1CJVA

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mg, and zn
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLATE CYCLASE, TYPE V
publication title Two-metal-Ion catalysis in adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
total genus 55
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cjvA00
1AB8A 1CULA 4OYAA 4CLSA 1FX4A 4CLUA 2GVZB 3C14A 4OZ3A 4P2XA 5D0HA 4CLPA 1WC6A 1WC0A 4USVA 5D0GA 1YBTA 3ET6A 3C16B 5IV4A 1CJKA 4P2FA 1CJUA 4CLFA 3UVJA 4USTA 3G82A 4CLTA 4CLLA 4OYPA 1TL7B 1AZSA 1CJVB 1CS4B 1U0HA 5D0RA 4CLKA 1CULB 3MAAB 4WP8A 4CLWA 1CJTB 4USWA 1YK9A 5IV3A 4OYMA 4WP9A 4NI2B 1Y11A 4OZ2A 3C16A 2QV6A 2GVDA 2W01A 3C15B 1TL7A 4CLZA 1WC1A 1CJVA 2GVZA 1WC3A 3C14B 5D0EA 1YBUA 4CM2A 3MAAA 4CM0A 4WPAA 4USUA 1CJTA 3ET6B 4WP3A 4CLYA 3MR7A 1CJKB 1WC5A 1CJUB 1Y10A 4OYOA 1FX2A 4NI2A 2BW7A 3UVJB 4P2MA 4OYXA 3G82B 2WZ1A 4OYZA 4OYBA 2GVDB 1CS4A 3R5GA 4OYWA 1AZSB 1WC4A 3C15A 4OYIA 5D15A 1U0HB
chains in the Genus database with same CATH superfamily
2OPPB 1S1XA 1HI1A 2DTJA 1WUUA 2MTLA 4DU7A 3QLHA 1S77D 1ZTWA 2NCKL 5F8NA 3IRXA 4RUAA 1I5OB 4KKOA 1S0MA 2ZC3A 5BJRA 4TVAB 5U47A 4DR4F 3T9NA 2OPPA 1KBRA 3TOQA 3H25A 3GCWP 4FDFA 4LBPA 4IR9A 3DRRB 4ZLLA 1AW0A 2BW2A 4DHVA 3G9CA 3M8SA 1DQ9A 2DYAA 4IH5A 1TFWA 4M95A 4IRDA 2AP6A 1YBUA 2ASJA 5E3QA 3VCDA 3DRRA 4H4MB 5ETKA 3A8EA 5F8MA 2GO8A 1D09B 1NKCA 3G2XA 4LRBA 4KIAA 1V9OA 3BYPA 1WSRA 4HHJA 4U67Q 5KFGA 3CT9A 3GYNA 4B9SA 5A8KB 1B99A 4WXOA 4RL1A 3CCTA 3K58A 4ZN3A 4H4MA 1HR0J 4DQPA 1E6VB 1NKEA 5KFWA 4RPFA 1HNVA 3D3CJ 2ALZA 1RYRA 1FFSB 1C0UB 3KMQA 2MGZB 4U96A 3L9ZA 5A8KA 3TQ1A 1SJ3P 3NMAA 1YRTA 3U1LA 4LIRA 2VQEF 4ILLA 1DAXA 5F9LA 2LA4A 2M3DA 1EQMA 2HHVA 3LPYA 1RU2A 1E6VA 4NLPA 3D9BA 2F9JA 1TKZB 2IFXA 4JI4F 4LRCA 1C0UA 1FRKA 2MGZA 2V8DA 2KRBA 2QMWA 2DHAA 2PD1A 5FDLB 5KFMA 4H4KA 1RLCL 1FX2A 4QOTA 4BHQA 4C3MA 3SMZA 2C2OB 4ECRA 3HO1A 5KFTA 4ZLJA 2J0XA 4MTPA 5KG7A 1IXKA 3K5MA 1H7XA 5H9FJ 2OSRA 2RDJA 3NLCA 2QFJA 3IFEA 3G6ES 1IBCB 2HEKA 2IIHA 4EYIB 3AOCA 4P73A 5DGAA 4PR6A 4DR2J 3GSIA 6FDRA 2DY1A 5AXLA 2D7SA 1CS4B 2UXBJ 4C0BA 4KQZA 1X4HA 2M2BA 4QCLA 1TELA 3QBCA 1WDDA 3CUNA 5CZXA 1UVMA 4DPYA 4P52A 1QLNA 4IG3B 2ZH4A 3TUIC 2WK4A 2NZCA 4HACA 2Y0SD 3EVMA 1Y00A 2M9KA 3MCSA 3PEJA 3BN7A 4CNZA 3OUYB 5IOLA 1N5TA 4U7UD 2ZHOA 5BYRA 3ZO7A 1U7LA 4DV6J 4YY3J 1KVJA 2YQ1A 5FLXY 2E66A 1M5KC 4IG3A 2E44A 3NMRA 2ZUGA 3CJ0A 4X4PA 3UDLA 5B0EA 3CW2C 4CLPA 4FVCA 2YH1A 3OUYA 3FSIA 4DCOB 5IWAF 3P4UB 1IN0A 1NU4A 3VVTA 3D4JA 3EZUA 2HQFA 1REVB 3OSNA 4B9LA 2CJKA 4CCHA 2DGQA 4OHXA 3BPDA 2QL5B 3CDBA 3MUVP 2GX8A 5DG8A 4K5SA 2XY5A 4A4JA 4Z7YA 2H5JB 5DJBA 2H4WB 4QPXA 2XO7A 5GMEA 2KL8A 3GJSB 2L9NA 1REVA 2MDAA 1BUXA 2HFSA 1X4BA 2J76E 2VU5A 2WVFA 4ES2A 1QSSA 1NM2A 4USUA 5ETRA 1RBOB 1UPMB 3KMSA 1N6QB 2IY5B 3HM9A 1YQHA 3TUPA 5E3AA 1AZSB 4C9DA 3PXGa 3V6KA 3ZTPA 1URRA 1SJRA 1HMVB 3QRRA 2YKMB 4ED7A 4N8OA 3CULA 1WC6A 1XC9A 2XBPA 4ECYA 2O3DA 4QJVA 5IC6B 3I82A 4DSFA 3W61A 1EQ0A 3PRVA 3EZOA 4OI0A 5H9EJ 1G6BA 2ZDOA 1AZSA 3K89A 5LMUJ 4WE1B 3OT9A 1HMVA 4JI5J 4JV5J 4ZVRB 2YKMA 5CD4H 2GQQA 2PC6A 4K4XA 4DL7A 3T1AA 1BC6A 1HNWJ 2DO0A 2ADCA 1B0PA 4N56A 3KHRA 2RHQB 4LQ3A 4GC6A 1VQLS 2IM3A 3H90A 4DV7J 2X51A 1KN6A 2QGFB 1NUEA 4G3IA 2YX1A 3D2WA 2CPFA 3PNIA 1ZAWA 3UDCA 4WE1A 5KFNA 2VBWA 2O67A 3GILA 2MKCA 1WF0A 2HHQA 1Y10A 1UJ6A 3TI0A 1UL3A 1TMJA 2HLTA 1BLUA 1L3SA 5HSPA 4ZVFA 2IYIA 4MH8A 4LSZB 2D3OR 1GMUA 4DUZJ 2EC2A 4WFYA 2LXIA 5HN0A 2V8PA 2YPYA 3TO8A 3QWPA 3F44A 1V5VA 5GAGU 1XR6A 4O4RA 4QWEA 5GADU 2DXEA 1PAEX 3HD1A 1DHMA 2W9AA 2NS1B 4DV4F 1NK0A 4LF4J 2F63A 3C6TA 2QJ3A 1HD1A 4MKYA 1R8BA 3NCRA 1A6LA 1U2FA 1U1KA 3QJLA 2ZWOA 3MECB 4NWBA 1HA1A 2CNKB 2FVCA 2JJ4D 2BMBA 2P6SA 3AD8C 1JKHB 4F4ZA 3KHHA 2R7SA 2RUSA 4O0NA 2Z2YB 2C2KB 2LECA 2EEYA 1NK4A 1FJCA 2AJ4A 3C8YA 1ROFA 4U6PA 3MECA 4H54A 1UEVA 2ZM6J 4N41A 3K5OA 4U9RA 3GFYA 4RBVA 3L09A 4LFBJ 2VFRA 4RBTA 1JKHA 1VISA 2P8IA 4RBUA 2DJWA 4AL6A 4MT1A 4QYZJ 3PM9A 5HROB 2IHR1 4FF4A 2GO9A 3D0GE 1N33J 2B5JB 5CH7B 4DS4A 3ZZOA 3MR3A 2WCXA 3KJNB 1S76D 3HHLD 2XMMA 2MKIA 2MSTA 8AT1B 2AD9A 4EZ6A 4OYMA 4NI2B 4NA1A 5AXKA 3CJ3A 1UAWA 1WORA 4P75A 2MQQA 2B9YA 1X5PA 1PYTA 2BOAA 1IR1A 4NXNJ 4P7VA 4B3SF 2B5JA 1OS5A 1JXLA 4ED4A 3PKYA 4MKBA 4KRWA 4DZ6A 3QJPA 3ZTSA 3AB2B 4ETXA 2VFUA 4UOCA 4NI2A 2WAQD 1Q8BA 2D3O1 3FEYB 3ISND 3K17A 1BWEA 2ZZNA 1UVJA 2J6UA 3ZZTA 4CLSA 2GAGC 2DR8A 1NSAA 1Q82T 2HHWA 4OZ1A 2A1BA 4ZCLA 4FP9A 1XNQF 1SPBP 4O0IA 4P10A 3IWLA 3MFIA 1D9DA 5E0OA 4M5IA 4ZCMA 4EBEA 1CSJA 4JB8B 4ED5A 2CVEA 4YDDB 4LRAA 5I4MA 1EETB 4KGXB 4C6AA 3SCIE 2UU9J 1U2RA 2AZ1A 4F2SA 1ZETA 3W9HA 1D3WA 2ZZMA 4X62F 5D3GB 2GJFA 3H5XA 3DLJA 5G0RB 2XLIA 1X9MA 4ZA1A 2Q66A 2ABYA 4NE9C 3LP0B 2J0WA 3R27A 1HW8A 2CVIA 2K2PA 1EETA 1WEYA 1CULA 2OP5A 3LALA 4LFAF 2EG1A 5D3GA 2GVZB 2MJUA 2ZWPA 1EZZB 5G0RA 2O5DA 3IR5B 4GKJJ 3DYAB 4QZVB 3CVKA 2CQDA 3TAMB 2Y3YA 4IH6A 3D6HB 3PG9A 3TRGA 3OHBA 1D1UA 4OX9F 4WP8A 1FEEA 2DCLA 3DYAA 3IM8A 2KI2A 2GA7A 2JRSA 2YNIB 3TAMA 4J90A 5F9NA 4YQWA 3K5NA 4PXDA 1HWKA 3Q2SC 4PQUA 4DPOA 1S4FA 3V6JA 1FTRA 2JX2A 4HKQA 3PRDA 4UF4A 3O6QA 3RAXA 4K4UA 4DR5J 3CC2S 3W9JA 4HI2A 1RT2B 2J7KA 3KG1A 4EI2A 3GJQB 2YNIA 4PPZA 4DQQA 4FVMA 1KDNA 3R9LA 1GQEA 4P2MA 3G82B 1CC7A 1Q8LA 3CD0A 1FNOA 4I68A 4DV2F 3MR2A 3EGNA 2BVZA 2YKQA 1DTTA 2B8PA 3LP1B 5J2NB 1GX5A 4KTQA 1YBTA 5F8IA 3C16B 4CLFA 2QSFA 4OLOA 3D67A 3G82A 4AXIA 3MEEB 3RAMA 4DV1F 2XSJB 1CJVB 3VTIA 1ZYQA 2UUCF 4KH1B 2LDIA 4KT0C 2OHDA 4EFAC 4F7VA 3LP1A 3ONQA 1K0VA 5J2NA 2HQGA 3C16A 2EFNA 1A9NB 3MEEA 2XSJA 2EFVA 1CJVA 2KVIA 2GHPA 1Q5YA 4OJGA 2IRUA 2YWGA 3CMES 2PI4A 3ET6B 5BYQA 3QYYA 2CDRB 3B82A 2KT2A 4J9VA 4DV3J 1HWIA 2C22A 1MW7A 4CQ1A 3TVZA 2CA9A 5D15A 2KFNA 3FFIB 4ZN1A 3BSOA 2RS8A 2E1CA 2V50A 4A8FA 3LAMA 5KG3A 2F8MA 3ET6A 2XS7A 4QR0A 2GGPB 2QL9B 2DEJA 1IJEB 4QIWD 2Z2MA 4DR3F 1TL7B 1YJNS 1RCOB 4MAKA 2DISA 5M2UA 4ALZA 1FE4A 1ZM4A 4ZVGA 3FFIA 2HHPA 2D69A 4PUOB 1OY8A 3OR1A 4NXMJ 3RBXA 4OJHA 4O3RA 4CIOA 2H54B 2YKPA 4M5NA 2C2ZB 2GGPA 4CP5A 4DSLA 3D66A 4FBTA 1S79A 2NZ4A 2RVJA 1TL7A 4N7TA 4OIXA 2JEGA 3TZYA 3PKMA 2C2MB 4PUOA 4FYVB 4TYBA 2VICA 2A18A 4FN5A 4Y2MA 1QAXA 2YNFB 4BDPA 1U8WA 3PX6A 7FD1A 4ZKAA 4F4WA 5IQQA 3IBFB 1AB8A 3DGVA 2N3OA 2FHJA 3MR5A 1AROP 2CQ0A 3GR1A 2BX6A 4OHWA 4ZVEA 1JB0C 2CQBA 3NAHA 5ETOA 1N32J 3QSIA 3OL8A 3ZTRA 2LYVA 3DLGB 4DZDA 2YNFA 5KFXA 4TYAA 5CHCB 1ULRA 1Z1ZA 1RWMB 1CJTB 2UXDJ 4NEYA 5JMNA 1NJYA 2R7RA 1KOOA 3R3TA 3IMQJ 4EBCA 3BZQA 2AU0A 2CPIA 2MKYA 3DLGA 3VGUA 2ACYA 3MZIA 3BQ1A 1URNA 2LQ5A 2OUGA 2AX1A 1UA1A 1X4DA 1X5TA 2J6TA 1M0SA 3MAHA 4OZNA 1S1VB 5J2MB 2ASYA 5KG5A 1EP4A 1CJTA 2R2TA 2E5LF 1XBWA 2HHXA 4M5MA 1U47A 4NOHA 1B3TA 2YKAA 1FJGJ 4WYLA 2MKSA 4PXCA 2I0XA 3Q23A 1UFKA 2R9LA 4ZP9A 1H73A 3GFZA 3CNQP 1SC1B 2OTJS 3CPWR 1S1VA 5J2MA 2Y8YA 4JI1J 4FF1A 4KHPF 4MK7A 3T6JA 3D1OA 4XO0A 4ANCA 5LSRA 2NYIA 1TL4A 3R7BB 2YH0A 3VGTA 2MQMA 5THWA 3JSRA 3V4MA 2V8VA 3VWSA 2MXYA 1JLCB 2KVQE 2B4PA 3VALA 1DTQB 3KJQB 2GJ2A 3CJTA 1SB6A 4LF7F 1RABB 4NMLA 2QLJB 4QQBA 2W8LA 1KVIA 4WFBQ 4I1TA 4QIVA 2UUTA 3HHNB 3SV4A 1RT7B 3EDQB 2Z8QA 1SQFA 2MY7A 3C14B 5GMDA 2IM1A 1JLCA 3M6XA 1DTQA 3B6BA 2QMUB 4RUCA 5KG0A 2PMZD 5F8LA 4I4BA 1FA0A 3BSNA 1HLWA 4RNOA 5CCMA 1G3OA 1WKKA 1HI0P 3M7VA 4RNMA 1X4CA 1I94F 1LW2B 3HHLB 1P9YA 2L9WA 5HVHA 4QIFA 2ZOMA 3SV3A 2VQEJ 1MSWD 2RAQA 3C14A 2KFYA 1VBZA 1OO0B 1DY3A 2JNJA 3SYZA 2ERRA 5IV4A 1S99A 2CQGA 2V69A 4O3PA 3BGRB 4DX8H 2FLOA 5HVFA 3M8ZA 2ROGA 2VL1A 2DHSA 1NRKA 2F40A 4MK8A 3W7BA 4YR2A 3CCES 1LW2A 3HHLA 1EJ7L 1XN9A 2HSEB 3W63A 1Q1KA 1IR2A 3DKDA 2R7TA 3E8OA 5DGBA 2KYXA 1AUSL 1BY9A 3P49B 2XYGB 4Y2IA 3DGPB 2LQJA 4NPOA 5C24B 3KLVA 3BGRA 1QVGR 3EWGA 2BE9B 3ULHA 1PJ6A 3RBDA 5IS2A 1X60A 2K7JA 4N47A 1PIEA 4V19J 4M1KA 1JJ4A 4F4KA 2BKOA 1I1GA 4OHZA 4RLEA 1JLEB 1TL1B 4M5DB 3IXQA 4X2BA 1C4AA 2RU3A 4ETZA 2MKJA 2YNHB 3DGPA 3CO9A 5C24A 4CH1A 3PW5A 1GXTA 3DN9A 1OPZA 2QZ8A 3V4IB 4URGA 1JLEA 1TL1A 1OY6A 1UW4A 4M5DA 2RQKA 2LCWA 2J9DE 3MM9B 2CZ4A 2LEBA 2YNHA 3FUYA 2D9PA 1S1UB 2VA3A 4MYUA 4DR1J 4J9UE 2F8HA 3Q86A 2W8KA 1NDLA 3A13A 1TV6A 2C3OA 3D28A 3KLEB 2KTQA 3V4IA 5HLFA 2QG9B 5F8GA 3HT3A 1RT5B 2FGCA 3MM9A 4Q8FA 1VQ6S 1TK5A 3NWGA 4O44B 1S1UA 3NOGA 2J0SD 3BSAA 4DPTA 5JVGQ 1QAYA 3D68A 3CDUA 1RAAB 2IRYA 3OFHA 2MEWA 4QBUA 4B17A 1JMTA 2BJ9A 1ZPVA 1RBLA 5KFBA 1RT5A 4LF5F 2B4OA 1UETA 4OYBA 1WC4A 4O44A 3TVYA 4KGVB 3PACA 1YZ7A 5D4PA 1VYAA 2XM3A 4J9MA 1W25A 4CRJA 2DIVA 5T7LB 4DX7A 4Q7AA 4D3GA 2XNQA 3R2DJ 1YKWA 2Q79A 4OJ1A 5AE3A 2B3TB 1F6TA 1B70B 1XWLA 2CPHA 2N3LA 3Q8YA 1WF1A 4R8UB 2IVYA 2JLFA 3I4HX 5HATA 4KR0B 2DB1A 2AYMA 4BCAA 3MTJA 3N79A 4HT5A 2CJYB 3TARA 4NYPA 2W24A 3GP9A 1VGYA 5T7LA 4CO0A 3G8TA 5F41A 2OMOA 3GJTB 1B4SA 1FNXH 4XIUA 4NA3A 1NJXA 4R8UA 1T11A 2RHSB 2NYHA 1RTJB 2I8EA 5T14A 4XK8C 1KQSR 4IOBA 2WRMA 3A8JA 4CLYA 3D3BJ 1SQGA 3KFWX 4FKYA 1U1NA 3SI8A 1RT3B 2ZJRQ 4USHA 4HTIA 1UCNA 3FRYA 2BJEA 1ITPA 3AQPA 3KJVB 2JFDA 3NCPA 3TJ8A 4XPEA 1RTJA 4UUWA 1YJ9S 5KG2A 2JDJA 4B02A 2X1FA 4FXVA 3C2PA 3O44A 3HF5A 4LR7A 1WHVA 3W65A 1EHWA 4Z37A 1RT3A 3ENWA 3G8QA 2X1BA 2AJ1A 3TJAA 2HFNA 1S5ZA 3KJVA 1N88A 4DL0C 2ZBIA 5KFHA 4C2MA 3KHGA 5F0UA 2CJXB 3CMQA 1H38A 3MEGB 2D3ZA 2GHWA 2IVFB 2YX7A 4BLGA 3KHLA 3O2IA 2LA6A 1NH7A 1FRXA 1KKHA 2MQLA 1D9FA 2AWZA 2CJAA 4U7UK 5KT3A 1H2TZ 1Q53A 1FRIA 3K8VA 3P5BP 3MEGA 5KFPA 1U1QA 5AE1A 3H2UB 1FRLA 2XLJA 4UQGA 4RO0A 2ZBPA 4DV4J 2XMVA 1KQGB 2IAJB 1Q0NA 4OZ5A 2HVEA 1ZAVA 5DDOC 4YR3A 3CCZA 3BBFA 1NPKA 3EPGA 1RAFB 1ZZFA 2O1PA 3IAS9 4M8LA 4LBHA 1U6FA 2C2NA 1AFIA 2C42A 1JNZB 1WSVA 1L3VA 2HWTA 3J7A1 2GMJA 1VQKS 3BKTA 2HVIA 2Q3PA 2IAJA 1B7YB 3WC2A 2HHSA 2VH7A 5HQ8A 2PFFB 5EX3A 4X84A 4W90B 1VBKA 2XNRA 2BQRA 1N5YB 5KFUA 1LEOA 1QDUB 1S4EA 3M30B 3GV5B 3ICLA 1FT8A 1M5SA 2RB7A 3OXGA 4Y2CA 2HZAA 2MZRA 1BWVA 4CM2A 1J5EF 3QMQA 5DLGA 2M7SA 2MZSA 3TUZC 4KJIA 2O01C 3A8KA 2Q1LA 1N5YA 2WZ1A 1YWXA 2EFGA 2V4JB 1APSA 2IDEA 3M30A 3QAUA 3H2LA 1YJVA 3UPFA 4PWDB 2LEAA 3IR7B 3N01A 4IOCQ 4LUBA 8RUCA 1K8AT 4YY3F 2MHEA 1JJCB 2HBQB 1T05B 3H4BA 3G71S 5IC4B 2XHWA 2EBEA 1UZHA 2LQ8A 1SVDA 3EICA 4IFYB 3BO3A 3O3LA 4F36A 3G6XA 3OVSA 2V4JA 2ZC4A 2YKNB 4IH7A 1SC4B 3ZZUA 4PWDA 3DHWC 4PYDA 3SQGB 3FCWA 3BO2A 1FWPA 3SSQA 1T05A 1G4CA 3QT6A 5HBMB 1R6VA 2JVOA 1LXNA 1AXQA 4IFYA 2WSEC 4IQXA 4PZVA 1V3RA 5L1LA 2YKNA 3E01B 3VZHA 1XNQJ 1HBNB 2XMUA 3I55S 3P96A 3SQGA 3W62A 4NLVA 4DPWA 2V6AA 3W3SA 3KJFB 3NS5A 3QRPA 3NL0A 5HBMA 4M5HA 1IJFB 4I2PB 5DG9A 2J8AA 2F3JA 1HBUB 4LR9A 3E01A 2D1CA 4CLUA 3GCXP 1HBNA 2G1HA 4KSEB 3IR6B 3I5BA 3FK4A 2ZHAA 2BJ8A 4HHHA 3VAJA 2BJ7A 1X9SA 2ROPA 1BHNA 1ZA1B 1V3ZA 3ZC4A 1FXLA 2L48A 4X62J 1R6YA 4I2PA 2Z0GA 2ZOFA 1RI7A 2CNNB 1HBUA 1PCAA 4LF8F 1KC8T 3CJ2A 2JEIA 3UWTA 5J2QB 5B0FA 3KKFA 3C46A 2XYHB 4B9MA 2FIUA 2AX0A 1WEXA 4MIWA 2X3DA 3BH6B 4GO7X 1NB7A 4LFAJ 2NSCA 4JI5F 1P8GA 5K14B 3HHEA 4GO5X 1HNWF 2WB1D 3QT8A 4XTTA 3FRZA 5J2QA 4CM0A 4WPAA 1O0PA 4C8NA 3MM5B 2XGPA 3PIPQ 1XJWB 2YBVA 4ID8A 1SKSA 2K06A 4OX9J 1TK0A 2B43A 3G6YA 4IOAQ 2UUBF 3S1TA 5K14A 2ZH6A 4JV0A 3UR3C 1RZMA 5DLFA 2OJ3A 5I3QA 5K9FA 3I87A 3GR0A 1ZTTA 2GZOA 2RD5C 3MM5A 3P8BB 1H7WA 2HK3A 3W5ZA 4YB1P 3M2RB 3DFEA 2GS8A 1U6ZA 2VUGA 1RQ0A 1NJIT 1TL3B 4TU9A 4TNOA 3LGNA 4C8ZA 1VK3A 3EGWB 2F65A 5CYMB 1HQ2A 2H5IB 5ETQA 1WELA 1HD0A 1IVZA 4FXDA 2BOPA 4DV2J 2HVZA 3TUJC 4G1PA 3QFWA 1QUPA 1T3NA 1SCJB 4NX9A 1S0VA 2G4BA 3M2RA 1NO8A 2OELA 2HBRB 3LF0A 1XR5A 3DOKB 2AKWB 2P5VA 1S57A 2BRKA 2RRBA 5KFCA 1TL3A 3W1YC 3B54A 2AJFE 2CQ1A 5CYMA 1YBAA 1LWEB 1EKRA 4OYOA 4L72B 2UUCJ 2BW7A 3SQOP 5KT6A 1D0EA 2AQ4A 4HEA9 4ICLB 2AJ2A 3GPAA 4K7QA 3AA9A 2CRLA 3AB4B 2DXDA 4ELVA 2B0GA 2HWHA 1NHKL 3M9NB 3DOKA 1Q81T 4AL5A 2Z2LA 2F8EX 2MZ1A 2QLXA 4IKAA 4RW8B 2M4MA 1QVFR 1GH8A 1LWEA 2UV8G 1NSPA 2RJZA 5K8PA 3DLLQ 1KTVA 3H5YA 4USJC 3U1MA 3BBCA 4ICLA 4F3OA 1Y5NB 2PDAA 1VR6A 3JB9k 3RG6A 1CBKA 1SL1A 2CFXA 3MCNA 4LVOP 2OPRA 4NLTA 3WX4A 3E2EA 3FQLA 1NK6A 1U1MA 4CO5A 4BC7A 3M32B 3PYDA 4KV8B 1ICEB 1S6UA 1SH2A 1U1LA 3Q8VA 3HPOA 4YUDA 4NLSA 4X4VA 3OVAA 1VDHA 4DR3J 3PHTA 3K0JA 2KB2A 4NRUA 4F26A 3QSYB 3M32A 4KV8A 4JP8A 5CZVA 1S0NA 3KK3B 3AAWB 1S6PB 1U0HB 4PRFA 2F5GA 3DCAA 2XY7A 2R42A 2G2YA 1GMWA 5J1NA 1KP6A 3OFFA 4LSLB 4WFZA 2M8DB 1FVSA 5E7OB 2DNLA 5RUBA 1UFLA 2OGUA 1BQMB 5HO4A 4Q2MA 2HHHF 1NBEB 3I96A 3KK3A 1S6PA 1U0HA 3GV8B 5SUHA 2GMLA 1N4LA 1WKLA 4OMFG 1R3NA 3G96A 1Y9OA 4LSLA 1L3TA 3BS9A 4I6WA 3Q8SB 2DT9A 1BQMA 1OSCA 1UEUA 4I67A 3M8WA 1VBYA 2V2KA 1S7HA 3DDNA 5D0EA 2MZTA 2VG5B 3VAGA 1WI8A 2FYXA 4OI4A 1SKWA 5IXUA 3TZXA 2R8GA 3I4PA 2V2VA 2K7KA 4ZHRB 3OVBA 4OYZA 1FRJA 1GX6A 2VKZG 4RJVA 3M4XA 4CZCA 1CG2A 2VG5A 3UNYA 2RKIB 1S1WB 2RDIA 2N82B 3LUYA 2YWWA 2EVZA 3HXMA 4ZHRA 1MWYA 1G2EA 1T9XA 4GKJF 5BR8J 2VDHA 3OTOJ 3L7UA 5KOXA 2E5LJ 1M5PC 1LQ9A 3JSMB 3ZFVA 2CKWA 3AJDA 5LXYA 2ZBQA 3B4DA 1P9QC 2ZOGA 4JV2A 4PQAA 2HQDA 4WZMA 2RKIA 1GXUA 5F8HA 1S1WA 2QA4G 2MQ8A 3C15B 2VV5A 5J1PA 4KHPJ 2MB0B 4OV6A 2PIIA 4USIA 2AYGA 3CC7S 4WFXA 3VHQA 2FTRA 3JSMA 1Q78A 2A10A 3MR7A 1V5IB 4YHHF 4WTYA 4IG0B 3AJ1A 4CWBA 4ZPCA 2XS5A 3VQSA 2V34A 3C15A 3CDEA 2NPIA 1NNDA 1NJWA 2RDDA 5D0HA 2ZEJA 1KHVA 4N8NA 3NGDA 4X4NA 5DDPC 1PSDA 3BEGB 2ZKUA 5JUMA 4QWDA 2BDPA 1KLMB 1MG7A 1Y3JA 4IG0A 4B3MJ 2B9XA 2OPQB 1QTNB 4PEOA 2VASA 2CQPA 4KO0B 3MURP 3SFUA 2YWHA 2DNOA 4ERDA 4GC7A 2CQCA 4P72A 1IR0A 5L1IA 3CXCR 4ZIVA 3QRQA 2AIRB 2DH8A 4NLQA 1KLMA 1U1PA 5KT5A 2OPQA 3AJ2A 4UOFA 2C28A 1WC1A 4KO0A 1U25A 3DLHA 2OI2A 4DDFA 2CZ9A 2GHVC 5E3PA 2HWIA 2ALYB 4G1IA 3ZZZA 3BQ0A 4K59A 1PC5A 2KH9A 1S49A 3JQMA 3ADAC 3RW6A 2NXJA 5E5NA 3JXOA 4CT8A 2DNNA 4Y65A 2MHNA 2C3YA 4U95A 1X9WA 4B3TJ 5DG7A 4MYTA 4ES3A 4YMEA 4K4WA 2Z56B 2H65B 3GMGA 2VG7B 2YWEA 3S8SA 4WFNQ 5DDQC 3I9V9 4IUFA 2PMWA 3KLIB 1VC6A 2Q6CA 3OD2A 4EGLA 3PRBA 4I64A 4E2FB 4OX7A 2UVVA 3K8WA 5DQGA 2R2RA 3FQKA 1U02A 2DEIA 1DZ5A 1Y0HA 3R7NB 2E1MC 1WG5A 3AFGA 2VG7A 1H2UX 2CJBA 1VS3A 1WJ9A 3CJKB 3UR0A 3KLIA 3AOAA 1KFDA 4NXMF 3CGIA 3FBBA 2JVRA 3OQ2A 4BS2A 4ZVOB 1VQ8S 2XWXA 5KAKA 1WWHA 3DC2A 4ED6A 3VAMA 1EAYC 3GLJA 4DJBA 1UA0A 2RU9A 2HNZB 5HQMA 3SBMA 3CJKA 3SEOA 4ZVSB 3J80Y 1IUJA 4URQU 4GKKF 4JI3F 3I0SB 4OZ3A 1GXLA 3QAEA 2KXNB 4USVA 2DPJA 1LNQA 3LOUA 2HHTA 2YVSA 2YX4A 1Y7PA 2DGWA 5FJ4A 1EB0A 2G0CA 2HNZA 4C8OA 1S6QB 3EJMA 5A0YB 1FK9B 3H40A 1XERA 2NUUG 5LSOA 1VK8A 2HFUA 3I0SA 5CAAA 2QTWA 4LF5J 1S1XB 3EMTA 4KB7A 4ZS6A 5IT9U 2NLWA 4B3RJ 3T9ZA 1IM6A 3KLHA 9RUBA 1LOUA 3CD7A 1PGZA 3SFGA 2W7PA 2WBMA 5IT0A 3GSDA 5A0YA 4DG1B 1FK9A 1N5VA 3WZ0A 4WF9Q 3BGUA 1ZZNA 1IKYB 2OO4A 4HTJA 2GQCA 4YN3B 3ZZPA 4KGZB 2PEBA 2XMAA 3KYLA 4K0KF 2QA2A 3RB3A 2XLKA 2KYZA 4DG1A 3X3UA 4A48A 1SUQA 4KAIA 2QA4S 3Q2TC 1IKYA 2H5EA 1CC8A 1FJGF 4EO6A 4RNHA 4EU0A 2UXCF 1T95A 2UUAF 4WKYA 1JLAB 4U8VA 3IM9A 1VQ4S 4I7FB 2XG8A 4MKAA 1FNMA 4JI1F 3T5KA 3N6MA 4ZITA 4TY9A 4QWBA 2W2NP 3RR8A 5L9NA 4B9NA 4ED8A 4KPCA 3NGKA 1FFWB 2GMHA 4ZPVR 1VMBA 4JI0J 1JLAA 1QSYA 2DNRA 1DARA 4I7FA 2J7WA 2LP4A 1WDTA 2UV8A 1HNVB 5BXIA 3BYRA 1S0OA 2CNOB 2QC3A 2XMJA 4E98A 4LBIA 5GVQA 2QT7A 4YB6A 3DXBA 3DOMB 4KYZA 2H9ZA 3C6UB 2XQCA 5KFLA 2EI5A 4ECQA 4OYIA 5K5MA 4ZIWA 3CCJS 2CPYA 3GG0A 2RRAA 5KFJA 4QWCA 3DOMA 1HHSA 2BANB 1SQEA 1K44A 3TP2A 3C6UA 4NLDA 4AYBD 4K50A 3VR1A 2IM2A 1RWXB 3AODA 4V1Ak 3NGRA 1RU1A 3UD3P 1LV5A 3I56S 4TXSA 2ZNZA 3U1NA 1QJHA 4UT4A 5HMWA 2CIMA 2BANA 1A7GE 4PWUA 1RKJA 4LSNB 4L6V3 2GC8A 1ACMB 1DFDA 4TY8B 3NOCA 3TANA 1BXNA 3HSJA 2ZH7A 1RHMB 1KNZA 4J37A 5E2QA 5F0WA 2M8HA 3A3NB 4HH1A 3C66A 4EUVA 1U24A 4JBCA 6AT1B 2ASDA 4FF2A 3IP0A 2MY8A 3KK2B 4HACB 4UY85 5GMKa 4RNFA 4LSNA 1K1QA 3TA1A 2HIYA 3CJ4A 3GIJA 3PEHA 3X1LB 4DFKA 3CTRA 4TY8A 3TR5A 3P45B 2LEPA 2ASLA 2AEFA 2V2ZA 1X4FA 4AQYJ 1YG0A 3JSYA 1BE4A 3PR4A 1J5EJ 3CCMS 4KFBB 3H7HB 1NH8A 1LFWA 3JQJA 3KK2A 4NLOA 4ECSA 2HIQA 1S48A 2RE1A 3KDOA 5CA5A 3NGSA 5ETSA 4PXEA 4DR1F 2QV6A 2ZHBA 3NS7B 3MTKA 3KWMA 5JXSA 1RWOB 3IG1B 3IGVA 2LQ9A 1EX8A 3FBFA 3HZEA 3HSDA 4ECTA 1RA7A 1UW9A 4KFBA 3OLBA 3RUBL 3HVWA 1M5OC 1TZ0A 2V63A 1LXJA 5IT4A 2KXHA 4RWWA 2DNYA 2YKOA 4OHVA 2C2RA 2AGOA 5LT5A 2R8JA 3IG1A 1N56A 2LFVA 3GIRA 2G1DA 3QGIA 3VZIA 2HFVA 4J9SA 1O8BA 3SCJE 2B4UA 4QW9A 2IVMA 1T8EA 2AJ0A 5ETNA 1SL0A 5JJBA 1CEZA 4OZJA 2IBOA 2L08A 3BV8A 2DR6A 1PBAA 4Q5VA 2NREA 3CB4A 1MMNA 4ED1A 1TL5A 2XZDB 1DJ0A 4DCJB 3PYEA 2EKNA 2V4QA 1HNXF 3PO4A 1WOOA 3RU0A 1YSJA 3BR8A 2KHDA 3RW7A 2DVIA 4DMZA 5KFEA 3P5TL 4ELTA 1YJUA 4FPIA 2LXUA 1T9VA 2CJ9A 3OL7A 1N36F 1S6OA 1RAHB 1ZS6A 4JI2F 2MKHA 3JAMU 3L7OA 1YDLA 3PDNA 2FHJD 3RB6A 3RZAA 4LF8J 4ED2A 2DD8S 1T9UA 2EG2A 2I2YA 3CCVS 4C8MA 4ILRA 4ANDA 2HVHA 3GTYX 1IQZA 2XMKA 3HSGA 1SC6A 3F41A 2R7XA 1F0XA 3MWBA 1VFJA 3FSXA 2EK1A 1IBMF 3MMJA 4QIGA 3G87A 4L3NA 5MLCV 1DBDA 3RBZA 2PN6A 2UUBJ 1FHTA 2VBXA 2VJUA 4ZLNA 5DS7A 3JTNA 3I9ZA 5HJXA 5KFYA 3BSCA 1A0OB 3MEKA 3KG4A 3N28A 5G4DA 2HNDB 1CJKB 3C6TB 5ADZA 2ZH3A 5KG1A 1M5HA 3NNAA 3IGNA 3KNAA 1WHWA 3ILJA 1FDDA 4OYAA 3P6YC 4O3OA 3EDRB 4N76A 4UOHA 1BGXT 1FKAF 4R25A 1WD6A 2HAFA 4C8LA 4NA2A 2HNDA 1CJKA 1VHFA 4TKTA 1X0FA 2R7QA 5D6GA 4OI1A 3UDEA 4URSA 2KRRA 1LW0B 1RWKB 2MKKA 3H2VE 3Q8UA 4HLBA 5H1SV 3MEDB 2HQCA 1YJRA 2BABA 4DU8A 2KG1A 4ATNA 1W7WA 1TKDA 1S1TB 4LRFA 4RUBA 1R8PA 3HSZA 3CD6S 1S9EB 4HHUA 1LW0A 2E7WA 2OFGX 2ZUAA 1PYSB 5D4OA 4F0HA 3MEDA 2CADA 3U27A 4DL3A 4OYXA 2H51B 2J9DA 1R0AB 1ZM3A 1F9EB 2W2MP 2D41A 4F8RA 1VQPS 5JVHQ 1NJZA 1S1TA 2FDNA 3MI7X 3GWCA 1S9EA 1VLOA 2XMWA 4FYDA 1TP7A 4QWAA 3N0VA 4K4SA 3DU5A 4L75A 3T19A 1W2IA 3WQPA 2DH7A 2PO4A 5HQLA 5C5JA 2VKRA 2CQHA 3MMCB 1R0AA 5A76A 1RHJB 2W7OA 4EK2A 3BQ2A 4IYQA 2E7VA 1FRHA 3HFVA 1HARA 2W9CB 4OX8A 4TU8A 2RH3A 4R0JA 3HCXA 3GG1A 2W7AA 4DEZA 3CIMA 3MMCA 5DZ6A 4LJMA 4LF6F 2KG0A 4NRTA 3KK1B 1LFPA 2W9CA 2XZWA 2HHHJ 2MPUA 3CJ8A 2KM8C 1CQMA 2VIHA 1HW9A 3NNCA 3K7RA 1NXIA 1R27B 3MF5A 3KK1A 1RHKB 1RTDB 5J1EB 2B7BB 4G1QB 4WZQA 2CWXA 4OYPA 1RWUA 1YRUA 1CULB 2C1EB 1F9HA 2CQ4A 3SIPB 2YNGB 1LKZA 1FCAA 3HJFA 3MD1A 1RTDA 1RT1B 4OV1A 2GVDA 1JLGB 5J1EA 4G1QA 4NZ6A 4LF9F 4WTOB 2JSXA 3KG0A 4CYUB 4F3MA 4JOUA 1JX4A 3EUNA 2UVUA 4ER8A 2EK6A 2YNGA 4X65F 2BACA 1RT1A 4FNIA 4ZCKA 1F5CA 1JLGA 1X7VA 4A47A 5K20B 1U1RA 4CYUA 4PQUB 1NMEB 3MPVA 3EXYA 1FXRA 2XCPA 1CPZA 2HZCA 1OMSA 4C4WA 1OYEA 2FJEB 1T9TA 1UFWA 3BPSP 1QTMA 4XPCA 3W2VB 4ZVTB 3ZZRA 2M88A 3K2YA 2IC3B 1L5UA 3CCQS 3T41A 2RT3A 4QPTA 4YHHJ 4E0DA 1NDPA 2G2OA 3NKYA 1DTTB 2DPIA 1KSPA 4Y0FA 5ETLA 1FD2A 3W2VA 5HVGA 4ED3A 3UO0A 2IC3A 1I6JA 2O66A 2L9DA 4I6YA 4BWJA 2V8HA 4TQSA 5A6PA 2P2CB 2HW3A 3A1YG 1RJJA 3CC4S 3PW2A 1JLFB 3UN3A 1LK7A 5LJ3Y 2P6TA 4OL8A 4CO3A 1Q7YT 3L7PA 4FKXA 1RKIA 4KE5A 3BDPA 2EFQA 3QO9B 3MCOA 2PEHA 3PCOB 2ACMA 1IBKF 2JZ5A 2YTCA 5CYJA 3KTQA 1VBXA 4FZVA 3GONA 3SSSA 2F1FA 4RUHA 2HLUA 2C3UA 2JEJA 3D6FB 2B9WA 4FYYB 3OFGA 3H4DA 2KO1A 2W1BA 1JLFA 1ELOA 2ATLA 4ZDNA 3BGFA 3EGZA 1RWWB 2GIRA 4A8QA 2FQQB 3QO9A 3J7AN 4QR2A 3J81U 3THVA 4Y2KA 3FKBA 2RSQA 4FNHA 2N4DA 1TFYA 4HH0A 1XTZA 4K2XA 1PILA 1TUVA 3R5CA 1MNEA 1RAGB 3NGUA 1V3SA 1YHQS 4V19X 3QGPA 4FBUA 2RNEA 2RUGA 3WBZA 3OR1B 2KJVA 3MR6A 4YEAA 1S9GB 3C19A 4OI6A 8ATCB 2OSQA 5IFMA 1DQAA 3RB0A 4YOEA 5A8RA 2RF2B 5C7PA 5HJYA 1W2BR 2AGPA 1F3VA 2VQFF 1RAIB 1S9GA 3H0PA 2BM0A 3K57A 7FDRA 2MLYA 3ILLA 1RWPB 4PWWA 3EVWA 2RF2A 1X5OA 3RRHA 4UZBA 5FIIA 4NLWA 5D4NA 3AOBA 1BMQB 1NK9A 2MQNA 3W64A 4IO9Q 3W5YA 2OEMA 1NZAA 1Z2ZA 4GKKJ 4O3QA 4JI3J 2VHGA 3PFEA 3HD2A 3TAQA 3HHLC 2AZ3A 1H6KX 2IJFA 1YIJS 2XS2A 2CAJA 2Y1JA 2VFSA 1RYSA 4NLYA 4DV0F 5EX0A 3TW0A 2I9SA 4MK9A 3A3PB 3W2WB 1AT1B 4LVNP 3HI9A 1X0PA 4A8KA 3ELHA 1PC4A 1GT8A 5C2GA 2MMYA 2YWKA 3MPWA 1Z4UA 1WF2A 4J9OA 1SC3B 3W2WA 3ISNC 1EP4B 1N34F 2KU7A 1HFEL 1SI9A 1P27B 1FJEB 2QE5A 5K8MA 4N5SA 1U09A 2KT5A 4DL6A 3GJRB 5I3PA 5ITHA 1FWKA 3OLAA 1PJ7A 1Q16B 4K0KJ 3IBWA 3MMAB 5AT1B 1N8RT 1IWGA 4U8YA 3W5XA 5AJ3J 1YK9A 1AFJA 5BR8F 3OTOF 3E51A 1M1HA 1BD6A 1Q86T 1SH3A 4YP3A 3EPIA 3F0NA 2UXCJ 2UUAJ 3LP2B 3FEXB 4IQMA 3PIOQ 3FGVA 3MMAA 4EEYA 1U8SA 1IQTA 4RU9A 1RAJA 4KH0B 4EYHB 4J9KA 2HK2A 5K8OA 1VIXA 4MMOA 5KOWA 1TUWA 3WDOA 1KD1T 2CZVC 3DDKA 2HMIB 2WVEA 2XHCA 2OH2A 3VVUA 3R6GB 2IRXA 5CQGA 4DWIA 3LP2A 2BYCA 3AD9C 5LL6d 1YZ6A 4KHRA 4EZ9A 1MLAA 3W9IA 2NUHA 1SIZA 4DBQA 1TKZA 3DRPB 3DU6A 2ILYA 2XC9A 3GFXA 5I42B 3RB4A 1M1KT 4C97A 2HMIA 4WIIA 1B0TA 5LMNJ 1H2VZ 5FDLA 4B3MF 2F4VJ 3KUGA 3T3FA 4MIBA 4OZ2A 1R31A 3K59A 3AXKA 4W92B 3CD5A 4RW6B 3LO3A 4L74A 1JK9B 3KLGB 1FFGB 3DRPA 2DR7A 2G0IA 5I42A 3MDFA 1TVRB 4AT1B 5B0CA 4AL7A 1WACA 3WHIA 3A8IA 4OI2A 3R6LB 3MAQA 3D54A 1S72S 1FERA 2Z4PA 1MU2B 1D8ZA 5J2PB 4QU6A 4RW6A 4MFBB 4Z7CA 1CS4A 4CO4A 3AQOA 1RB0A 1NAQA 1OSDA 1UKUA 2JLGA 3KLGA 1R8HA 2MSSA 1FX4A 4U7CA 4DV5F 1TVRA 2L3MA 4I69A 4XAKA 2CPDA 1WTFA 1PAUB 3R8YA 1MU2A 4QU7A 3BJYA 1QAJA 5J2PA 4J9LA 4B3TF 2X7IA 1RTZA 1UWBB 4MFBA 1SV5B 4MJKA 5KFFA 4MKVA 3FBEA 2PE8A 3KLFB 5FD1A 5B7WA 3DRYA 4DR6F 1X4GA 4ZPDA 3DXSX 2DRAA 2QN6B 1S7IA 4JV1A 4DN0A 4L73A 4K4TA 1UWBA 3R1HA 4FF3A 1SV5A 3QZ8A 1Y5LB 3CCRS 5ETVA 2WSFC 1KTQA 3KLFA 3AT1B 3CIZA 5HK4A 1TV6B 3G6VA 5I3UB 2DBBA 2JFKA 2R8KA 5HLFB 4USKA 2OIHA 3QQCD 2AYBA 4Y00A 2E5HA 3DLEB 4CO2A 5I3UA 2I38A 1FWLA 2NXNA 2QX0A 3TQEA 3WIUA 4ZPBA 1EIYB 2VFVA 2FZGB 3Q8PB 2JH3A 2XMTA 4J9QA 3OXFA 4CLLA 5HAOA 3VAIA 4P74A 4R0EA 2DITA 4Q8EA 1XMBA 2ZZTA 4DLGA 2HGLA 3R5BA 2FVQA 1YJTA 4IRKA 3J81Y 1IKWB 4LF1A 3I5AA 4NASA 4JI8J 3DLEA 1N6QA 1VOMA 1TKTB 2WVCA 2GNKA 1FD8A 1U6BA 4TN2A 2J6SA 2HBZB 1HKAA 3CJQA 3HVRA 4NCGB 3TEHB 4JYAF 3MPUB 1ZM9A 4OZLA 2E5JA 4B3RF 4O3NA 1IWAA 1WHYA 3H5SA 1IKWA 1T02A 1VI7A 4DL2A 3GFHA 3UDVA 1TKTA 2DNQA 1IKVB 3UVJB 1OPIA 2Z57B 1GMWD 2WB4A 4W98A 5L8RC 2RMLA 4NCGA 3M8QB 1HNXJ 2HQ3A 3FVYA 5DM7Q 1OJ4A 5A2QU 4N77A 3B8HA 1DQ8A 3BO4A 1SJQA 2DNGA 4NZ7A 1TU0B 2FY1A 1IKVA 3UVJA 1N36J 3HHDA 4JI2J 2WHOA 3TA2A 3M8QA 2QO3A 2V4RA 3IBCB 3L3CA 4L76A 4CLWA 2IMWP 2B7CB 2Y1RI 2X3GA 2LMIA 3PJ9A 1WKJA 1XQIA 4AXJA 5B0DA 4F02A 1I51B 4YS2A 3HFKA 1UVNA 2MQPA 1YRXA 3QJJA 3FSYA 1K0TA 1HWUA 3BDEA 4ZK7M 2J9EA 1U45A 3PYGA 4JI0F 4YR0A 2V94A 2KHCA 3DRSB 3DRXA 2ZH1A 4F25A 3Q8QB 3VAKA 3CCUS 1IBMJ 1LWFB 3OL9A 4PG7A 3D0IE 3L4BC 1H74A 2BR0A 4HR2A 1KRPA 4TU7A 3I6PA 3GIKA 2Q43A 1Q79A 3TYTA 3DRSA 4IDKB 5AXNA 5IM0B 1Y4ZB 1LWFA 1AUDA 2APOA 4Y34A 1U48A 3BF4A 4HL9A 4C98A 1D8YA 1UVIA 2J8SA 3NNHA 2IM0A 3FJ2A 3FCHA 4CLKA 3CEDA 4OQJA 4YFUA 1RT4B 2BQ3A 3MHYA 4JI7F 4IDKA 1Y11A 5IM0A 2OLWA 4AD6A 4J5OA 3M8PB 2VDIA 3OTEA 4XDDA 2AT1B 2HVDA 2E29A 1KONA 3LW5C 5MAOA 2E9TA 4HDHA 1XNRJ 3GV7B 4X66J 1B0VA 1WC3A 4ED0A 1Q4RA 4OI3A 2EFPA 3QIDA 2XY6A 1RK8A 1RT4A 5HROA 2DHXA 2CG8A 2DCUB 3M8PA 1HI8A 4JI6F 3ENAA 3JTOA 1N48A 2UVWA 5L38A 3VAHA 3MOJB 1NCLA 2WONB 4PABA 3OL6A 4DS5A 4QIEA 3N6LA 1J5OB 2ZFHA 1NDKA 4ZOSA 1KS2A 3HVTB 1TKXB 2PSZA 2KT3A 1HNIB 3DNCA 3LAKA 4HDGA 5HP1B 1JIHA 5GAHI 4HVZA 2Y1LB 1RACB 2PMHA 3BB5A 2HRTA 3R5AA 1FTCA 2RS2A 4AQYF 1H3DA 2I6WA 2WONA 3DM2B 2AYEA 4C0HA 3PJWA 1J5OA 2BKPA 3ZZYA 3D1QA 3HVTA 1TKXA 2HURA 3AH6A 1HL6A 1HNIA 2XB2D 4OX6A 1P6TA 5H9FK 5EWEA 4FYWB 3BN4A 3ZTOA 5HP1A 3QPIA 2V9KA 3ILIA 2CYYA 3JQKA 5A6WA 3D6TB 2VZ9A 3MD3A 3EYZA 4EBDA 4L3KA 1G1XA 3FZ2A 1F2GA 1EKSA 2DHGA 1K1SA 1GAOA 3DM2A 4QW8A 2VPZB 2ZD1B 2FGOA 3QT5A 3LWMA 3RRGA 4DF4A 3UE2A 2WOMB 4R5PB 4MIAA 1X5SA 2HFOA 3OFEA 3AD7C 1XMOF 1E6YB 1C0TB 4PG5A 4NCAA 4E8UA 4CO1A 2M5YA 1FXDA 1N0UA 4X4TA 3HZGA 2AW0A 4CNYA 1H0HB 2XTJP 5KG6A 1VQMS 4UZCA 4NYOA 4DR7F 2IYGA 2EPIA 2ZD1A 2KZMA 3FC9A 4LF6J 1RBAA 3O1LA 1SL2A 2JOQA 2A6MA 4X64F 2WOMA 4R5PA 2WTFA 3W8GA 1KHWA 1E6YA 1C0TA 2IA6A 6FD1A 2DNHA 2G13A 1S12A 4M5JA 3MAAB 3H5UA 1JXEA 2LLZA 1RE1B 3LP0A 3J81j 1HBOB 4X4QA 1SJ1A 1ZOTA 4ID5B 3S6EA 2V67A 3QATA 2EW9A 4Z2XA 2K3IA 2E9RX 4IR1A 3DDIA 4M94A 3J7Z5 4UOGA 3MOZA 2GVZA 3J7YI 5IZHA 1L3UA 3MAAA 3M6WA 1HBOA 4ID5A 4Q44A 1F9FA 1ZM2A 3V6DB 3SXLA 2HGMA 1F2HA 4A46A 2OMLA 5E3RA 4NMXA 3LWLA 1UWAA 3TVKA 2BA9A 4USMA 4ZJOA 2QSWA 2ZH5A 5K8NA 3WX8A 2DGTA 4K5RA 3QGHA 4M5KA 4LF9J 1VC5A 3ETOA 3TA0A 4RX6A 2WW8A 2H48B 3HFZB 3V6DA 3OPKA 4X65J 5T41A 4Y28C 2PT0A 5ETMA 4I6AA 1RT2A 1T0TV 2JC1A 1MN7A 2E5IA 3OHAA 7AT1B 3HHKA 4C8YA 3UD5A 2JEFA 3MUTP 1GTHA 2ZH8A 5HMZA 2KM8B 4ITSA 5F3ZA 3B78A 1K9MT 3A4TA 3KNGA 3LANA 4ZLPA 1FE0A 3T5LA 2ILZA 2AF6A 3IWXA 5H9EK 1KVKA 1QY7A 4JUZA 2E7XA 1T3OA 4M5LA 4RW7B 3WC0A 1U49A 3Q0AA 1NK5A 2VOOA 4J91A 3NGTA 2XYPB 5A2QY 2G9OA 3N5FA 4UY8T 4B9VA 4XDCA 1RT6B 1IBLJ 2BJ3A 4KPYA 4B08A 3R7SB 1RWNB 2FHMA 1K47A 4B9UA 2VONA 4RW7A 4NLXA 3THTA 5IQ6A 3HKWA 2DRDA 2GAHC 5DM6Q 1VCTA 2ZBRA 2W25A 4K4ZA 3HP6A 1NK8A 4ZJQA 1RT6A 4A8MP 3R1LA 4C7QA 2IDLA 1T94A 3GIMA 4WKRA 2W01A 3HT0A 1IBKJ 3OJSA 1NSKL 1HNZJ 5GAEI 3IRWP 1LWXA 3RYLA 4OJ3A 4YB7A 1JNRB 1NLKL 5KT4A 2VB6A 1UVKA 2OPRB 1KQKA 2KXFA 1GTEA 4RKUC 2F7VA 4DSIA 4C11B 2CUYA 2VBYA 4DI6A 1PBUA 3TNVA 1SH0A 2L41A 4UTGA 5KT7A 3JSBA 3T5JA 4WU3A 4DX6A 3S7RA 1MN9A 2B9EA 1HHTP 2WSCC 3OR2B 3FCVA 1VLYA 3L95X 4K8RA 1D9AA 1HQUB 4C11A 5EGYA 2COLA 1VQ5S 3NP5A 2DRBA 2B8QA 4C3LA 2W2QP 4DUTA 4DLEA 1FJ7A 2Y9HA 4C0OC 4ZPAA 2LKZA 3OR2A 3BR9A 2VFTA 1HQUA 1QM9A 1TAQA 2VQFJ 1FDAA 4QYZK 1JWWA 2OTLS 2N7CA 3CJSA 1NHVA 1XR7A 2FVSA 3W60A 2LU2A 1RAOA 5LXRA 3T1HF 3CDAA 2H1YA 1KOHA 3BKUA 1Q95G 3NCQA 1SKUB 3R5GA 4K4VA 2AEMA 4LT6A 4WU2A 3CDWA 3K5LA 1HQEB 3VGVA 4ECWA 5EUHA 3I31A 2R2SA 4ES1A 4P2XA 1F5BA 2KZZA 2HQIA 2V2QA 4DR4J 5CYQB 1WNEA 2CDQA 1RLDA 2UUWA 4A8YA 5B0AA 2FUG9 2H4YB 1CLFA 4DV0J 5HMYA 1KWMA 3MUMP 1U1OA 3HJVA 2GCFA 3GIIA 2XCAA 2HPUA 3P3DA 4ECZA 4KBIA 2QYCA 1HQEA 4A8SA 1J2VA 4RNNA 2W4CA 4USWA 2SXLA 1HIYA 2FC9A 4DSJA 5DQHA 5CYQA 4WP9A 1Y5IB 3JS9A 5KFAA 1H72C 1OY9A 3IAM9 3IC1A 2X1GA 3H98A 2IJRA 5CABA 2BM1A 1N34J 3I32A 3N6NA 4A8XA 2RQ4A 2C2DA 2LQBA 2VBZA 2ZNYA 5GAHU 1VQYA 4F4YA 4J9NA 3POTB 4PYAA 1RWVB 2M52A 2V0NA 1MWZA 1WC5A 1CJUB 4WWSA 2HRUA 2KKHA 2Z58B 1NB2A 2JL9A 2CQ3A 2DIUA 3OBIA 3SCLE 1Q8KA 3MXHP 2RQCA 1JJHA 4K4YA 1OYDA 5DO2A 2YWFA 4CDIA 3POTA 2V9WA 4M5GA 1CJUA 3GZ7A 1K73T 5KTQA 5M2PA 5E41A 4ENOA 2Q6BA 1XIQA 1RT7A 2RIJA 2YY3A 2R8HA 1WG4A 2BV3A 4AFFA 4LFCF 1T7PA 3PW4A 2ZJQQ 2DR5A 4DUYF 1HPZB 1XMQF 3RAQA 5DDRC 4JI4J 3MM6B 4WBFA 2OD4A 2HKEA 1NPRA 2IBKA 4O3SA 1WI6A 3D0HE 5EHHA 4J9PA 3TX0A 3V6HA 1GEHA 2K1RB 5CCLA 2DK2A 3US5A 1NK7A 1OQ6A 3GYGA 3U7JA 2EBGA 1HPZA 4PG8A 1SBRA 2A2CA 3C3LA 5E33A 2QEXS 3MM6A 4DN9A 1YJWS 3UCUP 3AXMA 2BE2B 4OYWA 4C48A 2BE7D 1WOPA 2ZVIA 4KGKA 2DR9A 2AEJA 5B0BA 2K1RA 3M8YA 2DGVA 1UJ5A 1FESA 3J7YU 3OTCA 5HI7A 1YVFA 2B51A 4ZP6A 1QAIA 3V2UC 1O5JA 2XZTB 4G6VB 1DLOB 4HT7A 2NPFA 2BE2A 3MM8B 3CCSS 4WK3A 2KFZA 1MMLA 1KEKA 1SJ4P 4ZJLA 5C42B 2D9OA 1LK5A 4DCPB 3VQTA 2Y1IA 4RW4B 5D78A 4PG4A 1R0CB 1UPPA 1H98A 1U4BA 4PAAA 4DV5J 3NXZA 1DLOA 2GJIA 3MM8A 2V5HG 3T1YF 2P9GA 1C2PA 1QUVA 2QA1A 1IKXB 5C42A 1FVQA 4RW4A 1UZDA 4ZVHA 3PTWA 3BBBA 3R2CJ 3UW1A 3UNGC 5HANA 2VD3A 4DR6J 3AA8A 2FB0A 5IWAJ 1C1CB 1RCXB 2ZDPA 1VC0A 1YITS 4NLRA 3KLEA 1F5AA 5ETTA 2XWYA 1FF2A 1JLBB 3IS9B 2ATCB 1IKXA 3N5BA 3Q24A 2DXFA 4P2SA 1R89A 1SJFA 2DO4A 3BGLA 4ZPWR 4P2FA 2A3JA 5KFRA 2AHOB 2V68A 3IWNC 3HKZD 1QD1A 1B64A 1P1LA 2XI2A 1C1CA 2ADBA 1P1TA 2UP1A 4OHYA 3PVXA 1JLBA 5HMXA 4DSEA 3IS9A 4RWXA 5B09A 1U2CA 3V5RA 3Q22A 5CXTA 5IV3A 4DFMA 1YTYA 2FJWA 5EN1A 2XSFA 3EE3A 3PYFA 2VODA 5D8HB 3B4MA 3Q89A 4EWTA 3VV2B 5LSLA 3D5MA 2GFFA 1JQGA 3W8PA 4H4KC 2J9CA 1JLQB 5DQIA 2HS3A 3KLHB 2NQPA 3NWRA 2BRLA 2AJQA 2EKYA 3NAIA 3HVAA 1NEEA 3ZTQA 4BBYA 1O51A 1JJ2R 1OWXA 3LA0A 5L1JA 1NKBA 4F0MA 5GAEU 4ZPTR 1VRUB 1KLNA 2V8GA 4JYAJ 2GIQA 1JLQA 4FPRA 4P7TA 3K5PA 2MQOA 2AGQA 4Q2LA 2FJBB 1UP1A 3NY0A 1RHUB 4LMZA 2CQ2A 2M70A 2POKA 5KFVA 1SUQB 1OQ3A 4QR1A 2CPZA 1S10A 2JHEA 4EMDA 2QMXA 2DKOB 2E5GA 4RR5A 3KDNA 3MPDA 4DL5A 1VRUA 2UZAA 4DL4A 3UD4P 4FXWA 1OIAA 3GE9A 1S59A 2RILA 1SKRA 4CLZA 4DFJA 5AJ3F 5AE2A 2HS4A 1VQNS 1Y3KA 4CTAB 1WOSA 1GMVA 1HR0F 1QE1B 3HX9A 4BWMA 2RRNA 4D3HA 3DLBA 2PA3A 2E1AA 2CPEA 1F60B 4ZVPB 2F9DA 2D3UA 2FPHX 3ZNUA 3MPYA 3A12A 3OXLA 2QL7B 4CTAA 3RR7A 2P9EA 3Q8RB 4F4AA 1QE1A 4X4OA 4O23A 9ATCB 1C4CA 4ZVUB 2XEXA 2PGCA 3EZ5A 4X4RA 3M9MB 2GV1A 2A0FB 2FD2A 2FVRA 2HHUA 2W4DA 4Q43A 3R5JB 1HHQA 3TWZA 3PJXA 2BUNA 4K2JA 4ECXA 3LH2S 5SZTA 4DQRA 3ENQA 2E1PA 4HI1A 1HWLA 2XULA 5LMNF 3DI6B 4PPDA 2ZJPQ 1RTHB 2F4VF 3AY0A 4DR2F 2OFHX 4X4UA 2EWHA 4AUKA 1YGYA 3D7SB 2KDOA 2GW8A 2UXBF 2FVPA 3QWUA 4KC5A 3N9UC 5LOQA 4NEZA 4TLQA 4F0KA 3DI6A 5KFDA 1LWCB 4P71A 3G4SS 1RTHA 5KFQA 5L9XA 4JI7J 1V6HA 3PR5B 2Z2ZA 3QNWB 2X1AA 2G0JA 1U0SA 2QRRA 4WYWA 1UTAA 2GIFA 1VQOS 3FBCA 5L1KA 3BKFA 2R4FA 3ZNJ1 3D6MB 3RGIA 1AYEA 4DV6F 1LWCA 2IA0A 4ELUA 1TTHB 3CCWA 5D0RA 4DPXA 2OAUA 2R7OA 3NG8A 5EWFA 2DGUA 4B3SJ 4DX5A 2QLBB 2CPXA 4JI6J 2G2ZA 3CJ5A 3PW0A 3FZBA 4BC9A 4J9RA 2ZH2A 1FI4A 1WEZA 2IMOA 2VC0A 1FKOB 2KN4A 1RHQB 3EX7B 2E1RA 2FLPA 4C3KA 5DETA 5AXMA 3E3XA 2U2FA 1RHRB 2J7UA 4GVLA 1X8DA 3DHXA 4TLRA 3S01A 5D4LA 2FJXA 3LTOA 1FKOA 4KGMA 1CVJA 4ECVA 2ROEA 4NZ0A 1WC0A 3G86A 5D0GA 1HBMB 3PY8A 1C1BB 2UVRA 2R8IA 4CT9A 1VQ7S 1M1GA 1TK8A 3NBPB 3SCKE 1PO6A 3LGHA 4NYZA 1ZA2B 2VJVA 3EGVA 4HYKA 5A8WB 4DF8A 4ZCIA 1R7IA 3UCZP 1L3KA 1XMOJ 3TEGA 3O5TB 2QYGA 1HBMA 3ITHB 2BXJA 2LXFA 4PXBA 1ZBTA 3I5CA 1C1BA 4UUXA 5CD4A 4IRCA 2DGOA 4X4SA 3NBPA 1YLXA 2J5AA 4JI8F 4DR7J 2DNPA 4F3QA 1NSQA 2MLZA 3H59A 2PFDA 1RTIB 3HDSA 1Q8IA 2OKQA 5A8WA 3HLUA 3GB0A 3PX4A 3MFHA 4X64J 3EM1A 4WP3A 5LMUF 2B6AB 3I0RB 4S0MA 3QZ7A 4JV5F 3ITHA 1RUSA 5LJ5Y 3IO1A 2MZQA 2R2UA 4LREA 1RP5A 2HGNA 4DV7F 2JC0A 1RTIA 2I1RA 3ILOA 2LDYA 1SIWB 2ZITA 2U1AA 2CJQA 2NXCA 2B6AA 3I0RA 2PI5A 2Y8WA 2CQIA 3HMJG 5KFIA 3RTVA 5F3TA 3BM7A 3NS6A 3ETMA 3ISZA 3CE8A 1YX2A 1KFSA 4KY3A 5KFKA 3LQVA 2WVDA 3T5HA 2EC0A 3M9OB 4I2QB 5LM7E 4P6QA 3PV8A 3RRKA 2HBYB 2VG6B 3QFHA 4OFZA 3SDEB 3D1HA 3H20A 4YDXA 4DUZF 2VPYB 3CO0P 2EFOA 4YB5A 4C8KA 1TMMA 2BJDA 3ZXWA 1R8CA 1N5SA 5BYSA 4Y3CA 5B08A 4WCEQ 5F8JA 1RA6A 4F04B 3GQCA 3EXCX 3PFOA 3W66A 1U26A 4I2QA 3M1VB 4FYXB 2HFZA 2BQUA 2VG6A 2XO6A 3V81B 3SDEA 2FJAB 4LF4F 2DY9A 4CH0S 1TR0A 2E9ZA 1TAUA 4PG6A 3DMJB 3FMBA 4DV1J 3CSKA 1UJ4A 3BREA 4WIQA 1WTBA 2IPOB 2ZKTA 1FDBA 1ZAXA 1YI2S 5IT9Y 4ZP7A 3M1VA 2LVWA 4DOZA 1IM4A 3J80U 2HAIA 4USTA 2VOPA 1O6XA 3V81A 4I56A 4OLPA 4CLTA 1BQXA 1N54B 4G65A 1Z2LA 4NLUA 4I0WA 3KUHA 5L46A 3DMJA 3JTPA 2ZM6F 3M05A 1RSCA 2CWKA 3H42A 2BZ2A 1F3FA 5M2RA 3LPEA 3OV7A 4LFBF 1X4AA 2K8GA 2D74B 2ZVSA 2OEJA 2HRYA 2CPJA 3SZ2A 5DRKA 2DGXA 4IFVB 1W26A 2QIFA 4GMKA 3NEKA 3MCMA 3TZZA 3VGSA 1JXVA 5C25B 5DZ7A 1MWQA 1N33F 4RW8A 4RW9B 3PX0A 1VHIA 2Y0BB 4FS2A 3PO5A 2FHOB 3TZWA 1XNRF 3TJ9A 4X66F 3KXDA 4RZRA 3QIPB 4IFVA 2YQ3A 1GNKA 3CJRA 4NLGA 1FEHA 5C25A 4ZP8A 4F2RA 2BEFA 3FNNA 1VQSA 2JWNA 4NXNF 4RW9A 1B7FA 1UMJA 3M2VB 4DPUA 4WXWA 2PA8D 3TX8A 2BKNA 3FEZA 2MYFA 3QIPA 4UW2A 2W4PA 3TAPA 2FY8A 2K3KA 4LRDA 3THPA 3JYTB 2VPXB 3H8YA 1XK8A 1WHXA 3UCGA 2WBRA 4Y2AA 3O8WA 3BH7B 3CWJA 3M2VA 4PCQA 2CNLB 5E3CA 4ANEA 3F73A 1FDNA 5C2CA 4M63A 1QSLA 1RISA 2LU1A 3DOLB 3FDSA 2A2DA 4J7CA 2AV5A 1HWJA 4CI0B 2QLWA 1EARA 3UN5A 3JYTA 2JLEA 1N52B 2C2EA 5B0GA 4F4XA 4ECUA 1UVLA 3G8SA 3GYXB 3WIVA 4IO1A 2P9CA 4KHMA 1KQFB 4F50A 2HNYB 2RQMA 3EVOA 3A3OB 3U02A 2MLXA 2N7YA 1VQ9S 3DOLA 3HULA 2ZBCA 3UFCX 2UU9F 1UEKA 2C3MA 1PYOB 2VA2A 1RXOB 2I5JB 5D77A 2FZCB 2XGQA 2NSBA 3ENVA 3VF0B 2DH9A 1XEZA 5KFSA 2HNYA 2EXUA 2FHKA 3T1HJ 1RAEB 3PZPA 4GVBB 1CQNA 1ZPWX 2I5JA 4FS1A 3QT7A 1T9YA 2ZE2B 1NHUA 4EO8A 1FRMA 1J27A 1SXLA 4GVBA 1RDRA 1RGVA 1S9FA 4DQSA 4TQRA 1Q5VA 4PKDB 3CCLS 3SSRA 2GVDB 1VRQC 1GFWB 1FO1A 3RBEA 2ZE2A 4AE5A 5EDWA 1KR4A 1HYSB 4A8WA 1F1BB 1PKUA 1VJWA 2W2PP 4DR5F 1RADB 4WK1A 4LF7J 4B9TA 2R7VA 2YPZA 3LGMA 4DXLA 2ZH9A 2NR0A 2J0QD 1I3OB 3QGGA 3PW7A 4B3OB 4GRSA 1HYSA 1T9WA 2W9BB 1M5VC 1DRZA 2QFIA 1NDCA 3IN5A 1X4EA 3DLKB 2H3EB 3IA0A 1GK8A 2NXUA 1VRTB 2GQ2A 1YJ7A 1G7CB 3T6BA 1T03B 3OW2R 2FC8A 1VIOA 4B3OA 1I94J 5HL7Q 2W9BA 1X31C 2DNKA 1FKPB 2YXLA 2FLLA 3KOAA 1ZH5A 4LFCJ 5KG4A 3DLKA 5FLXU 1AA1B 2A6OA 5KFOA 2NXEA 2OEKA 2AMCB 2B4VA 2DNZA 4DUYJ 4DQIA 4ZMMA 1XMQJ 1NPPA 1VRTA 3MMBB 4W4MA 4DFPA 3M6UA 1T03A 1R8AA 2VC1A 2Z30B 2BBEA 4QYRA 1FKPA 2IJNA 2FJDB 2DGSA 4P9SA 3UI3A 3UQSA 3ZZ0A 4CH7A 4DV3F 3M6VA 4H4OB 1IBLF 3MMBA 1TQLA 2F4FA 1PG5B 2N4CA 4RU2A 4NCBA 2W2OP 3JAMY 3UN2A 3MM7B 4LQ9A 5ETPA 3AHPA 3OTDA 3CMAS 3F56A 2VPWB 1BQNB 2VF3A 3OJUA 4ILMA 1NZ8A 2MJNA 4WFAQ 2HS0A 2QLFB 4H4OA 1N5QA 3Q83A 1R43A 2R7UA 1N0VC 2KJWA 3M8RA 3FMWA 3R5DA 3BGOP 1HNZF 3MM7A 2YQ0A 2B56A 3GU0A 2CG4A 2DNMA 4OZ0A 4DSKA 5KFZA 1BQNA 2OD6A 1WG1A 3VAFA 3R97A 4UQTA 1S97A 1MMDA 2MZJA 3T1YJ 2R7WA 4O4GB 2HG4A 2DHHA 3RJMB 1PJ5A 5KT2A 2OPSB 2FZKB 2FLNA 5A8RB 3OSPA 2HZVA 4A8OA 2XI3A 4NL5A 1VJQA 3NRBA 4LF2A 4WJBA 1R0BG 1TUGB 2WVBA 3KUEA 4LR8A 1DURA 4LIWA 4O4GA 2CXEA 2FJVA 1MROB 3M2UB 2M0GB 2OPSA 3OTBA 4F67A 1N32F 4Q0BB 3J7ZT 5L39A 2HYIB 3HK2A 2C3PA 3QLHB 4ZVQB 5GAGI 3CF5Q 3N4WA 3MGJA 4Y6IA 3IRXB 5GADI 4KKOB 1S6QA 2WW4A 1M90T 1REGX 2UXDF 1Q7LB 4Q45A 1MROA 3M2UA 5EWGA 2BJ1A 2R3VA 4Q0BA 3PHEA
chains in the Genus database with same CATH topology
1AB8A 1CULA 4OYAA 4CLSA 1FX4A 4CLUA 2GVZB 3C14A 4OZ3A 4P2XA 5D0HA 4CLPA 1WC6A 1WC0A 4USVA 5D0GA 1YBTA 3ET6A 3C16B 5IV4A 1CJKA 4P2FA 1CJUA 4CLFA 3UVJA 4USTA 3G82A 4CLTA 4CLLA 4OYPA 1TL7B 1AZSA 1CJVB 1CS4B 1U0HA 5D0RA 4CLKA 1CULB 3MAAB 4WP8A 4CLWA 1CJTB 4USWA 1YK9A 5IV3A 4OYMA 4WP9A 4NI2B 1Y11A 4OZ2A 3C16A 2QV6A 2GVDA 2W01A 3C15B 1TL7A 4CLZA 1WC1A 1CJVA 2GVZA 1WC3A 3C14B 5D0EA 1YBUA 4CM2A 3MAAA 4CM0A 4WPAA 4USUA 1CJTA 3ET6B 4WP3A 4CLYA 3MR7A 1CJKB 1WC5A 1CJUB 1Y10A 4OYOA 1FX2A 4NI2A 2BW7A 3UVJB 4P2MA 4OYXA 3G82B 2WZ1A 4OYZA 4OYBA 2GVDB 1CS4A 3R5GA 4OYWA 1AZSB 1WC4A 3C15A 4OYIA 5D15A 1U0HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AB8 A;  1CUL A;  4OYA A;  4CLS A;  1FX4 A;  4CLU A;  2GVZ B;  3C14 A;  4OZ3 A;  4P2X A;  5D0H A;  4CLP A;  1WC6 A;  1WC0 A;  4USV A;  5D0G A;  1YBT A;  3ET6 A;  3C16 B;  5IV4 A;  1CJK A;  4P2F A;  1CJU A;  4CLF A;  3UVJ A;  4UST A;  3G82 A;  4CLT A;  4CLL A;  4OYP A;  1TL7 B;  1AZS A;  1CJV B;  1CS4 B;  1U0H A;  5D0R A;  4CLK A;  1CUL B;  3MAA B;  4WP8 A;  4CLW A;  1CJT B;  4USW A;  1YK9 A;  5IV3 A;  4OYM A;  4WP9 A;  4NI2 B;  1Y11 A;  4OZ2 A;  3C16 A;  2QV6 A;  2GVD A;  2W01 A;  3C15 B;  1TL7 A;  4CLZ A;  1WC1 A;  1CJV A;  2GVZ A;  1WC3 A;  3C14 B;  5D0E A;  1YBU A;  4CM2 A;  3MAA A;  4CM0 A;  4WPA A;  4USU A;  1CJT A;  3ET6 B;  4WP3 A;  4CLY A;  3MR7 A;  1CJK B;  1WC5 A;  1CJU B;  1Y10 A;  4OYO A;  1FX2 A;  4NI2 A;  2BW7 A;  3UVJ B;  4P2M A;  4OYX A;  3G82 B;  2WZ1 A;  4OYZ A;  4OYB A;  2GVD B;  1CS4 A;  3R5G A;  4OYW A;  1AZS B;  1WC4 A;  3C15 A;  4OYI A;  5D15 A;  1U0H B; 
#chains in the Genus database with same CATH topology
 2OPP B;  1S1X A;  1HI1 A;  2DTJ A;  1WUU A;  2MTL A;  4DU7 A;  3QLH A;  1S77 D;  1ZTW A;  2NCK L;  5F8N A;  3IRX A;  4RUA A;  1I5O B;  4KKO A;  1S0M A;  2ZC3 A;  5BJR A;  4TVA B;  5U47 A;  4DR4 F;  3T9N A;  2OPP A;  1KBR A;  3TOQ A;  3H25 A;  3GCW P;  4FDF A;  4LBP A;  4IR9 A;  3DRR B;  4ZLL A;  1AW0 A;  2BW2 A;  4DHV A;  3G9C A;  3M8S A;  1DQ9 A;  2DYA A;  4IH5 A;  1TFW A;  4M95 A;  4IRD A;  2AP6 A;  1YBU A;  2ASJ A;  5E3Q A;  3VCD A;  3DRR A;  4H4M B;  5ETK A;  3A8E A;  5F8M A;  2GO8 A;  1D09 B;  1NKC A;  3G2X A;  4LRB A;  4KIA A;  1V9O A;  3BYP A;  1WSR A;  4HHJ A;  4U67 Q;  5KFG A;  3CT9 A;  3GYN A;  4B9S A;  5A8K B;  1B99 A;  4WXO A;  4RL1 A;  3CCT A;  3K58 A;  4ZN3 A;  4H4M A;  1HR0 J;  4DQP A;  1E6V B;  1NKE A;  5KFW A;  4RPF A;  1HNV A;  3D3C J;  2ALZ A;  1RYR A;  1FFS B;  1C0U B;  3KMQ A;  2MGZ B;  4U96 A;  3L9Z A;  5A8K A;  3TQ1 A;  1SJ3 P;  3NMA A;  1YRT A;  3U1L A;  4LIR A;  2VQE F;  4ILL A;  1DAX A;  5F9L A;  2LA4 A;  2M3D A;  1EQM A;  2HHV A;  3LPY A;  1RU2 A;  1E6V A;  4NLP A;  3D9B A;  2F9J A;  1TKZ B;  2IFX A;  4JI4 F;  4LRC A;  1C0U A;  1FRK A;  2MGZ A;  2V8D A;  2KRB A;  2QMW A;  2DHA A;  2PD1 A;  5FDL B;  5KFM A;  4H4K A;  1RLC L;  1FX2 A;  4QOT A;  4BHQ A;  4C3M A;  3SMZ A;  2C2O B;  4ECR A;  3HO1 A;  5KFT A;  4ZLJ A;  2J0X A;  4MTP A;  5KG7 A;  1IXK A;  3K5M A;  1H7X A;  5H9F J;  2OSR A;  2RDJ A;  3NLC A;  2QFJ A;  3IFE A;  3G6E S;  1IBC B;  2HEK A;  2IIH A;  4EYI B;  3AOC A;  4P73 A;  5DGA A;  4PR6 A;  4DR2 J;  3GSI A;  6FDR A;  2DY1 A;  5AXL A;  2D7S A;  1CS4 B;  2UXB J;  4C0B A;  4KQZ A;  1X4H A;  2M2B A;  4QCL A;  1TEL A;  3QBC A;  1WDD A;  3CUN A;  5CZX A;  1UVM A;  4DPY A;  4P52 A;  1QLN A;  4IG3 B;  2ZH4 A;  3TUI C;  2WK4 A;  2NZC A;  4HAC A;  2Y0S D;  3EVM A;  1Y00 A;  2M9K A;  3MCS A;  3PEJ A;  3BN7 A;  4CNZ A;  3OUY B;  5IOL A;  1N5T A;  4U7U D;  2ZHO A;  5BYR A;  3ZO7 A;  1U7L A;  4DV6 J;  4YY3 J;  1KVJ A;  2YQ1 A;  5FLX Y;  2E66 A;  1M5K C;  4IG3 A;  2E44 A;  3NMR A;  2ZUG A;  3CJ0 A;  4X4P A;  3UDL A;  5B0E A;  3CW2 C;  4CLP A;  4FVC A;  2YH1 A;  3OUY A;  3FSI A;  4DCO B;  5IWA F;  3P4U B;  1IN0 A;  1NU4 A;  3VVT A;  3D4J A;  3EZU A;  2HQF A;  1REV B;  3OSN A;  4B9L A;  2CJK A;  4CCH A;  2DGQ A;  4OHX A;  3BPD A;  2QL5 B;  3CDB A;  3MUV P;  2GX8 A;  5DG8 A;  4K5S A;  2XY5 A;  4A4J A;  4Z7Y A;  2H5J B;  5DJB A;  2H4W B;  4QPX A;  2XO7 A;  5GME A;  2KL8 A;  3GJS B;  2L9N A;  1REV A;  2MDA A;  1BUX A;  2HFS A;  1X4B A;  2J76 E;  2VU5 A;  2WVF A;  4ES2 A;  1QSS A;  1NM2 A;  4USU A;  5ETR A;  1RBO B;  1UPM B;  3KMS A;  1N6Q B;  2IY5 B;  3HM9 A;  1YQH A;  3TUP A;  5E3A A;  1AZS B;  4C9D A;  3PXG a;  3V6K A;  3ZTP A;  1URR A;  1SJR A;  1HMV B;  3QRR A;  2YKM B;  4ED7 A;  4N8O A;  3CUL A;  1WC6 A;  1XC9 A;  2XBP A;  4ECY A;  2O3D A;  4QJV A;  5IC6 B;  3I82 A;  4DSF A;  3W61 A;  1EQ0 A;  3PRV A;  3EZO A;  4OI0 A;  5H9E J;  1G6B A;  2ZDO A;  1AZS A;  3K89 A;  5LMU J;  4WE1 B;  3OT9 A;  1HMV A;  4JI5 J;  4JV5 J;  4ZVR B;  2YKM A;  5CD4 H;  2GQQ A;  2PC6 A;  4K4X A;  4DL7 A;  3T1A A;  1BC6 A;  1HNW J;  2DO0 A;  2ADC A;  1B0P A;  4N56 A;  3KHR A;  2RHQ B;  4LQ3 A;  4GC6 A;  1VQL S;  2IM3 A;  3H90 A;  4DV7 J;  2X51 A;  1KN6 A;  2QGF B;  1NUE A;  4G3I A;  2YX1 A;  3D2W A;  2CPF A;  3PNI A;  1ZAW A;  3UDC A;  4WE1 A;  5KFN A;  2VBW A;  2O67 A;  3GIL A;  2MKC A;  1WF0 A;  2HHQ A;  1Y10 A;  1UJ6 A;  3TI0 A;  1UL3 A;  1TMJ A;  2HLT A;  1BLU A;  1L3S A;  5HSP A;  4ZVF A;  2IYI A;  4MH8 A;  4LSZ B;  2D3O R;  1GMU A;  4DUZ J;  2EC2 A;  4WFY A;  2LXI A;  5HN0 A;  2V8P A;  2YPY A;  3TO8 A;  3QWP A;  3F44 A;  1V5V A;  5GAG U;  1XR6 A;  4O4R A;  4QWE A;  5GAD U;  2DXE A;  1PAE X;  3HD1 A;  1DHM A;  2W9A A;  2NS1 B;  4DV4 F;  1NK0 A;  4LF4 J;  2F63 A;  3C6T A;  2QJ3 A;  1HD1 A;  4MKY A;  1R8B A;  3NCR A;  1A6L A;  1U2F A;  1U1K A;  3QJL A;  2ZWO A;  3MEC B;  4NWB A;  1HA1 A;  2CNK B;  2FVC A;  2JJ4 D;  2BMB A;  2P6S A;  3AD8 C;  1JKH B;  4F4Z A;  3KHH A;  2R7S A;  2RUS A;  4O0N A;  2Z2Y B;  2C2K B;  2LEC A;  2EEY A;  1NK4 A;  1FJC A;  2AJ4 A;  3C8Y A;  1ROF A;  4U6P A;  3MEC A;  4H54 A;  1UEV A;  2ZM6 J;  4N41 A;  3K5O A;  4U9R A;  3GFY A;  4RBV A;  3L09 A;  4LFB J;  2VFR A;  4RBT A;  1JKH A;  1VIS A;  2P8I A;  4RBU A;  2DJW A;  4AL6 A;  4MT1 A;  4QYZ J;  3PM9 A;  5HRO B;  2IHR 1;  4FF4 A;  2GO9 A;  3D0G E;  1N33 J;  2B5J B;  5CH7 B;  4DS4 A;  3ZZO A;  3MR3 A;  2WCX A;  3KJN B;  1S76 D;  3HHL D;  2XMM A;  2MKI A;  2MST A;  8AT1 B;  2AD9 A;  4EZ6 A;  4OYM A;  4NI2 B;  4NA1 A;  5AXK A;  3CJ3 A;  1UAW A;  1WOR A;  4P75 A;  2MQQ A;  2B9Y A;  1X5P A;  1PYT A;  2BOA A;  1IR1 A;  4NXN J;  4P7V A;  4B3S F;  2B5J A;  1OS5 A;  1JXL A;  4ED4 A;  3PKY A;  4MKB A;  4KRW A;  4DZ6 A;  3QJP A;  3ZTS A;  3AB2 B;  4ETX A;  2VFU A;  4UOC A;  4NI2 A;  2WAQ D;  1Q8B A;  2D3O 1;  3FEY B;  3ISN D;  3K17 A;  1BWE A;  2ZZN A;  1UVJ A;  2J6U A;  3ZZT A;  4CLS A;  2GAG C;  2DR8 A;  1NSA A;  1Q82 T;  2HHW A;  4OZ1 A;  2A1B A;  4ZCL A;  4FP9 A;  1XNQ F;  1SPB P;  4O0I A;  4P10 A;  3IWL A;  3MFI A;  1D9D A;  5E0O A;  4M5I A;  4ZCM A;  4EBE A;  1CSJ A;  4JB8 B;  4ED5 A;  2CVE A;  4YDD B;  4LRA A;  5I4M A;  1EET B;  4KGX B;  4C6A A;  3SCI E;  2UU9 J;  1U2R A;  2AZ1 A;  4F2S A;  1ZET A;  3W9H A;  1D3W A;  2ZZM A;  4X62 F;  5D3G B;  2GJF A;  3H5X A;  3DLJ A;  5G0R B;  2XLI A;  1X9M A;  4ZA1 A;  2Q66 A;  2ABY A;  4NE9 C;  3LP0 B;  2J0W A;  3R27 A;  1HW8 A;  2CVI A;  2K2P A;  1EET A;  1WEY A;  1CUL A;  2OP5 A;  3LAL A;  4LFA F;  2EG1 A;  5D3G A;  2GVZ B;  2MJU A;  2ZWP A;  1EZZ B;  5G0R A;  2O5D A;  3IR5 B;  4GKJ J;  3DYA B;  4QZV B;  3CVK A;  2CQD A;  3TAM B;  2Y3Y A;  4IH6 A;  3D6H B;  3PG9 A;  3TRG A;  3OHB A;  1D1U A;  4OX9 F;  4WP8 A;  1FEE A;  2DCL A;  3DYA A;  3IM8 A;  2KI2 A;  2GA7 A;  2JRS A;  2YNI B;  3TAM A;  4J90 A;  5F9N A;  4YQW A;  3K5N A;  4PXD A;  1HWK A;  3Q2S C;  4PQU A;  4DPO A;  1S4F A;  3V6J A;  1FTR A;  2JX2 A;  4HKQ A;  3PRD A;  4UF4 A;  3O6Q A;  3RAX A;  4K4U A;  4DR5 J;  3CC2 S;  3W9J A;  4HI2 A;  1RT2 B;  2J7K A;  3KG1 A;  4EI2 A;  3GJQ B;  2YNI A;  4PPZ A;  4DQQ A;  4FVM A;  1KDN A;  3R9L A;  1GQE A;  4P2M A;  3G82 B;  1CC7 A;  1Q8L A;  3CD0 A;  1FNO A;  4I68 A;  4DV2 F;  3MR2 A;  3EGN A;  2BVZ A;  2YKQ A;  1DTT A;  2B8P A;  3LP1 B;  5J2N B;  1GX5 A;  4KTQ A;  1YBT A;  5F8I A;  3C16 B;  4CLF A;  2QSF A;  4OLO A;  3D67 A;  3G82 A;  4AXI A;  3MEE B;  3RAM A;  4DV1 F;  2XSJ B;  1CJV B;  3VTI A;  1ZYQ A;  2UUC F;  4KH1 B;  2LDI A;  4KT0 C;  2OHD A;  4EFA C;  4F7V A;  3LP1 A;  3ONQ A;  1K0V A;  5J2N A;  2HQG A;  3C16 A;  2EFN A;  1A9N B;  3MEE A;  2XSJ A;  2EFV A;  1CJV A;  2KVI A;  2GHP A;  1Q5Y A;  4OJG A;  2IRU A;  2YWG A;  3CME S;  2PI4 A;  3ET6 B;  5BYQ A;  3QYY A;  2CDR B;  3B82 A;  2KT2 A;  4J9V A;  4DV3 J;  1HWI A;  2C22 A;  1MW7 A;  4CQ1 A;  3TVZ A;  2CA9 A;  5D15 A;  2KFN A;  3FFI B;  4ZN1 A;  3BSO A;  2RS8 A;  2E1C A;  2V50 A;  4A8F A;  3LAM A;  5KG3 A;  2F8M A;  3ET6 A;  2XS7 A;  4QR0 A;  2GGP B;  2QL9 B;  2DEJ A;  1IJE B;  4QIW D;  2Z2M A;  4DR3 F;  1TL7 B;  1YJN S;  1RCO B;  4MAK A;  2DIS A;  5M2U A;  4ALZ A;  1FE4 A;  1ZM4 A;  4ZVG A;  3FFI A;  2HHP A;  2D69 A;  4PUO B;  1OY8 A;  3OR1 A;  4NXM J;  3RBX A;  4OJH A;  4O3R A;  4CIO A;  2H54 B;  2YKP A;  4M5N A;  2C2Z B;  2GGP A;  4CP5 A;  4DSL A;  3D66 A;  4FBT A;  1S79 A;  2NZ4 A;  2RVJ A;  1TL7 A;  4N7T A;  4OIX A;  2JEG A;  3TZY A;  3PKM A;  2C2M B;  4PUO A;  4FYV B;  4TYB A;  2VIC A;  2A18 A;  4FN5 A;  4Y2M A;  1QAX A;  2YNF B;  4BDP A;  1U8W A;  3PX6 A;  7FD1 A;  4ZKA A;  4F4W A;  5IQQ A;  3IBF B;  1AB8 A;  3DGV A;  2N3O A;  2FHJ A;  3MR5 A;  1ARO P;  2CQ0 A;  3GR1 A;  2BX6 A;  4OHW A;  4ZVE A;  1JB0 C;  2CQB A;  3NAH A;  5ETO A;  1N32 J;  3QSI A;  3OL8 A;  3ZTR A;  2LYV A;  3DLG B;  4DZD A;  2YNF A;  5KFX A;  4TYA A;  5CHC B;  1ULR A;  1Z1Z A;  1RWM B;  1CJT B;  2UXD J;  4NEY A;  5JMN A;  1NJY A;  2R7R A;  1KOO A;  3R3T A;  3IMQ J;  4EBC A;  3BZQ A;  2AU0 A;  2CPI A;  2MKY A;  3DLG A;  3VGU A;  2ACY A;  3MZI A;  3BQ1 A;  1URN A;  2LQ5 A;  2OUG A;  2AX1 A;  1UA1 A;  1X4D A;  1X5T A;  2J6T A;  1M0S A;  3MAH A;  4OZN A;  1S1V B;  5J2M B;  2ASY A;  5KG5 A;  1EP4 A;  1CJT A;  2R2T A;  2E5L F;  1XBW A;  2HHX A;  4M5M A;  1U47 A;  4NOH A;  1B3T A;  2YKA A;  1FJG J;  4WYL A;  2MKS A;  4PXC A;  2I0X A;  3Q23 A;  1UFK A;  2R9L A;  4ZP9 A;  1H73 A;  3GFZ A;  3CNQ P;  1SC1 B;  2OTJ S;  3CPW R;  1S1V A;  5J2M A;  2Y8Y A;  4JI1 J;  4FF1 A;  4KHP F;  4MK7 A;  3T6J A;  3D1O A;  4XO0 A;  4ANC A;  5LSR A;  2NYI A;  1TL4 A;  3R7B B;  2YH0 A;  3VGT A;  2MQM A;  5THW A;  3JSR A;  3V4M A;  2V8V A;  3VWS A;  2MXY A;  1JLC B;  2KVQ E;  2B4P A;  3VAL A;  1DTQ B;  3KJQ B;  2GJ2 A;  3CJT A;  1SB6 A;  4LF7 F;  1RAB B;  4NML A;  2QLJ B;  4QQB A;  2W8L A;  1KVI A;  4WFB Q;  4I1T A;  4QIV A;  2UUT A;  3HHN B;  3SV4 A;  1RT7 B;  3EDQ B;  2Z8Q A;  1SQF A;  2MY7 A;  3C14 B;  5GMD A;  2IM1 A;  1JLC A;  3M6X A;  1DTQ A;  3B6B A;  2QMU B;  4RUC A;  5KG0 A;  2PMZ D;  5F8L A;  4I4B A;  1FA0 A;  3BSN A;  1HLW A;  4RNO A;  5CCM A;  1G3O A;  1WKK A;  1HI0 P;  3M7V A;  4RNM A;  1X4C A;  1I94 F;  1LW2 B;  3HHL B;  1P9Y A;  2L9W A;  5HVH A;  4QIF A;  2ZOM A;  3SV3 A;  2VQE J;  1MSW D;  2RAQ A;  3C14 A;  2KFY A;  1VBZ A;  1OO0 B;  1DY3 A;  2JNJ A;  3SYZ A;  2ERR A;  5IV4 A;  1S99 A;  2CQG A;  2V69 A;  4O3P A;  3BGR B;  4DX8 H;  2FLO A;  5HVF A;  3M8Z A;  2ROG A;  2VL1 A;  2DHS A;  1NRK A;  2F40 A;  4MK8 A;  3W7B A;  4YR2 A;  3CCE S;  1LW2 A;  3HHL A;  1EJ7 L;  1XN9 A;  2HSE B;  3W63 A;  1Q1K A;  1IR2 A;  3DKD A;  2R7T A;  3E8O A;  5DGB A;  2KYX A;  1AUS L;  1BY9 A;  3P49 B;  2XYG B;  4Y2I A;  3DGP B;  2LQJ A;  4NPO A;  5C24 B;  3KLV A;  3BGR A;  1QVG R;  3EWG A;  2BE9 B;  3ULH A;  1PJ6 A;  3RBD A;  5IS2 A;  1X60 A;  2K7J A;  4N47 A;  1PIE A;  4V19 J;  4M1K A;  1JJ4 A;  4F4K A;  2BKO A;  1I1G A;  4OHZ A;  4RLE A;  1JLE B;  1TL1 B;  4M5D B;  3IXQ A;  4X2B A;  1C4A A;  2RU3 A;  4ETZ A;  2MKJ A;  2YNH B;  3DGP A;  3CO9 A;  5C24 A;  4CH1 A;  3PW5 A;  1GXT A;  3DN9 A;  1OPZ A;  2QZ8 A;  3V4I B;  4URG A;  1JLE A;  1TL1 A;  1OY6 A;  1UW4 A;  4M5D A;  2RQK A;  2LCW A;  2J9D E;  3MM9 B;  2CZ4 A;  2LEB A;  2YNH A;  3FUY A;  2D9P A;  1S1U B;  2VA3 A;  4MYU A;  4DR1 J;  4J9U E;  2F8H A;  3Q86 A;  2W8K A;  1NDL A;  3A13 A;  1TV6 A;  2C3O A;  3D28 A;  3KLE B;  2KTQ A;  3V4I A;  5HLF A;  2QG9 B;  5F8G A;  3HT3 A;  1RT5 B;  2FGC A;  3MM9 A;  4Q8F A;  1VQ6 S;  1TK5 A;  3NWG A;  4O44 B;  1S1U A;  3NOG A;  2J0S D;  3BSA A;  4DPT A;  5JVG Q;  1QAY A;  3D68 A;  3CDU A;  1RAA B;  2IRY A;  3OFH A;  2MEW A;  4QBU A;  4B17 A;  1JMT A;  2BJ9 A;  1ZPV A;  1RBL A;  5KFB A;  1RT5 A;  4LF5 F;  2B4O A;  1UET A;  4OYB A;  1WC4 A;  4O44 A;  3TVY A;  4KGV B;  3PAC A;  1YZ7 A;  5D4P A;  1VYA A;  2XM3 A;  4J9M A;  1W25 A;  4CRJ A;  2DIV A;  5T7L B;  4DX7 A;  4Q7A A;  4D3G A;  2XNQ A;  3R2D J;  1YKW A;  2Q79 A;  4OJ1 A;  5AE3 A;  2B3T B;  1F6T A;  1B70 B;  1XWL A;  2CPH A;  2N3L A;  3Q8Y A;  1WF1 A;  4R8U B;  2IVY A;  2JLF A;  3I4H X;  5HAT A;  4KR0 B;  2DB1 A;  2AYM A;  4BCA A;  3MTJ A;  3N79 A;  4HT5 A;  2CJY B;  3TAR A;  4NYP A;  2W24 A;  3GP9 A;  1VGY A;  5T7L A;  4CO0 A;  3G8T A;  5F41 A;  2OMO A;  3GJT B;  1B4S A;  1FNX H;  4XIU A;  4NA3 A;  1NJX A;  4R8U A;  1T11 A;  2RHS B;  2NYH A;  1RTJ B;  2I8E A;  5T14 A;  4XK8 C;  1KQS R;  4IOB A;  2WRM A;  3A8J A;  4CLY A;  3D3B J;  1SQG A;  3KFW X;  4FKY A;  1U1N A;  3SI8 A;  1RT3 B;  2ZJR Q;  4USH A;  4HTI A;  1UCN A;  3FRY A;  2BJE A;  1ITP A;  3AQP A;  3KJV B;  2JFD A;  3NCP A;  3TJ8 A;  4XPE A;  1RTJ A;  4UUW A;  1YJ9 S;  5KG2 A;  2JDJ A;  4B02 A;  2X1F A;  4FXV A;  3C2P A;  3O44 A;  3HF5 A;  4LR7 A;  1WHV A;  3W65 A;  1EHW A;  4Z37 A;  1RT3 A;  3ENW A;  3G8Q A;  2X1B A;  2AJ1 A;  3TJA A;  2HFN A;  1S5Z A;  3KJV A;  1N88 A;  4DL0 C;  2ZBI A;  5KFH A;  4C2M A;  3KHG A;  5F0U A;  2CJX B;  3CMQ A;  1H38 A;  3MEG B;  2D3Z A;  2GHW A;  2IVF B;  2YX7 A;  4BLG A;  3KHL A;  3O2I A;  2LA6 A;  1NH7 A;  1FRX A;  1KKH A;  2MQL A;  1D9F A;  2AWZ A;  2CJA A;  4U7U K;  5KT3 A;  1H2T Z;  1Q53 A;  1FRI A;  3K8V A;  3P5B P;  3MEG A;  5KFP A;  1U1Q A;  5AE1 A;  3H2U B;  1FRL A;  2XLJ A;  4UQG A;  4RO0 A;  2ZBP A;  4DV4 J;  2XMV A;  1KQG B;  2IAJ B;  1Q0N A;  4OZ5 A;  2HVE A;  1ZAV A;  5DDO C;  4YR3 A;  3CCZ A;  3BBF A;  1NPK A;  3EPG A;  1RAF B;  1ZZF A;  2O1P A;  3IAS 9;  4M8L A;  4LBH A;  1U6F A;  2C2N A;  1AFI A;  2C42 A;  1JNZ B;  1WSV A;  1L3V A;  2HWT A;  3J7A 1;  2GMJ A;  1VQK S;  3BKT A;  2HVI A;  2Q3P A;  2IAJ A;  1B7Y B;  3WC2 A;  2HHS A;  2VH7 A;  5HQ8 A;  2PFF B;  5EX3 A;  4X84 A;  4W90 B;  1VBK A;  2XNR A;  2BQR A;  1N5Y B;  5KFU A;  1LEO A;  1QDU B;  1S4E A;  3M30 B;  3GV5 B;  3ICL A;  1FT8 A;  1M5S A;  2RB7 A;  3OXG A;  4Y2C A;  2HZA A;  2MZR A;  1BWV A;  4CM2 A;  1J5E F;  3QMQ A;  5DLG A;  2M7S A;  2MZS A;  3TUZ C;  4KJI A;  2O01 C;  3A8K A;  2Q1L A;  1N5Y A;  2WZ1 A;  1YWX A;  2EFG A;  2V4J B;  1APS A;  2IDE A;  3M30 A;  3QAU A;  3H2L A;  1YJV A;  3UPF A;  4PWD B;  2LEA A;  3IR7 B;  3N01 A;  4IOC Q;  4LUB A;  8RUC A;  1K8A T;  4YY3 F;  2MHE A;  1JJC B;  2HBQ B;  1T05 B;  3H4B A;  3G71 S;  5IC4 B;  2XHW A;  2EBE A;  1UZH A;  2LQ8 A;  1SVD A;  3EIC A;  4IFY B;  3BO3 A;  3O3L A;  4F36 A;  3G6X A;  3OVS A;  2V4J A;  2ZC4 A;  2YKN B;  4IH7 A;  1SC4 B;  3ZZU A;  4PWD A;  3DHW C;  4PYD A;  3SQG B;  3FCW A;  3BO2 A;  1FWP A;  3SSQ A;  1T05 A;  1G4C A;  3QT6 A;  5HBM B;  1R6V A;  2JVO A;  1LXN A;  1AXQ A;  4IFY A;  2WSE C;  4IQX A;  4PZV A;  1V3R A;  5L1L A;  2YKN A;  3E01 B;  3VZH A;  1XNQ J;  1HBN B;  2XMU A;  3I55 S;  3P96 A;  3SQG A;  3W62 A;  4NLV A;  4DPW A;  2V6A A;  3W3S A;  3KJF B;  3NS5 A;  3QRP A;  3NL0 A;  5HBM A;  4M5H A;  1IJF B;  4I2P B;  5DG9 A;  2J8A A;  2F3J A;  1HBU B;  4LR9 A;  3E01 A;  2D1C A;  4CLU A;  3GCX P;  1HBN A;  2G1H A;  4KSE B;  3IR6 B;  3I5B A;  3FK4 A;  2ZHA A;  2BJ8 A;  4HHH A;  3VAJ A;  2BJ7 A;  1X9S A;  2ROP A;  1BHN A;  1ZA1 B;  1V3Z A;  3ZC4 A;  1FXL A;  2L48 A;  4X62 J;  1R6Y A;  4I2P A;  2Z0G A;  2ZOF A;  1RI7 A;  2CNN B;  1HBU A;  1PCA A;  4LF8 F;  1KC8 T;  3CJ2 A;  2JEI A;  3UWT A;  5J2Q B;  5B0F A;  3KKF A;  3C46 A;  2XYH B;  4B9M A;  2FIU A;  2AX0 A;  1WEX A;  4MIW A;  2X3D A;  3BH6 B;  4GO7 X;  1NB7 A;  4LFA J;  2NSC A;  4JI5 F;  1P8G A;  5K14 B;  3HHE A;  4GO5 X;  1HNW F;  2WB1 D;  3QT8 A;  4XTT A;  3FRZ A;  5J2Q A;  4CM0 A;  4WPA A;  1O0P A;  4C8N A;  3MM5 B;  2XGP A;  3PIP Q;  1XJW B;  2YBV A;  4ID8 A;  1SKS A;  2K06 A;  4OX9 J;  1TK0 A;  2B43 A;  3G6Y A;  4IOA Q;  2UUB F;  3S1T A;  5K14 A;  2ZH6 A;  4JV0 A;  3UR3 C;  1RZM A;  5DLF A;  2OJ3 A;  5I3Q A;  5K9F A;  3I87 A;  3GR0 A;  1ZTT A;  2GZO A;  2RD5 C;  3MM5 A;  3P8B B;  1H7W A;  2HK3 A;  3W5Z A;  4YB1 P;  3M2R B;  3DFE A;  2GS8 A;  1U6Z A;  2VUG A;  1RQ0 A;  1NJI T;  1TL3 B;  4TU9 A;  4TNO A;  3LGN A;  4C8Z A;  1VK3 A;  3EGW B;  2F65 A;  5CYM B;  1HQ2 A;  2H5I B;  5ETQ A;  1WEL A;  1HD0 A;  1IVZ A;  4FXD A;  2BOP A;  4DV2 J;  2HVZ A;  3TUJ C;  4G1P A;  3QFW A;  1QUP A;  1T3N A;  1SCJ B;  4NX9 A;  1S0V A;  2G4B A;  3M2R A;  1NO8 A;  2OEL A;  2HBR B;  3LF0 A;  1XR5 A;  3DOK B;  2AKW B;  2P5V A;  1S57 A;  2BRK A;  2RRB A;  5KFC A;  1TL3 A;  3W1Y C;  3B54 A;  2AJF E;  2CQ1 A;  5CYM A;  1YBA A;  1LWE B;  1EKR A;  4OYO A;  4L72 B;  2UUC J;  2BW7 A;  3SQO P;  5KT6 A;  1D0E A;  2AQ4 A;  4HEA 9;  4ICL B;  2AJ2 A;  3GPA A;  4K7Q A;  3AA9 A;  2CRL A;  3AB4 B;  2DXD A;  4ELV A;  2B0G A;  2HWH A;  1NHK L;  3M9N B;  3DOK A;  1Q81 T;  4AL5 A;  2Z2L A;  2F8E X;  2MZ1 A;  2QLX A;  4IKA A;  4RW8 B;  2M4M A;  1QVF R;  1GH8 A;  1LWE A;  2UV8 G;  1NSP A;  2RJZ A;  5K8P A;  3DLL Q;  1KTV A;  3H5Y A;  4USJ C;  3U1M A;  3BBC A;  4ICL A;  4F3O A;  1Y5N B;  2PDA A;  1VR6 A;  3JB9 k;  3RG6 A;  1CBK A;  1SL1 A;  2CFX A;  3MCN A;  4LVO P;  2OPR A;  4NLT A;  3WX4 A;  3E2E A;  3FQL A;  1NK6 A;  1U1M A;  4CO5 A;  4BC7 A;  3M32 B;  3PYD A;  4KV8 B;  1ICE B;  1S6U A;  1SH2 A;  1U1L A;  3Q8V A;  3HPO A;  4YUD A;  4NLS A;  4X4V A;  3OVA A;  1VDH A;  4DR3 J;  3PHT A;  3K0J A;  2KB2 A;  4NRU A;  4F26 A;  3QSY B;  3M32 A;  4KV8 A;  4JP8 A;  5CZV A;  1S0N A;  3KK3 B;  3AAW B;  1S6P B;  1U0H B;  4PRF A;  2F5G A;  3DCA A;  2XY7 A;  2R42 A;  2G2Y A;  1GMW A;  5J1N A;  1KP6 A;  3OFF A;  4LSL B;  4WFZ A;  2M8D B;  1FVS A;  5E7O B;  2DNL A;  5RUB A;  1UFL A;  2OGU A;  1BQM B;  5HO4 A;  4Q2M A;  2HHH F;  1NBE B;  3I96 A;  3KK3 A;  1S6P A;  1U0H A;  3GV8 B;  5SUH A;  2GML A;  1N4L A;  1WKL A;  4OMF G;  1R3N A;  3G96 A;  1Y9O A;  4LSL A;  1L3T A;  3BS9 A;  4I6W A;  3Q8S B;  2DT9 A;  1BQM A;  1OSC A;  1UEU A;  4I67 A;  3M8W A;  1VBY A;  2V2K A;  1S7H A;  3DDN A;  5D0E A;  2MZT A;  2VG5 B;  3VAG A;  1WI8 A;  2FYX A;  4OI4 A;  1SKW A;  5IXU A;  3TZX A;  2R8G A;  3I4P A;  2V2V A;  2K7K A;  4ZHR B;  3OVB A;  4OYZ A;  1FRJ A;  1GX6 A;  2VKZ G;  4RJV A;  3M4X A;  4CZC A;  1CG2 A;  2VG5 A;  3UNY A;  2RKI B;  1S1W B;  2RDI A;  2N82 B;  3LUY A;  2YWW A;  2EVZ A;  3HXM A;  4ZHR A;  1MWY A;  1G2E A;  1T9X A;  4GKJ F;  5BR8 J;  2VDH A;  3OTO J;  3L7U A;  5KOX A;  2E5L J;  1M5P C;  1LQ9 A;  3JSM B;  3ZFV A;  2CKW A;  3AJD A;  5LXY A;  2ZBQ A;  3B4D A;  1P9Q C;  2ZOG A;  4JV2 A;  4PQA A;  2HQD A;  4WZM A;  2RKI A;  1GXU A;  5F8H A;  1S1W A;  2QA4 G;  2MQ8 A;  3C15 B;  2VV5 A;  5J1P A;  4KHP J;  2MB0 B;  4OV6 A;  2PII A;  4USI A;  2AYG A;  3CC7 S;  4WFX A;  3VHQ A;  2FTR A;  3JSM A;  1Q78 A;  2A10 A;  3MR7 A;  1V5I B;  4YHH F;  4WTY A;  4IG0 B;  3AJ1 A;  4CWB A;  4ZPC A;  2XS5 A;  3VQS A;  2V34 A;  3C15 A;  3CDE A;  2NPI A;  1NND A;  1NJW A;  2RDD A;  5D0H A;  2ZEJ A;  1KHV A;  4N8N A;  3NGD A;  4X4N A;  5DDP C;  1PSD A;  3BEG B;  2ZKU A;  5JUM A;  4QWD A;  2BDP A;  1KLM B;  1MG7 A;  1Y3J A;  4IG0 A;  4B3M J;  2B9X A;  2OPQ B;  1QTN B;  4PEO A;  2VAS A;  2CQP A;  4KO0 B;  3MUR P;  3SFU A;  2YWH A;  2DNO A;  4ERD A;  4GC7 A;  2CQC A;  4P72 A;  1IR0 A;  5L1I A;  3CXC R;  4ZIV A;  3QRQ A;  2AIR B;  2DH8 A;  4NLQ A;  1KLM A;  1U1P A;  5KT5 A;  2OPQ A;  3AJ2 A;  4UOF A;  2C28 A;  1WC1 A;  4KO0 A;  1U25 A;  3DLH A;  2OI2 A;  4DDF A;  2CZ9 A;  2GHV C;  5E3P A;  2HWI A;  2ALY B;  4G1I A;  3ZZZ A;  3BQ0 A;  4K59 A;  1PC5 A;  2KH9 A;  1S49 A;  3JQM A;  3ADA C;  3RW6 A;  2NXJ A;  5E5N A;  3JXO A;  4CT8 A;  2DNN A;  4Y65 A;  2MHN A;  2C3Y A;  4U95 A;  1X9W A;  4B3T J;  5DG7 A;  4MYT A;  4ES3 A;  4YME A;  4K4W A;  2Z56 B;  2H65 B;  3GMG A;  2VG7 B;  2YWE A;  3S8S A;  4WFN Q;  5DDQ C;  3I9V 9;  4IUF A;  2PMW A;  3KLI B;  1VC6 A;  2Q6C A;  3OD2 A;  4EGL A;  3PRB A;  4I64 A;  4E2F B;  4OX7 A;  2UVV A;  3K8W A;  5DQG A;  2R2R A;  3FQK A;  1U02 A;  2DEI A;  1DZ5 A;  1Y0H A;  3R7N B;  2E1M C;  1WG5 A;  3AFG A;  2VG7 A;  1H2U X;  2CJB A;  1VS3 A;  1WJ9 A;  3CJK B;  3UR0 A;  3KLI A;  3AOA A;  1KFD A;  4NXM F;  3CGI A;  3FBB A;  2JVR A;  3OQ2 A;  4BS2 A;  4ZVO B;  1VQ8 S;  2XWX A;  5KAK A;  1WWH A;  3DC2 A;  4ED6 A;  3VAM A;  1EAY C;  3GLJ A;  4DJB A;  1UA0 A;  2RU9 A;  2HNZ B;  5HQM A;  3SBM A;  3CJK A;  3SEO A;  4ZVS B;  3J80 Y;  1IUJ A;  4URQ U;  4GKK F;  4JI3 F;  3I0S B;  4OZ3 A;  1GXL A;  3QAE A;  2KXN B;  4USV A;  2DPJ A;  1LNQ A;  3LOU A;  2HHT A;  2YVS A;  2YX4 A;  1Y7P A;  2DGW A;  5FJ4 A;  1EB0 A;  2G0C A;  2HNZ A;  4C8O A;  1S6Q B;  3EJM A;  5A0Y B;  1FK9 B;  3H40 A;  1XER A;  2NUU G;  5LSO A;  1VK8 A;  2HFU A;  3I0S A;  5CAA A;  2QTW A;  4LF5 J;  1S1X B;  3EMT A;  4KB7 A;  4ZS6 A;  5IT9 U;  2NLW A;  4B3R J;  3T9Z A;  1IM6 A;  3KLH A;  9RUB A;  1LOU A;  3CD7 A;  1PGZ A;  3SFG A;  2W7P A;  2WBM A;  5IT0 A;  3GSD A;  5A0Y A;  4DG1 B;  1FK9 A;  1N5V A;  3WZ0 A;  4WF9 Q;  3BGU A;  1ZZN A;  1IKY B;  2OO4 A;  4HTJ A;  2GQC A;  4YN3 B;  3ZZP A;  4KGZ B;  2PEB A;  2XMA A;  3KYL A;  4K0K F;  2QA2 A;  3RB3 A;  2XLK A;  2KYZ A;  4DG1 A;  3X3U A;  4A48 A;  1SUQ A;  4KAI A;  2QA4 S;  3Q2T C;  1IKY A;  2H5E A;  1CC8 A;  1FJG F;  4EO6 A;  4RNH A;  4EU0 A;  2UXC F;  1T95 A;  2UUA F;  4WKY A;  1JLA B;  4U8V A;  3IM9 A;  1VQ4 S;  4I7F B;  2XG8 A;  4MKA A;  1FNM A;  4JI1 F;  3T5K A;  3N6M A;  4ZIT A;  4TY9 A;  4QWB A;  2W2N P;  3RR8 A;  5L9N A;  4B9N A;  4ED8 A;  4KPC A;  3NGK A;  1FFW B;  2GMH A;  4ZPV R;  1VMB A;  4JI0 J;  1JLA A;  1QSY A;  2DNR A;  1DAR A;  4I7F A;  2J7W A;  2LP4 A;  1WDT A;  2UV8 A;  1HNV B;  5BXI A;  3BYR A;  1S0O A;  2CNO B;  2QC3 A;  2XMJ A;  4E98 A;  4LBI A;  5GVQ A;  2QT7 A;  4YB6 A;  3DXB A;  3DOM B;  4KYZ A;  2H9Z A;  3C6U B;  2XQC A;  5KFL A;  2EI5 A;  4ECQ A;  4OYI A;  5K5M A;  4ZIW A;  3CCJ S;  2CPY A;  3GG0 A;  2RRA A;  5KFJ A;  4QWC A;  3DOM A;  1HHS A;  2BAN B;  1SQE A;  1K44 A;  3TP2 A;  3C6U A;  4NLD A;  4AYB D;  4K50 A;  3VR1 A;  2IM2 A;  1RWX B;  3AOD A;  4V1A k;  3NGR A;  1RU1 A;  3UD3 P;  1LV5 A;  3I56 S;  4TXS A;  2ZNZ A;  3U1N A;  1QJH A;  4UT4 A;  5HMW A;  2CIM A;  2BAN A;  1A7G E;  4PWU A;  1RKJ A;  4LSN B;  4L6V 3;  2GC8 A;  1ACM B;  1DFD A;  4TY8 B;  3NOC A;  3TAN A;  1BXN A;  3HSJ A;  2ZH7 A;  1RHM B;  1KNZ A;  4J37 A;  5E2Q A;  5F0W A;  2M8H A;  3A3N B;  4HH1 A;  3C66 A;  4EUV A;  1U24 A;  4JBC A;  6AT1 B;  2ASD A;  4FF2 A;  3IP0 A;  2MY8 A;  3KK2 B;  4HAC B;  4UY8 5;  5GMK a;  4RNF A;  4LSN A;  1K1Q A;  3TA1 A;  2HIY A;  3CJ4 A;  3GIJ A;  3PEH A;  3X1L B;  4DFK A;  3CTR A;  4TY8 A;  3TR5 A;  3P45 B;  2LEP A;  2ASL A;  2AEF A;  2V2Z A;  1X4F A;  4AQY J;  1YG0 A;  3JSY A;  1BE4 A;  3PR4 A;  1J5E J;  3CCM S;  4KFB B;  3H7H B;  1NH8 A;  1LFW A;  3JQJ A;  3KK2 A;  4NLO A;  4ECS A;  2HIQ A;  1S48 A;  2RE1 A;  3KDO A;  5CA5 A;  3NGS A;  5ETS A;  4PXE A;  4DR1 F;  2QV6 A;  2ZHB A;  3NS7 B;  3MTK A;  3KWM A;  5JXS A;  1RWO B;  3IG1 B;  3IGV A;  2LQ9 A;  1EX8 A;  3FBF A;  3HZE A;  3HSD A;  4ECT A;  1RA7 A;  1UW9 A;  4KFB A;  3OLB A;  3RUB L;  3HVW A;  1M5O C;  1TZ0 A;  2V63 A;  1LXJ A;  5IT4 A;  2KXH A;  4RWW A;  2DNY A;  2YKO A;  4OHV A;  2C2R A;  2AGO A;  5LT5 A;  2R8J A;  3IG1 A;  1N56 A;  2LFV A;  3GIR A;  2G1D A;  3QGI A;  3VZI A;  2HFV A;  4J9S A;  1O8B A;  3SCJ E;  2B4U A;  4QW9 A;  2IVM A;  1T8E A;  2AJ0 A;  5ETN A;  1SL0 A;  5JJB A;  1CEZ A;  4OZJ A;  2IBO A;  2L08 A;  3BV8 A;  2DR6 A;  1PBA A;  4Q5V A;  2NRE A;  3CB4 A;  1MMN A;  4ED1 A;  1TL5 A;  2XZD B;  1DJ0 A;  4DCJ B;  3PYE A;  2EKN A;  2V4Q A;  1HNX F;  3PO4 A;  1WOO A;  3RU0 A;  1YSJ A;  3BR8 A;  2KHD A;  3RW7 A;  2DVI A;  4DMZ A;  5KFE A;  3P5T L;  4ELT A;  1YJU A;  4FPI A;  2LXU A;  1T9V A;  2CJ9 A;  3OL7 A;  1N36 F;  1S6O A;  1RAH B;  1ZS6 A;  4JI2 F;  2MKH A;  3JAM U;  3L7O A;  1YDL A;  3PDN A;  2FHJ D;  3RB6 A;  3RZA A;  4LF8 J;  4ED2 A;  2DD8 S;  1T9U A;  2EG2 A;  2I2Y A;  3CCV S;  4C8M A;  4ILR A;  4AND A;  2HVH A;  3GTY X;  1IQZ A;  2XMK A;  3HSG A;  1SC6 A;  3F41 A;  2R7X A;  1F0X A;  3MWB A;  1VFJ A;  3FSX A;  2EK1 A;  1IBM F;  3MMJ A;  4QIG A;  3G87 A;  4L3N A;  5MLC V;  1DBD A;  3RBZ A;  2PN6 A;  2UUB J;  1FHT A;  2VBX A;  2VJU A;  4ZLN A;  5DS7 A;  3JTN A;  3I9Z A;  5HJX A;  5KFY A;  3BSC A;  1A0O B;  3MEK A;  3KG4 A;  3N28 A;  5G4D A;  2HND B;  1CJK B;  3C6T B;  5ADZ A;  2ZH3 A;  5KG1 A;  1M5H A;  3NNA A;  3IGN A;  3KNA A;  1WHW A;  3ILJ A;  1FDD A;  4OYA A;  3P6Y C;  4O3O A;  3EDR B;  4N76 A;  4UOH A;  1BGX T;  1FKA F;  4R25 A;  1WD6 A;  2HAF A;  4C8L A;  4NA2 A;  2HND A;  1CJK A;  1VHF A;  4TKT A;  1X0F A;  2R7Q A;  5D6G A;  4OI1 A;  3UDE A;  4URS A;  2KRR A;  1LW0 B;  1RWK B;  2MKK A;  3H2V E;  3Q8U A;  4HLB A;  5H1S V;  3MED B;  2HQC A;  1YJR A;  2BAB A;  4DU8 A;  2KG1 A;  4ATN A;  1W7W A;  1TKD A;  1S1T B;  4LRF A;  4RUB A;  1R8P A;  3HSZ A;  3CD6 S;  1S9E B;  4HHU A;  1LW0 A;  2E7W A;  2OFG X;  2ZUA A;  1PYS B;  5D4O A;  4F0H A;  3MED A;  2CAD A;  3U27 A;  4DL3 A;  4OYX A;  2H51 B;  2J9D A;  1R0A B;  1ZM3 A;  1F9E B;  2W2M P;  2D41 A;  4F8R A;  1VQP S;  5JVH Q;  1NJZ A;  1S1T A;  2FDN A;  3MI7 X;  3GWC A;  1S9E A;  1VLO A;  2XMW A;  4FYD A;  1TP7 A;  4QWA A;  3N0V A;  4K4S A;  3DU5 A;  4L75 A;  3T19 A;  1W2I A;  3WQP A;  2DH7 A;  2PO4 A;  5HQL A;  5C5J A;  2VKR A;  2CQH A;  3MMC B;  1R0A A;  5A76 A;  1RHJ B;  2W7O A;  4EK2 A;  3BQ2 A;  4IYQ A;  2E7V A;  1FRH A;  3HFV A;  1HAR A;  2W9C B;  4OX8 A;  4TU8 A;  2RH3 A;  4R0J A;  3HCX A;  3GG1 A;  2W7A A;  4DEZ A;  3CIM A;  3MMC A;  5DZ6 A;  4LJM A;  4LF6 F;  2KG0 A;  4NRT A;  3KK1 B;  1LFP A;  2W9C A;  2XZW A;  2HHH J;  2MPU A;  3CJ8 A;  2KM8 C;  1CQM A;  2VIH A;  1HW9 A;  3NNC A;  3K7R A;  1NXI A;  1R27 B;  3MF5 A;  3KK1 A;  1RHK B;  1RTD B;  5J1E B;  2B7B B;  4G1Q B;  4WZQ A;  2CWX A;  4OYP A;  1RWU A;  1YRU A;  1CUL B;  2C1E B;  1F9H A;  2CQ4 A;  3SIP B;  2YNG B;  1LKZ A;  1FCA A;  3HJF A;  3MD1 A;  1RTD A;  1RT1 B;  4OV1 A;  2GVD A;  1JLG B;  5J1E A;  4G1Q A;  4NZ6 A;  4LF9 F;  4WTO B;  2JSX A;  3KG0 A;  4CYU B;  4F3M A;  4JOU A;  1JX4 A;  3EUN A;  2UVU A;  4ER8 A;  2EK6 A;  2YNG A;  4X65 F;  2BAC A;  1RT1 A;  4FNI A;  4ZCK A;  1F5C A;  1JLG A;  1X7V A;  4A47 A;  5K20 B;  1U1R A;  4CYU A;  4PQU B;  1NME B;  3MPV A;  3EXY A;  1FXR A;  2XCP A;  1CPZ A;  2HZC A;  1OMS A;  4C4W A;  1OYE A;  2FJE B;  1T9T A;  1UFW A;  3BPS P;  1QTM A;  4XPC A;  3W2V B;  4ZVT B;  3ZZR A;  2M88 A;  3K2Y A;  2IC3 B;  1L5U A;  3CCQ S;  3T41 A;  2RT3 A;  4QPT A;  4YHH J;  4E0D A;  1NDP A;  2G2O A;  3NKY A;  1DTT B;  2DPI A;  1KSP A;  4Y0F A;  5ETL A;  1FD2 A;  3W2V A;  5HVG A;  4ED3 A;  3UO0 A;  2IC3 A;  1I6J A;  2O66 A;  2L9D A;  4I6Y A;  4BWJ A;  2V8H A;  4TQS A;  5A6P A;  2P2C B;  2HW3 A;  3A1Y G;  1RJJ A;  3CC4 S;  3PW2 A;  1JLF B;  3UN3 A;  1LK7 A;  5LJ3 Y;  2P6T A;  4OL8 A;  4CO3 A;  1Q7Y T;  3L7P A;  4FKX A;  1RKI A;  4KE5 A;  3BDP A;  2EFQ A;  3QO9 B;  3MCO A;  2PEH A;  3PCO B;  2ACM A;  1IBK F;  2JZ5 A;  2YTC A;  5CYJ A;  3KTQ A;  1VBX A;  4FZV A;  3GON A;  3SSS A;  2F1F A;  4RUH A;  2HLU A;  2C3U A;  2JEJ A;  3D6F B;  2B9W A;  4FYY B;  3OFG A;  3H4D A;  2KO1 A;  2W1B A;  1JLF A;  1ELO A;  2ATL A;  4ZDN A;  3BGF A;  3EGZ A;  1RWW B;  2GIR A;  4A8Q A;  2FQQ B;  3QO9 A;  3J7A N;  4QR2 A;  3J81 U;  3THV A;  4Y2K A;  3FKB A;  2RSQ A;  4FNH A;  2N4D A;  1TFY A;  4HH0 A;  1XTZ A;  4K2X A;  1PIL A;  1TUV A;  3R5C A;  1MNE A;  1RAG B;  3NGU A;  1V3S A;  1YHQ S;  4V19 X;  3QGP A;  4FBU A;  2RNE A;  2RUG A;  3WBZ A;  3OR1 B;  2KJV A;  3MR6 A;  4YEA A;  1S9G B;  3C19 A;  4OI6 A;  8ATC B;  2OSQ A;  5IFM A;  1DQA A;  3RB0 A;  4YOE A;  5A8R A;  2RF2 B;  5C7P A;  5HJY A;  1W2B R;  2AGP A;  1F3V A;  2VQF F;  1RAI B;  1S9G A;  3H0P A;  2BM0 A;  3K57 A;  7FDR A;  2MLY A;  3ILL A;  1RWP B;  4PWW A;  3EVW A;  2RF2 A;  1X5O A;  3RRH A;  4UZB A;  5FII A;  4NLW A;  5D4N A;  3AOB A;  1BMQ B;  1NK9 A;  2MQN A;  3W64 A;  4IO9 Q;  3W5Y A;  2OEM A;  1NZA A;  1Z2Z A;  4GKK J;  4O3Q A;  4JI3 J;  2VHG A;  3PFE A;  3HD2 A;  3TAQ A;  3HHL C;  2AZ3 A;  1H6K X;  2IJF A;  1YIJ S;  2XS2 A;  2CAJ A;  2Y1J A;  2VFS A;  1RYS A;  4NLY A;  4DV0 F;  5EX0 A;  3TW0 A;  2I9S A;  4MK9 A;  3A3P B;  3W2W B;  1AT1 B;  4LVN P;  3HI9 A;  1X0P A;  4A8K A;  3ELH A;  1PC4 A;  1GT8 A;  5C2G A;  2MMY A;  2YWK A;  3MPW A;  1Z4U A;  1WF2 A;  4J9O A;  1SC3 B;  3W2W A;  3ISN C;  1EP4 B;  1N34 F;  2KU7 A;  1HFE L;  1SI9 A;  1P27 B;  1FJE B;  2QE5 A;  5K8M A;  4N5S A;  1U09 A;  2KT5 A;  4DL6 A;  3GJR B;  5I3P A;  5ITH A;  1FWK A;  3OLA A;  1PJ7 A;  1Q16 B;  4K0K J;  3IBW A;  3MMA B;  5AT1 B;  1N8R T;  1IWG A;  4U8Y A;  3W5X A;  5AJ3 J;  1YK9 A;  1AFJ A;  5BR8 F;  3OTO F;  3E51 A;  1M1H A;  1BD6 A;  1Q86 T;  1SH3 A;  4YP3 A;  3EPI A;  3F0N A;  2UXC J;  2UUA J;  3LP2 B;  3FEX B;  4IQM A;  3PIO Q;  3FGV A;  3MMA A;  4EEY A;  1U8S A;  1IQT A;  4RU9 A;  1RAJ A;  4KH0 B;  4EYH B;  4J9K A;  2HK2 A;  5K8O A;  1VIX A;  4MMO A;  5KOW A;  1TUW A;  3WDO A;  1KD1 T;  2CZV C;  3DDK A;  2HMI B;  2WVE A;  2XHC A;  2OH2 A;  3VVU A;  3R6G B;  2IRX A;  5CQG A;  4DWI A;  3LP2 A;  2BYC A;  3AD9 C;  5LL6 d;  1YZ6 A;  4KHR A;  4EZ9 A;  1MLA A;  3W9I A;  2NUH A;  1SIZ A;  4DBQ A;  1TKZ A;  3DRP B;  3DU6 A;  2ILY A;  2XC9 A;  3GFX A;  5I42 B;  3RB4 A;  1M1K T;  4C97 A;  2HMI A;  4WII A;  1B0T A;  5LMN J;  1H2V Z;  5FDL A;  4B3M F;  2F4V J;  3KUG A;  3T3F A;  4MIB A;  4OZ2 A;  1R31 A;  3K59 A;  3AXK A;  4W92 B;  3CD5 A;  4RW6 B;  3LO3 A;  4L74 A;  1JK9 B;  3KLG B;  1FFG B;  3DRP A;  2DR7 A;  2G0I A;  5I42 A;  3MDF A;  1TVR B;  4AT1 B;  5B0C A;  4AL7 A;  1WAC A;  3WHI A;  3A8I A;  4OI2 A;  3R6L B;  3MAQ A;  3D54 A;  1S72 S;  1FER A;  2Z4P A;  1MU2 B;  1D8Z A;  5J2P B;  4QU6 A;  4RW6 A;  4MFB B;  4Z7C A;  1CS4 A;  4CO4 A;  3AQO A;  1RB0 A;  1NAQ A;  1OSD A;  1UKU A;  2JLG A;  3KLG A;  1R8H A;  2MSS A;  1FX4 A;  4U7C A;  4DV5 F;  1TVR A;  2L3M A;  4I69 A;  4XAK A;  2CPD A;  1WTF A;  1PAU B;  3R8Y A;  1MU2 A;  4QU7 A;  3BJY A;  1QAJ A;  5J2P A;  4J9L A;  4B3T F;  2X7I A;  1RTZ A;  1UWB B;  4MFB A;  1SV5 B;  4MJK A;  5KFF A;  4MKV A;  3FBE A;  2PE8 A;  3KLF B;  5FD1 A;  5B7W A;  3DRY A;  4DR6 F;  1X4G A;  4ZPD A;  3DXS X;  2DRA A;  2QN6 B;  1S7I A;  4JV1 A;  4DN0 A;  4L73 A;  4K4T A;  1UWB A;  3R1H A;  4FF3 A;  1SV5 A;  3QZ8 A;  1Y5L B;  3CCR S;  5ETV A;  2WSF C;  1KTQ A;  3KLF A;  3AT1 B;  3CIZ A;  5HK4 A;  1TV6 B;  3G6V A;  5I3U B;  2DBB A;  2JFK A;  2R8K A;  5HLF B;  4USK A;  2OIH A;  3QQC D;  2AYB A;  4Y00 A;  2E5H A;  3DLE B;  4CO2 A;  5I3U A;  2I38 A;  1FWL A;  2NXN A;  2QX0 A;  3TQE A;  3WIU A;  4ZPB A;  1EIY B;  2VFV A;  2FZG B;  3Q8P B;  2JH3 A;  2XMT A;  4J9Q A;  3OXF A;  4CLL A;  5HAO A;  3VAI A;  4P74 A;  4R0E A;  2DIT A;  4Q8E A;  1XMB A;  2ZZT A;  4DLG A;  2HGL A;  3R5B A;  2FVQ A;  1YJT A;  4IRK A;  3J81 Y;  1IKW B;  4LF1 A;  3I5A A;  4NAS A;  4JI8 J;  3DLE A;  1N6Q A;  1VOM A;  1TKT B;  2WVC A;  2GNK A;  1FD8 A;  1U6B A;  4TN2 A;  2J6S A;  2HBZ B;  1HKA A;  3CJQ A;  3HVR A;  4NCG B;  3TEH B;  4JYA F;  3MPU B;  1ZM9 A;  4OZL A;  2E5J A;  4B3R F;  4O3N A;  1IWA A;  1WHY A;  3H5S A;  1IKW A;  1T02 A;  1VI7 A;  4DL2 A;  3GFH A;  3UDV A;  1TKT A;  2DNQ A;  1IKV B;  3UVJ B;  1OPI A;  2Z57 B;  1GMW D;  2WB4 A;  4W98 A;  5L8R C;  2RML A;  4NCG A;  3M8Q B;  1HNX J;  2HQ3 A;  3FVY A;  5DM7 Q;  1OJ4 A;  5A2Q U;  4N77 A;  3B8H A;  1DQ8 A;  3BO4 A;  1SJQ A;  2DNG A;  4NZ7 A;  1TU0 B;  2FY1 A;  1IKV A;  3UVJ A;  1N36 J;  3HHD A;  4JI2 J;  2WHO A;  3TA2 A;  3M8Q A;  2QO3 A;  2V4R A;  3IBC B;  3L3C A;  4L76 A;  4CLW A;  2IMW P;  2B7C B;  2Y1R I;  2X3G A;  2LMI A;  3PJ9 A;  1WKJ A;  1XQI A;  4AXJ A;  5B0D A;  4F02 A;  1I51 B;  4YS2 A;  3HFK A;  1UVN A;  2MQP A;  1YRX A;  3QJJ A;  3FSY A;  1K0T A;  1HWU A;  3BDE A;  4ZK7 M;  2J9E A;  1U45 A;  3PYG A;  4JI0 F;  4YR0 A;  2V94 A;  2KHC A;  3DRS B;  3DRX A;  2ZH1 A;  4F25 A;  3Q8Q B;  3VAK A;  3CCU S;  1IBM J;  1LWF B;  3OL9 A;  4PG7 A;  3D0I E;  3L4B C;  1H74 A;  2BR0 A;  4HR2 A;  1KRP A;  4TU7 A;  3I6P A;  3GIK A;  2Q43 A;  1Q79 A;  3TYT A;  3DRS A;  4IDK B;  5AXN A;  5IM0 B;  1Y4Z B;  1LWF A;  1AUD A;  2APO A;  4Y34 A;  1U48 A;  3BF4 A;  4HL9 A;  4C98 A;  1D8Y A;  1UVI A;  2J8S A;  3NNH A;  2IM0 A;  3FJ2 A;  3FCH A;  4CLK A;  3CED A;  4OQJ A;  4YFU A;  1RT4 B;  2BQ3 A;  3MHY A;  4JI7 F;  4IDK A;  1Y11 A;  5IM0 A;  2OLW A;  4AD6 A;  4J5O A;  3M8P B;  2VDI A;  3OTE A;  4XDD A;  2AT1 B;  2HVD A;  2E29 A;  1KON A;  3LW5 C;  5MAO A;  2E9T A;  4HDH A;  1XNR J;  3GV7 B;  4X66 J;  1B0V A;  1WC3 A;  4ED0 A;  1Q4R A;  4OI3 A;  2EFP A;  3QID A;  2XY6 A;  1RK8 A;  1RT4 A;  5HRO A;  2DHX A;  2CG8 A;  2DCU B;  3M8P A;  1HI8 A;  4JI6 F;  3ENA A;  3JTO A;  1N48 A;  2UVW A;  5L38 A;  3VAH A;  3MOJ B;  1NCL A;  2WON B;  4PAB A;  3OL6 A;  4DS5 A;  4QIE A;  3N6L A;  1J5O B;  2ZFH A;  1NDK A;  4ZOS A;  1KS2 A;  3HVT B;  1TKX B;  2PSZ A;  2KT3 A;  1HNI B;  3DNC A;  3LAK A;  4HDG A;  5HP1 B;  1JIH A;  5GAH I;  4HVZ A;  2Y1L B;  1RAC B;  2PMH A;  3BB5 A;  2HRT A;  3R5A A;  1FTC A;  2RS2 A;  4AQY F;  1H3D A;  2I6W A;  2WON A;  3DM2 B;  2AYE A;  4C0H A;  3PJW A;  1J5O A;  2BKP A;  3ZZY A;  3D1Q A;  3HVT A;  1TKX A;  2HUR A;  3AH6 A;  1HL6 A;  1HNI A;  2XB2 D;  4OX6 A;  1P6T A;  5H9F K;  5EWE A;  4FYW B;  3BN4 A;  3ZTO A;  5HP1 A;  3QPI A;  2V9K A;  3ILI A;  2CYY A;  3JQK A;  5A6W A;  3D6T B;  2VZ9 A;  3MD3 A;  3EYZ A;  4EBD A;  4L3K A;  1G1X A;  3FZ2 A;  1F2G A;  1EKS A;  2DHG A;  1K1S A;  1GAO A;  3DM2 A;  4QW8 A;  2VPZ B;  2ZD1 B;  2FGO A;  3QT5 A;  3LWM A;  3RRG A;  4DF4 A;  3UE2 A;  2WOM B;  4R5P B;  4MIA A;  1X5S A;  2HFO A;  3OFE A;  3AD7 C;  1XMO F;  1E6Y B;  1C0T B;  4PG5 A;  4NCA A;  4E8U A;  4CO1 A;  2M5Y A;  1FXD A;  1N0U A;  4X4T A;  3HZG A;  2AW0 A;  4CNY A;  1H0H B;  2XTJ P;  5KG6 A;  1VQM S;  4UZC A;  4NYO A;  4DR7 F;  2IYG A;  2EPI A;  2ZD1 A;  2KZM A;  3FC9 A;  4LF6 J;  1RBA A;  3O1L A;  1SL2 A;  2JOQ A;  2A6M A;  4X64 F;  2WOM A;  4R5P A;  2WTF A;  3W8G A;  1KHW A;  1E6Y A;  1C0T A;  2IA6 A;  6FD1 A;  2DNH A;  2G13 A;  1S12 A;  4M5J A;  3MAA B;  3H5U A;  1JXE A;  2LLZ A;  1RE1 B;  3LP0 A;  3J81 j;  1HBO B;  4X4Q A;  1SJ1 A;  1ZOT A;  4ID5 B;  3S6E A;  2V67 A;  3QAT A;  2EW9 A;  4Z2X A;  2K3I A;  2E9R X;  4IR1 A;  3DDI A;  4M94 A;  3J7Z 5;  4UOG A;  3MOZ A;  2GVZ A;  3J7Y I;  5IZH A;  1L3U A;  3MAA A;  3M6W A;  1HBO A;  4ID5 A;  4Q44 A;  1F9F A;  1ZM2 A;  3V6D B;  3SXL A;  2HGM A;  1F2H A;  4A46 A;  2OML A;  5E3R A;  4NMX A;  3LWL A;  1UWA A;  3TVK A;  2BA9 A;  4USM A;  4ZJO A;  2QSW A;  2ZH5 A;  5K8N A;  3WX8 A;  2DGT A;  4K5R A;  3QGH A;  4M5K A;  4LF9 J;  1VC5 A;  3ETO A;  3TA0 A;  4RX6 A;  2WW8 A;  2H48 B;  3HFZ B;  3V6D A;  3OPK A;  4X65 J;  5T41 A;  4Y28 C;  2PT0 A;  5ETM A;  4I6A A;  1RT2 A;  1T0T V;  2JC1 A;  1MN7 A;  2E5I A;  3OHA A;  7AT1 B;  3HHK A;  4C8Y A;  3UD5 A;  2JEF A;  3MUT P;  1GTH A;  2ZH8 A;  5HMZ A;  2KM8 B;  4ITS A;  5F3Z A;  3B78 A;  1K9M T;  3A4T A;  3KNG A;  3LAN A;  4ZLP A;  1FE0 A;  3T5L A;  2ILZ A;  2AF6 A;  3IWX A;  5H9E K;  1KVK A;  1QY7 A;  4JUZ A;  2E7X A;  1T3O A;  4M5L A;  4RW7 B;  3WC0 A;  1U49 A;  3Q0A A;  1NK5 A;  2VOO A;  4J91 A;  3NGT A;  2XYP B;  5A2Q Y;  2G9O A;  3N5F A;  4UY8 T;  4B9V A;  4XDC A;  1RT6 B;  1IBL J;  2BJ3 A;  4KPY A;  4B08 A;  3R7S B;  1RWN B;  2FHM A;  1K47 A;  4B9U A;  2VON A;  4RW7 A;  4NLX A;  3THT A;  5IQ6 A;  3HKW A;  2DRD A;  2GAH C;  5DM6 Q;  1VCT A;  2ZBR A;  2W25 A;  4K4Z A;  3HP6 A;  1NK8 A;  4ZJQ A;  1RT6 A;  4A8M P;  3R1L A;  4C7Q A;  2IDL A;  1T94 A;  3GIM A;  4WKR A;  2W01 A;  3HT0 A;  1IBK J;  3OJS A;  1NSK L;  1HNZ J;  5GAE I;  3IRW P;  1LWX A;  3RYL A;  4OJ3 A;  4YB7 A;  1JNR B;  1NLK L;  5KT4 A;  2VB6 A;  1UVK A;  2OPR B;  1KQK A;  2KXF A;  1GTE A;  4RKU C;  2F7V A;  4DSI A;  4C11 B;  2CUY A;  2VBY A;  4DI6 A;  1PBU A;  3TNV A;  1SH0 A;  2L41 A;  4UTG A;  5KT7 A;  3JSB A;  3T5J A;  4WU3 A;  4DX6 A;  3S7R A;  1MN9 A;  2B9E A;  1HHT P;  2WSC C;  3OR2 B;  3FCV A;  1VLY A;  3L95 X;  4K8R A;  1D9A A;  1HQU B;  4C11 A;  5EGY A;  2COL A;  1VQ5 S;  3NP5 A;  2DRB A;  2B8Q A;  4C3L A;  2W2Q P;  4DUT A;  4DLE A;  1FJ7 A;  2Y9H A;  4C0O C;  4ZPA A;  2LKZ A;  3OR2 A;  3BR9 A;  2VFT A;  1HQU A;  1QM9 A;  1TAQ A;  2VQF J;  1FDA A;  4QYZ K;  1JWW A;  2OTL S;  2N7C A;  3CJS A;  1NHV A;  1XR7 A;  2FVS A;  3W60 A;  2LU2 A;  1RAO A;  5LXR A;  3T1H F;  3CDA A;  2H1Y A;  1KOH A;  3BKU A;  1Q95 G;  3NCQ A;  1SKU B;  3R5G A;  4K4V A;  2AEM A;  4LT6 A;  4WU2 A;  3CDW A;  3K5L A;  1HQE B;  3VGV A;  4ECW A;  5EUH A;  3I31 A;  2R2S A;  4ES1 A;  4P2X A;  1F5B A;  2KZZ A;  2HQI A;  2V2Q A;  4DR4 J;  5CYQ B;  1WNE A;  2CDQ A;  1RLD A;  2UUW A;  4A8Y A;  5B0A A;  2FUG 9;  2H4Y B;  1CLF A;  4DV0 J;  5HMY A;  1KWM A;  3MUM P;  1U1O A;  3HJV A;  2GCF A;  3GII A;  2XCA A;  2HPU A;  3P3D A;  4ECZ A;  4KBI A;  2QYC A;  1HQE A;  4A8S A;  1J2V A;  4RNN A;  2W4C A;  4USW A;  2SXL A;  1HIY A;  2FC9 A;  4DSJ A;  5DQH A;  5CYQ A;  4WP9 A;  1Y5I B;  3JS9 A;  5KFA A;  1H72 C;  1OY9 A;  3IAM 9;  3IC1 A;  2X1G A;  3H98 A;  2IJR A;  5CAB A;  2BM1 A;  1N34 J;  3I32 A;  3N6N A;  4A8X A;  2RQ4 A;  2C2D A;  2LQB A;  2VBZ A;  2ZNY A;  5GAH U;  1VQY A;  4F4Y A;  4J9N A;  3POT B;  4PYA A;  1RWV B;  2M52 A;  2V0N A;  1MWZ A;  1WC5 A;  1CJU B;  4WWS A;  2HRU A;  2KKH A;  2Z58 B;  1NB2 A;  2JL9 A;  2CQ3 A;  2DIU A;  3OBI A;  3SCL E;  1Q8K A;  3MXH P;  2RQC A;  1JJH A;  4K4Y A;  1OYD A;  5DO2 A;  2YWF A;  4CDI A;  3POT A;  2V9W A;  4M5G A;  1CJU A;  3GZ7 A;  1K73 T;  5KTQ A;  5M2P A;  5E41 A;  4ENO A;  2Q6B A;  1XIQ A;  1RT7 A;  2RIJ A;  2YY3 A;  2R8H A;  1WG4 A;  2BV3 A;  4AFF A;  4LFC F;  1T7P A;  3PW4 A;  2ZJQ Q;  2DR5 A;  4DUY F;  1HPZ B;  1XMQ F;  3RAQ A;  5DDR C;  4JI4 J;  3MM6 B;  4WBF A;  2OD4 A;  2HKE A;  1NPR A;  2IBK A;  4O3S A;  1WI6 A;  3D0H E;  5EHH A;  4J9P A;  3TX0 A;  3V6H A;  1GEH A;  2K1R B;  5CCL A;  2DK2 A;  3US5 A;  1NK7 A;  1OQ6 A;  3GYG A;  3U7J A;  2EBG A;  1HPZ A;  4PG8 A;  1SBR A;  2A2C A;  3C3L A;  5E33 A;  2QEX S;  3MM6 A;  4DN9 A;  1YJW S;  3UCU P;  3AXM A;  2BE2 B;  4OYW A;  4C48 A;  2BE7 D;  1WOP A;  2ZVI A;  4KGK A;  2DR9 A;  2AEJ A;  5B0B A;  2K1R A;  3M8Y A;  2DGV A;  1UJ5 A;  1FES A;  3J7Y U;  3OTC A;  5HI7 A;  1YVF A;  2B51 A;  4ZP6 A;  1QAI A;  3V2U C;  1O5J A;  2XZT B;  4G6V B;  1DLO B;  4HT7 A;  2NPF A;  2BE2 A;  3MM8 B;  3CCS S;  4WK3 A;  2KFZ A;  1MML A;  1KEK A;  1SJ4 P;  4ZJL A;  5C42 B;  2D9O A;  1LK5 A;  4DCP B;  3VQT A;  2Y1I A;  4RW4 B;  5D78 A;  4PG4 A;  1R0C B;  1UPP A;  1H98 A;  1U4B A;  4PAA A;  4DV5 J;  3NXZ A;  1DLO A;  2GJI A;  3MM8 A;  2V5H G;  3T1Y F;  2P9G A;  1C2P A;  1QUV A;  2QA1 A;  1IKX B;  5C42 A;  1FVQ A;  4RW4 A;  1UZD A;  4ZVH A;  3PTW A;  3BBB A;  3R2C J;  3UW1 A;  3UNG C;  5HAN A;  2VD3 A;  4DR6 J;  3AA8 A;  2FB0 A;  5IWA J;  1C1C B;  1RCX B;  2ZDP A;  1VC0 A;  1YIT S;  4NLR A;  3KLE A;  1F5A A;  5ETT A;  2XWY A;  1FF2 A;  1JLB B;  3IS9 B;  2ATC B;  1IKX A;  3N5B A;  3Q24 A;  2DXF A;  4P2S A;  1R89 A;  1SJF A;  2DO4 A;  3BGL A;  4ZPW R;  4P2F A;  2A3J A;  5KFR A;  2AHO B;  2V68 A;  3IWN C;  3HKZ D;  1QD1 A;  1B64 A;  1P1L A;  2XI2 A;  1C1C A;  2ADB A;  1P1T A;  2UP1 A;  4OHY A;  3PVX A;  1JLB A;  5HMX A;  4DSE A;  3IS9 A;  4RWX A;  5B09 A;  1U2C A;  3V5R A;  3Q22 A;  5CXT A;  5IV3 A;  4DFM A;  1YTY A;  2FJW A;  5EN1 A;  2XSF A;  3EE3 A;  3PYF A;  2VOD A;  5D8H B;  3B4M A;  3Q89 A;  4EWT A;  3VV2 B;  5LSL A;  3D5M A;  2GFF A;  1JQG A;  3W8P A;  4H4K C;  2J9C A;  1JLQ B;  5DQI A;  2HS3 A;  3KLH B;  2NQP A;  3NWR A;  2BRL A;  2AJQ A;  2EKY A;  3NAI A;  3HVA A;  1NEE A;  3ZTQ A;  4BBY A;  1O51 A;  1JJ2 R;  1OWX A;  3LA0 A;  5L1J A;  1NKB A;  4F0M A;  5GAE U;  4ZPT R;  1VRU B;  1KLN A;  2V8G A;  4JYA J;  2GIQ A;  1JLQ A;  4FPR A;  4P7T A;  3K5P A;  2MQO A;  2AGQ A;  4Q2L A;  2FJB B;  1UP1 A;  3NY0 A;  1RHU B;  4LMZ A;  2CQ2 A;  2M70 A;  2POK A;  5KFV A;  1SUQ B;  1OQ3 A;  4QR1 A;  2CPZ A;  1S10 A;  2JHE A;  4EMD A;  2QMX A;  2DKO B;  2E5G A;  4RR5 A;  3KDN A;  3MPD A;  4DL5 A;  1VRU A;  2UZA A;  4DL4 A;  3UD4 P;  4FXW A;  1OIA A;  3GE9 A;  1S59 A;  2RIL A;  1SKR A;  4CLZ A;  4DFJ A;  5AJ3 F;  5AE2 A;  2HS4 A;  1VQN S;  1Y3K A;  4CTA B;  1WOS A;  1GMV A;  1HR0 F;  1QE1 B;  3HX9 A;  4BWM A;  2RRN A;  4D3H A;  3DLB A;  2PA3 A;  2E1A A;  2CPE A;  1F60 B;  4ZVP B;  2F9D A;  2D3U A;  2FPH X;  3ZNU A;  3MPY A;  3A12 A;  3OXL A;  2QL7 B;  4CTA A;  3RR7 A;  2P9E A;  3Q8R B;  4F4A A;  1QE1 A;  4X4O A;  4O23 A;  9ATC B;  1C4C A;  4ZVU B;  2XEX A;  2PGC A;  3EZ5 A;  4X4R A;  3M9M B;  2GV1 A;  2A0F B;  2FD2 A;  2FVR A;  2HHU A;  2W4D A;  4Q43 A;  3R5J B;  1HHQ A;  3TWZ A;  3PJX A;  2BUN A;  4K2J A;  4ECX A;  3LH2 S;  5SZT A;  4DQR A;  3ENQ A;  2E1P A;  4HI1 A;  1HWL A;  2XUL A;  5LMN F;  3DI6 B;  4PPD A;  2ZJP Q;  1RTH B;  2F4V F;  3AY0 A;  4DR2 F;  2OFH X;  4X4U A;  2EWH A;  4AUK A;  1YGY A;  3D7S B;  2KDO A;  2GW8 A;  2UXB F;  2FVP A;  3QWU A;  4KC5 A;  3N9U C;  5LOQ A;  4NEZ A;  4TLQ A;  4F0K A;  3DI6 A;  5KFD A;  1LWC B;  4P71 A;  3G4S S;  1RTH A;  5KFQ A;  5L9X A;  4JI7 J;  1V6H A;  3PR5 B;  2Z2Z A;  3QNW B;  2X1A A;  2G0J A;  1U0S A;  2QRR A;  4WYW A;  1UTA A;  2GIF A;  1VQO S;  3FBC A;  5L1K A;  3BKF A;  2R4F A;  3ZNJ 1;  3D6M B;  3RGI A;  1AYE A;  4DV6 F;  1LWC A;  2IA0 A;  4ELU A;  1TTH B;  3CCW A;  5D0R A;  4DPX A;  2OAU A;  2R7O A;  3NG8 A;  5EWF A;  2DGU A;  4B3S J;  4DX5 A;  2QLB B;  2CPX A;  4JI6 J;  2G2Z A;  3CJ5 A;  3PW0 A;  3FZB A;  4BC9 A;  4J9R A;  2ZH2 A;  1FI4 A;  1WEZ A;  2IMO A;  2VC0 A;  1FKO B;  2KN4 A;  1RHQ B;  3EX7 B;  2E1R A;  2FLP A;  4C3K A;  5DET A;  5AXM A;  3E3X A;  2U2F A;  1RHR B;  2J7U A;  4GVL A;  1X8D A;  3DHX A;  4TLR A;  3S01 A;  5D4L A;  2FJX A;  3LTO A;  1FKO A;  4KGM A;  1CVJ A;  4ECV A;  2ROE A;  4NZ0 A;  1WC0 A;  3G86 A;  5D0G A;  1HBM B;  3PY8 A;  1C1B B;  2UVR A;  2R8I A;  4CT9 A;  1VQ7 S;  1M1G A;  1TK8 A;  3NBP B;  3SCK E;  1PO6 A;  3LGH A;  4NYZ A;  1ZA2 B;  2VJV A;  3EGV A;  4HYK A;  5A8W B;  4DF8 A;  4ZCI A;  1R7I A;  3UCZ P;  1L3K A;  1XMO J;  3TEG A;  3O5T B;  2QYG A;  1HBM A;  3ITH B;  2BXJ A;  2LXF A;  4PXB A;  1ZBT A;  3I5C A;  1C1B A;  4UUX A;  5CD4 A;  4IRC A;  2DGO A;  4X4S A;  3NBP A;  1YLX A;  2J5A A;  4JI8 F;  4DR7 J;  2DNP A;  4F3Q A;  1NSQ A;  2MLZ A;  3H59 A;  2PFD A;  1RTI B;  3HDS A;  1Q8I A;  2OKQ A;  5A8W A;  3HLU A;  3GB0 A;  3PX4 A;  3MFH A;  4X64 J;  3EM1 A;  4WP3 A;  5LMU F;  2B6A B;  3I0R B;  4S0M A;  3QZ7 A;  4JV5 F;  3ITH A;  1RUS A;  5LJ5 Y;  3IO1 A;  2MZQ A;  2R2U A;  4LRE A;  1RP5 A;  2HGN A;  4DV7 F;  2JC0 A;  1RTI A;  2I1R A;  3ILO A;  2LDY A;  1SIW B;  2ZIT A;  2U1A A;  2CJQ A;  2NXC A;  2B6A A;  3I0R A;  2PI5 A;  2Y8W A;  2CQI A;  3HMJ G;  5KFI A;  3RTV A;  5F3T A;  3BM7 A;  3NS6 A;  3ETM A;  3ISZ A;  3CE8 A;  1YX2 A;  1KFS A;  4KY3 A;  5KFK A;  3LQV A;  2WVD A;  3T5H A;  2EC0 A;  3M9O B;  4I2Q B;  5LM7 E;  4P6Q A;  3PV8 A;  3RRK A;  2HBY B;  2VG6 B;  3QFH A;  4OFZ A;  3SDE B;  3D1H A;  3H20 A;  4YDX A;  4DUZ F;  2VPY B;  3CO0 P;  2EFO A;  4YB5 A;  4C8K A;  1TMM A;  2BJD A;  3ZXW A;  1R8C A;  1N5S A;  5BYS A;  4Y3C A;  5B08 A;  4WCE Q;  5F8J A;  1RA6 A;  4F04 B;  3GQC A;  3EXC X;  3PFO A;  3W66 A;  1U26 A;  4I2Q A;  3M1V B;  4FYX B;  2HFZ A;  2BQU A;  2VG6 A;  2XO6 A;  3V81 B;  3SDE A;  2FJA B;  4LF4 F;  2DY9 A;  4CH0 S;  1TR0 A;  2E9Z A;  1TAU A;  4PG6 A;  3DMJ B;  3FMB A;  4DV1 J;  3CSK A;  1UJ4 A;  3BRE A;  4WIQ A;  1WTB A;  2IPO B;  2ZKT A;  1FDB A;  1ZAX A;  1YI2 S;  5IT9 Y;  4ZP7 A;  3M1V A;  2LVW A;  4DOZ A;  1IM4 A;  3J80 U;  2HAI A;  4UST A;  2VOP A;  1O6X A;  3V81 A;  4I56 A;  4OLP A;  4CLT A;  1BQX A;  1N54 B;  4G65 A;  1Z2L A;  4NLU A;  4I0W A;  3KUH A;  5L46 A;  3DMJ A;  3JTP A;  2ZM6 F;  3M05 A;  1RSC A;  2CWK A;  3H42 A;  2BZ2 A;  1F3F A;  5M2R A;  3LPE A;  3OV7 A;  4LFB F;  1X4A A;  2K8G A;  2D74 B;  2ZVS A;  2OEJ A;  2HRY A;  2CPJ A;  3SZ2 A;  5DRK A;  2DGX A;  4IFV B;  1W26 A;  2QIF A;  4GMK A;  3NEK A;  3MCM A;  3TZZ A;  3VGS A;  1JXV A;  5C25 B;  5DZ7 A;  1MWQ A;  1N33 F;  4RW8 A;  4RW9 B;  3PX0 A;  1VHI A;  2Y0B B;  4FS2 A;  3PO5 A;  2FHO B;  3TZW A;  1XNR F;  3TJ9 A;  4X66 F;  3KXD A;  4RZR A;  3QIP B;  4IFV A;  2YQ3 A;  1GNK A;  3CJR A;  4NLG A;  1FEH A;  5C25 A;  4ZP8 A;  4F2R A;  2BEF A;  3FNN A;  1VQS A;  2JWN A;  4NXN F;  4RW9 A;  1B7F A;  1UMJ A;  3M2V B;  4DPU A;  4WXW A;  2PA8 D;  3TX8 A;  2BKN A;  3FEZ A;  2MYF A;  3QIP A;  4UW2 A;  2W4P A;  3TAP A;  2FY8 A;  2K3K A;  4LRD A;  3THP A;  3JYT B;  2VPX B;  3H8Y A;  1XK8 A;  1WHX A;  3UCG A;  2WBR A;  4Y2A A;  3O8W A;  3BH7 B;  3CWJ A;  3M2V A;  4PCQ A;  2CNL B;  5E3C A;  4ANE A;  3F73 A;  1FDN A;  5C2C A;  4M63 A;  1QSL A;  1RIS A;  2LU1 A;  3DOL B;  3FDS A;  2A2D A;  4J7C A;  2AV5 A;  1HWJ A;  4CI0 B;  2QLW A;  1EAR A;  3UN5 A;  3JYT A;  2JLE A;  1N52 B;  2C2E A;  5B0G A;  4F4X A;  4ECU A;  1UVL A;  3G8S A;  3GYX B;  3WIV A;  4IO1 A;  2P9C A;  4KHM A;  1KQF B;  4F50 A;  2HNY B;  2RQM A;  3EVO A;  3A3O B;  3U02 A;  2MLX A;  2N7Y A;  1VQ9 S;  3DOL A;  3HUL A;  2ZBC A;  3UFC X;  2UU9 F;  1UEK A;  2C3M A;  1PYO B;  2VA2 A;  1RXO B;  2I5J B;  5D77 A;  2FZC B;  2XGQ A;  2NSB A;  3ENV A;  3VF0 B;  2DH9 A;  1XEZ A;  5KFS A;  2HNY A;  2EXU A;  2FHK A;  3T1H J;  1RAE B;  3PZP A;  4GVB B;  1CQN A;  1ZPW X;  2I5J A;  4FS1 A;  3QT7 A;  1T9Y A;  2ZE2 B;  1NHU A;  4EO8 A;  1FRM A;  1J27 A;  1SXL A;  4GVB A;  1RDR A;  1RGV A;  1S9F A;  4DQS A;  4TQR A;  1Q5V A;  4PKD B;  3CCL S;  3SSR A;  2GVD B;  1VRQ C;  1GFW B;  1FO1 A;  3RBE A;  2ZE2 A;  4AE5 A;  5EDW A;  1KR4 A;  1HYS B;  4A8W A;  1F1B B;  1PKU A;  1VJW A;  2W2P P;  4DR5 F;  1RAD B;  4WK1 A;  4LF7 J;  4B9T A;  2R7V A;  2YPZ A;  3LGM A;  4DXL A;  2ZH9 A;  2NR0 A;  2J0Q D;  1I3O B;  3QGG A;  3PW7 A;  4B3O B;  4GRS A;  1HYS A;  1T9W A;  2W9B B;  1M5V C;  1DRZ A;  2QFI A;  1NDC A;  3IN5 A;  1X4E A;  3DLK B;  2H3E B;  3IA0 A;  1GK8 A;  2NXU A;  1VRT B;  2GQ2 A;  1YJ7 A;  1G7C B;  3T6B A;  1T03 B;  3OW2 R;  2FC8 A;  1VIO A;  4B3O A;  1I94 J;  5HL7 Q;  2W9B A;  1X31 C;  2DNK A;  1FKP B;  2YXL A;  2FLL A;  3KOA A;  1ZH5 A;  4LFC J;  5KG4 A;  3DLK A;  5FLX U;  1AA1 B;  2A6O A;  5KFO A;  2NXE A;  2OEK A;  2AMC B;  2B4V A;  2DNZ A;  4DUY J;  4DQI A;  4ZMM A;  1XMQ J;  1NPP A;  1VRT A;  3MMB B;  4W4M A;  4DFP A;  3M6U A;  1T03 A;  1R8A A;  2VC1 A;  2Z30 B;  2BBE A;  4QYR A;  1FKP A;  2IJN A;  2FJD B;  2DGS A;  4P9S A;  3UI3 A;  3UQS A;  3ZZ0 A;  4CH7 A;  4DV3 F;  3M6V A;  4H4O B;  1IBL F;  3MMB A;  1TQL A;  2F4F A;  1PG5 B;  2N4C A;  4RU2 A;  4NCB A;  2W2O P;  3JAM Y;  3UN2 A;  3MM7 B;  4LQ9 A;  5ETP A;  3AHP A;  3OTD A;  3CMA S;  3F56 A;  2VPW B;  1BQN B;  2VF3 A;  3OJU A;  4ILM A;  1NZ8 A;  2MJN A;  4WFA Q;  2HS0 A;  2QLF B;  4H4O A;  1N5Q A;  3Q83 A;  1R43 A;  2R7U A;  1N0V C;  2KJW A;  3M8R A;  3FMW A;  3R5D A;  3BGO P;  1HNZ F;  3MM7 A;  2YQ0 A;  2B56 A;  3GU0 A;  2CG4 A;  2DNM A;  4OZ0 A;  4DSK A;  5KFZ A;  1BQN A;  2OD6 A;  1WG1 A;  3VAF A;  3R97 A;  4UQT A;  1S97 A;  1MMD A;  2MZJ A;  3T1Y J;  2R7W A;  4O4G B;  2HG4 A;  2DHH A;  3RJM B;  1PJ5 A;  5KT2 A;  2OPS B;  2FZK B;  2FLN A;  5A8R B;  3OSP A;  2HZV A;  4A8O A;  2XI3 A;  4NL5 A;  1VJQ A;  3NRB A;  4LF2 A;  4WJB A;  1R0B G;  1TUG B;  2WVB A;  3KUE A;  4LR8 A;  1DUR A;  4LIW A;  4O4G A;  2CXE A;  2FJV A;  1MRO B;  3M2U B;  2M0G B;  2OPS A;  3OTB A;  4F67 A;  1N32 F;  4Q0B B;  3J7Z T;  5L39 A;  2HYI B;  3HK2 A;  2C3P A;  3QLH B;  4ZVQ B;  5GAG I;  3CF5 Q;  3N4W A;  3MGJ A;  4Y6I A;  3IRX B;  5GAD I;  4KKO B;  1S6Q A;  2WW4 A;  1M90 T;  1REG X;  2UXD F;  1Q7L B;  4Q45 A;  1MRO A;  3M2U A;  5EWG A;  2BJ1 A;  2R3V A;  4Q0B A;  3PHE A; 
#chains in the Genus database with same CATH homology
 1AB8 A;  1CUL A;  4OYA A;  4CLS A;  1FX4 A;  4CLU A;  2GVZ B;  3C14 A;  4OZ3 A;  4P2X A;  5D0H A;  4CLP A;  1WC6 A;  1WC0 A;  4USV A;  5D0G A;  1YBT A;  3ET6 A;  3C16 B;  5IV4 A;  1CJK A;  4P2F A;  1CJU A;  4CLF A;  3UVJ A;  4UST A;  3G82 A;  4CLT A;  4CLL A;  4OYP A;  1TL7 B;  1AZS A;  1CJV B;  1CS4 B;  1U0H A;  5D0R A;  4CLK A;  1CUL B;  3MAA B;  4WP8 A;  4CLW A;  1CJT B;  4USW A;  1YK9 A;  5IV3 A;  4OYM A;  4WP9 A;  4NI2 B;  1Y11 A;  4OZ2 A;  3C16 A;  2QV6 A;  2GVD A;  2W01 A;  3C15 B;  1TL7 A;  4CLZ A;  1WC1 A;  1CJV A;  2GVZ A;  1WC3 A;  3C14 B;  5D0E A;  1YBU A;  4CM2 A;  3MAA A;  4CM0 A;  4WPA A;  4USU A;  1CJT A;  3ET6 B;  4WP3 A;  4CLY A;  3MR7 A;  1CJK B;  1WC5 A;  1CJU B;  1Y10 A;  4OYO A;  1FX2 A;  4NI2 A;  2BW7 A;  3UVJ B;  4P2M A;  4OYX A;  3G82 B;  2WZ1 A;  4OYZ A;  4OYB A;  2GVD B;  1CS4 A;  3R5G A;  4OYW A;  1AZS B;  1WC4 A;  3C15 A;  4OYI A;  5D15 A;  1U0H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...