1CJVA

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mg, and zn
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLATE CYCLASE, TYPE V
publication title Two-metal-Ion catalysis in adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
total genus 55
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cjvA00
1U0HA 4WPAA 1CJKB 1CJVB 1AZSB 4OYZA 3MAAB 3ET6A 4NI2B 4CLUA 4P2MA 1YBUA 1CJKA 5IV3A 4USTA 1CJVA 1AZSA 4OYAA 4OZ2A 3C15B 3C16B 3G82A 4CLZA 1CS4B 1WC4A 4P2FA 4CLPA 3C15A 4OYXA 4CLTA 3C16A 1CJTB 5D0EA 4WP8A 5IV4A 1CS4A 3R5GA 4OYWA 5D0RA 1CULB 1CJTA 1YK9A 4CLSA 4CLWA 4CM2A 5D0HA 5D15A 1WC3A 4USWA 3MAAA 4NI2A 4OYOA 2GVZB 1CULA 4WP9A 1WC5A 4OYPA 2BW7A 4CM0A 1AB8A 1WC0A 4OZ3A 1YBTA 4P2XA 4OYIA 4CLYA 4WP3A 1CJUB 3ET6B 1Y11A 3UVJB 2WZ1A 1TL7B 1Y10A 1FX2A 5D0GA 1CJUA 4USVA 3G82B 3MR7A 2GVDB 3C14B 4OYMA 1WC1A 2GVZA 2QV6A 2W01A 3UVJA 4CLLA 1U0HB 4CLKA 1TL7A 4CLFA 1FX4A 1WC6A 4OYBA 2GVDA 4USUA 3C14A
chains in the Genus database with same CATH superfamily
3HKWA 3MM6A 3CJQA 5J1PA 3EZ5A 2AYEA 3KLGB 5HP1A 2HHSA 2XMTA 3IS9B 1X31C 4DL3A 3W65A 1BWEA 3RR7A 2RUGA 1MMLA 2UV8G 2OPSA 3HZEA 2NSBA 4DG1A 1GFWB 5IC6B 4CT8A 4F2SA 2HFSA 4KGVB 1R43A 4ED3A 1PIEA 4MT1A 1C0UB 1N48A 1D1UA 2I1RA 2I5JB 2Y1LB 5F3TA 4A47A 2KVIA 4AXJA 2MQPA 1RWKB 2HNYB 2ZZMA 3KLEA 4IG3B 4K0KF 3MTKA 4K5RA 4DV5F 5GMEA 4LBPA 4WF9Q 2OELA 3CMQA 3SV3A 2YNFB 2ZJPQ 2JWNA 3I5AA 2BABA 2P9CA 4ZCIA 4ILMA 1SVDA 4B3MF 3QYYA 1WELA 3T3FA 4CRJA 4JI7F 1S9GB 3NGTA 3MECA 2MSTA 2B6AA 2QV6A 2XC9A 1TL7A 3GYNA 3AJ1A 2R2UA 1FDNA 3LP2B 3UR3C 4USUA 2MKKA 3IWNC 1FRIA 4ZIVA 1HNVA 3RGIA 4AT1B 2DHGA 3Q8UA 3M7VA 4C97A 4Q44A 3SV4A 3G96A 1MMNA 2DH9A 3QO9B 3L09A 1RBLA 3GIRA 3SCKE 3CJ5A 3FK4A 4RW7B 4DR2F 4LRAA 3SSRA 4ZITA 4RR5A 2C1EB 1S0MA 3JYTA 4ES1A 3MPVA 2BXJA 1NSKL 2W24A 3ENVA 4ZVRB 3MMBB 2Z30B 5GAGI 2XLJA 3TA1A 4ATNA 2QA1A 3ZTOA 4AL5A 3OFHA 1UVMA 1OYEA 1IBLF 1HBOA 3UVJB 4JI0F 2WZ1A 2FHOB 2MJUA 2EK6A 3DRPB 3CJSA 5B0AA 3RTVA 2KG0A 3NRBA 1D9FA 1RT5B 1NJWA 1X4AA 4HACA 2ASJA 4X62F 4X4SA 2ZE2A 3X1LB 2LQBA 3CDWA 4Y00A 3NMRA 2A18A 2GGPB 4WFYA 2DR8A 1S6QB 1RADB 2D9OA 5IV3A 4RNHA 1VQ5S 2XEXA 1JLAA 1YVFA 1ZOTA 3R7BB 2HWIA 1KDNA 4LMZA 1QAJA 4NL5A 1XERA 3AB4B 1QUPA 3Q24A 4WWSA 1ZPVA 4I1TA 4A4JA 4EO8A 4PWDA 4DQIA 4I67A 1ZAWA 4RW6B 3D1QA 4CO0A 1N32J 4B3RJ 3RB3A 2V34A 4JI2F 2BDPA 2E1MC 3KWMA 2K1RA 1LQ9A 4YY3F 3DOKB 2HZCA 2NUUG 3ZTQA 4RBVA 3TRGA 4ANEA 5KFDA 4DF8A 1TVRB 5K14B 4RLEA 1UFWA 5HJYA 2GHPA 3KK1B 2AMCB 4B9UA 1NKCA 2OD4A 3IM9A 5KT3A 4A8MP 1RISA 4Z7YA 2AT1B 2IM2A 5KT5A 1GTEA 2VF3A 1LWXA 1IQZA 1FDBA 3ELHA 4UT4A 3VAIA 1IXKA 3QGGA 4HYKA 1XNRJ 5CYQB 2LLZA 4OYWA 3CO0P 3U1MA 2W9AA 1XMOF 3M8PB 1FXRA 1SV5B 3W64A 3MM7B 5MAOA 3R27A 2I8EA 2OPQB 5HN0A 4RJVA 1M5OC 2CPXA 3W2WB 2CQ3A 2DNQA 2R8HA 2COLA 2GA7A 2HIYA 4OI3A 1RHUB 5BYSA 2Q79A 4Z37A 2IA6A 5CCMA 2WVEA 2ZFHA 4MKAA 2DCLA 5CA5A 3H59A 2PE8A 5LJ3Y 4TY8B 2ZZTA 4O44A 1MW7A 1FT8A 2VQEJ 2GIRA 3GFZA 2GMHA 5HLFA 1LW2B 4F0KA 3W9IA 3DM2A 2L9WA 5B0GA 3HVAA 1WTFA 4I0WA 1TKXB 3P8BB 3DHXA 5L1IA 2C2EA 4HHHA 4LF9J 1FWPA 3O2IA 3AQPA 4B02A 3R8YA 1Q8BA 2JH3A 3G86A 4KKOA 5IWAJ 3RB4A 2BR0A 3E51A 4YHHF 3MMCB 4OX6A 2MZSA 1FFWB 1WKLA 3F41A 1B64A 4J9MA 2DR6A 5L9NA 1RHMB 2WONB 3MM8A 5LOQA 2HWTA 1ROFA 5GADI 3POTB 4JI5F 4IH5A 1UKUA 1WKJA 3CJRA 1T9YA 3ZTRA 1T8EA 3KLHB 2E9TA 3D54A 2DGSA 4MIAA 5L46A 2WVFA 2Z4PA 4KRWA 3TR5A 3AD7C 1JLGB 5C2CA 4OMFG 3G8SA 3HFKA 2UU9F 1OQ6A 1RU1A 4IFYA 1RA6A 1WC6A 3PRDA 3DHWC 4PG4A 4EYHB 4A8QA 1S1UB 3I0SB 4ID5B 3VGSA 1QAIA 2PA3A 2QIFA 4M5DA 2CAJA 5E3QA 4F02A 2E1CA 4NZ7A 4RBTA 1J5EF 4U95A 3QNWB 4OYXA 3CCVS 1TL1B 5IV4A 5KFOA 1FKOB 1T9UA 2IM3A 3H98A 4G6VB 4IG0A 2YWFA 1TKZA 3I9ZA 3NS7B 3NNCA 4GO7X 4WP9A 3RYLA 2UXDF 3MDFA 3ZTPA 2R7RA 3ILJA 4ANDA 2IVMA 4LF4J 2B9XA 4CLYA 2D9PA 2QEXS 1LW0A 4U67Q 4K59A 4ZLPA 1JXEA 1V3ZA 2MXYA 4WJBA 3O5TB 3L7UA 1I5OB 4OX8A 5KG1A 4DR3J 4M5IA 5KFPA 1REVA 2FVPA 2DK2A 1WTBA 2MLYA 2QLBB 3A8KA 1VQ6S 1SB6A 4MK8A 2B5JA 4DJBA 2KJWA 5KFNA 3KG4A 2RT3A 5EUHA 3VR1A 4RNFA 4F4KA 4FXDA 2V8DA 5M2PA 4OJ1A 2RIJA 2RS2A 1MROA 2R7SA 3C6TB 3IMQJ 3MFIA 1K9MT 3BDPA 3WBZA 1N5YB 3D4JA 4QIVA 2ZWOA 3NOGA 1Q5YA 1G3OA 5AE3A 4Q8EA 2BE7D 2RHSB 3KLVA 2VQFJ 4JI6F 2HHTA 4FVCA 1X0PA 4YDDB 3KHGA 1VK8A 4O4RA 4ECQA 3L7PA 1RWUA 4DQSA 2APOA 1GH8A 3FUYA 4ICLB 3QJJA 4CIOA 2VG5A 5BYRA 1W26A 2LU1A 1WDTA 3CIZA 1VK3A 5F8MA 2XQCA 1LFPA 1WEXA 4DV3J 5G0RB 2FLNA 2QN6B 3IGNA 2QSFA 1QVFR 1F5AA 2BV3A 2R7UA 4WIQA 1W7WA 5I42A 3UI3A 3FCWA 1MU2A 3GJTB 2DPJA 3QMQA 2CZ4A 2EBGA 4UQTA 5ETSA 1B70B 1UVJA 3D0IE 4ZJOA 3M8SA 4I2QA 4MFBB 1XC9A 2RQMA 2ZHBA 2XGPA 2XB2D 3IBFB 1H74A 1A0OB 1RCXB 5DLGA 3BH7B 2E7VA 2VJUA 2DRAA 3T1HJ 2HLUA 2BE2A 4F2RA 5A76A 3A4TA 2GJ2A 1M1GA 4DV1F 3PDNA 4CYUA 1KD1T 1HYSA 3NCRA 2MZRA 5C25B 6AT1B 3WX8A 1VQ8S 4Y28C 3HSGA 2ASLA 3FGVA 4TU8A 1JJCB 1WJ9A 3AOBA 3BDEA 4NWBA 2AGPA 1FXDA 3M9OB 4ZJLA 1BY9A 2YKPA 3MEEA 3BQ0A 5A6WA 4R8UA 4LF5J 1HL6A 2R2TA 4KR0B 4DX8H 3MXHP 3OR1B 2LKZA 4JI3F 3Q8QB 3SQGB 5A8RB 3SQOP 2OTLS 4H4OB 2GJFA 2OTJS 2JVOA 4Q7AA 2Y9HA 1SCJB 2YKMB 2OJ3A 3BPSP 1HWKA 1HMVA 3LP0A 4P74A 3W8GA 4DX6A 1JNZB 1CS4A 1U1OA 2UUWA 1P6TA 2L9NA 4JV5J 5AXNA 1CULB 5E5NA 3SCJE 3A8IA 4X84A 3GG1A 3OUYA 4ER8A 4F25A 1T9XA 1MMDA 4F4AA 2HBRB 4AD6A 2YNGA 1T3OA 4QJVA 2QMUB 4U7UD 2VUGA 3OR2A 1RWNB 1KP6A 3OXFA 5KFZA 3MR3A 3EVWA 3MR2A 3D3CJ 4O23A 2HBZB 3HVRA 4C0OC 3OVSA 2DY9A 3M30B 2DYAA 3BGRA 2BQUA 1DTQA 5LJ5Y 3BB5A 1S1XB 4ZVSB 2WTFA 4UUWA 4ECSA 1SC1B 3W66A 1L3TA 3QT7A 1ZTTA 2XNRA 3N6LA 4L76A 3ET6A 3PW0A 2O5DA 1YBUA 1T11A 5C24A 2LQJA 2Z2MA 5C5JA 2KKHA 4UTGA 2OKQA 2GIQA 3TZXA 4ZDNA 3DDNA 5B0FA 3BJYA 1VCTA 3HHEA 4DFKA 4C11A 4PQUA 2GMLA 1NM2A 4PPZA 3BYPA 4LRDA 1XR7A 3H42A 2PMWA 2IDEA 4DDFA 1YRUA 1ZH5A 3H25A 4K4YA 2KM8B 1YRXA 1DRZA 1D9DA 3V6DA 2BMBA 3SFUA 1RT1B 4HH1A 1S4EA 2NSCA 4P2XA 2BQRA 3OTDA 3QQCD 3OJUA 3I0RA 1R27B 1T03B 3U27A 2YX4A 1RXOB 2ZDPA 1GMWD 2YNIB 3AOAA 2JLFA 1HBNB 4DUYJ 2KFNA 2H4YB 4CH0S 3DU6A 1FKPA 1ICEB 3NAHA 1EKSA 1WSRA 1FRLA 4PCQA 1JMTA 1FTCA 3EZOA 1HNWJ 3DMJA 2RS8A 3I4HX 2KM8C 3D3BJ 5GAHU 1X9WA 4N56A 2FY8A 3UNGC 2LQ9A 5A6PA 4DSEA 1JXVA 1WHVA 1RAOA 3G9CA 2JFDA 3VQSA 2XZWA 3KDNA 2EWHA 4P73A 1S49A 3TAMA 4LUBA 2OUGA 3IAS9 4IH7A 1N52B 2HEKA 1S6OA 1H3DA 2WSFC 1U25A 2NZCA 2C42A 2HHHJ 3NAIA 2FLPA 4URSA 4PPDA 1KHWA 1N0VC 2NXCA 4F04B 2PIIA 2RQKA 4FF4A 2OGUA 1VOMA 5J2NB 5AT1B 1TK0A 4TLRA 3W2VB 5GAEI 5DGBA 1FRJA 3SI8A 3QZ7A 2G13A 3ZXWA 4DPTA 2B51A 4IDKB 2NLWA 1M0SA 1LWFA 1C0TB 3RRKA 3R5DA 2UUCJ 2W7AA 1UETA 5F3ZA 3BO4A 4IRDA 4DL7A 2DR9A 1HPZB 4ZPWR 1P1TA 3DGPA 3R9LA 2ERRA 5I3UB 2AEFA 2OFGX 1M5HA 1VBXA 4B3TF 1RT2B 4J9SA 4MYTA 2JNJA 2QT7A 4C8LA 1UJ6A 4L72B 2C2ZB 3IC1A 3UCZP 2B43A 1I51B 4XTTA 4KV8B 1RQ0A 2WBMA 1DLOB 4IOAQ 2F9DA 4X4NA 1IBCB 2WOMA 4ZVTB 4IFVB 3HT0A 1LOUA 1VQOS 3NCPA 3CMAS 2YKNA 2HFUA 4NOHA 1VIXA 2JX2A 1W25A 5F8GA 4UW2A 1D8ZA 5K9FA 4GRSA 2IM0A 3U1NA 4ALZA 2FC9A 4CH1A 1BQNB 2EFNA 2IBKA 3GIMA 3NGKA 2DH8A 5KAKA 2F9JA 1X5PA 2W01A 5D3GB 5MLCV 5IC4B 1KLMA 3DLGA 4DR6F 4GVLA 3CDUA 3MAHA 5FJ4A 1YBAA 4C8ZA 3DDKA 4UY8T 5IM0A 1UMJA 4B17A 5LSLA 3C15B 1EETB 4F8RA 2Y0SD 4NMLA 2CPJA 3QAUA 2R42A 2NQPA 3W63A 5C2GA 2VFSA 5F41A 4LBIA 2KT2A 1PILA 1XJWB 4K8RA 2BM0A 9ATCB 1KR4A 1PJ6A 1UEKA 2QFIA 3OD2A 1FRHA 4PXEA 3TJ9A 1O51A 1U1PA 4NE9C 4R0EA 2E5LJ 2GVZB 4NXMJ 2QRRA 2M5YA 2DNNA 1O8BA 3IAM9 1UZHA 3JSYA 3K57A 5KFHA 5CYMA 3ZZZA 3FC9A 1EP4B 1RACB 1EZZB 1ITPA 5J1EB 1NHKL 3H2VE 3W5YA 1NK9A 4EZ9A 4DR1F 1I94F 3P49B 3OT9A 2QX0A 1H0HB 1UFKA 2V4QA 1Z2ZA 2NYHA 2N4CA 4B9SA 3AA8A 3MPUB 3NWRA 3ICLA 4NYOA 4O3SA 4LF8F 2RRBA 3JSBA 5C42B 2NUHA 2YXLA 5IQQA 4WFNQ 2E5IA 2F40A 4QIGA 4N76A 3KKFA 1H98A 4DG1B 1FJGJ 2DNZA 3CC7S 1TR0A 4NLTA 4A46A 2W4PA 2YWEA 1F1BB 2EPIA 2GCFA 2ZBQA 3T5KA 2RJZA 2IBOA 1Q7YT 3VVTA 4YB7A 2E5JA 2FVSA 1OO0B 1YSJA 1AA1B 1U2RA 3P6YC 3KLEB 2M4MA 3HF5A 3CD6S 1T02A 4RUCA 2H9ZA 3KK3A 5HBMA 2P2CB 2HQGA 2HHUA 3DKDA 4FVMA 4ZK7M 5HK4A 1X4HA 2PEBA 4DQQA 4OYIA 1EHWA 1L3UA 3PJ9A 1U6BA 1FVSA 1HNIB 3MECB 1FNMA 2ZOFA 3IO1A 2B6AB 4LREA 1TL7B 4HVZA 1VLOA 5D6GA 3F44A 3NBPB 5DDQC 2NPIA 4QR1A 5KFGA 1NK6A 1RLCL 4CLKA 2ACYA 1FD8A 4XPEA 3IR6B 1HNVB 4EUVA 2KT3A 3BPDA 4URGA 3NGDA 1RTDA 2F5GA 3H2UB 4B9LA 2R7OA 4V19J 1F5BA 5CD4A 1WF1A 3T1YJ 3PYEA 1S77D 4U96A 1WF0A 3G8QA 3AOCA 1DY3A 2VC1A 2CJXB 4I7FA 4LQ3A 4M5KA 4X64J 3MEGA 3A1YG 3JYTB 1E6VA 2OP5A 4WP8A 1RAGB 3GU0A 2OEMA 1LKZA 1OY9A 5D0RA 4NLYA 3NKYA 2BJ7A 1TELA 1F5CA 2AQ4A 4KC5A 4PR6A 1FEHA 5DM6Q 2JHEA 4GMKA 2AGOA 3KG0A 3K5OA 5KG7A 5HMWA 1X7VA 2UXCJ 1NK8A 4BDPA 1SJ3P 2KO1A 4LFBJ 4HACB 3W9HA 2IPOB 4FS2A 2EFQA 2MGZB 2UUBF 4BC9A 3F0NA 3N6MA 4ZPDA 4X4UA 4LSZB 4E8UA 3THVA 4K4UA 2C3UA 2AJQA 1U48A 3ZTSA 2BJDA 2R8KA 3SCLE 2LDIA 1TAQA 3CJ4A 4ECWA 3ILIA 2B9YA 1Q0NA 4DPXA 4ZPTR 2HHVA 1BLUA 1GMWA 3BKUA 2YPYA 2QMWA 1R6VA 2CPFA 3GZ7A 2CJ9A 1RT6A 2BOAA 1S1VA 4ZVHA 4PWDB 1HFEL 3OSNA 3KUEA 1YX2A 4YR0A 4FKYA 2VG7A 4I56A 5ADZA 2D3ZA 2FTRA 3UFCX 1UCNA 4OX9F 3HHNB 1RP5A 3WIUA 2K1RB 1EARA 1HIYA 1TFYA 3R5JB 1M1KT 4LRCA 2OH2A 4IR1A 1V6HA 2AU0A 2PN6A 5GMDA 1XR6A 3FMBA 4KHRA 4G1IA 2WRMA 4L74A 4DQRA 2NREA 3EGZA 1TTHB 5DGAA 2DBBA 3DI6A 2DHSA 4LT6A 2JEFA 3Q8RB 1NU4A 1SH2A 3IP0A 2WCXA 1F3VA 1GT8A 4Y2MA 1AT1B 3KLFA 3EDRB 1VS3A 1RYRA 4LR9A 1NSQA 2NS1B 2JVRA 4QW8A 5FDLA 4YOEA 3DRYA 3SYZA 3SZ2A 2CYYA 5F8LA 4QYZK 1FVQA 4ZN1A 3R6GB 5HMXA 3W8PA 3KMSA 1QJHA 4OHZA 4KHPJ 1RB0A 4OI6A 4TQRA 1S9EB 2ZHOA 4FBTA 4NLQA 3MM9A 4EMDA 3MAAA 4QR0A 2N82B 2V0NA 1UWBA 4EEYA 3I56S 1Z4UA 3JSMB 4OZ3A 1FWKA 1PGZA 1KONA 1UEUA 2XLIA 2B9EA 3VGTA 5HMZA 1U1RA 2VODA 2ILZA 4O44B 4K0KJ 2B4PA 2I2YA 3M2RA 2D1CA 4WFAQ 1NZAA 5FD1A 1KOHA 3DM2B 3HT3A 3D1OA 1S7IA 1UWAA 4ID8A 4BC7A 3N79A 1X4CA 3FQKA 2X1FA 3C6UB 3KNAA 1HWUA 1IR1A 3QGPA 4P2FA 2O01C 3MEKA 2K06A 2PC6A 3MM8B 5K5MA 2QL7B 3CULA 3ZNJ1 1YK9A 3ILLA 2XSFA 3TARA 3S7RA 5LMNF 1U6ZA 1QTMA 3SMZA 1Q8KA 2RILA 2W8LA 5DDRC 5GAGU 1ZA2B 3DXBA 3MOJB 4IO9Q 1D0EA 3CE8A 1Y00A 2HLTA 1OPZA 3TP2A 3OPKA 1B4SA 4IFYB 2CQPA 2CG4A 2GJIA 2PDAA 5IFMA 2QYGA 4C8KA 4F67A 1YJNS 1GK8A 1N0UA 5LMUF 2KL8A 2AEMA 4WPAA 4M5DB 1ULRA 1JX4A 5E3CA 3ULHA 1K1SA 2CDRB 2HFVA 4HT7A 2DGWA 4M95A 1SUQB 4AL7A 2DIUA 4FYDA 2BOPA 2EG2A 1MWQA 2KB2A 2N7YA 3GLJA 1LK5A 2XNQA 4HDGA 5H1SV 4IG0B 1NAQA 3C3LA 1TKZB 4F50A 1LWCA 4C3KA 1S6PB 2CNLB 3RW7A 4TKTA 4WZMA 2HNDB 2PT0A 4AFFA 4P7VA 1RJJA 4PWWA 3BSOA 5DQGA 3QRPA 5KG4A 1QSLA 2UUAJ 4DV2J 1S59A 2F4FA 3OL9A 2FB0A 1VMBA 4JI4J 4EFAC 4MK9A 2Y1IA 5LSRA 4NEYA 4LFCF 2ZKTA 2BEFA 3F73A 3BREA 2RVJA 3TI0A 2DGOA 2HPUA 4DV0J 3J80Y 2B5JB 3EZUA 5KG3A 5ETOA 1DFDA 3QFWA 1S79A 3NGSA 1MROB 1CJVA 4DHVA 5KFCA 3A12A 4YR2A 3DDIA 2BJEA 1JLBA 4NLDA 2XS5A 3GCWP 2ZH3A 2IYIA 3OVAA 3FCVA 3VAGA 5KFAA 4AUKA 2RKIA 4EBEA 1JJHA 2D74B 3UN3A 1T0TV 5DLFA 2ZITA 1X9MA 4WU2A 3DLEA 1AFIA 1N36F 2VG5B 2ZH9A 1HWJA 2Q1LA 1MN7A 3NNAA 2CQBA 1VR6A 2DXFA 5F8IA 4RW4A 1WG1A 4DCPB 3M6VA 2W7PA 3EWGA 1OJ4A 4ZP9A 3KUGA 1HNXJ 3PM9A 2Y1RI 4MKVA 2LXIA 4DLEA 2BANA 1QD1A 2FIUA 2CQ4A 3MHYA 3WIVA 5I42B 4U8YA 4OHWA 3K17A 3M2VA 2V67A 1Z1ZA 1MU2B 1NHUA 2V4JA 4P6QA 1X5SA 3SBMA 1JLCB 5ETPA 1VDHA 3PY8A 2POKA 3OSPA 5DG9A 2PEHA 4FBUA 3Q83A 1P8GA 2W2MP 4I2QB 3ZZ0A 2G1HA 3C46A 3SXLA 1VBYA 5I4MA 5CAAA 2WHOA 1GMVA 4HDHA 5KT7A 3T9NA 1G4CA 3UCGA 4DV4J 1SH0A 2B7CB 2BE2B 1N88A 1BQMA 3LA0A 3DLJA 2BA9A 3W3SA 2DNLA 2QJ3A 2HVIA 4CYUB 2PMHA 2QE5A 1HYSB 1P27B 4BS2A 3D6FB 5DQIA 1NUEA 1SJRA 3IWLA 2XY5A 4OYOA 4DUZF 3QFHA 3CUNA 3IG1A 1U24A 2HAIA 4KH0B 1VJQA 4DPWA 4YUDA 1N6QB 2VDIA 5L1KA 1L3KA 3BGOP 1VRUB 1F60B 3MEEB 4IOCQ 3UNYA 2LMIA 2W1BA 3GILA 3E3XA 2ROPA 3GFHA 5F8NA 3M8YA 2G4BA 4A8SA 5GAHI 2A2DA 2HKEA 1FF2A 4OQJA 3CJTA 3OTEA 2HNZB 1X9SA 4JI8J 2FD2A 2XCPA 4B08A 3OVBA 3CB4A 3M6UA 3RRGA 3HK2A 2QA4S 5L1JA 4C2MA 2QZ8A 4DUTA 4ZMMA 2D41A 5ETRA 4ED7A 4W90B 4USTA 1DARA 2HS4A 4KO0A 3GMGA 3LP0B 5H9FJ 4EK2A 2EFVA 1CS4B 2BQ3A 3MMAA 3ZZTA 2MHEA 1VRTA 3EVOA 4Y2AA 2E1RA 4CTAA 3HHLA 1FJCA 2IDLA 3TVKA 2BJ9A 1YG0A 2CQDA 4ECYA 5B0EA 2ZVIA 2XMAA 2YNGB 2MJNA 3PV8A 4DR5J 2CWXA 1KHVA 2KH9A 3OR2B 1NEEA 3WC0A 3MGJA 3OBIA 4LF2A 5CHCB 2YWKA 2BJ1A 4CQ1A 1KRPA 1FDDA 4PKDB 2CKWA 2UXDJ 1LWEA 4NLOA 3BGRB 5M2UA 1DTQB 2MY7A 2R7QA 3K58A 3JTNA 4LF7J 2O66A 4QYRA 5KFSA 1UAWA 2F4VJ 1Y9OA 3MM5A 3KG1A 2MKSA 2A0FB 1TL5A 1T95A 4P2MA 2GFFA 3E01A 4C11B 3P3DA 4PG7A 3OXLA 1VC5A 1NZ8A 2HFZA 1K0VA 4DSJA 3RBXA 1CPZA 4DU7A 3GR0A 2XY6A 2VOPA 2RDIA 3MF5A 1VIOA 2HBYB 2DNHA 1YTYA 5B0DA 3DLKA 2OMOA 1IJFB 1V3SA 3UW1A 3V6DB 2ZHAA 1Q5VA 4CM0A 2ZOGA 3PW7A 3D68A 2KZZA 2BW2A 3DOLA 3M2UB 3OTBA 4A8WA 1MNEA 4DXLA 5L8RC 4OJ3A 2XM3A 4N77A 2AW0A 3CJ2A 1S12A 3ETMA 1LXJA 1FKPB 2MQOA 5E3AA 3KUHA 2W2NP 1VQYA 1XR5A 5D78A 3UD4P 3C19A 3DMJB 3KJFB 3OFFA 1SXLA 3A3NB 2J7UA 4ZVQB 2BM1A 3JB9k 1UP1A 4DL6A 4O0NA 4FNHA 4CLUA 5CABA 4ZS6A 1T05B 3MWBA 4IO1A 3DNCA 1NK5A 4NX9A 5THWA 2JFKA 4DEZA 2F63A 3CWJA 4OHVA 1RHQB 2KI2A 3WDOA 3EM1A 4O3RA 2IJFA 2JJ4D 4CLSA 4WIIA 3K5LA 2HAFA 1O5JA 3MOZA 3I82A 4CCHA 4USKA 3M8QA 3ITHB 2RHQB 3P96A 4B3RF 1N32F 3DLHA 4DSFA 1PBUA 4ILRA 3HPOA 3W5ZA 3FSYA 4TN2A 2XULA 1LWFB 2DCUB 3IGVA 2WBRA 5J2QA 4JOUA 3N9UC 2R3VA 1C1BA 3ILOA 3QRQA 1YQHA 3C14A 4KY3A 3AH6A 1U02A 1HNZJ 3CCMS 1FO1A 5DETA 2W8KA 4LRBA 2R9LA 3DLBA 1H2VZ 2W2OP 2XLKA 2OMLA 2OPPA 3LF0A 3BBFA 4N7TA 2O67A 3LAMA 8ATCB 2WOMB 4YB6A 2R8IA 5E7OB 1XNRF 1DAXA 2YKNB 7FDRA 5HVGA 1Y4ZB 1TK8A 3MR5A 3IS9A 2AIRB 1WC5A 4ANCA 5KFEA 2BW7A 4I6YA 3BN4A 3PFOA 4OZ1A 4ZLJA 4URQU 3KNGA 3EJMA 3IR7B 3D6TB 3HZGA 2Y8WA 1Q95G 4W92B 1FFSB 1JLFA 2EI5A 3H40A 1QAYA 1C0UA 3RG6A 1KLMB 4H54A 1IQTA 2UP1A 3DYAB 1JNRB 2GV1A 3GSDA 5A8KB 4ED5A 1TUVA 1J5OA 2HNYA 1U09A 1RAAB 1DURA 3DRSB 1N34J 1KQSR 5IM0B 2VQEF 1FTRA 1U1QA 3FBEA 3GR1A 1XMQJ 2YNFA 1YZ7A 3K2YA 4KT0C 3LTOA 4IYQA 3C8YA 1M5VC 2QA2A 2BKNA 2IFXA 2V68A 3R1HA 4MKBA 4LF9F 3N5BA 4DMZA 4CLTA 3JQMA 1JLEB 1RT4A 2X1BA 4LFAJ 5ETLA 4TXSA 5IWAF 4TNOA 4NMXA 4C9DA 4KB7A 4KH1B 4FXWA 5KFIA 3W1YC 3U7JA 3PHTA 3QPIA 1URNA 2HZVA 2UZAA 3O44A 5CYMB 1U45A 3DFEA 2GAHC 3CCQS 1BD6A 2ATLA 1DBDA 1IKWB 3GSIA 2E29A 1UVKA 1JK9B 4KFBA 2VB6A 2WVBA 3GIIA 2FGOA 2VPYB 4OYMA 4G1QB 2XMKA 2OEKA 3PKYA 2H54B 3MMBA 4K2XA 1YGYA 3TUPA 3AT1B 4OYBA 3FBCA 5EX0A 1U0HA 2DITA 2KYZA 2QFJA 1Q1KA 4QYZJ 2ZJRQ 4NLPA 2VJVA 2RDJA 3GCXP 4RW9A 1TMJA 3ENAA 2MZTA 3DRPA 2KG1A 3AD8C 1QVGR 2PA8D 2VKRA 2NPFA 1U7LA 1UL3A 3PTWA 1VQLS 2G2YA 2BRLA 1HQUA 3I96A 4JI1J 1IKVA 3DGVA 2C2DA 3RU0A 2KXNB 3KK3B 5HBMB 4DR7J 4DSKA 1KBRA 1S6QA 1WHXA 3BGLA 2CIMA 1Y3JA 1PAUB 2IJRA 1KQKA 2YTCA 3CF5Q 2HQCA 3GYXB 1QSYA 4DV6J 4M5NA 3UN5A 3GJQB 4TVAB 4LF4F 2QGFB 1TV6B 3KOAA 3LGHA 1NO8A 5GAEU 2NXNA 3SIPB 3G82B 3MEDB 1HD1A 5IS2A 1U2CA 2XMMA 4LSLA 1RTDB 1DZ5A 4DR3F 2HMIA 4B3OA 3THTA 5B0CA 4HR2A 4I6WA 4UQGA 5AJ3J 1FHTA 4NI2B 4FNIA 4IUFA 3BEGB 4I7FB 3BQ2A 3DOKA 2XO6A 3MEGB 1PJ5A 2QTWA 3T5JA 4DI6A 1IKYA 1IN0A 4RUHA 2BYCA 1E6VB 5A2QY 1RU2A 3T41A 4LR8A 2DNRA 2ZNZA 3MD1A 2KN4A 3M9MB 4ECTA 5A2QU 3DC2A 2V69A 2DGXA 5ETNA 3J81j 3CCZA 2R7VA 1NPRA 2VQFF 4RUAA 3MUVP 4LIRA 2M9KA 3W5XA 1YI2S 4QWBA 3O3LA 3HD1A 4HTIA 3GP9A 2BX6A 4USMA 4DS5A 5HVFA 4R25A 2X1AA 4J9OA 4WU3A 3SDEA 4J9KA 4NLWA 4DV7J 9RUBA 4AQYJ 5E3RA 5ETQA 3NEKA 4DV3F 4HHUA 3J7A1 3W2WA 3JS9A 4RU2A 4ZVUB 4ZCKA 2QSWA 3TVZA 3ZZRA 4GO5X 2M0GB 1YJWS 1BUXA 2IAJB 4J5OA 4O4GA 3BGFA 3QIPA 2VHGA 4EYIB 2VFTA 4OZLA 4NXNJ 4J91A 3L7OA 1SQEA 2V8VA 3MPYA 1HR0J 3D9BA 3WHIA 1UA0A 4GKJJ 1S4FA 4WXOA 3VALA 4J9UE 4PQAA 1X5TA 3C66A 1GXUA 2GMJA 1LW2A 3T1HF 2E5GA 4CM2A 2XI3A 5J2PA 5HAOA 3DXSX 1M5SA 1X4GA 3ISZA 3TANA 2GAGC 4O3QA 1FJEB 3PVXA 1K44A 1TUWA 3CDAA 2V63A 3CSKA 3HJVA 1N5QA 4EWTA 2AEJA 1J2VA 5DO2A 4K4WA 3A13A 4JV1A 2E9RX 2D7SA 3DI6B 1UVLA 4QU6A 1URRA 3BSCA 3KLHA 2G2ZA 2LYVA 2DHAA 4LF5F 4ECUA 4OHYA 4QWDA 2H5EA 3ENQA 3BN7A 3QJPA 4O3PA 4OIXA 4DL5A 1FXLA 4DWIA 4GKKJ 4LQ9A 5EX3A 2ZVSA 4FYWB 2QG9B 3CCSS 4ZCMA 1JLGA 3V5RA 3I4PA 1KKHA 2N7CA 3HLUA 3O6QA 1SJ4P 2RB7A 3PYDA 3MM9B 3NY0A 4PXCA 2HWHA 2B4OA 2CVIA 2Y8YA 3CGIA 4ZCLA 1UWBB 2GO9A 2CJQA 3CJ0A 4OX7A 3ZNUA 1KSPA 4JV5F 4J9LA 1RHRB 3VAJA 2FQQB 1XMBA 1HKAA 5IQ6A 3KHRA 1YHQS 4A8FA 2XY7A 1Q8IA 2CQ1A 4KGXB 5BYQA 4Y3CA 5F8JA 3UDVA 1X8DA 2R8GA 1IJEB 3D5MA 3T6JA 1FKOA 2CJBA 4DBQA 2YQ3A 1NLKL 3M2RB 5H9EJ 3Q22A 3ETOA 1PYSB 3H5YA 3LWLA 4LF6J 1F2GA 3PX6A 1Y5LB 2ZOMA 1BE4A 3EYZA 2Y3YA 2W4CA 1KN6A 5KG5A 1TKTB 3BM7A 1CG2A 1T94A 2VD3A 3PIOQ 2CJKA 1NK0A 1VBZA 3FDSA 2VICA 2HRTA 3BBBA 5SUHA 4QR2A 1TUGB 1WF2A 1NDLA 4A8YA 3K59A 1HWIA 1ZS6A 3C16A 4WCEQ 5E41A 4I69A 3FZBA 3KHHA 3OHAA 2O1PA 4MAKA 2MLZA 3TNVA 2UUTA 4DCOB 1WUUA 2OSQA 4FYYB 2BKPA 4X66J 2BVZA 1SH3A 1EX8A 2LXFA 3MAQA 3SSQA 3J7YU 3EX7B 1N5YA 3M8WA 1YJUA 3EDQB 2F8EX 2OO4A 4FYXB 3OL8A 1P9QC 4H4MA 5GMKa 3AFGA 5J2MB 4IR9A 4YP3A 2V94A 4R5PA 3G6YA 2RD5C 4J90A 2OIHA 3PW4A 4I6AA 1IWGA 3OJSA 3ZZUA 4UZBA 2FJVA 2JLGA 1OQ3A 3PX4A 4DUYF 1AYEA 1HA1A 3S8SA 3R3TA 2UUBJ 2XO7A 1U6FA 1HNWF 2W9BB 2AJ2A 1CJKA 3H20A 4JV0A 2RQCA 1K0TA 4UUXA 5G0RA 3US5A 3V81A 1LWCB 1RSCA 4U7UK 2C2MB 4RL1A 2M8HA 2QL9B 3AXKA 5GVQA 4G65A 2KU7A 1ZETA 1Q4RA 1TAUA 1IBMJ 1NPPA 3Q8YA 3ZZOA 2R7XA 3I32A 3MCSA 4PG8A 3LP1A 5CH7B 1FWLA 3CJKA 4OZ5A 4Q0BB 4KAIA 2ZNYA 3M6WA 3LGMA 2HRUA 3IWXA 2HHHF 3BZQA 1WG4A 4V1Ak 4NRUA 4J7CA 3HHKA 3U02A 1BGXT 2IMWP 4UOHA 3IRXA 5E33A 2CWKA 2IRXA 3K89A 5C25A 1NMEB 4U8VA 3FMWA 2R7WA 2J8AA 4YQWA 2CQHA 1CJVB 2B9WA 1OSCA 4EZ6A 3BKFA 2UUCF 3HVTB 4UOFA 4N5SA 1UJ5A 3Q23A 1TMMA 3GQCA 1KLNA 5SZTA 4F4XA 3PZPA 2DEIA 1F6TA 2UVUA 3OR1A 5IOLA 4ZKAA 3V4IB 5F9LA 5D4NA 2G0JA 3SQGA 8RUCA 1R7IA 3OFEA 3DLEB 1B0PA 2RNEA 2V2QA 5LSOA 2E9ZA 1S1WB 4OLPA 1GMUA 1WDDA 2ILYA 4RW4B 2MKJA 2V8HA 3QT6A 2BANB 1DTTB 4C48A 5IT9Y 3G4SS 1S72S 3M2VB 5ETTA 4AXIA 2J9DE 1B3TA 4ED2A 3NG8A 2V4JB 1KFSA 2VH7A 2PFDA 5IT9U 1SKSA 3VWSA 2KT5A 2ZC4A 2Q66A 2JLEA 1VQNS 4WK3A 4G1PA 1SKUB 2W2QP 1BXNA 5DDPC 4I2PB 3VCDA 4B3SF 3OTOJ 2HGLA 4PXBA 3G6XA 3J7AN 1BQMB 2HQDA 2B8QA 1PBAA 3PW2A 2CA9A 5IXUA 3BYRA 2BJ8A 2UXBJ 1RGVA 2HHWA 5A8WB 2CVEA 4MTPA 3MCOA 1S1XA 5M2RA 3D6MB 3IG1B 4OV1A 3VAKA 1Q86T 4OJHA 4RW8B 2W9CA 4HL9A 2L48A 1B7YB 4WFZA 3KJVA 4FF2A 5T7LB 2HFOA 3L4BC 2DHHA 2E5LF 4NXMF 3Q86A 4I64A 3N6NA 2CQ0A 1SL0A 2KXHA 1YZ6A 4H4KA 4YN3B 2XHWA 4K2JA 2YNHB 4ELTA 3QGHA 3LALA 3N0VA 2QLFB 2J9CA 1HW8A 1SJ1A 2MKYA 2EFGA 4LBHA 3TEHB 3CC4S 2C22A 1RT1A 2DVIA 2YX7A 4KO0B 2P8IA 4CO1A 2CPHA 1R0AA 1GAOA 1FI4A 4EO6A 1T03A 4F7VA 1VRTB 3MD3A 1IM6A 5B09A 3K5NA 3H8YA 3HHLB 3JQJA 2M88A 2ZEJA 4X4TA 1HBNA 1FJGF 3DCAA 3Q2SC 3IBCB 1RBOB 3P5TL 4ES3A 3G8TA 1R31A 3TZZA 5D0HA 1WC3A 5BR8J 2U2FA 5AE1A 1LNQA 4LJMA 1SJFA 2DNOA 1VYAA 5EWGA 2WSEC 3B4MA 3MURP 4PRFA 3QIDA 2Z57B 1UFLA 1LWEB 3VZIA 2FLOA 2H5JB 2F7VA 3DOMB 2NXEA 2CPEA 3HHLC 3TVYA 2VG6A 1HHQA 4ZLNA 1FNXH 2DEJA 2FZCB 1VQMS 3QBCA 1XNQJ 3BR8A 3JAMY 4ZVEA 1PYOB 5K8PA 2V8PA 1FRXA 4CNZA 1GXLA 1LXNA 4YFUA 5J2NA 3E01B 3RAMA 2XBPA 4NASA 1M1HA 3VZHA 4M5JA 4IQXA 1RWOB 3FFIA 4Y0FA 2B7BB 1L5UA 2I9SA 3M32B 2JEIA 2WVDA 2DNKA 2CPZA 3B8HA 2LCWA 4X64F 3ZZPA 5BXIA 1ELOA 3IRWP 3K5PA 1HQEA 2EEYA 5ETVA 4O3NA 3B82A 1WKKA 3NNHA 3RJMB 4CO4A 3DOLB 3CCUS 2J7KA 4LVOP 2E7XA 3HFVA 2NZ4A 1VQSA 1RK8A 2Z58B 4C8OA 3BGUA 3H5UA 5HANA 5HQ8A 5ITHA 3PJWA 4OV6A 8AT1B 4KV8A 3MCMA 2D3O1 1KQFB 2UXCF 1N36J 1TP7A 3AODA 1Y10A 1QLNA 4IFVA 4LFBF 1Q78A 4R0JA 1G2EA 1QE1A 2XTJP 1UW9A 4EI2A 5KTQA 4Y2CA 3VGVA 3KMQA 4GVBA 4ZHRA 2HW3A 4NCAA 2CQCA 2EFOA 2ZBRA 3GWCA 1WSVA 1FKAF 2MHNA 3IXQA 2OLWA 3FBBA 5D3GA 5FLXY 3UR0A 5CYJA 5HQLA 2AX1A 1RUSA 2R7TA 4O3OA 1SIZA 1SBRA 1I1GA 4WBFA 1MWZA 1WOPA 2AV5A 2ZBPA 3LH2S 4ZLLA 5FLXU 5KFUA 2HS0A 2YH1A 1RA7A 3MI7X 3I55S 2ACMA 1S1TA 3EVMA 4DCJB 4RKUC 2VL1A 2ZD1A 1MSWD 3M8QB 5E3PA 3V2UC 4K4XA 3D7SB 2DO0A 2B8PA 5KG6A 2UVRA 4NCBA 4DUZJ 1X0FA 1HBMA 3V6JA 1S0NA 2DNYA 5JUMA 3OLBA 1UA1A 2EXUA 4KBIA 1C1BB 1TK5A 4AYBD 1NB2A 3C14B 2LP4A 2E1AA 1YJVA 1N33J 2GVZA 2RF2B 4ED4A 2PD1A 4RUBA 3IA0A 1G7CB 4MH8A 3CCJS 1KS2A 3GFYA 1JQGA 2IIHA 1TQLA 1AZSA 2OPPB 5J1EA 2CNNB 2J9DA 2CXEA 1KQGB 1N54B 3QGIA 4ZPBA 5C42A 3CMES 4KHPF 2LQ8A 3UDEA 4JYAJ 4PUOB 4K4ZA 3BR9A 1FK9A 1JXLA 1JLFB 1NJIT 2X1GA 2RMLA 6FDRA 3G6VA 2CJYB 3PCOB 5KT4A 3TW0A 2FHKA 3BBCA 4QIWD 3HXMA 1AXQA 4XAKA 4LVNP 3UD3P 3CEDA 2F65A 2D3OR 1J5OB 1IVZA 3CDEA 2LFVA 5LXRA 1SI9A 4P9SA 2N3OA 1PYTA 2ZUAA 1HQ2A 4B9NA 1J27A 2M7SA 1LV5A 5D77A 2XYPB 1HNIA 5KOXA 3JXOA 2EK1A 5KFFA 1PC4A 1S7HA 2FJXA 1RT4B 3NBPA 4WZQA 4HLBA 3VGUA 2ROEA 5KFYA 2LU2A 3VAFA 2OD6A 2FHJD 1UW4A 3CJ3A 5JJBA 3TAQA 2V2KA 5T41A 3EGWB 1U8WA 1IBKJ 2EC2A 4E0DA 2VFRA 3PX0A 2C2KB 2FGCA 4DZDA 1TU0B 1NH7A 3K0JA 4KFBB 1S10A 2ALZA 2CZ9A 5A0YA 1S99A 4Q43A 4NCGA 3TJAA 2BUNA 1RWMB 2RQ4A 4NLUA 4TQSA 3MCNA 1U0HB 4B9TA 2XCAA 1EB0A 3G2XA 2MLXA 1RHKB 4WE1A 4K4SA 4JUZA 3WX4A 4RW9B 2J6SA 3I5BA 4YMEA 3CNQP 1M90T 2Z8QA 4CO2A 3L95X 2ZM6J 4NRTA 4GC7A 4OYAA 2CFXA 4I4BA 4C7QA 4IH6A 1ZM3A 2MGZA 1SC4B 1HQUB 1IKVB 1KWMA 1X4EA 6FD1A 7AT1B 1VJWA 4FF3A 2C3MA 5F0UA 3M9NB 4F26A 1EAYC 1U8SA 4ITSA 2IHR1 2PI5A 4Z2XA 3HM9A 1ZAXA 3EGVA 2JC1A 3K8WA 1NXIA 2B4VA 2J76E 4MIWA 1D8YA 2BZ2A 3MM6B 2DIVA 3VAMA 3M1VA 4C8YA 4TYBA 5HP1B 2UUAF 4DV2F 4LSLB 4JI4F 4F0MA 2HMIB 4B3OB 4DL0C 1RKJA 3OV7A 3QZ8A 2OPSB 3J7Z5 5AXMA 1RI7A 3W7BA 1UPMB 5ETMA 3FVYA 3KDOA 2HURA 2DTJA 1OIAA 4DV0F 1RWXB 2LXUA 5CZXA 2G0CA 1IKYB 4PZVA 4NLGA 1JLQA 1WI8A 1FDAA 5HL7Q 4X65J 2VA3A 3RBZA 2KFYA 1QY7A 2Q3PA 3FRYA 1R89A 2MKCA 3R7NB 2VBZA 1YLXA 3I5CA 4TU9A 2YQ0A 4DSLA 5KFXA 1IWAA 2CADA 4ZIWA 5U47A 2BKOA 5D15A 3MUMP 3QSIA 3GIKA 3I87A 2ZKUA 1NB7A 3CCLS 1JB0C 1NHVA 1S9FA 4DPUA 4M5LA 3SDEB 2O3DA 4L75A 1S9EA 1WOSA 2G2OA 3BO2A 1HNXF 1RAEB 1WNEA 4WTYA 1OWXA 5EWEA 2PO4A 4QPTA 4O4GB 3QIPB 3JSMA 5B7WA 4PYDA 4OYZA 1H38A 2DKOB 1R8PA 5AXLA 3P4UB 5CXTA 5K8NA 3HMJG 1NDPA 4CLPA 2CNKB 1RWVB 2KTQA 4ZP8A 2DT9A 3J7YI 1HBOB 3TUJC 4DV4F 4JV2A 4F36A 4YDXA 5J2PB 4GC6A 1SQGA 4UF4A 1VLYA 5AE2A 3TZWA 1NDKA 4ZN3A 2V9WA 3AY0A 3C6UA 3OL6A 1HI1A 2ZE2B 1SKRA 4QPXA 3A3PB 3UDCA 2J8SA 4D3HA 2HQ3A 3T6BA 1RTHA 4C6AA 3CCRS 3ISND 1GX5A 2ZH2A 1JLAB 4KSEB 1NSAA 3UN2A 3OXGA 5E0OA 4IKAA 1B7FA 2N3LA 1NSPA 1RAHB 1U0SA 2J6TA 3HDSA 2HHQA 2GVDA 4Q8FA 2FVCA 4F3MA 2CNOB 4HKQA 2IYGA 2ZJQQ 3H0PA 4Z7CA 4DR4J 4JI8F 4X4RA 1DJ0A 3PR4A 4X4OA 4CNYA 2HRYA 2B3TB 2MDAA 1ZZNA 1QM9A 4DLGA 1SJQA 1BHNA 3R5GA 1VQKS 3H7HB 1HBUA 3DN9A 2VONA 3QJLA 1HHTP 3U1LA 4IRKA 4D3GA 4C8MA 4P10A 2KVQE 3PKMA 4Y34A 2VPXB 1SUQA 3D67A 4ZVFA 4DR5F 1R6YA 3TUZC 4XIUA 4C3LA 4WTOB 4DPOA 2XMUA 3R7SB 2OPRA 1S6PA 2EG1A 5F0WA 3P45B 1VI7A 2HNDA 4B9MA 2J6UA 1EIYB 2ZDOA 4B9VA 4LF7F 3G71S 2VV5A 2MMYA 2CQ2A 1Z2LA 4BLGA 4K5SA 1SPBP 2F4VF 3N28A 4ED6A 4CZCA 1VQPS 2M52A 3C16B 2Z2LA 2L41A 2A6OA 2VZ9A 2VPZB 3TQ1A 1NKBA 1H6KX 3TA2A 4KHMA 3A8JA 1NK7A 3GPAA 3NS6A 4DFJA 3CCES 2KRRA 2FZGB 2RSQA 2DRDA 4LRFA 3HULA 1ZTWA 4O0IA 1DQ8A 4DL4A 3HX9A 4RNNA 4DV5J 4F4ZA 1JKHA 3QATA 4P75A 4G3IA 4H4MB 2DPIA 1WC0A 5HLFB 1PAEX 2DGTA 4B3MJ 1RZMA 1S6UA 4R5PB 4RPFA 2FHJA 3N5FA 4JI7J 1Y11A 1CJUA 4OJGA 2MQLA 4P72A 1PC5A 1XK8A 4KKOB 1WG5A 1X4BA 4ZVPB 5HSPA 4L3KA 3R5AA 2QLWA 4NLRA 4USIA 3FSXA 1CJKB 4MKYA 2FJDB 4EGLA 3EE3A 3V81B 2JEGA 4RWXA 1K73T 1V9OA 2F1FA 4DR2J 3ZO7A 4S0MA 1FRMA 3NS5A 1DHMA 1LK7A 3KHLA 3LP1B 3OLAA 4JP8A 1JLCA 4DFPA 3CJKB 3AA9A 1A7GE 4Y6IA 4J9VA 1FNOA 3CT9A 4RX6A 2ASYA 4AL6A 2PMZD 1RWPB 1KTVA 1VBKA 5EWFA 1ZPWX 4QWCA 1IBLJ 1FE4A 1JJ4A 5KFBA 2N4DA 2KHDA 3TX8A 2B4UA 5IZHA 1BC6A 1XWLA 2AWZA 4JI0J 3IRXB 2U1AA 1F3FA 4DL2A 1RDRA 4USHA 1VGYA 3LQVA 5DDOC 3HJFA 2RU9A 2GQ2A 3EUNA 5L38A 4X62J 1I6JA 5K8MA 2MZJA 3SFGA 2M8DB 3LPEA 1FX4A 3MZIA 1N6QA 5F9NA 3NLCA 2KDOA 1YJTA 3H2LA 1VRUA 5B08A 2DGQA 4P2SA 3GV5B 3R5CA 5LT5A 1HNZF 4IQMA 4CH7A 3PHEA 2AKWB 5DZ6A 1M5PC 5L9XA 1EQ0A 3EGNA 3EXYA 3CIMA 2D3UA 1XEZA 3O8WA 2YVSA 1IM4A 2VBYA 1WEYA 5D4OA 2RH3A 2HNZA 1Q79A 5DJBA 1LW0B 1MG7A 1CJTA 5CD4H 3H90A 1Q82T 3HD2A 4DQPA 4DX5A 1FE0A 1RT3A 1FFGB 1OY8A 1UEVA 1REVB 2LQ5A 4JI2J 2Y0BB 2HG4A 2HZAA 3QT8A 4YY3J 1YBTA 3Q8VA 2YKQA 3IFEA 3QLHA 4F4YA 4UOCA 1FX2A 2A1BA 1V5IB 3MR7A 2L9DA 3HHDA 1CC8A 1U1LA 3J80U 3PYFA 3JTOA 4CLFA 2E7WA 3FEXB 2MY8A 3LGNA 1AFJA 3UPFA 3QRRA 5DZ7A 2V5HG 5LM7E 1PJ7A 4L73A 5EDWA 2XMVA 5JXSA 1R0CB 1N34F 4ECXA 1TKDA 4OLOA 1XMQF 1GNKA 4A48A 4HH0A 4FN5A 2J0SD 2MKIA 1RTIA 1RT7A 2XZDB 4N47A 3KJNB 2L08A 2RE1A 1O0PA 4DFMA 2FY1A 3MPWA 4J9NA 1XMOJ 2W9CB 5DS7A 2YQ1A 4FXVA 1YJ7A 3KJVB 2BACA 4LFAF 4CLWA 2NXUA 2XYGB 2AX0A 1APSA 1HLWA 3W61A 1KEKA 1P1LA 2XSJA 4TY9A 1D3WA 2R2RA 2UV8A 1IKXA 2VBXA 1RBAA 5KFRA 3R5BA 1C4CA 3T5HA 3TUIC 3CVKA 4OZJA 2C2NA 5D0GA 2P9GA 2KYXA 2F8MA 3TWZA 2DD8S 3D28A 3CXCR 2ADCA 4OL8A 3DRRA 2YY3A 1TZ0A 3RUBL 2D69A 1R0AB 3PO5A 2UVWA 1BQXA 3GE9A 3M2UA 1U1NA 4MMOA 3B78A 4PXDA 3CD7A 2XMJA 1FA0A 4H4KC 4HT5A 4KPCA 3GJRB 4YHHJ 5HMYA 3O1LA 2J9EA 4PWUA 2UVVA 2ROGA 1CEZA 4N8OA 2W7OA 3H4DA 1GX6A 2A6MA 4KGZB 2H3EB 4JI5J 2ZBCA 4R8UB 4JI1F 2EKNA 1IUJA 3WC2A 4NPOA 4FP9A 3TEGA 4DR7F 1K8AT 1T05A 1X60A 3DRXA 2H5IB 2DR7A 3D6HB 2VG6B 5I3PA 2HQFA 3WQPA 1QSSA 4DV6F 4LSNA 2UU9J 1PSDA 2P9EA 3KYLA 2VC0A 1HMVB 4DOZA 3RAQA 2J0XA 1CC7A 2KJVA 1RKIA 3ITHA 4J9QA 4NA1A 2Q6CA 2YWHA 1WI6A 3PEHA 3OUYB 1C2PA 3FFIB 1S0OA 5AJ3F 3J81Y 1J5EJ 3PR5B 3CW2C 1SIWB 1Y5IB 3H5SA 2KZMA 2HYIB 3TAPA 2HVDA 1EJ7L 1Q8LA 4BBYA 3J81U 1HQEB 2LDYA 3E8OA 1NPKA 3MMJA 2AHOB 1RTZA 1XN9A 3AJ2A 3BQ1A 1CSJA 1NNDA 3FQLA 3M4XA 1Y3KA 1EQMA 3GYGA 1U49A 3K5MA 5H9FK 2I0XA 3IN5A 2CUYA 3FBFA 2XZTB 3IBWA 1TL3A 3QT5A 3H4BA 1Q16B 1VQ9S 4QOTA 3ET6B 2JSXA 1N56A 5C24B 3D0GE 4USVA 1QE1B 2BJ3A 1KNZA 3JQKA 1N4LA 2XS7A 4DV7F 3A3OB 4AQYF 1B0TA 4PQUB 2Z0GA 2IC3A 4GVBB 1RLDA 4ZHRB 1KVIA 1RHJB 1F0XA 1VQ4S 4NZ0A 1E6YA 1OSDA 3B54A 1VC0A 3Q89A 1RCOB 2GX8A 4ZVOB 2M3DA 1JJ2R 2ZH4A 3MR6A 4CLZA 4DN0A 3DYAA 2NYIA 4B3SJ 3CPWR 4NXNF 1HARA 5A8KA 2XS2A 4EBCA 1YKWA 3OQ2A 3LWMA 2YPZA 2AD9A 3I0RB 1HR0F 3DRSA 3FEYB 3KK2A 1U1KA 4ELUA 1U2FA 2DJWA 3MPDA 4MJKA 4GKJF 4BWJA 1S1TB 4JI6J 1X4DA 4OI0A 2VKZG 1AUDA 2ZD1B 1O6XA 4K50A 3K8VA 2WSCC 5G4DA 3ZFVA 2L3MA 1RAIB 2QL5B 4QQBA 3VF0B 3CD5A 2QA4G 1HBMB 3SCIE 3AHPA 4CWBA 1WWHA 4JB8B 4I68A 3W62A 5HQMA 2K8GA 2XHCA 3LO3A 1JLEA 5KFQA 2JDJA 3N4WA 1QDUB 1U4BA 5KT6A 1P9YA 5DM7Q 2KXFA 5HROA 2OI2A 2IVYA 3TX0A 2RDDA 2WB4A 1QUVA 3KLIA 2ASDA 2RRAA 4CO3A 3TAMB 3GV7B 1AZSB 1IKWA 2J7WA 2RRNA 2B56A 1WHWA 2A3JA 2DISA 4V19X 4GKKF 3TZYA 1FD2A 4F3OA 3B6BA 4G1QA 3GTYX 1SC3B 2DH7A 2H48B 4RZRA 3H5XA 3LW5C 2GZOA 4DV1J 1FK9B 1C1CA 3Q8SB 4ZA1A 1V5VA 2ALYB 2JL9A 4CT9A 2QMXA 1RTJA 2YKOA 2HBQB 4OYPA 2MYFA 3DLLQ 3M8RA 2HGMA 1H73A 3HVWA 1UTAA 1G6BA 3CTRA 3DGPB 3NP5A 4NA2A 3W9JA 2AYMA 4OZ0A 5B0BA 3M6XA 4YB5A 3FJ2A 4HTJA 2MQQA 3AXMA 2AJ4A 1YJ9S 1BMQB 4JI3J 3L3CA 1B99A 3PACA 2DNGA 4LF6F 1AROP 1ZBTA 4TLQA 1HI8A 1TV6A 2V4RA 1UVIA 5D8HB 3KLGA 4HI2A 3G82A 3GB0A 3MEDA 3M05A 4FZVA 2X7IA 4Y65A 2HS3A 2FJWA 5KFKA 2H1YA 5HJXA 2ZH1A 2DR5A 4F3QA 2QC3A 4ENOA 1FESA 1OPIA 1VHIA 1JWWA 5D4PA 1VRQC 3KFWX 2W4DA 3UDLA 4NI2A 2I38A 1F2HA 1ZAVA 2HHPA 1NJYA 2I5JA 5KFLA 2MB0B 3DLGB 4X66F 4BHQA 5A0YB 4J37A 7FD1A 2FUG9 5DRKA 4NCGB 2R4FA 3FCHA 3TQEA 4IG3A 3MUTP 2K7JA 2ADBA 1R8CA 2ZH8A 1R8HA 1KVKA 2VBWA 4PYAA 4WE1B 4IRCA 4ECZA 5KFTA 1A9NB 3FNNA 1S9GA 3V6HA 1T9WA 3LP2A 1GQEA 2FJBB 4L6V3 1PKUA 1B0VA 2GQQA 5C7PA 2VIHA 3R2CJ 4ELVA 1QTNB 1WC4A 4PG5A 2QLJB 2CPIA 1MN9A 2PFFB 4HI1A 2FJAB 3QO9A 3R1LA 3PRVA 3I6PA 3G6ES 2WVCA 4RW7A 3NOCA 2AP6A 2IAJA 1I3OB 1IBMF 1FJ7A 3FRZA 3OW2R 1XBWA 1T7PA 1M5KC 3QAEA 4XDDA 2FYXA 3M1VB 3RRHA 3JSRA 4P7TA 2XMWA 2FHMA 2DXDA 3TYTA 3UD5A 2HVZA 4WFXA 2C3PA 2ZBIA 1RAJA 1Q53A 2ZZNA 3CO9A 5CCLA 2E66A 3S6EA 1U1MA 3AAWB 2C2OB 3PJXA 3BH6B 2IMOA 4M8LA 3UVJA 4U9RA 5KOWA 4NLVA 3BV8A 1NBEB 3Q2TC 1JLQB 3BS9A 4XPCA 1RT5A 2GC8A 2AGQA 4ZPCA 2K3KA 4N8NA 3UCUP 2K7KA 2GGPA 2KRBA 1H7XA 4MK7A 3HHLD 1FERA 3NCQA 2R2SA 1TFWA 3P5BP 4RO0A 5D0EA 4J9PA 3NGRA 1VFJA 2CQIA 5L39A 5AXKA 3PNIA 1T9TA 2Y1JA 2X3DA 4X4VA 1H2UX 2F3JA 2YWGA 2HSEB 5CZVA 3PEJA 4XO0A 2GQCA 1CVJA 2OAUA 4KPYA 3HSDA 4WKRA 4RW6A 3D0HE 4CI0B 3WZ0A 5IT0A 3D2WA 3GFXA 2G1DA 1AW0A 5KG0A 4CLLA 4KJIA 1HWLA 1WOOA 1X5OA 1UJ4A 3OL7A 2XWYA 3PW5A 1HHSA 1TVRA 2MEWA 2YBVA 5K14A 3PIPQ 1DQ9A 2MQNA 1C4AA 4B3TJ 3CJ8A 4M5HA 1R8AA 3VVUA 3OTOF 3ENWA 1JIHA 4OZ2A 3KK1A 2NXJA 5DQHA 1YRTA 1RWWB 3EPIA 1S5ZA 3GONA 4AE5A 1D9AA 1WD6A 4FKXA 3FEZA 2UXBF 5DG8A 1OYDA 2RU3A 3D66A 1TKTA 2GHWA 5CYQA 2J0QD 1MLAA 4K4TA 1Q7LB 4DF4A 3DU5A 3M8PA 1SV5A 4M5GA 2FDNA 2HK3A 3MM7A 1AB8A 2OPQA 1HD0A 1RTHB 2WAQD 4P71A 4EBDA 4UOGA 1AUSL 2F8HA 2J5AA 4QU7A 4ECVA 2FVRA 1RE1B 2VU5A 2JEJA 1KOOA 2GVDB 4CDIA 2W25A 4DR6J 3R97A 4X2BA 4TY8A 2JC0A 5KFWA 2MZQA 5FIIA 1RT6B 4NLSA 4FS1A 1D09B 1S1VB 1K47A 2JZ5A 2VG7B 5J2MA 1WACA 1TKXA 2HQIA 3BKTA 3I31A 4HEA9 4KQZA 2XGQA 3F56A 1XIQA 1HBUB 3NXZA 2ZH6A 1SL1A 3LAKA 2IM1A 1UPPA 4A8KA 1N5VA 2BRKA 3MMCA 5L1LA 4A8OA 1OY6A 2W9BA 4W98A 5F8HA 4FYVB 3HI9A 5BR8F 2EC0A 3LPYA 2WONA 1YWXA 2LVWA 3AB2B 1QAXA 2XYHB 3POTA 1X4FA 1S57A 3QSYB 4WKYA 2OPRB 2FLLA 2NCKL 3UWTA 3KLFB 4M1KA 4QBUA 4JBCA 2IVFB 4DR1J 5FDLB 3LOUA 2AZ3A 1I94J 1PO6A 2G9OA 5EHHA 1UZDA 2H51B 1NJZA 4LF8J 3ADAC 5BJRA 1XNQF 4Q0BA 1W2BR 2DB1A 4M5MA 5D4LA 1OS5A 2ATCB 2OHDA 2Z56B 4OZNA 2DGVA 2VASA 3JTPA 3MAAB 1KVJA 2IRUA 4C98A 2G0IA 1FCAA 2V2ZA 1S1UA 5KFJA 3I0SA 4ID5A 2CPDA 3FKBA 2VFVA 1ACMB 2OEJA 2MKHA 3HSJA 1IR2A 3T1AA 5I3QA 5RUBA 1TL1A 4DZ6A 4WYLA 1JKHB 3HVTA 2C2RA 1L3VA 2DRBA 2R8JA 4UY85 1ZM9A 5EGYA 2Z2ZA 3EICA 3L9ZA 4EU0A 4A8XA 1G1XA 3PG9A 2VOOA 3V4IA 1CJUB 5K20B 4DU8A 5KT2A 2PGCA 2CZVC 1S1WA 1SQFA 4C0HA 4ETZA 2CRLA 4RNOA 5CQGA 4F4WA 1F9HA 3T5LA 1N5TA 4OI1A 1DTTA 2H65B 4QIFA 3AQOA 3TJ8A 2ZH5A 5HVHA 1ZYQA 2V2VA 2CG8A 3X3UA 4UZCA 2ZH7A 2MPUA 2YX1A 1YDLA 1NDCA 3QWPA 3TA0A 5H9EK 3EXCX 4K7QA 4X4QA 2FJEB 2CDQA 4ZP7A 2EKYA 3RAXA 3C6TA 2M70A 3S1TA 4RU9A 2P5VA 2YWWA 2ZC3A 4CP5A 4I2PA 3FZ2A 4DPYA 2HVEA 5JVGQ 3D1HA 4NYPA 3KTQA 3HCXA 4KYZA 2NR0A 4ED1A 4ED0A 3V6KA 1YITS 3ONQA 3RZAA 5EN1A 4ED8A 4C0BA 2P6TA 3UO0A 4M94A 1S76D 5A8WA 3CC2S 2YKAA 2IA0A 4C3MA 5GADU 1RYSA 2VA2A 4ICLA 4RW8A 4RNMA 2BE9B 1N8RT 2SXLA 3RBDA 5T7LA 1N33F 2X3GA 3E2EA 1VHFA 4ZJQA 4FDFA 1BWVA 4ERDA 3PRBA 2YNHA 1FEEA 1VISA 3UQSA 3IM8A 2C3OA 1T9VA 5HATA 2E1PA 3BSAA 1CJTB 1NKEA 4MFBA 1CQMA 1NH8A 1RT3B 5J1NA 2X51A 1NRKA 1ZA1B 2XG8A 4KIAA 4USWA 4OX9J 2DY1A 4FPIA 2GIFA 1N5SA 2LEBA 4JYAF 3I9V9 4IOBA 3TO8A 1GTHA 2P6SA 2JRSA 4ZP6A 3QLHB 4PG6A 4QW9A 4KGKA 3R2DJ 1Q81T 2MZ1A 4KTQA 1LFWA 4ETXA 2B0GA 4FF1A 3N01A 3VQTA 1JLBB 2KHCA 1SKWA 4P52A 1DQAA 2WB1D 4PABA 2RKIB 4OI4A 2GHVC 3ZC4A 5E2QA 1ZM4A 2E5HA 1XQIA 3DOMA 2DNMA 1WORA 4CO5A 3HFZB 3EPGA 4FPRA 2Z2YB 5HO4A 1RTIB 1RT7B 3GV8B 5A8RA 2DHXA 4H4OA 4BCAA 1NJXA 1R0BG 3GG0A 3RB0A 2IY5B 3VTIA 2C28A 1CBKA 1KFDA 2CPYA 2M2BA 4ES2A 3GIJA 2GW8A 2HGNA 4LR7A 1U47A 2YKMA 4RWWA 3J7ZT 3LUYA 2FC8A 3BO3A 1SL2A 2CQGA 4MYUA 2EFPA 4MIBA 2XSJB 3BSNA 1CULA 4QIEA 4Y2IA 4USJC 1IBKF 1IKXB 3QWUA 1GXTA 3HSZA 1HI0P 3ZZYA 4XK8C 5LL6d 2AJFE 2WW4A 4OFZA 3M32A 2J0WA 4ZVGA 3KXDA 1IR0A 1YJRA 4QZVB 2HHXA 3VHQA 1KC8T 4L3NA 1T3NA 3T9ZA 1K1QA 3DRRB 3HP6A 4C4WA 2QO3A 2V8GA 2QYCA 3HKZD 2W2PP 5LXYA 2QLXA 2WW8A 2RUSA 3LANA 1R3NA 4WFBQ 3M30A 2GNKA 3RBEA 3A8EA 4X4PA 4KE5A 2C3YA 4WXWA 4WK1A 2HVHA 5JMNA 4NEZA 2ZM6F 5T14A 1SC6A 3OTCA 4ZPAA 1V3RA 1H7WA 2VFUA 1NCLA 3CCWA 5LMNJ 1UVNA 2MQ8A 4LIWA 3AJDA 3SSSA 1VC6A 4WYWA 3EMTA 4RBUA 2OSRA 3ISNC 3BF4A 4LSNB 4Y2KA 3VAHA 2A2CA 1EKRA 4C8NA 1MWYA 4NA3A 2Q6BA 2V9KA 4QCLA 2AZ1A 1A6LA 2YH0A 3VV2B 4ZOSA 3NL0A 4N41A 1PG5B 3SEOA 1WC1A 2DNPA 3MMAB 1HW9A 5LMUJ 2DXEA 3PYGA 1KTQA 5KFVA 2YNIA 4CTAB 2RAQA 1Y5NB 3RB6A 2JOQA 4YS2A 1RAFB 2PSZA 3W60A 1CLFA 2FVQA 1U26A 1F9FA 3RW6A 1S97A 1GEHA 2AJ0A 4X65F 2V6AA 3CDBA 2HK2A 3RR8A 2ZUGA 2IRYA 2K3IA 2RF2A 3TOQA 4K4VA 3CCTA 2E44A 4LF1A 2MTLA 2LECA 4HHJA 4YR3A 3THPA 3B4DA 1L3SA 1S0VA 4TU7A 3GJSB 4QWAA 1REGX 2XWXA 3FSIA 5K8OA 1TL3B 4ECRA 2DO4A 1VQ7S 5IT4A 1WEZA 3MM5B 4DS4A 2MQMA 4WP3A 2LEAA 4LFCJ 2ZWPA 3PFEA 1XTZA 3M8ZA 4DN9A 2LA4A 2FZKB 3JAMU 2MSSA 2DGUA 4PAAA 5KFMA 1ZZFA 4DSIA 2IC3B 3MFHA 3W2VA 5KG2A 2EVZA 4PUOA 3T1YF 4ZPVR 1WHYA 3S01A 2HIQA 1E6YB 2AJ1A 3UE2A 2K2PA 4IDKA 4YEAA 2VDHA 1C0TA 3DLKB 1LEOA 4Q2LA 4DX7A 5HI7A 3R6LB 1HPZA 3Q0AA 1FRKA 5I3UA 3KK2B 2WK4A 1RT2A 4NZ6A 1Y0HA 2FPHX 2I6WA 2H4WB 2IJNA 5JVHQ 1DLOA 3NGUA 1H72C 5ETKA 4OI2A 1RABB 2KFZA 3NWGA 4BWMA 3MTJA 4XDCA 3HO1A 5HROB 3NMAA 4E2FB 4OHXA 2A10A 3KLIB 1BQNA 3OFGA 4TYAA 2LA6A 4NYZA 4PEOA 1H2TZ 4Q5VA 1NK4A 1PCAA 4ILLA 3IR5B 4U7CA 2PI4A 4J9RA 4M63A 1OMSA 3G87A 2VPWB 1YIJS 3OHBA 3CD0A 2LEPA 2GS8A 4U6PA 3AD9C 3Q8PB 5DG7A 4DR4F 4Q45A 3C15A 1W2IA 1EETA 4E98A 4W4MA 1C1CB 1ZM2A 2GO8A 2XI2A 2AF6A 1F9EB 1RTJB 3KJQB 3PO4A 2BBEA 4KGMA 3K7RA 2EW9A 3T19A 2HFNA 4NLXA 5J2QB 2OFHX 2V50A 3PXGa 2AYGA 4QWEA 2AYBA 2Q43A 1S48A 2CJAA 2EBEA 3V4MA 1R8BA 2ABYA 1CQNA 4YB1P 1EP4A 1Y7PA 4Q2MA 4F0HA 3C2PA 1TL4A
chains in the Genus database with same CATH topology
1U0HA 4WPAA 1CJKB 1CJVB 1AZSB 4OYZA 3MAAB 3ET6A 4NI2B 4CLUA 4P2MA 1YBUA 1CJKA 5IV3A 4USTA 1CJVA 1AZSA 4OYAA 4OZ2A 3C15B 3C16B 3G82A 4CLZA 1CS4B 1WC4A 4P2FA 4CLPA 3C15A 4OYXA 4CLTA 3C16A 1CJTB 5D0EA 4WP8A 5IV4A 1CS4A 3R5GA 4OYWA 5D0RA 1CULB 1CJTA 1YK9A 4CLSA 4CLWA 4CM2A 5D0HA 5D15A 1WC3A 4USWA 3MAAA 4NI2A 4OYOA 2GVZB 1CULA 4WP9A 1WC5A 4OYPA 2BW7A 4CM0A 1AB8A 1WC0A 4OZ3A 1YBTA 4P2XA 4OYIA 4CLYA 4WP3A 1CJUB 3ET6B 1Y11A 3UVJB 2WZ1A 1TL7B 1Y10A 1FX2A 5D0GA 1CJUA 4USVA 3G82B 3MR7A 2GVDB 3C14B 4OYMA 1WC1A 2GVZA 2QV6A 2W01A 3UVJA 4CLLA 1U0HB 4CLKA 1TL7A 4CLFA 1FX4A 1WC6A 4OYBA 2GVDA 4USUA 3C14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U0H A;  4WPA A;  1CJK B;  1CJV B;  1AZS B;  4OYZ A;  3MAA B;  3ET6 A;  4NI2 B;  4CLU A;  4P2M A;  1YBU A;  1CJK A;  5IV3 A;  4UST A;  1CJV A;  1AZS A;  4OYA A;  4OZ2 A;  3C15 B;  3C16 B;  3G82 A;  4CLZ A;  1CS4 B;  1WC4 A;  4P2F A;  4CLP A;  3C15 A;  4OYX A;  4CLT A;  3C16 A;  1CJT B;  5D0E A;  4WP8 A;  5IV4 A;  1CS4 A;  3R5G A;  4OYW A;  5D0R A;  1CUL B;  1CJT A;  1YK9 A;  4CLS A;  4CLW A;  4CM2 A;  5D0H A;  5D15 A;  1WC3 A;  4USW A;  3MAA A;  4NI2 A;  4OYO A;  2GVZ B;  1CUL A;  4WP9 A;  1WC5 A;  4OYP A;  2BW7 A;  4CM0 A;  1AB8 A;  1WC0 A;  4OZ3 A;  1YBT A;  4P2X A;  4OYI A;  4CLY A;  4WP3 A;  1CJU B;  3ET6 B;  1Y11 A;  3UVJ B;  2WZ1 A;  1TL7 B;  1Y10 A;  1FX2 A;  5D0G A;  1CJU A;  4USV A;  3G82 B;  3MR7 A;  2GVD B;  3C14 B;  4OYM A;  1WC1 A;  2GVZ A;  2QV6 A;  2W01 A;  3UVJ A;  4CLL A;  1U0H B;  4CLK A;  1TL7 A;  4CLF A;  1FX4 A;  1WC6 A;  4OYB A;  2GVD A;  4USU A;  3C14 A; 
#chains in the Genus database with same CATH topology
 3HKW A;  3MM6 A;  3CJQ A;  5J1P A;  3EZ5 A;  2AYE A;  3KLG B;  5HP1 A;  2HHS A;  2XMT A;  3IS9 B;  1X31 C;  4DL3 A;  3W65 A;  1BWE A;  3RR7 A;  2RUG A;  1MML A;  2UV8 G;  2OPS A;  3HZE A;  2NSB A;  4DG1 A;  1GFW B;  5IC6 B;  4CT8 A;  4F2S A;  2HFS A;  4KGV B;  1R43 A;  4ED3 A;  1PIE A;  4MT1 A;  1C0U B;  1N48 A;  1D1U A;  2I1R A;  2I5J B;  2Y1L B;  5F3T A;  4A47 A;  2KVI A;  4AXJ A;  2MQP A;  1RWK B;  2HNY B;  2ZZM A;  3KLE A;  4IG3 B;  4K0K F;  3MTK A;  4K5R A;  4DV5 F;  5GME A;  4LBP A;  4WF9 Q;  2OEL A;  3CMQ A;  3SV3 A;  2YNF B;  2ZJP Q;  2JWN A;  3I5A A;  2BAB A;  2P9C A;  4ZCI A;  4ILM A;  1SVD A;  4B3M F;  3QYY A;  1WEL A;  3T3F A;  4CRJ A;  4JI7 F;  1S9G B;  3NGT A;  3MEC A;  2MST A;  2B6A A;  2QV6 A;  2XC9 A;  1TL7 A;  3GYN A;  3AJ1 A;  2R2U A;  1FDN A;  3LP2 B;  3UR3 C;  4USU A;  2MKK A;  3IWN C;  1FRI A;  4ZIV A;  1HNV A;  3RGI A;  4AT1 B;  2DHG A;  3Q8U A;  3M7V A;  4C97 A;  4Q44 A;  3SV4 A;  3G96 A;  1MMN A;  2DH9 A;  3QO9 B;  3L09 A;  1RBL A;  3GIR A;  3SCK E;  3CJ5 A;  3FK4 A;  4RW7 B;  4DR2 F;  4LRA A;  3SSR A;  4ZIT A;  4RR5 A;  2C1E B;  1S0M A;  3JYT A;  4ES1 A;  3MPV A;  2BXJ A;  1NSK L;  2W24 A;  3ENV A;  4ZVR B;  3MMB B;  2Z30 B;  5GAG I;  2XLJ A;  3TA1 A;  4ATN A;  2QA1 A;  3ZTO A;  4AL5 A;  3OFH A;  1UVM A;  1OYE A;  1IBL F;  1HBO A;  3UVJ B;  4JI0 F;  2WZ1 A;  2FHO B;  2MJU A;  2EK6 A;  3DRP B;  3CJS A;  5B0A A;  3RTV A;  2KG0 A;  3NRB A;  1D9F A;  1RT5 B;  1NJW A;  1X4A A;  4HAC A;  2ASJ A;  4X62 F;  4X4S A;  2ZE2 A;  3X1L B;  2LQB A;  3CDW A;  4Y00 A;  3NMR A;  2A18 A;  2GGP B;  4WFY A;  2DR8 A;  1S6Q B;  1RAD B;  2D9O A;  5IV3 A;  4RNH A;  1VQ5 S;  2XEX A;  1JLA A;  1YVF A;  1ZOT A;  3R7B B;  2HWI A;  1KDN A;  4LMZ A;  1QAJ A;  4NL5 A;  1XER A;  3AB4 B;  1QUP A;  3Q24 A;  4WWS A;  1ZPV A;  4I1T A;  4A4J A;  4EO8 A;  4PWD A;  4DQI A;  4I67 A;  1ZAW A;  4RW6 B;  3D1Q A;  4CO0 A;  1N32 J;  4B3R J;  3RB3 A;  2V34 A;  4JI2 F;  2BDP A;  2E1M C;  3KWM A;  2K1R A;  1LQ9 A;  4YY3 F;  3DOK B;  2HZC A;  2NUU G;  3ZTQ A;  4RBV A;  3TRG A;  4ANE A;  5KFD A;  4DF8 A;  1TVR B;  5K14 B;  4RLE A;  1UFW A;  5HJY A;  2GHP A;  3KK1 B;  2AMC B;  4B9U A;  1NKC A;  2OD4 A;  3IM9 A;  5KT3 A;  4A8M P;  1RIS A;  4Z7Y A;  2AT1 B;  2IM2 A;  5KT5 A;  1GTE A;  2VF3 A;  1LWX A;  1IQZ A;  1FDB A;  3ELH A;  4UT4 A;  3VAI A;  1IXK A;  3QGG A;  4HYK A;  1XNR J;  5CYQ B;  2LLZ A;  4OYW A;  3CO0 P;  3U1M A;  2W9A A;  1XMO F;  3M8P B;  1FXR A;  1SV5 B;  3W64 A;  3MM7 B;  5MAO A;  3R27 A;  2I8E A;  2OPQ B;  5HN0 A;  4RJV A;  1M5O C;  2CPX A;  3W2W B;  2CQ3 A;  2DNQ A;  2R8H A;  2COL A;  2GA7 A;  2HIY A;  4OI3 A;  1RHU B;  5BYS A;  2Q79 A;  4Z37 A;  2IA6 A;  5CCM A;  2WVE A;  2ZFH A;  4MKA A;  2DCL A;  5CA5 A;  3H59 A;  2PE8 A;  5LJ3 Y;  4TY8 B;  2ZZT A;  4O44 A;  1MW7 A;  1FT8 A;  2VQE J;  2GIR A;  3GFZ A;  2GMH A;  5HLF A;  1LW2 B;  4F0K A;  3W9I A;  3DM2 A;  2L9W A;  5B0G A;  3HVA A;  1WTF A;  4I0W A;  1TKX B;  3P8B B;  3DHX A;  5L1I A;  2C2E A;  4HHH A;  4LF9 J;  1FWP A;  3O2I A;  3AQP A;  4B02 A;  3R8Y A;  1Q8B A;  2JH3 A;  3G86 A;  4KKO A;  5IWA J;  3RB4 A;  2BR0 A;  3E51 A;  4YHH F;  3MMC B;  4OX6 A;  2MZS A;  1FFW B;  1WKL A;  3F41 A;  1B64 A;  4J9M A;  2DR6 A;  5L9N A;  1RHM B;  2WON B;  3MM8 A;  5LOQ A;  2HWT A;  1ROF A;  5GAD I;  3POT B;  4JI5 F;  4IH5 A;  1UKU A;  1WKJ A;  3CJR A;  1T9Y A;  3ZTR A;  1T8E A;  3KLH B;  2E9T A;  3D54 A;  2DGS A;  4MIA A;  5L46 A;  2WVF A;  2Z4P A;  4KRW A;  3TR5 A;  3AD7 C;  1JLG B;  5C2C A;  4OMF G;  3G8S A;  3HFK A;  2UU9 F;  1OQ6 A;  1RU1 A;  4IFY A;  1RA6 A;  1WC6 A;  3PRD A;  3DHW C;  4PG4 A;  4EYH B;  4A8Q A;  1S1U B;  3I0S B;  4ID5 B;  3VGS A;  1QAI A;  2PA3 A;  2QIF A;  4M5D A;  2CAJ A;  5E3Q A;  4F02 A;  2E1C A;  4NZ7 A;  4RBT A;  1J5E F;  4U95 A;  3QNW B;  4OYX A;  3CCV S;  1TL1 B;  5IV4 A;  5KFO A;  1FKO B;  1T9U A;  2IM3 A;  3H98 A;  4G6V B;  4IG0 A;  2YWF A;  1TKZ A;  3I9Z A;  3NS7 B;  3NNC A;  4GO7 X;  4WP9 A;  3RYL A;  2UXD F;  3MDF A;  3ZTP A;  2R7R A;  3ILJ A;  4AND A;  2IVM A;  4LF4 J;  2B9X A;  4CLY A;  2D9P A;  2QEX S;  1LW0 A;  4U67 Q;  4K59 A;  4ZLP A;  1JXE A;  1V3Z A;  2MXY A;  4WJB A;  3O5T B;  3L7U A;  1I5O B;  4OX8 A;  5KG1 A;  4DR3 J;  4M5I A;  5KFP A;  1REV A;  2FVP A;  2DK2 A;  1WTB A;  2MLY A;  2QLB B;  3A8K A;  1VQ6 S;  1SB6 A;  4MK8 A;  2B5J A;  4DJB A;  2KJW A;  5KFN A;  3KG4 A;  2RT3 A;  5EUH A;  3VR1 A;  4RNF A;  4F4K A;  4FXD A;  2V8D A;  5M2P A;  4OJ1 A;  2RIJ A;  2RS2 A;  1MRO A;  2R7S A;  3C6T B;  3IMQ J;  3MFI A;  1K9M T;  3BDP A;  3WBZ A;  1N5Y B;  3D4J A;  4QIV A;  2ZWO A;  3NOG A;  1Q5Y A;  1G3O A;  5AE3 A;  4Q8E A;  2BE7 D;  2RHS B;  3KLV A;  2VQF J;  4JI6 F;  2HHT A;  4FVC A;  1X0P A;  4YDD B;  3KHG A;  1VK8 A;  4O4R A;  4ECQ A;  3L7P A;  1RWU A;  4DQS A;  2APO A;  1GH8 A;  3FUY A;  4ICL B;  3QJJ A;  4CIO A;  2VG5 A;  5BYR A;  1W26 A;  2LU1 A;  1WDT A;  3CIZ A;  1VK3 A;  5F8M A;  2XQC A;  1LFP A;  1WEX A;  4DV3 J;  5G0R B;  2FLN A;  2QN6 B;  3IGN A;  2QSF A;  1QVF R;  1F5A A;  2BV3 A;  2R7U A;  4WIQ A;  1W7W A;  5I42 A;  3UI3 A;  3FCW A;  1MU2 A;  3GJT B;  2DPJ A;  3QMQ A;  2CZ4 A;  2EBG A;  4UQT A;  5ETS A;  1B70 B;  1UVJ A;  3D0I E;  4ZJO A;  3M8S A;  4I2Q A;  4MFB B;  1XC9 A;  2RQM A;  2ZHB A;  2XGP A;  2XB2 D;  3IBF B;  1H74 A;  1A0O B;  1RCX B;  5DLG A;  3BH7 B;  2E7V A;  2VJU A;  2DRA A;  3T1H J;  2HLU A;  2BE2 A;  4F2R A;  5A76 A;  3A4T A;  2GJ2 A;  1M1G A;  4DV1 F;  3PDN A;  4CYU A;  1KD1 T;  1HYS A;  3NCR A;  2MZR A;  5C25 B;  6AT1 B;  3WX8 A;  1VQ8 S;  4Y28 C;  3HSG A;  2ASL A;  3FGV A;  4TU8 A;  1JJC B;  1WJ9 A;  3AOB A;  3BDE A;  4NWB A;  2AGP A;  1FXD A;  3M9O B;  4ZJL A;  1BY9 A;  2YKP A;  3MEE A;  3BQ0 A;  5A6W A;  4R8U A;  4LF5 J;  1HL6 A;  2R2T A;  4KR0 B;  4DX8 H;  3MXH P;  3OR1 B;  2LKZ A;  4JI3 F;  3Q8Q B;  3SQG B;  5A8R B;  3SQO P;  2OTL S;  4H4O B;  2GJF A;  2OTJ S;  2JVO A;  4Q7A A;  2Y9H A;  1SCJ B;  2YKM B;  2OJ3 A;  3BPS P;  1HWK A;  1HMV A;  3LP0 A;  4P74 A;  3W8G A;  4DX6 A;  1JNZ B;  1CS4 A;  1U1O A;  2UUW A;  1P6T A;  2L9N A;  4JV5 J;  5AXN A;  1CUL B;  5E5N A;  3SCJ E;  3A8I A;  4X84 A;  3GG1 A;  3OUY A;  4ER8 A;  4F25 A;  1T9X A;  1MMD A;  4F4A A;  2HBR B;  4AD6 A;  2YNG A;  1T3O A;  4QJV A;  2QMU B;  4U7U D;  2VUG A;  3OR2 A;  1RWN B;  1KP6 A;  3OXF A;  5KFZ A;  3MR3 A;  3EVW A;  3MR2 A;  3D3C J;  4O23 A;  2HBZ B;  3HVR A;  4C0O C;  3OVS A;  2DY9 A;  3M30 B;  2DYA A;  3BGR A;  2BQU A;  1DTQ A;  5LJ5 Y;  3BB5 A;  1S1X B;  4ZVS B;  2WTF A;  4UUW A;  4ECS A;  1SC1 B;  3W66 A;  1L3T A;  3QT7 A;  1ZTT A;  2XNR A;  3N6L A;  4L76 A;  3ET6 A;  3PW0 A;  2O5D A;  1YBU A;  1T11 A;  5C24 A;  2LQJ A;  2Z2M A;  5C5J A;  2KKH A;  4UTG A;  2OKQ A;  2GIQ A;  3TZX A;  4ZDN A;  3DDN A;  5B0F A;  3BJY A;  1VCT A;  3HHE A;  4DFK A;  4C11 A;  4PQU A;  2GML A;  1NM2 A;  4PPZ A;  3BYP A;  4LRD A;  1XR7 A;  3H42 A;  2PMW A;  2IDE A;  4DDF A;  1YRU A;  1ZH5 A;  3H25 A;  4K4Y A;  2KM8 B;  1YRX A;  1DRZ A;  1D9D A;  3V6D A;  2BMB A;  3SFU A;  1RT1 B;  4HH1 A;  1S4E A;  2NSC A;  4P2X A;  2BQR A;  3OTD A;  3QQC D;  3OJU A;  3I0R A;  1R27 B;  1T03 B;  3U27 A;  2YX4 A;  1RXO B;  2ZDP A;  1GMW D;  2YNI B;  3AOA A;  2JLF A;  1HBN B;  4DUY J;  2KFN A;  2H4Y B;  4CH0 S;  3DU6 A;  1FKP A;  1ICE B;  3NAH A;  1EKS A;  1WSR A;  1FRL A;  4PCQ A;  1JMT A;  1FTC A;  3EZO A;  1HNW J;  3DMJ A;  2RS8 A;  3I4H X;  2KM8 C;  3D3B J;  5GAH U;  1X9W A;  4N56 A;  2FY8 A;  3UNG C;  2LQ9 A;  5A6P A;  4DSE A;  1JXV A;  1WHV A;  1RAO A;  3G9C A;  2JFD A;  3VQS A;  2XZW A;  3KDN A;  2EWH A;  4P73 A;  1S49 A;  3TAM A;  4LUB A;  2OUG A;  3IAS 9;  4IH7 A;  1N52 B;  2HEK A;  1S6O A;  1H3D A;  2WSF C;  1U25 A;  2NZC A;  2C42 A;  2HHH J;  3NAI A;  2FLP A;  4URS A;  4PPD A;  1KHW A;  1N0V C;  2NXC A;  4F04 B;  2PII A;  2RQK A;  4FF4 A;  2OGU A;  1VOM A;  5J2N B;  5AT1 B;  1TK0 A;  4TLR A;  3W2V B;  5GAE I;  5DGB A;  1FRJ A;  3SI8 A;  3QZ7 A;  2G13 A;  3ZXW A;  4DPT A;  2B51 A;  4IDK B;  2NLW A;  1M0S A;  1LWF A;  1C0T B;  3RRK A;  3R5D A;  2UUC J;  2W7A A;  1UET A;  5F3Z A;  3BO4 A;  4IRD A;  4DL7 A;  2DR9 A;  1HPZ B;  4ZPW R;  1P1T A;  3DGP A;  3R9L A;  2ERR A;  5I3U B;  2AEF A;  2OFG X;  1M5H A;  1VBX A;  4B3T F;  1RT2 B;  4J9S A;  4MYT A;  2JNJ A;  2QT7 A;  4C8L A;  1UJ6 A;  4L72 B;  2C2Z B;  3IC1 A;  3UCZ P;  2B43 A;  1I51 B;  4XTT A;  4KV8 B;  1RQ0 A;  2WBM A;  1DLO B;  4IOA Q;  2F9D A;  4X4N A;  1IBC B;  2WOM A;  4ZVT B;  4IFV B;  3HT0 A;  1LOU A;  1VQO S;  3NCP A;  3CMA S;  2YKN A;  2HFU A;  4NOH A;  1VIX A;  2JX2 A;  1W25 A;  5F8G A;  4UW2 A;  1D8Z A;  5K9F A;  4GRS A;  2IM0 A;  3U1N A;  4ALZ A;  2FC9 A;  4CH1 A;  1BQN B;  2EFN A;  2IBK A;  3GIM A;  3NGK A;  2DH8 A;  5KAK A;  2F9J A;  1X5P A;  2W01 A;  5D3G B;  5MLC V;  5IC4 B;  1KLM A;  3DLG A;  4DR6 F;  4GVL A;  3CDU A;  3MAH A;  5FJ4 A;  1YBA A;  4C8Z A;  3DDK A;  4UY8 T;  5IM0 A;  1UMJ A;  4B17 A;  5LSL A;  3C15 B;  1EET B;  4F8R A;  2Y0S D;  4NML A;  2CPJ A;  3QAU A;  2R42 A;  2NQP A;  3W63 A;  5C2G A;  2VFS A;  5F41 A;  4LBI A;  2KT2 A;  1PIL A;  1XJW B;  4K8R A;  2BM0 A;  9ATC B;  1KR4 A;  1PJ6 A;  1UEK A;  2QFI A;  3OD2 A;  1FRH A;  4PXE A;  3TJ9 A;  1O51 A;  1U1P A;  4NE9 C;  4R0E A;  2E5L J;  2GVZ B;  4NXM J;  2QRR A;  2M5Y A;  2DNN A;  1O8B A;  3IAM 9;  1UZH A;  3JSY A;  3K57 A;  5KFH A;  5CYM A;  3ZZZ A;  3FC9 A;  1EP4 B;  1RAC B;  1EZZ B;  1ITP A;  5J1E B;  1NHK L;  3H2V E;  3W5Y A;  1NK9 A;  4EZ9 A;  4DR1 F;  1I94 F;  3P49 B;  3OT9 A;  2QX0 A;  1H0H B;  1UFK A;  2V4Q A;  1Z2Z A;  2NYH A;  2N4C A;  4B9S A;  3AA8 A;  3MPU B;  3NWR A;  3ICL A;  4NYO A;  4O3S A;  4LF8 F;  2RRB A;  3JSB A;  5C42 B;  2NUH A;  2YXL A;  5IQQ A;  4WFN Q;  2E5I A;  2F40 A;  4QIG A;  4N76 A;  3KKF A;  1H98 A;  4DG1 B;  1FJG J;  2DNZ A;  3CC7 S;  1TR0 A;  4NLT A;  4A46 A;  2W4P A;  2YWE A;  1F1B B;  2EPI A;  2GCF A;  2ZBQ A;  3T5K A;  2RJZ A;  2IBO A;  1Q7Y T;  3VVT A;  4YB7 A;  2E5J A;  2FVS A;  1OO0 B;  1YSJ A;  1AA1 B;  1U2R A;  3P6Y C;  3KLE B;  2M4M A;  3HF5 A;  3CD6 S;  1T02 A;  4RUC A;  2H9Z A;  3KK3 A;  5HBM A;  2P2C B;  2HQG A;  2HHU A;  3DKD A;  4FVM A;  4ZK7 M;  5HK4 A;  1X4H A;  2PEB A;  4DQQ A;  4OYI A;  1EHW A;  1L3U A;  3PJ9 A;  1U6B A;  1FVS A;  1HNI B;  3MEC B;  1FNM A;  2ZOF A;  3IO1 A;  2B6A B;  4LRE A;  1TL7 B;  4HVZ A;  1VLO A;  5D6G A;  3F44 A;  3NBP B;  5DDQ C;  2NPI A;  4QR1 A;  5KFG A;  1NK6 A;  1RLC L;  4CLK A;  2ACY A;  1FD8 A;  4XPE A;  3IR6 B;  1HNV B;  4EUV A;  2KT3 A;  3BPD A;  4URG A;  3NGD A;  1RTD A;  2F5G A;  3H2U B;  4B9L A;  2R7O A;  4V19 J;  1F5B A;  5CD4 A;  1WF1 A;  3T1Y J;  3PYE A;  1S77 D;  4U96 A;  1WF0 A;  3G8Q A;  3AOC A;  1DY3 A;  2VC1 A;  2CJX B;  4I7F A;  4LQ3 A;  4M5K A;  4X64 J;  3MEG A;  3A1Y G;  3JYT B;  1E6V A;  2OP5 A;  4WP8 A;  1RAG B;  3GU0 A;  2OEM A;  1LKZ A;  1OY9 A;  5D0R A;  4NLY A;  3NKY A;  2BJ7 A;  1TEL A;  1F5C A;  2AQ4 A;  4KC5 A;  4PR6 A;  1FEH A;  5DM6 Q;  2JHE A;  4GMK A;  2AGO A;  3KG0 A;  3K5O A;  5KG7 A;  5HMW A;  1X7V A;  2UXC J;  1NK8 A;  4BDP A;  1SJ3 P;  2KO1 A;  4LFB J;  4HAC B;  3W9H A;  2IPO B;  4FS2 A;  2EFQ A;  2MGZ B;  2UUB F;  4BC9 A;  3F0N A;  3N6M A;  4ZPD A;  4X4U A;  4LSZ B;  4E8U A;  3THV A;  4K4U A;  2C3U A;  2AJQ A;  1U48 A;  3ZTS A;  2BJD A;  2R8K A;  3SCL E;  2LDI A;  1TAQ A;  3CJ4 A;  4ECW A;  3ILI A;  2B9Y A;  1Q0N A;  4DPX A;  4ZPT R;  2HHV A;  1BLU A;  1GMW A;  3BKU A;  2YPY A;  2QMW A;  1R6V A;  2CPF A;  3GZ7 A;  2CJ9 A;  1RT6 A;  2BOA A;  1S1V A;  4ZVH A;  4PWD B;  1HFE L;  3OSN A;  3KUE A;  1YX2 A;  4YR0 A;  4FKY A;  2VG7 A;  4I56 A;  5ADZ A;  2D3Z A;  2FTR A;  3UFC X;  1UCN A;  4OX9 F;  3HHN B;  1RP5 A;  3WIU A;  2K1R B;  1EAR A;  1HIY A;  1TFY A;  3R5J B;  1M1K T;  4LRC A;  2OH2 A;  4IR1 A;  1V6H A;  2AU0 A;  2PN6 A;  5GMD A;  1XR6 A;  3FMB A;  4KHR A;  4G1I A;  2WRM A;  4L74 A;  4DQR A;  2NRE A;  3EGZ A;  1TTH B;  5DGA A;  2DBB A;  3DI6 A;  2DHS A;  4LT6 A;  2JEF A;  3Q8R B;  1NU4 A;  1SH2 A;  3IP0 A;  2WCX A;  1F3V A;  1GT8 A;  4Y2M A;  1AT1 B;  3KLF A;  3EDR B;  1VS3 A;  1RYR A;  4LR9 A;  1NSQ A;  2NS1 B;  2JVR A;  4QW8 A;  5FDL A;  4YOE A;  3DRY A;  3SYZ A;  3SZ2 A;  2CYY A;  5F8L A;  4QYZ K;  1FVQ A;  4ZN1 A;  3R6G B;  5HMX A;  3W8P A;  3KMS A;  1QJH A;  4OHZ A;  4KHP J;  1RB0 A;  4OI6 A;  4TQR A;  1S9E B;  2ZHO A;  4FBT A;  4NLQ A;  3MM9 A;  4EMD A;  3MAA A;  4QR0 A;  2N82 B;  2V0N A;  1UWB A;  4EEY A;  3I56 S;  1Z4U A;  3JSM B;  4OZ3 A;  1FWK A;  1PGZ A;  1KON A;  1UEU A;  2XLI A;  2B9E A;  3VGT A;  5HMZ A;  1U1R A;  2VOD A;  2ILZ A;  4O44 B;  4K0K J;  2B4P A;  2I2Y A;  3M2R A;  2D1C A;  4WFA Q;  1NZA A;  5FD1 A;  1KOH A;  3DM2 B;  3HT3 A;  3D1O A;  1S7I A;  1UWA A;  4ID8 A;  4BC7 A;  3N79 A;  1X4C A;  3FQK A;  2X1F A;  3C6U B;  3KNA A;  1HWU A;  1IR1 A;  3QGP A;  4P2F A;  2O01 C;  3MEK A;  2K06 A;  2PC6 A;  3MM8 B;  5K5M A;  2QL7 B;  3CUL A;  3ZNJ 1;  1YK9 A;  3ILL A;  2XSF A;  3TAR A;  3S7R A;  5LMN F;  1U6Z A;  1QTM A;  3SMZ A;  1Q8K A;  2RIL A;  2W8L A;  5DDR C;  5GAG U;  1ZA2 B;  3DXB A;  3MOJ B;  4IO9 Q;  1D0E A;  3CE8 A;  1Y00 A;  2HLT A;  1OPZ A;  3TP2 A;  3OPK A;  1B4S A;  4IFY B;  2CQP A;  2CG4 A;  2GJI A;  2PDA A;  5IFM A;  2QYG A;  4C8K A;  4F67 A;  1YJN S;  1GK8 A;  1N0U A;  5LMU F;  2KL8 A;  2AEM A;  4WPA A;  4M5D B;  1ULR A;  1JX4 A;  5E3C A;  3ULH A;  1K1S A;  2CDR B;  2HFV A;  4HT7 A;  2DGW A;  4M95 A;  1SUQ B;  4AL7 A;  2DIU A;  4FYD A;  2BOP A;  2EG2 A;  1MWQ A;  2KB2 A;  2N7Y A;  3GLJ A;  1LK5 A;  2XNQ A;  4HDG A;  5H1S V;  4IG0 B;  1NAQ A;  3C3L A;  1TKZ B;  4F50 A;  1LWC A;  4C3K A;  1S6P B;  2CNL B;  3RW7 A;  4TKT A;  4WZM A;  2HND B;  2PT0 A;  4AFF A;  4P7V A;  1RJJ A;  4PWW A;  3BSO A;  5DQG A;  3QRP A;  5KG4 A;  1QSL A;  2UUA J;  4DV2 J;  1S59 A;  2F4F A;  3OL9 A;  2FB0 A;  1VMB A;  4JI4 J;  4EFA C;  4MK9 A;  2Y1I A;  5LSR A;  4NEY A;  4LFC F;  2ZKT A;  2BEF A;  3F73 A;  3BRE A;  2RVJ A;  3TI0 A;  2DGO A;  2HPU A;  4DV0 J;  3J80 Y;  2B5J B;  3EZU A;  5KG3 A;  5ETO A;  1DFD A;  3QFW A;  1S79 A;  3NGS A;  1MRO B;  1CJV A;  4DHV A;  5KFC A;  3A12 A;  4YR2 A;  3DDI A;  2BJE A;  1JLB A;  4NLD A;  2XS5 A;  3GCW P;  2ZH3 A;  2IYI A;  3OVA A;  3FCV A;  3VAG A;  5KFA A;  4AUK A;  2RKI A;  4EBE A;  1JJH A;  2D74 B;  3UN3 A;  1T0T V;  5DLF A;  2ZIT A;  1X9M A;  4WU2 A;  3DLE A;  1AFI A;  1N36 F;  2VG5 B;  2ZH9 A;  1HWJ A;  2Q1L A;  1MN7 A;  3NNA A;  2CQB A;  1VR6 A;  2DXF A;  5F8I A;  4RW4 A;  1WG1 A;  4DCP B;  3M6V A;  2W7P A;  3EWG A;  1OJ4 A;  4ZP9 A;  3KUG A;  1HNX J;  3PM9 A;  2Y1R I;  4MKV A;  2LXI A;  4DLE A;  2BAN A;  1QD1 A;  2FIU A;  2CQ4 A;  3MHY A;  3WIV A;  5I42 B;  4U8Y A;  4OHW A;  3K17 A;  3M2V A;  2V67 A;  1Z1Z A;  1MU2 B;  1NHU A;  2V4J A;  4P6Q A;  1X5S A;  3SBM A;  1JLC B;  5ETP A;  1VDH A;  3PY8 A;  2POK A;  3OSP A;  5DG9 A;  2PEH A;  4FBU A;  3Q83 A;  1P8G A;  2W2M P;  4I2Q B;  3ZZ0 A;  2G1H A;  3C46 A;  3SXL A;  1VBY A;  5I4M A;  5CAA A;  2WHO A;  1GMV A;  4HDH A;  5KT7 A;  3T9N A;  1G4C A;  3UCG A;  4DV4 J;  1SH0 A;  2B7C B;  2BE2 B;  1N88 A;  1BQM A;  3LA0 A;  3DLJ A;  2BA9 A;  3W3S A;  2DNL A;  2QJ3 A;  2HVI A;  4CYU B;  2PMH A;  2QE5 A;  1HYS B;  1P27 B;  4BS2 A;  3D6F B;  5DQI A;  1NUE A;  1SJR A;  3IWL A;  2XY5 A;  4OYO A;  4DUZ F;  3QFH A;  3CUN A;  3IG1 A;  1U24 A;  2HAI A;  4KH0 B;  1VJQ A;  4DPW A;  4YUD A;  1N6Q B;  2VDI A;  5L1K A;  1L3K A;  3BGO P;  1VRU B;  1F60 B;  3MEE B;  4IOC Q;  3UNY A;  2LMI A;  2W1B A;  3GIL A;  3E3X A;  2ROP A;  3GFH A;  5F8N A;  3M8Y A;  2G4B A;  4A8S A;  5GAH I;  2A2D A;  2HKE A;  1FF2 A;  4OQJ A;  3CJT A;  3OTE A;  2HNZ B;  1X9S A;  4JI8 J;  2FD2 A;  2XCP A;  4B08 A;  3OVB A;  3CB4 A;  3M6U A;  3RRG A;  3HK2 A;  2QA4 S;  5L1J A;  4C2M A;  2QZ8 A;  4DUT A;  4ZMM A;  2D41 A;  5ETR A;  4ED7 A;  4W90 B;  4UST A;  1DAR A;  2HS4 A;  4KO0 A;  3GMG A;  3LP0 B;  5H9F J;  4EK2 A;  2EFV A;  1CS4 B;  2BQ3 A;  3MMA A;  3ZZT A;  2MHE A;  1VRT A;  3EVO A;  4Y2A A;  2E1R A;  4CTA A;  3HHL A;  1FJC A;  2IDL A;  3TVK A;  2BJ9 A;  1YG0 A;  2CQD A;  4ECY A;  5B0E A;  2ZVI A;  2XMA A;  2YNG B;  2MJN A;  3PV8 A;  4DR5 J;  2CWX A;  1KHV A;  2KH9 A;  3OR2 B;  1NEE A;  3WC0 A;  3MGJ A;  3OBI A;  4LF2 A;  5CHC B;  2YWK A;  2BJ1 A;  4CQ1 A;  1KRP A;  1FDD A;  4PKD B;  2CKW A;  2UXD J;  1LWE A;  4NLO A;  3BGR B;  5M2U A;  1DTQ B;  2MY7 A;  2R7Q A;  3K58 A;  3JTN A;  4LF7 J;  2O66 A;  4QYR A;  5KFS A;  1UAW A;  2F4V J;  1Y9O A;  3MM5 A;  3KG1 A;  2MKS A;  2A0F B;  1TL5 A;  1T95 A;  4P2M A;  2GFF A;  3E01 A;  4C11 B;  3P3D A;  4PG7 A;  3OXL A;  1VC5 A;  1NZ8 A;  2HFZ A;  1K0V A;  4DSJ A;  3RBX A;  1CPZ A;  4DU7 A;  3GR0 A;  2XY6 A;  2VOP A;  2RDI A;  3MF5 A;  1VIO A;  2HBY B;  2DNH A;  1YTY A;  5B0D A;  3DLK A;  2OMO A;  1IJF B;  1V3S A;  3UW1 A;  3V6D B;  2ZHA A;  1Q5V A;  4CM0 A;  2ZOG A;  3PW7 A;  3D68 A;  2KZZ A;  2BW2 A;  3DOL A;  3M2U B;  3OTB A;  4A8W A;  1MNE A;  4DXL A;  5L8R C;  4OJ3 A;  2XM3 A;  4N77 A;  2AW0 A;  3CJ2 A;  1S12 A;  3ETM A;  1LXJ A;  1FKP B;  2MQO A;  5E3A A;  3KUH A;  2W2N P;  1VQY A;  1XR5 A;  5D78 A;  3UD4 P;  3C19 A;  3DMJ B;  3KJF B;  3OFF A;  1SXL A;  3A3N B;  2J7U A;  4ZVQ B;  2BM1 A;  3JB9 k;  1UP1 A;  4DL6 A;  4O0N A;  4FNH A;  4CLU A;  5CAB A;  4ZS6 A;  1T05 B;  3MWB A;  4IO1 A;  3DNC A;  1NK5 A;  4NX9 A;  5THW A;  2JFK A;  4DEZ A;  2F63 A;  3CWJ A;  4OHV A;  1RHQ B;  2KI2 A;  3WDO A;  3EM1 A;  4O3R A;  2IJF A;  2JJ4 D;  4CLS A;  4WII A;  3K5L A;  2HAF A;  1O5J A;  3MOZ A;  3I82 A;  4CCH A;  4USK A;  3M8Q A;  3ITH B;  2RHQ B;  3P96 A;  4B3R F;  1N32 F;  3DLH A;  4DSF A;  1PBU A;  4ILR A;  3HPO A;  3W5Z A;  3FSY A;  4TN2 A;  2XUL A;  1LWF B;  2DCU B;  3IGV A;  2WBR A;  5J2Q A;  4JOU A;  3N9U C;  2R3V A;  1C1B A;  3ILO A;  3QRQ A;  1YQH A;  3C14 A;  4KY3 A;  3AH6 A;  1U02 A;  1HNZ J;  3CCM S;  1FO1 A;  5DET A;  2W8K A;  4LRB A;  2R9L A;  3DLB A;  1H2V Z;  2W2O P;  2XLK A;  2OML A;  2OPP A;  3LF0 A;  3BBF A;  4N7T A;  2O67 A;  3LAM A;  8ATC B;  2WOM B;  4YB6 A;  2R8I A;  5E7O B;  1XNR F;  1DAX A;  2YKN B;  7FDR A;  5HVG A;  1Y4Z B;  1TK8 A;  3MR5 A;  3IS9 A;  2AIR B;  1WC5 A;  4ANC A;  5KFE A;  2BW7 A;  4I6Y A;  3BN4 A;  3PFO A;  4OZ1 A;  4ZLJ A;  4URQ U;  3KNG A;  3EJM A;  3IR7 B;  3D6T B;  3HZG A;  2Y8W A;  1Q95 G;  4W92 B;  1FFS B;  1JLF A;  2EI5 A;  3H40 A;  1QAY A;  1C0U A;  3RG6 A;  1KLM B;  4H54 A;  1IQT A;  2UP1 A;  3DYA B;  1JNR B;  2GV1 A;  3GSD A;  5A8K B;  4ED5 A;  1TUV A;  1J5O A;  2HNY A;  1U09 A;  1RAA B;  1DUR A;  3DRS B;  1N34 J;  1KQS R;  5IM0 B;  2VQE F;  1FTR A;  1U1Q A;  3FBE A;  3GR1 A;  1XMQ J;  2YNF A;  1YZ7 A;  3K2Y A;  4KT0 C;  3LTO A;  4IYQ A;  3C8Y A;  1M5V C;  2QA2 A;  2BKN A;  2IFX A;  2V68 A;  3R1H A;  4MKB A;  4LF9 F;  3N5B A;  4DMZ A;  4CLT A;  3JQM A;  1JLE B;  1RT4 A;  2X1B A;  4LFA J;  5ETL A;  4TXS A;  5IWA F;  4TNO A;  4NMX A;  4C9D A;  4KB7 A;  4KH1 B;  4FXW A;  5KFI A;  3W1Y C;  3U7J A;  3PHT A;  3QPI A;  1URN A;  2HZV A;  2UZA A;  3O44 A;  5CYM B;  1U45 A;  3DFE A;  2GAH C;  3CCQ S;  1BD6 A;  2ATL A;  1DBD A;  1IKW B;  3GSI A;  2E29 A;  1UVK A;  1JK9 B;  4KFB A;  2VB6 A;  2WVB A;  3GII A;  2FGO A;  2VPY B;  4OYM A;  4G1Q B;  2XMK A;  2OEK A;  3PKY A;  2H54 B;  3MMB A;  4K2X A;  1YGY A;  3TUP A;  3AT1 B;  4OYB A;  3FBC A;  5EX0 A;  1U0H A;  2DIT A;  2KYZ A;  2QFJ A;  1Q1K A;  4QYZ J;  2ZJR Q;  4NLP A;  2VJV A;  2RDJ A;  3GCX P;  4RW9 A;  1TMJ A;  3ENA A;  2MZT A;  3DRP A;  2KG1 A;  3AD8 C;  1QVG R;  2PA8 D;  2VKR A;  2NPF A;  1U7L A;  1UL3 A;  3PTW A;  1VQL S;  2G2Y A;  2BRL A;  1HQU A;  3I96 A;  4JI1 J;  1IKV A;  3DGV A;  2C2D A;  3RU0 A;  2KXN B;  3KK3 B;  5HBM B;  4DR7 J;  4DSK A;  1KBR A;  1S6Q A;  1WHX A;  3BGL A;  2CIM A;  1Y3J A;  1PAU B;  2IJR A;  1KQK A;  2YTC A;  3CF5 Q;  2HQC A;  3GYX B;  1QSY A;  4DV6 J;  4M5N A;  3UN5 A;  3GJQ B;  4TVA B;  4LF4 F;  2QGF B;  1TV6 B;  3KOA A;  3LGH A;  1NO8 A;  5GAE U;  2NXN A;  3SIP B;  3G82 B;  3MED B;  1HD1 A;  5IS2 A;  1U2C A;  2XMM A;  4LSL A;  1RTD B;  1DZ5 A;  4DR3 F;  2HMI A;  4B3O A;  3THT A;  5B0C A;  4HR2 A;  4I6W A;  4UQG A;  5AJ3 J;  1FHT A;  4NI2 B;  4FNI A;  4IUF A;  3BEG B;  4I7F B;  3BQ2 A;  3DOK A;  2XO6 A;  3MEG B;  1PJ5 A;  2QTW A;  3T5J A;  4DI6 A;  1IKY A;  1IN0 A;  4RUH A;  2BYC A;  1E6V B;  5A2Q Y;  1RU2 A;  3T41 A;  4LR8 A;  2DNR A;  2ZNZ A;  3MD1 A;  2KN4 A;  3M9M B;  4ECT A;  5A2Q U;  3DC2 A;  2V69 A;  2DGX A;  5ETN A;  3J81 j;  3CCZ A;  2R7V A;  1NPR A;  2VQF F;  4RUA A;  3MUV P;  4LIR A;  2M9K A;  3W5X A;  1YI2 S;  4QWB A;  3O3L A;  3HD1 A;  4HTI A;  3GP9 A;  2BX6 A;  4USM A;  4DS5 A;  5HVF A;  4R25 A;  2X1A A;  4J9O A;  4WU3 A;  3SDE A;  4J9K A;  4NLW A;  4DV7 J;  9RUB A;  4AQY J;  5E3R A;  5ETQ A;  3NEK A;  4DV3 F;  4HHU A;  3J7A 1;  3W2W A;  3JS9 A;  4RU2 A;  4ZVU B;  4ZCK A;  2QSW A;  3TVZ A;  3ZZR A;  4GO5 X;  2M0G B;  1YJW S;  1BUX A;  2IAJ B;  4J5O A;  4O4G A;  3BGF A;  3QIP A;  2VHG A;  4EYI B;  2VFT A;  4OZL A;  4NXN J;  4J91 A;  3L7O A;  1SQE A;  2V8V A;  3MPY A;  1HR0 J;  3D9B A;  3WHI A;  1UA0 A;  4GKJ J;  1S4F A;  4WXO A;  3VAL A;  4J9U E;  4PQA A;  1X5T A;  3C66 A;  1GXU A;  2GMJ A;  1LW2 A;  3T1H F;  2E5G A;  4CM2 A;  2XI3 A;  5J2P A;  5HAO A;  3DXS X;  1M5S A;  1X4G A;  3ISZ A;  3TAN A;  2GAG C;  4O3Q A;  1FJE B;  3PVX A;  1K44 A;  1TUW A;  3CDA A;  2V63 A;  3CSK A;  3HJV A;  1N5Q A;  4EWT A;  2AEJ A;  1J2V A;  5DO2 A;  4K4W A;  3A13 A;  4JV1 A;  2E9R X;  2D7S A;  3DI6 B;  1UVL A;  4QU6 A;  1URR A;  3BSC A;  3KLH A;  2G2Z A;  2LYV A;  2DHA A;  4LF5 F;  4ECU A;  4OHY A;  4QWD A;  2H5E A;  3ENQ A;  3BN7 A;  3QJP A;  4O3P A;  4OIX A;  4DL5 A;  1FXL A;  4DWI A;  4GKK J;  4LQ9 A;  5EX3 A;  2ZVS A;  4FYW B;  2QG9 B;  3CCS S;  4ZCM A;  1JLG A;  3V5R A;  3I4P A;  1KKH A;  2N7C A;  3HLU A;  3O6Q A;  1SJ4 P;  2RB7 A;  3PYD A;  3MM9 B;  3NY0 A;  4PXC A;  2HWH A;  2B4O A;  2CVI A;  2Y8Y A;  3CGI A;  4ZCL A;  1UWB B;  2GO9 A;  2CJQ A;  3CJ0 A;  4OX7 A;  3ZNU A;  1KSP A;  4JV5 F;  4J9L A;  1RHR B;  3VAJ A;  2FQQ B;  1XMB A;  1HKA A;  5IQ6 A;  3KHR A;  1YHQ S;  4A8F A;  2XY7 A;  1Q8I A;  2CQ1 A;  4KGX B;  5BYQ A;  4Y3C A;  5F8J A;  3UDV A;  1X8D A;  2R8G A;  1IJE B;  3D5M A;  3T6J A;  1FKO A;  2CJB A;  4DBQ A;  2YQ3 A;  1NLK L;  3M2R B;  5H9E J;  3Q22 A;  3ETO A;  1PYS B;  3H5Y A;  3LWL A;  4LF6 J;  1F2G A;  3PX6 A;  1Y5L B;  2ZOM A;  1BE4 A;  3EYZ A;  2Y3Y A;  2W4C A;  1KN6 A;  5KG5 A;  1TKT B;  3BM7 A;  1CG2 A;  1T94 A;  2VD3 A;  3PIO Q;  2CJK A;  1NK0 A;  1VBZ A;  3FDS A;  2VIC A;  2HRT A;  3BBB A;  5SUH A;  4QR2 A;  1TUG B;  1WF2 A;  1NDL A;  4A8Y A;  3K59 A;  1HWI A;  1ZS6 A;  3C16 A;  4WCE Q;  5E41 A;  4I69 A;  3FZB A;  3KHH A;  3OHA A;  2O1P A;  4MAK A;  2MLZ A;  3TNV A;  2UUT A;  4DCO B;  1WUU A;  2OSQ A;  4FYY B;  2BKP A;  4X66 J;  2BVZ A;  1SH3 A;  1EX8 A;  2LXF A;  3MAQ A;  3SSQ A;  3J7Y U;  3EX7 B;  1N5Y A;  3M8W A;  1YJU A;  3EDQ B;  2F8E X;  2OO4 A;  4FYX B;  3OL8 A;  1P9Q C;  4H4M A;  5GMK a;  3AFG A;  5J2M B;  4IR9 A;  4YP3 A;  2V94 A;  4R5P A;  3G6Y A;  2RD5 C;  4J90 A;  2OIH A;  3PW4 A;  4I6A A;  1IWG A;  3OJS A;  3ZZU A;  4UZB A;  2FJV A;  2JLG A;  1OQ3 A;  3PX4 A;  4DUY F;  1AYE A;  1HA1 A;  3S8S A;  3R3T A;  2UUB J;  2XO7 A;  1U6F A;  1HNW F;  2W9B B;  2AJ2 A;  1CJK A;  3H20 A;  4JV0 A;  2RQC A;  1K0T A;  4UUX A;  5G0R A;  3US5 A;  3V81 A;  1LWC B;  1RSC A;  4U7U K;  2C2M B;  4RL1 A;  2M8H A;  2QL9 B;  3AXK A;  5GVQ A;  4G65 A;  2KU7 A;  1ZET A;  1Q4R A;  1TAU A;  1IBM J;  1NPP A;  3Q8Y A;  3ZZO A;  2R7X A;  3I32 A;  3MCS A;  4PG8 A;  3LP1 A;  5CH7 B;  1FWL A;  3CJK A;  4OZ5 A;  4Q0B B;  4KAI A;  2ZNY A;  3M6W A;  3LGM A;  2HRU A;  3IWX A;  2HHH F;  3BZQ A;  1WG4 A;  4V1A k;  4NRU A;  4J7C A;  3HHK A;  3U02 A;  1BGX T;  2IMW P;  4UOH A;  3IRX A;  5E33 A;  2CWK A;  2IRX A;  3K89 A;  5C25 A;  1NME B;  4U8V A;  3FMW A;  2R7W A;  2J8A A;  4YQW A;  2CQH A;  1CJV B;  2B9W A;  1OSC A;  4EZ6 A;  3BKF A;  2UUC F;  3HVT B;  4UOF A;  4N5S A;  1UJ5 A;  3Q23 A;  1TMM A;  3GQC A;  1KLN A;  5SZT A;  4F4X A;  3PZP A;  2DEI A;  1F6T A;  2UVU A;  3OR1 A;  5IOL A;  4ZKA A;  3V4I B;  5F9L A;  5D4N A;  2G0J A;  3SQG A;  8RUC A;  1R7I A;  3OFE A;  3DLE B;  1B0P A;  2RNE A;  2V2Q A;  5LSO A;  2E9Z A;  1S1W B;  4OLP A;  1GMU A;  1WDD A;  2ILY A;  4RW4 B;  2MKJ A;  2V8H A;  3QT6 A;  2BAN B;  1DTT B;  4C48 A;  5IT9 Y;  3G4S S;  1S72 S;  3M2V B;  5ETT A;  4AXI A;  2J9D E;  1B3T A;  4ED2 A;  3NG8 A;  2V4J B;  1KFS A;  2VH7 A;  2PFD A;  5IT9 U;  1SKS A;  3VWS A;  2KT5 A;  2ZC4 A;  2Q66 A;  2JLE A;  1VQN S;  4WK3 A;  4G1P A;  1SKU B;  2W2Q P;  1BXN A;  5DDP C;  4I2P B;  3VCD A;  4B3S F;  3OTO J;  2HGL A;  4PXB A;  3G6X A;  3J7A N;  1BQM B;  2HQD A;  2B8Q A;  1PBA A;  3PW2 A;  2CA9 A;  5IXU A;  3BYR A;  2BJ8 A;  2UXB J;  1RGV A;  2HHW A;  5A8W B;  2CVE A;  4MTP A;  3MCO A;  1S1X A;  5M2R A;  3D6M B;  3IG1 B;  4OV1 A;  3VAK A;  1Q86 T;  4OJH A;  4RW8 B;  2W9C A;  4HL9 A;  2L48 A;  1B7Y B;  4WFZ A;  3KJV A;  4FF2 A;  5T7L B;  2HFO A;  3L4B C;  2DHH A;  2E5L F;  4NXM F;  3Q86 A;  4I64 A;  3N6N A;  2CQ0 A;  1SL0 A;  2KXH A;  1YZ6 A;  4H4K A;  4YN3 B;  2XHW A;  4K2J A;  2YNH B;  4ELT A;  3QGH A;  3LAL A;  3N0V A;  2QLF B;  2J9C A;  1HW8 A;  1SJ1 A;  2MKY A;  2EFG A;  4LBH A;  3TEH B;  3CC4 S;  2C22 A;  1RT1 A;  2DVI A;  2YX7 A;  4KO0 B;  2P8I A;  4CO1 A;  2CPH A;  1R0A A;  1GAO A;  1FI4 A;  4EO6 A;  1T03 A;  4F7V A;  1VRT B;  3MD3 A;  1IM6 A;  5B09 A;  3K5N A;  3H8Y A;  3HHL B;  3JQJ A;  2M88 A;  2ZEJ A;  4X4T A;  1HBN A;  1FJG F;  3DCA A;  3Q2S C;  3IBC B;  1RBO B;  3P5T L;  4ES3 A;  3G8T A;  1R31 A;  3TZZ A;  5D0H A;  1WC3 A;  5BR8 J;  2U2F A;  5AE1 A;  1LNQ A;  4LJM A;  1SJF A;  2DNO A;  1VYA A;  5EWG A;  2WSE C;  3B4M A;  3MUR P;  4PRF A;  3QID A;  2Z57 B;  1UFL A;  1LWE B;  3VZI A;  2FLO A;  2H5J B;  2F7V A;  3DOM B;  2NXE A;  2CPE A;  3HHL C;  3TVY A;  2VG6 A;  1HHQ A;  4ZLN A;  1FNX H;  2DEJ A;  2FZC B;  1VQM S;  3QBC A;  1XNQ J;  3BR8 A;  3JAM Y;  4ZVE A;  1PYO B;  5K8P A;  2V8P A;  1FRX A;  4CNZ A;  1GXL A;  1LXN A;  4YFU A;  5J2N A;  3E01 B;  3RAM A;  2XBP A;  4NAS A;  1M1H A;  3VZH A;  4M5J A;  4IQX A;  1RWO B;  3FFI A;  4Y0F A;  2B7B B;  1L5U A;  2I9S A;  3M32 B;  2JEI A;  2WVD A;  2DNK A;  2CPZ A;  3B8H A;  2LCW A;  4X64 F;  3ZZP A;  5BXI A;  1ELO A;  3IRW P;  3K5P A;  1HQE A;  2EEY A;  5ETV A;  4O3N A;  3B82 A;  1WKK A;  3NNH A;  3RJM B;  4CO4 A;  3DOL B;  3CCU S;  2J7K A;  4LVO P;  2E7X A;  3HFV A;  2NZ4 A;  1VQS A;  1RK8 A;  2Z58 B;  4C8O A;  3BGU A;  3H5U A;  5HAN A;  5HQ8 A;  5ITH A;  3PJW A;  4OV6 A;  8AT1 B;  4KV8 A;  3MCM A;  2D3O 1;  1KQF B;  2UXC F;  1N36 J;  1TP7 A;  3AOD A;  1Y10 A;  1QLN A;  4IFV A;  4LFB F;  1Q78 A;  4R0J A;  1G2E A;  1QE1 A;  2XTJ P;  1UW9 A;  4EI2 A;  5KTQ A;  4Y2C A;  3VGV A;  3KMQ A;  4GVB A;  4ZHR A;  2HW3 A;  4NCA A;  2CQC A;  2EFO A;  2ZBR A;  3GWC A;  1WSV A;  1FKA F;  2MHN A;  3IXQ A;  2OLW A;  3FBB A;  5D3G A;  5FLX Y;  3UR0 A;  5CYJ A;  5HQL A;  2AX1 A;  1RUS A;  2R7T A;  4O3O A;  1SIZ A;  1SBR A;  1I1G A;  4WBF A;  1MWZ A;  1WOP A;  2AV5 A;  2ZBP A;  3LH2 S;  4ZLL A;  5FLX U;  5KFU A;  2HS0 A;  2YH1 A;  1RA7 A;  3MI7 X;  3I55 S;  2ACM A;  1S1T A;  3EVM A;  4DCJ B;  4RKU C;  2VL1 A;  2ZD1 A;  1MSW D;  3M8Q B;  5E3P A;  3V2U C;  4K4X A;  3D7S B;  2DO0 A;  2B8P A;  5KG6 A;  2UVR A;  4NCB A;  4DUZ J;  1X0F A;  1HBM A;  3V6J A;  1S0N A;  2DNY A;  5JUM A;  3OLB A;  1UA1 A;  2EXU A;  4KBI A;  1C1B B;  1TK5 A;  4AYB D;  1NB2 A;  3C14 B;  2LP4 A;  2E1A A;  1YJV A;  1N33 J;  2GVZ A;  2RF2 B;  4ED4 A;  2PD1 A;  4RUB A;  3IA0 A;  1G7C B;  4MH8 A;  3CCJ S;  1KS2 A;  3GFY A;  1JQG A;  2IIH A;  1TQL A;  1AZS A;  2OPP B;  5J1E A;  2CNN B;  2J9D A;  2CXE A;  1KQG B;  1N54 B;  3QGI A;  4ZPB A;  5C42 A;  3CME S;  4KHP F;  2LQ8 A;  3UDE A;  4JYA J;  4PUO B;  4K4Z A;  3BR9 A;  1FK9 A;  1JXL A;  1JLF B;  1NJI T;  2X1G A;  2RML A;  6FDR A;  3G6V A;  2CJY B;  3PCO B;  5KT4 A;  3TW0 A;  2FHK A;  3BBC A;  4QIW D;  3HXM A;  1AXQ A;  4XAK A;  4LVN P;  3UD3 P;  3CED A;  2F65 A;  2D3O R;  1J5O B;  1IVZ A;  3CDE A;  2LFV A;  5LXR A;  1SI9 A;  4P9S A;  2N3O A;  1PYT A;  2ZUA A;  1HQ2 A;  4B9N A;  1J27 A;  2M7S A;  1LV5 A;  5D77 A;  2XYP B;  1HNI A;  5KOX A;  3JXO A;  2EK1 A;  5KFF A;  1PC4 A;  1S7H A;  2FJX A;  1RT4 B;  3NBP A;  4WZQ A;  4HLB A;  3VGU A;  2ROE A;  5KFY A;  2LU2 A;  3VAF A;  2OD6 A;  2FHJ D;  1UW4 A;  3CJ3 A;  5JJB A;  3TAQ A;  2V2K A;  5T41 A;  3EGW B;  1U8W A;  1IBK J;  2EC2 A;  4E0D A;  2VFR A;  3PX0 A;  2C2K B;  2FGC A;  4DZD A;  1TU0 B;  1NH7 A;  3K0J A;  4KFB B;  1S10 A;  2ALZ A;  2CZ9 A;  5A0Y A;  1S99 A;  4Q43 A;  4NCG A;  3TJA A;  2BUN A;  1RWM B;  2RQ4 A;  4NLU A;  4TQS A;  3MCN A;  1U0H B;  4B9T A;  2XCA A;  1EB0 A;  3G2X A;  2MLX A;  1RHK B;  4WE1 A;  4K4S A;  4JUZ A;  3WX4 A;  4RW9 B;  2J6S A;  3I5B A;  4YME A;  3CNQ P;  1M90 T;  2Z8Q A;  4CO2 A;  3L95 X;  2ZM6 J;  4NRT A;  4GC7 A;  4OYA A;  2CFX A;  4I4B A;  4C7Q A;  4IH6 A;  1ZM3 A;  2MGZ A;  1SC4 B;  1HQU B;  1IKV B;  1KWM A;  1X4E A;  6FD1 A;  7AT1 B;  1VJW A;  4FF3 A;  2C3M A;  5F0U A;  3M9N B;  4F26 A;  1EAY C;  1U8S A;  4ITS A;  2IHR 1;  2PI5 A;  4Z2X A;  3HM9 A;  1ZAX A;  3EGV A;  2JC1 A;  3K8W A;  1NXI A;  2B4V A;  2J76 E;  4MIW A;  1D8Y A;  2BZ2 A;  3MM6 B;  2DIV A;  3VAM A;  3M1V A;  4C8Y A;  4TYB A;  5HP1 B;  2UUA F;  4DV2 F;  4LSL B;  4JI4 F;  4F0M A;  2HMI B;  4B3O B;  4DL0 C;  1RKJ A;  3OV7 A;  3QZ8 A;  2OPS B;  3J7Z 5;  5AXM A;  1RI7 A;  3W7B A;  1UPM B;  5ETM A;  3FVY A;  3KDO A;  2HUR A;  2DTJ A;  1OIA A;  4DV0 F;  1RWX B;  2LXU A;  5CZX A;  2G0C A;  1IKY B;  4PZV A;  4NLG A;  1JLQ A;  1WI8 A;  1FDA A;  5HL7 Q;  4X65 J;  2VA3 A;  3RBZ A;  2KFY A;  1QY7 A;  2Q3P A;  3FRY A;  1R89 A;  2MKC A;  3R7N B;  2VBZ A;  1YLX A;  3I5C A;  4TU9 A;  2YQ0 A;  4DSL A;  5KFX A;  1IWA A;  2CAD A;  4ZIW A;  5U47 A;  2BKO A;  5D15 A;  3MUM P;  3QSI A;  3GIK A;  3I87 A;  2ZKU A;  1NB7 A;  3CCL S;  1JB0 C;  1NHV A;  1S9F A;  4DPU A;  4M5L A;  3SDE B;  2O3D A;  4L75 A;  1S9E A;  1WOS A;  2G2O A;  3BO2 A;  1HNX F;  1RAE B;  1WNE A;  4WTY A;  1OWX A;  5EWE A;  2PO4 A;  4QPT A;  4O4G B;  3QIP B;  3JSM A;  5B7W A;  4PYD A;  4OYZ A;  1H38 A;  2DKO B;  1R8P A;  5AXL A;  3P4U B;  5CXT A;  5K8N A;  3HMJ G;  1NDP A;  4CLP A;  2CNK B;  1RWV B;  2KTQ A;  4ZP8 A;  2DT9 A;  3J7Y I;  1HBO B;  3TUJ C;  4DV4 F;  4JV2 A;  4F36 A;  4YDX A;  5J2P B;  4GC6 A;  1SQG A;  4UF4 A;  1VLY A;  5AE2 A;  3TZW A;  1NDK A;  4ZN3 A;  2V9W A;  3AY0 A;  3C6U A;  3OL6 A;  1HI1 A;  2ZE2 B;  1SKR A;  4QPX A;  3A3P B;  3UDC A;  2J8S A;  4D3H A;  2HQ3 A;  3T6B A;  1RTH A;  4C6A A;  3CCR S;  3ISN D;  1GX5 A;  2ZH2 A;  1JLA B;  4KSE B;  1NSA A;  3UN2 A;  3OXG A;  5E0O A;  4IKA A;  1B7F A;  2N3L A;  1NSP A;  1RAH B;  1U0S A;  2J6T A;  3HDS A;  2HHQ A;  2GVD A;  4Q8F A;  2FVC A;  4F3M A;  2CNO B;  4HKQ A;  2IYG A;  2ZJQ Q;  3H0P A;  4Z7C A;  4DR4 J;  4JI8 F;  4X4R A;  1DJ0 A;  3PR4 A;  4X4O A;  4CNY A;  2HRY A;  2B3T B;  2MDA A;  1ZZN A;  1QM9 A;  4DLG A;  1SJQ A;  1BHN A;  3R5G A;  1VQK S;  3H7H B;  1HBU A;  3DN9 A;  2VON A;  3QJL A;  1HHT P;  3U1L A;  4IRK A;  4D3G A;  4C8M A;  4P10 A;  2KVQ E;  3PKM A;  4Y34 A;  2VPX B;  1SUQ A;  3D67 A;  4ZVF A;  4DR5 F;  1R6Y A;  3TUZ C;  4XIU A;  4C3L A;  4WTO B;  4DPO A;  2XMU A;  3R7S B;  2OPR A;  1S6P A;  2EG1 A;  5F0W A;  3P45 B;  1VI7 A;  2HND A;  4B9M A;  2J6U A;  1EIY B;  2ZDO A;  4B9V A;  4LF7 F;  3G71 S;  2VV5 A;  2MMY A;  2CQ2 A;  1Z2L A;  4BLG A;  4K5S A;  1SPB P;  2F4V F;  3N28 A;  4ED6 A;  4CZC A;  1VQP S;  2M52 A;  3C16 B;  2Z2L A;  2L41 A;  2A6O A;  2VZ9 A;  2VPZ B;  3TQ1 A;  1NKB A;  1H6K X;  3TA2 A;  4KHM A;  3A8J A;  1NK7 A;  3GPA A;  3NS6 A;  4DFJ A;  3CCE S;  2KRR A;  2FZG B;  2RSQ A;  2DRD A;  4LRF A;  3HUL A;  1ZTW A;  4O0I A;  1DQ8 A;  4DL4 A;  3HX9 A;  4RNN A;  4DV5 J;  4F4Z A;  1JKH A;  3QAT A;  4P75 A;  4G3I A;  4H4M B;  2DPI A;  1WC0 A;  5HLF B;  1PAE X;  2DGT A;  4B3M J;  1RZM A;  1S6U A;  4R5P B;  4RPF A;  2FHJ A;  3N5F A;  4JI7 J;  1Y11 A;  1CJU A;  4OJG A;  2MQL A;  4P72 A;  1PC5 A;  1XK8 A;  4KKO B;  1WG5 A;  1X4B A;  4ZVP B;  5HSP A;  4L3K A;  3R5A A;  2QLW A;  4NLR A;  4USI A;  3FSX A;  1CJK B;  4MKY A;  2FJD B;  4EGL A;  3EE3 A;  3V81 B;  2JEG A;  4RWX A;  1K73 T;  1V9O A;  2F1F A;  4DR2 J;  3ZO7 A;  4S0M A;  1FRM A;  3NS5 A;  1DHM A;  1LK7 A;  3KHL A;  3LP1 B;  3OLA A;  4JP8 A;  1JLC A;  4DFP A;  3CJK B;  3AA9 A;  1A7G E;  4Y6I A;  4J9V A;  1FNO A;  3CT9 A;  4RX6 A;  2ASY A;  4AL6 A;  2PMZ D;  1RWP B;  1KTV A;  1VBK A;  5EWF A;  1ZPW X;  4QWC A;  1IBL J;  1FE4 A;  1JJ4 A;  5KFB A;  2N4D A;  2KHD A;  3TX8 A;  2B4U A;  5IZH A;  1BC6 A;  1XWL A;  2AWZ A;  4JI0 J;  3IRX B;  2U1A A;  1F3F A;  4DL2 A;  1RDR A;  4USH A;  1VGY A;  3LQV A;  5DDO C;  3HJF A;  2RU9 A;  2GQ2 A;  3EUN A;  5L38 A;  4X62 J;  1I6J A;  5K8M A;  2MZJ A;  3SFG A;  2M8D B;  3LPE A;  1FX4 A;  3MZI A;  1N6Q A;  5F9N A;  3NLC A;  2KDO A;  1YJT A;  3H2L A;  1VRU A;  5B08 A;  2DGQ A;  4P2S A;  3GV5 B;  3R5C A;  5LT5 A;  1HNZ F;  4IQM A;  4CH7 A;  3PHE A;  2AKW B;  5DZ6 A;  1M5P C;  5L9X A;  1EQ0 A;  3EGN A;  3EXY A;  3CIM A;  2D3U A;  1XEZ A;  3O8W A;  2YVS A;  1IM4 A;  2VBY A;  1WEY A;  5D4O A;  2RH3 A;  2HNZ A;  1Q79 A;  5DJB A;  1LW0 B;  1MG7 A;  1CJT A;  5CD4 H;  3H90 A;  1Q82 T;  3HD2 A;  4DQP A;  4DX5 A;  1FE0 A;  1RT3 A;  1FFG B;  1OY8 A;  1UEV A;  1REV B;  2LQ5 A;  4JI2 J;  2Y0B B;  2HG4 A;  2HZA A;  3QT8 A;  4YY3 J;  1YBT A;  3Q8V A;  2YKQ A;  3IFE A;  3QLH A;  4F4Y A;  4UOC A;  1FX2 A;  2A1B A;  1V5I B;  3MR7 A;  2L9D A;  3HHD A;  1CC8 A;  1U1L A;  3J80 U;  3PYF A;  3JTO A;  4CLF A;  2E7W A;  3FEX B;  2MY8 A;  3LGN A;  1AFJ A;  3UPF A;  3QRR A;  5DZ7 A;  2V5H G;  5LM7 E;  1PJ7 A;  4L73 A;  5EDW A;  2XMV A;  5JXS A;  1R0C B;  1N34 F;  4ECX A;  1TKD A;  4OLO A;  1XMQ F;  1GNK A;  4A48 A;  4HH0 A;  4FN5 A;  2J0S D;  2MKI A;  1RTI A;  1RT7 A;  2XZD B;  4N47 A;  3KJN B;  2L08 A;  2RE1 A;  1O0P A;  4DFM A;  2FY1 A;  3MPW A;  4J9N A;  1XMO J;  2W9C B;  5DS7 A;  2YQ1 A;  4FXV A;  1YJ7 A;  3KJV B;  2BAC A;  4LFA F;  4CLW A;  2NXU A;  2XYG B;  2AX0 A;  1APS A;  1HLW A;  3W61 A;  1KEK A;  1P1L A;  2XSJ A;  4TY9 A;  1D3W A;  2R2R A;  2UV8 A;  1IKX A;  2VBX A;  1RBA A;  5KFR A;  3R5B A;  1C4C A;  3T5H A;  3TUI C;  3CVK A;  4OZJ A;  2C2N A;  5D0G A;  2P9G A;  2KYX A;  2F8M A;  3TWZ A;  2DD8 S;  3D28 A;  3CXC R;  2ADC A;  4OL8 A;  3DRR A;  2YY3 A;  1TZ0 A;  3RUB L;  2D69 A;  1R0A B;  3PO5 A;  2UVW A;  1BQX A;  3GE9 A;  3M2U A;  1U1N A;  4MMO A;  3B78 A;  4PXD A;  3CD7 A;  2XMJ A;  1FA0 A;  4H4K C;  4HT5 A;  4KPC A;  3GJR B;  4YHH J;  5HMY A;  3O1L A;  2J9E A;  4PWU A;  2UVV A;  2ROG A;  1CEZ A;  4N8O A;  2W7O A;  3H4D A;  1GX6 A;  2A6M A;  4KGZ B;  2H3E B;  4JI5 J;  2ZBC A;  4R8U B;  4JI1 F;  2EKN A;  1IUJ A;  3WC2 A;  4NPO A;  4FP9 A;  3TEG A;  4DR7 F;  1K8A T;  1T05 A;  1X60 A;  3DRX A;  2H5I B;  2DR7 A;  3D6H B;  2VG6 B;  5I3P A;  2HQF A;  3WQP A;  1QSS A;  4DV6 F;  4LSN A;  2UU9 J;  1PSD A;  2P9E A;  3KYL A;  2VC0 A;  1HMV B;  4DOZ A;  3RAQ A;  2J0X A;  1CC7 A;  2KJV A;  1RKI A;  3ITH A;  4J9Q A;  4NA1 A;  2Q6C A;  2YWH A;  1WI6 A;  3PEH A;  3OUY B;  1C2P A;  3FFI B;  1S0O A;  5AJ3 F;  3J81 Y;  1J5E J;  3PR5 B;  3CW2 C;  1SIW B;  1Y5I B;  3H5S A;  2KZM A;  2HYI B;  3TAP A;  2HVD A;  1EJ7 L;  1Q8L A;  4BBY A;  3J81 U;  1HQE B;  2LDY A;  3E8O A;  1NPK A;  3MMJ A;  2AHO B;  1RTZ A;  1XN9 A;  3AJ2 A;  3BQ1 A;  1CSJ A;  1NND A;  3FQL A;  3M4X A;  1Y3K A;  1EQM A;  3GYG A;  1U49 A;  3K5M A;  5H9F K;  2I0X A;  3IN5 A;  2CUY A;  3FBF A;  2XZT B;  3IBW A;  1TL3 A;  3QT5 A;  3H4B A;  1Q16 B;  1VQ9 S;  4QOT A;  3ET6 B;  2JSX A;  1N56 A;  5C24 B;  3D0G E;  4USV A;  1QE1 B;  2BJ3 A;  1KNZ A;  3JQK A;  1N4L A;  2XS7 A;  4DV7 F;  3A3O B;  4AQY F;  1B0T A;  4PQU B;  2Z0G A;  2IC3 A;  4GVB B;  1RLD A;  4ZHR B;  1KVI A;  1RHJ B;  1F0X A;  1VQ4 S;  4NZ0 A;  1E6Y A;  1OSD A;  3B54 A;  1VC0 A;  3Q89 A;  1RCO B;  2GX8 A;  4ZVO B;  2M3D A;  1JJ2 R;  2ZH4 A;  3MR6 A;  4CLZ A;  4DN0 A;  3DYA A;  2NYI A;  4B3S J;  3CPW R;  4NXN F;  1HAR A;  5A8K A;  2XS2 A;  4EBC A;  1YKW A;  3OQ2 A;  3LWM A;  2YPZ A;  2AD9 A;  3I0R B;  1HR0 F;  3DRS A;  3FEY B;  3KK2 A;  1U1K A;  4ELU A;  1U2F A;  2DJW A;  3MPD A;  4MJK A;  4GKJ F;  4BWJ A;  1S1T B;  4JI6 J;  1X4D A;  4OI0 A;  2VKZ G;  1AUD A;  2ZD1 B;  1O6X A;  4K50 A;  3K8V A;  2WSC C;  5G4D A;  3ZFV A;  2L3M A;  1RAI B;  2QL5 B;  4QQB A;  3VF0 B;  3CD5 A;  2QA4 G;  1HBM B;  3SCI E;  3AHP A;  4CWB A;  1WWH A;  4JB8 B;  4I68 A;  3W62 A;  5HQM A;  2K8G A;  2XHC A;  3LO3 A;  1JLE A;  5KFQ A;  2JDJ A;  3N4W A;  1QDU B;  1U4B A;  5KT6 A;  1P9Y A;  5DM7 Q;  2KXF A;  5HRO A;  2OI2 A;  2IVY A;  3TX0 A;  2RDD A;  2WB4 A;  1QUV A;  3KLI A;  2ASD A;  2RRA A;  4CO3 A;  3TAM B;  3GV7 B;  1AZS B;  1IKW A;  2J7W A;  2RRN A;  2B56 A;  1WHW A;  2A3J A;  2DIS A;  4V19 X;  4GKK F;  3TZY A;  1FD2 A;  4F3O A;  3B6B A;  4G1Q A;  3GTY X;  1SC3 B;  2DH7 A;  2H48 B;  4RZR A;  3H5X A;  3LW5 C;  2GZO A;  4DV1 J;  1FK9 B;  1C1C A;  3Q8S B;  4ZA1 A;  1V5V A;  2ALY B;  2JL9 A;  4CT9 A;  2QMX A;  1RTJ A;  2YKO A;  2HBQ B;  4OYP A;  2MYF A;  3DLL Q;  3M8R A;  2HGM A;  1H73 A;  3HVW A;  1UTA A;  1G6B A;  3CTR A;  3DGP B;  3NP5 A;  4NA2 A;  3W9J A;  2AYM A;  4OZ0 A;  5B0B A;  3M6X A;  4YB5 A;  3FJ2 A;  4HTJ A;  2MQQ A;  3AXM A;  2AJ4 A;  1YJ9 S;  1BMQ B;  4JI3 J;  3L3C A;  1B99 A;  3PAC A;  2DNG A;  4LF6 F;  1ARO P;  1ZBT A;  4TLQ A;  1HI8 A;  1TV6 A;  2V4R A;  1UVI A;  5D8H B;  3KLG A;  4HI2 A;  3G82 A;  3GB0 A;  3MED A;  3M05 A;  4FZV A;  2X7I A;  4Y65 A;  2HS3 A;  2FJW A;  5KFK A;  2H1Y A;  5HJX A;  2ZH1 A;  2DR5 A;  4F3Q A;  2QC3 A;  4ENO A;  1FES A;  1OPI A;  1VHI A;  1JWW A;  5D4P A;  1VRQ C;  3KFW X;  2W4D A;  3UDL A;  4NI2 A;  2I38 A;  1F2H A;  1ZAV A;  2HHP A;  1NJY A;  2I5J A;  5KFL A;  2MB0 B;  3DLG B;  4X66 F;  4BHQ A;  5A0Y B;  4J37 A;  7FD1 A;  2FUG 9;  5DRK A;  4NCG B;  2R4F A;  3FCH A;  3TQE A;  4IG3 A;  3MUT P;  2K7J A;  2ADB A;  1R8C A;  2ZH8 A;  1R8H A;  1KVK A;  2VBW A;  4PYA A;  4WE1 B;  4IRC A;  4ECZ A;  5KFT A;  1A9N B;  3FNN A;  1S9G A;  3V6H A;  1T9W A;  3LP2 A;  1GQE A;  2FJB B;  4L6V 3;  1PKU A;  1B0V A;  2GQQ A;  5C7P A;  2VIH A;  3R2C J;  4ELV A;  1QTN B;  1WC4 A;  4PG5 A;  2QLJ B;  2CPI A;  1MN9 A;  2PFF B;  4HI1 A;  2FJA B;  3QO9 A;  3R1L A;  3PRV A;  3I6P A;  3G6E S;  2WVC A;  4RW7 A;  3NOC A;  2AP6 A;  2IAJ A;  1I3O B;  1IBM F;  1FJ7 A;  3FRZ A;  3OW2 R;  1XBW A;  1T7P A;  1M5K C;  3QAE A;  4XDD A;  2FYX A;  3M1V B;  3RRH A;  3JSR A;  4P7T A;  2XMW A;  2FHM A;  2DXD A;  3TYT A;  3UD5 A;  2HVZ A;  4WFX A;  2C3P A;  2ZBI A;  1RAJ A;  1Q53 A;  2ZZN A;  3CO9 A;  5CCL A;  2E66 A;  3S6E A;  1U1M A;  3AAW B;  2C2O B;  3PJX A;  3BH6 B;  2IMO A;  4M8L A;  3UVJ A;  4U9R A;  5KOW A;  4NLV A;  3BV8 A;  1NBE B;  3Q2T C;  1JLQ B;  3BS9 A;  4XPC A;  1RT5 A;  2GC8 A;  2AGQ A;  4ZPC A;  2K3K A;  4N8N A;  3UCU P;  2K7K A;  2GGP A;  2KRB A;  1H7X A;  4MK7 A;  3HHL D;  1FER A;  3NCQ A;  2R2S A;  1TFW A;  3P5B P;  4RO0 A;  5D0E A;  4J9P A;  3NGR A;  1VFJ A;  2CQI A;  5L39 A;  5AXK A;  3PNI A;  1T9T A;  2Y1J A;  2X3D A;  4X4V A;  1H2U X;  2F3J A;  2YWG A;  2HSE B;  5CZV A;  3PEJ A;  4XO0 A;  2GQC A;  1CVJ A;  2OAU A;  4KPY A;  3HSD A;  4WKR A;  4RW6 A;  3D0H E;  4CI0 B;  3WZ0 A;  5IT0 A;  3D2W A;  3GFX A;  2G1D A;  1AW0 A;  5KG0 A;  4CLL A;  4KJI A;  1HWL A;  1WOO A;  1X5O A;  1UJ4 A;  3OL7 A;  2XWY A;  3PW5 A;  1HHS A;  1TVR A;  2MEW A;  2YBV A;  5K14 A;  3PIP Q;  1DQ9 A;  2MQN A;  1C4A A;  4B3T J;  3CJ8 A;  4M5H A;  1R8A A;  3VVU A;  3OTO F;  3ENW A;  1JIH A;  4OZ2 A;  3KK1 A;  2NXJ A;  5DQH A;  1YRT A;  1RWW B;  3EPI A;  1S5Z A;  3GON A;  4AE5 A;  1D9A A;  1WD6 A;  4FKX A;  3FEZ A;  2UXB F;  5DG8 A;  1OYD A;  2RU3 A;  3D66 A;  1TKT A;  2GHW A;  5CYQ A;  2J0Q D;  1MLA A;  4K4T A;  1Q7L B;  4DF4 A;  3DU5 A;  3M8P A;  1SV5 A;  4M5G A;  2FDN A;  2HK3 A;  3MM7 A;  1AB8 A;  2OPQ A;  1HD0 A;  1RTH B;  2WAQ D;  4P71 A;  4EBD A;  4UOG A;  1AUS L;  2F8H A;  2J5A A;  4QU7 A;  4ECV A;  2FVR A;  1RE1 B;  2VU5 A;  2JEJ A;  1KOO A;  2GVD B;  4CDI A;  2W25 A;  4DR6 J;  3R97 A;  4X2B A;  4TY8 A;  2JC0 A;  5KFW A;  2MZQ A;  5FII A;  1RT6 B;  4NLS A;  4FS1 A;  1D09 B;  1S1V B;  1K47 A;  2JZ5 A;  2VG7 B;  5J2M A;  1WAC A;  1TKX A;  2HQI A;  3BKT A;  3I31 A;  4HEA 9;  4KQZ A;  2XGQ A;  3F56 A;  1XIQ A;  1HBU B;  3NXZ A;  2ZH6 A;  1SL1 A;  3LAK A;  2IM1 A;  1UPP A;  4A8K A;  1N5V A;  2BRK A;  3MMC A;  5L1L A;  4A8O A;  1OY6 A;  2W9B A;  4W98 A;  5F8H A;  4FYV B;  3HI9 A;  5BR8 F;  2EC0 A;  3LPY A;  2WON A;  1YWX A;  2LVW A;  3AB2 B;  1QAX A;  2XYH B;  3POT A;  1X4F A;  1S57 A;  3QSY B;  4WKY A;  2OPR B;  2FLL A;  2NCK L;  3UWT A;  3KLF B;  4M1K A;  4QBU A;  4JBC A;  2IVF B;  4DR1 J;  5FDL B;  3LOU A;  2AZ3 A;  1I94 J;  1PO6 A;  2G9O A;  5EHH A;  1UZD A;  2H51 B;  1NJZ A;  4LF8 J;  3ADA C;  5BJR A;  1XNQ F;  4Q0B A;  1W2B R;  2DB1 A;  4M5M A;  5D4L A;  1OS5 A;  2ATC B;  2OHD A;  2Z56 B;  4OZN A;  2DGV A;  2VAS A;  3JTP A;  3MAA B;  1KVJ A;  2IRU A;  4C98 A;  2G0I A;  1FCA A;  2V2Z A;  1S1U A;  5KFJ A;  3I0S A;  4ID5 A;  2CPD A;  3FKB A;  2VFV A;  1ACM B;  2OEJ A;  2MKH A;  3HSJ A;  1IR2 A;  3T1A A;  5I3Q A;  5RUB A;  1TL1 A;  4DZ6 A;  4WYL A;  1JKH B;  3HVT A;  2C2R A;  1L3V A;  2DRB A;  2R8J A;  4UY8 5;  1ZM9 A;  5EGY A;  2Z2Z A;  3EIC A;  3L9Z A;  4EU0 A;  4A8X A;  1G1X A;  3PG9 A;  2VOO A;  3V4I A;  1CJU B;  5K20 B;  4DU8 A;  5KT2 A;  2PGC A;  2CZV C;  1S1W A;  1SQF A;  4C0H A;  4ETZ A;  2CRL A;  4RNO A;  5CQG A;  4F4W A;  1F9H A;  3T5L A;  1N5T A;  4OI1 A;  1DTT A;  2H65 B;  4QIF A;  3AQO A;  3TJ8 A;  2ZH5 A;  5HVH A;  1ZYQ A;  2V2V A;  2CG8 A;  3X3U A;  4UZC A;  2ZH7 A;  2MPU A;  2YX1 A;  1YDL A;  1NDC A;  3QWP A;  3TA0 A;  5H9E K;  3EXC X;  4K7Q A;  4X4Q A;  2FJE B;  2CDQ A;  4ZP7 A;  2EKY A;  3RAX A;  3C6T A;  2M70 A;  3S1T A;  4RU9 A;  2P5V A;  2YWW A;  2ZC3 A;  4CP5 A;  4I2P A;  3FZ2 A;  4DPY A;  2HVE A;  5JVG Q;  3D1H A;  4NYP A;  3KTQ A;  3HCX A;  4KYZ A;  2NR0 A;  4ED1 A;  4ED0 A;  3V6K A;  1YIT S;  3ONQ A;  3RZA A;  5EN1 A;  4ED8 A;  4C0B A;  2P6T A;  3UO0 A;  4M94 A;  1S76 D;  5A8W A;  3CC2 S;  2YKA A;  2IA0 A;  4C3M A;  5GAD U;  1RYS A;  2VA2 A;  4ICL A;  4RW8 A;  4RNM A;  2BE9 B;  1N8R T;  2SXL A;  3RBD A;  5T7L A;  1N33 F;  2X3G A;  3E2E A;  1VHF A;  4ZJQ A;  4FDF A;  1BWV A;  4ERD A;  3PRB A;  2YNH A;  1FEE A;  1VIS A;  3UQS A;  3IM8 A;  2C3O A;  1T9V A;  5HAT A;  2E1P A;  3BSA A;  1CJT B;  1NKE A;  4MFB A;  1CQM A;  1NH8 A;  1RT3 B;  5J1N A;  2X51 A;  1NRK A;  1ZA1 B;  2XG8 A;  4KIA A;  4USW A;  4OX9 J;  2DY1 A;  4FPI A;  2GIF A;  1N5S A;  2LEB A;  4JYA F;  3I9V 9;  4IOB A;  3TO8 A;  1GTH A;  2P6S A;  2JRS A;  4ZP6 A;  3QLH B;  4PG6 A;  4QW9 A;  4KGK A;  3R2D J;  1Q81 T;  2MZ1 A;  4KTQ A;  1LFW A;  4ETX A;  2B0G A;  4FF1 A;  3N01 A;  3VQT A;  1JLB B;  2KHC A;  1SKW A;  4P52 A;  1DQA A;  2WB1 D;  4PAB A;  2RKI B;  4OI4 A;  2GHV C;  3ZC4 A;  5E2Q A;  1ZM4 A;  2E5H A;  1XQI A;  3DOM A;  2DNM A;  1WOR A;  4CO5 A;  3HFZ B;  3EPG A;  4FPR A;  2Z2Y B;  5HO4 A;  1RTI B;  1RT7 B;  3GV8 B;  5A8R A;  2DHX A;  4H4O A;  4BCA A;  1NJX A;  1R0B G;  3GG0 A;  3RB0 A;  2IY5 B;  3VTI A;  2C28 A;  1CBK A;  1KFD A;  2CPY A;  2M2B A;  4ES2 A;  3GIJ A;  2GW8 A;  2HGN A;  4LR7 A;  1U47 A;  2YKM A;  4RWW A;  3J7Z T;  3LUY A;  2FC8 A;  3BO3 A;  1SL2 A;  2CQG A;  4MYU A;  2EFP A;  4MIB A;  2XSJ B;  3BSN A;  1CUL A;  4QIE A;  4Y2I A;  4USJ C;  1IBK F;  1IKX B;  3QWU A;  1GXT A;  3HSZ A;  1HI0 P;  3ZZY A;  4XK8 C;  5LL6 d;  2AJF E;  2WW4 A;  4OFZ A;  3M32 A;  2J0W A;  4ZVG A;  3KXD A;  1IR0 A;  1YJR A;  4QZV B;  2HHX A;  3VHQ A;  1KC8 T;  4L3N A;  1T3N A;  3T9Z A;  1K1Q A;  3DRR B;  3HP6 A;  4C4W A;  2QO3 A;  2V8G A;  2QYC A;  3HKZ D;  2W2P P;  5LXY A;  2QLX A;  2WW8 A;  2RUS A;  3LAN A;  1R3N A;  4WFB Q;  3M30 A;  2GNK A;  3RBE A;  3A8E A;  4X4P A;  4KE5 A;  2C3Y A;  4WXW A;  4WK1 A;  2HVH A;  5JMN A;  4NEZ A;  2ZM6 F;  5T14 A;  1SC6 A;  3OTC A;  4ZPA A;  1V3R A;  1H7W A;  2VFU A;  1NCL A;  3CCW A;  5LMN J;  1UVN A;  2MQ8 A;  4LIW A;  3AJD A;  3SSS A;  1VC6 A;  4WYW A;  3EMT A;  4RBU A;  2OSR A;  3ISN C;  3BF4 A;  4LSN B;  4Y2K A;  3VAH A;  2A2C A;  1EKR A;  4C8N A;  1MWY A;  4NA3 A;  2Q6B A;  2V9K A;  4QCL A;  2AZ1 A;  1A6L A;  2YH0 A;  3VV2 B;  4ZOS A;  3NL0 A;  4N41 A;  1PG5 B;  3SEO A;  1WC1 A;  2DNP A;  3MMA B;  1HW9 A;  5LMU J;  2DXE A;  3PYG A;  1KTQ A;  5KFV A;  2YNI A;  4CTA B;  2RAQ A;  1Y5N B;  3RB6 A;  2JOQ A;  4YS2 A;  1RAF B;  2PSZ A;  3W60 A;  1CLF A;  2FVQ A;  1U26 A;  1F9F A;  3RW6 A;  1S97 A;  1GEH A;  2AJ0 A;  4X65 F;  2V6A A;  3CDB A;  2HK2 A;  3RR8 A;  2ZUG A;  2IRY A;  2K3I A;  2RF2 A;  3TOQ A;  4K4V A;  3CCT A;  2E44 A;  4LF1 A;  2MTL A;  2LEC A;  4HHJ A;  4YR3 A;  3THP A;  3B4D A;  1L3S A;  1S0V A;  4TU7 A;  3GJS B;  4QWA A;  1REG X;  2XWX A;  3FSI A;  5K8O A;  1TL3 B;  4ECR A;  2DO4 A;  1VQ7 S;  5IT4 A;  1WEZ A;  3MM5 B;  4DS4 A;  2MQM A;  4WP3 A;  2LEA A;  4LFC J;  2ZWP A;  3PFE A;  1XTZ A;  3M8Z A;  4DN9 A;  2LA4 A;  2FZK B;  3JAM U;  2MSS A;  2DGU A;  4PAA A;  5KFM A;  1ZZF A;  4DSI A;  2IC3 B;  3MFH A;  3W2V A;  5KG2 A;  2EVZ A;  4PUO A;  3T1Y F;  4ZPV R;  1WHY A;  3S01 A;  2HIQ A;  1E6Y B;  2AJ1 A;  3UE2 A;  2K2P A;  4IDK A;  4YEA A;  2VDH A;  1C0T A;  3DLK B;  1LEO A;  4Q2L A;  4DX7 A;  5HI7 A;  3R6L B;  1HPZ A;  3Q0A A;  1FRK A;  5I3U A;  3KK2 B;  2WK4 A;  1RT2 A;  4NZ6 A;  1Y0H A;  2FPH X;  2I6W A;  2H4W B;  2IJN A;  5JVH Q;  1DLO A;  3NGU A;  1H72 C;  5ETK A;  4OI2 A;  1RAB B;  2KFZ A;  3NWG A;  4BWM A;  3MTJ A;  4XDC A;  3HO1 A;  5HRO B;  3NMA A;  4E2F B;  4OHX A;  2A10 A;  3KLI B;  1BQN A;  3OFG A;  4TYA A;  2LA6 A;  4NYZ A;  4PEO A;  1H2T Z;  4Q5V A;  1NK4 A;  1PCA A;  4ILL A;  3IR5 B;  4U7C A;  2PI4 A;  4J9R A;  4M63 A;  1OMS A;  3G87 A;  2VPW B;  1YIJ S;  3OHB A;  3CD0 A;  2LEP A;  2GS8 A;  4U6P A;  3AD9 C;  3Q8P B;  5DG7 A;  4DR4 F;  4Q45 A;  3C15 A;  1W2I A;  1EET A;  4E98 A;  4W4M A;  1C1C B;  1ZM2 A;  2GO8 A;  2XI2 A;  2AF6 A;  1F9E B;  1RTJ B;  3KJQ B;  3PO4 A;  2BBE A;  4KGM A;  3K7R A;  2EW9 A;  3T19 A;  2HFN A;  4NLX A;  5J2Q B;  2OFH X;  2V50 A;  3PXG a;  2AYG A;  4QWE A;  2AYB A;  2Q43 A;  1S48 A;  2CJA A;  2EBE A;  3V4M A;  1R8B A;  2ABY A;  1CQN A;  4YB1 P;  1EP4 A;  1Y7P A;  4Q2M A;  4F0H A;  3C2P A;  1TL4 A; 
#chains in the Genus database with same CATH homology
 1U0H A;  4WPA A;  1CJK B;  1CJV B;  1AZS B;  4OYZ A;  3MAA B;  3ET6 A;  4NI2 B;  4CLU A;  4P2M A;  1YBU A;  1CJK A;  5IV3 A;  4UST A;  1CJV A;  1AZS A;  4OYA A;  4OZ2 A;  3C15 B;  3C16 B;  3G82 A;  4CLZ A;  1CS4 B;  1WC4 A;  4P2F A;  4CLP A;  3C15 A;  4OYX A;  4CLT A;  3C16 A;  1CJT B;  5D0E A;  4WP8 A;  5IV4 A;  1CS4 A;  3R5G A;  4OYW A;  5D0R A;  1CUL B;  1CJT A;  1YK9 A;  4CLS A;  4CLW A;  4CM2 A;  5D0H A;  5D15 A;  1WC3 A;  4USW A;  3MAA A;  4NI2 A;  4OYO A;  2GVZ B;  1CUL A;  4WP9 A;  1WC5 A;  4OYP A;  2BW7 A;  4CM0 A;  1AB8 A;  1WC0 A;  4OZ3 A;  1YBT A;  4P2X A;  4OYI A;  4CLY A;  4WP3 A;  1CJU B;  3ET6 B;  1Y11 A;  3UVJ B;  2WZ1 A;  1TL7 B;  1Y10 A;  1FX2 A;  5D0G A;  1CJU A;  4USV A;  3G82 B;  3MR7 A;  2GVD B;  3C14 B;  4OYM A;  1WC1 A;  2GVZ A;  2QV6 A;  2W01 A;  3UVJ A;  4CLL A;  1U0H B;  4CLK A;  1TL7 A;  4CLF A;  1FX4 A;  1WC6 A;  4OYB A;  2GVD A;  4USU A;  3C14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...