A;  3U7Z A;  1YQ3 B;  3SEB A;  1C4A A;  1KRH A;  4ZRQ A;  4WQM A;  1IGC A;  4H2A A;  1DGJ A;  4XWW A;  1SIJ A;  2J53 A;  1GB1 A;  3MFG A;  1ZP0 B;  1FEH A;  1N62 A;  1WGK A;  4LLG M;  4DXG A;  2DLB A;  2HTM E;  2WNM A;  1AWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...