1CJVA

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mg, and zn
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two-metal-Ion catalysis in adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
molecule keywords ADENYLATE CYCLASE, TYPE V
total genus 55
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cjvA00
4OYPA 5IV4A 3UVJB 4P2FA 4CLPA 4CLLA 4WP8A 4OYIA 1CULA 1CS4A 1WC3A 1AB8A 5D0EA 1CJTA 2WZ1A 3C14A 3C16B 3ET6A 1CS4B 1CJKA 1CJVB 4USUA 3MR7A 1WC6A 5IV3A 4OYMA 4OZ2A 4NI2B 1AZSA 4CLUA 1AZSB 1FX2A 2GVZA 3C15A 3MAAB 1CJUB 4NI2A 2QV6A 2GVDA 1WC0A 2GVZB 2W01A 2GVDB 1FX4A 1CULB 4OYBA 1CJTB 4OYAA 5D15A 5D0GA 1TL7A 3UVJA 4CLSA 1TL7B 4P2MA 2BW7A 1Y11A 4OYXA 5D0RA 1WC1A 3G82B 4WP3A 3C16A 4OZ3A 1YK9A 3R5GA 4CLKA 1YBUA 4CM0A 4OYWA 1Y10A 3C14B 3C15B 4CLZA 3G82A 1CJKB 4USWA 1CJVA 5D0HA 4WP9A 1YBTA 4WPAA 3ET6B 3MAAA 4CLYA 1CJUA 4CLTA 1WC4A 4USVA 1WC5A 4CLFA 4P2XA 1U0HB 4CLWA 4OYZA 4CM2A 4USTA 1U0HA 4OYOA
chains in the Genus database with same CATH superfamily
1RAIB 3MPDA 3MGJA 3ZO7A 5EUHA 2FZKB 3R9LA 3R7NB 4WWSA 3D3BJ 2XHWA 4KR0B 3EZUA 5MAOA 1Q8IA 3A8KA 2JC1A 3GZ7A 3M8RA 1GK8A 4EBDA 3CCES 4JI1J 4KHPJ 4QIWD 2IAJA 2P8IA 2GIRA 3DOMA 3LAKA 4ZJOA 1RKIA 4GVBB 1ZBTA 4U6PA 1VQ9S 3THPA 1C2PA 1A0OB 4RX6A 4RW4A 8AT1B 4X2BA 1ACMB 3DRYA 2UUCJ 1Q86T 3PRBA 1JLBB 2F9DA 5SZTA 3FKBA 2XQCA 2GZOA 4M5HA 3MEGA 3TNVA 4JI5J 4X4UA 3RZAA 4R5PA 4JI6J 3BR9A 5LMNF 4D3HA 1OY6A 4NE9C 3LP2A 1C4CA 1LWXA 1V9OA 3NXZA 4OI6A 3UR0A 1VQOS 2MZJA 2OAUA 4TU9A 2JEIA 4IFVB 5B0CA 4WZQA 4IFVA 2M4MA 1WG4A 4QIGA 4J37A 2D41A 2RVJA 2ZBPA 2QMWA 3I5CA 5B0AA 4DPYA 2GQQA 2AZ3A 1F5BA 2GVZA 2HK2A 2VA2A 1MU2B 3HVTB 3HK2A 2DJWA 1E6VA 2BRKA 2DHAA 2NXNA 4NLOA 1U25A 4ECYA 1H7XA 5I3UA 2VG5A 4LREA 1XR6A 1SIWB 2R7RA 1SV5A 2W01A 4YB1P 2R9LA 4KHRA 3HD2A 2GGPB 3IWLA 1EETB 1G4CA 2CVIA 2MHNA 1B4SA 1F60B 3LP1A 3WIUA 4J9MA 2C2RA 4JYAF 1N34F 2GCFA 3DOKA 1MWYA 2F7VA 2H4YB 3V4MA 2GAHC 3VVTA 3BO4A 3HFKA 1AXQA 1U02A 4LSNB 5HJYA 3GSIA 2O1PA 4LR9A 5AE2A 4O0IA 2V2QA 2RAQA 4OJ1A 5D15A 1U2RA 3OL7A 2UUAF 3U1LA 4DHVA 1LXNA 5FJ4A 3TUZC 1TL7A 1WACA 3AODA 1C1BB 3D0GE 5AXKA 1P27B 1TL7B 3UVJA 1NJXA 1CVJA 1P8GA 3KLIA 3LGMA 4EFAC 2W7PA 1QTNB 4K0KF 5H9FK 4DZ6A 1TK0A 3KLEA 4DPOA 1I5OB 1RT5B 2PEHA 4X4VA 1YJ9S 1U1OA 4Q44A 4KGXB 4N77A 4OYXA 5KG4A 2HHXA 4UTGA 4FBUA 2CDQA 3KNAA 4F2RA 4GO5X 4ZOSA 1YQHA 3FQKA 5K8MA 3DM2B 3FDSA 3MEEA 3R5GA 5DZ7A 4HLBA 3MM6B 4QQBA 2CPHA 6FDRA 1NBEB 4QW8A 2WONB 3BGRB 2NPIA 4X62J 2B9YA 5G0RA 4JI7F 3MMJA 2NUUG 3I9ZA 1M1HA 4ZVEA 5HQ8A 1VQLS 3B8HA 3T5KA 3DRPB 2DK2A 4ANDA 2MKIA 2PDAA 2Y1LB 2ZKTA 1HA1A 3OR2A 2AP6A 4JP8A 4PXCA 4ZP9A 4F4YA 1T9UA 4ZVHA 3MAHA 3D1HA 4OZLA 2RUGA 3AD8C 3GG1A 2PMWA 2XMTA 3EGZA 4PUOA 1FCAA 3FK4A 4TVAB 3EZ5A 3MTJA 3E3XA 4JI0F 1H0HB 3CDEA 1N36J 4BBYA 1B64A 2AX1A 4RPFA 4EUVA 3JYTB 5K8PA 3WC2A 5F9LA 2MQOA 1RISA 2L9NA 2OUGA 2L41A 2EXUA 2VBXA 2F40A 5KFYA 1Q1KA 3OLBA 1UEUA 1QVFR 2V9WA 2QL9B 3W8GA 4CT9A 1LWCB 3FUYA 2ZVIA 2L48A 1LWCA 2QL5B 4EYHB 1P9QC 1FFSB 3RU0A 1JLGA 1JLCA 4B3MF 3MUVP 2W9CA 4JI8J 1T94A 2CQ1A 2E5JA 3W3SA 4UQTA 4DQIA 3K0JA 2IMOA 3ILOA 3TA1A 4I2QB 4DSKA 1X5TA 2BEFA 4RW6A 1DARA 1JLFA 5HO4A 3R1LA 1S49A 3PTWA 4NYZA 1NH7A 2CJAA 2CNNB 1U2CA 2IJNA 2XMVA 5K9FA 5HQMA 1LXJA 2FZCB 2BJ7A 4XDCA 3W61A 2ATCB 5B0EA 2F4VJ 1UP1A 5L9XA 4OX6A 2EG2A 4LF8J 2UXBJ 2J9CA 3BSCA 3A4TA 4NMLA 2R8HA 3PJ9A 4FNIA 4L72B 1RWPB 4YR2A 2IFXA 3I9V9 4NEZA 3OSNA 1L5UA 2X1BA 1HNIB 4FKXA 1IJEB 1TAQA 2HMIB 4CNYA 4EO8A 5I3QA 2W8LA 2HMIA 2WAQD 1SH3A 1Z2LA 3Q8PB 4K4ZA 2NCKL 4WFXA 2V50A 1EKRA 3L4BC 4LR7A 1Q8KA 4LRBA 2J0WA 5CAAA 2YPZA 1W2BR 1ZA1B 2RE1A 2V8GA 4PQAA 3EMTA 1APSA 2QLJB 1R8AA 4WE1B 1KDNA 1KTVA 2NR0A 4K4WA 1NJIT 1S1TA 1G1XA 1LWFA 4WKYA 3ZZTA 1UTAA 4USJC 4KTQA 3Q2TC 4ILLA 4TYAA 3ENWA 2UVUA 2IM2A 1VR6A 2DD8S 3W2WA 1FFGB 2G9OA 2MZSA 2DNRA 1RZMA 2DNMA 1WKKA 2F5GA 3D1QA 4DX6A 5HROA 2XYHB 1R8HA 2GQCA 5B08A 4ZIVA 4HKQA 3Q24A 1UW4A 3WZ0A 1VQMS 1FTCA 1ELOA 2E7WA 3ZZYA 1TTHB 3P45B 1S76D 2WB4A 2APOA 3UDVA 2OD4A 1FX4A 3K5MA 1XR5A 1IKYB 4B3SJ 1YGYA 2IJFA 2L08A 3HFVA 2KJVA 2ERRA 2DNNA 1R43A 2A6MA 1RTIA 4ZPWR 1XIQA 2HNYB 3K7RA 3Q22A 4RWWA 4DU7A 3PW2A 2KTQA 3R3TA 4DV1J 4RW8B 3C19A 2FLLA 3KHRA 4CWBA 5E33A 3IO1A 5L1JA 1VQSA 2DEJA 3C6TB 2OSRA 3EJMA 4I0WA 4KFBA 5DQHA 3GIKA 3DLKB 1TL1A 4JI8F 4N47A 2RHQB 1FKOA 1JJCB 2HIYA 3N79A 4XIUA 1TVRB 3R5DA 2IM1A 2VB6A 4DL7A 3GSDA 4IO1A 1LFPA 1RBAA 3D6HB 2J8SA 2WTFA 2NXCA 1LQ9A 2KRBA 2H4WB 3MECA 1B0VA 2CXEA 2AGPA 3TWZA 1VRUA 4AE5A 3MMBB 5HATA 4X65F 3HJFA 3MMBA 2COLA 4HHJA 3D4JA 5JJBA 5I42A 1JK9B 1KQKA 5I42B 4HI1A 2H54B 2ACYA 4BC9A 3KK1A 3PO5A 3J80U 4EK2A 2H1YA 1H7WA 1SVDA 3GMGA 4UZBA 1DLOB 5HQLA 4BDPA 2V69A 1RAOA 2FGCA 1DLOA 3DMJB 3H5SA 2HURA 3IFEA 4RW9B 1N48A 2DGXA 4Q7AA 1Q0NA 5K14A 4UUXA 2N7CA 2V8DA 3RR7A 4RUCA 2KN4A 3TAMB 1NDLA 3TAMA 4WYWA 1KVIA 1RAGB 2BBEA 2MJUA 4C0OC 5BR8J 1K9MT 5KFNA 5GVQA 3UD3P 2MYFA 2WHOA 2IY5B 2FDNA 2AYBA 2Z4PA 4YY3F 4D3GA 4QWAA 3PX0A 2DXDA 3AJ1A 3FGVA 5KG3A 2KG1A 1C1CA 3M9NB 2J6UA 4ZVTB 4QCLA 2W24A 7AT1B 2OP5A 3U02A 2GJIA 4U7UD 3MM9A 4JYAJ 2OPPA 3MFIA 3KK3A 1TKZB 2EFPA 1RWWB 1V3ZA 2DXEA 1GXLA 2F8HA 2MKSA 3A1YG 3MM5A 4ECQA 4DSEA 1LW0A 1KHWA 3FFIB 3V5RA 3WX8A 1EHWA 4DS4A 2CYYA 2XY6A 4DS5A 3O3LA 1C0UA 2UUAJ 1QE1A 2AF6A 1UVKA 1SCJB 2FYXA 2LEAA 1OY9A 2RSQA 2XZDB 1VJQA 2BABA 3OXLA 4OZ5A 4DV5J 3CO9A 1PSDA 1RCXB 3GR0A 4QWEA 2ZHBA 1WUUA 3X3UA 2CZ4A 2WBMA 4M1KA 1EQMA 3JQMA 3ZZPA 1W7WA 4ER8A 4FYVB 1DZ5A 1CS4B 3CJRA 4O3SA 1CJVB 1IKXA 2C2ZB 2HIQA 2MZQA 4F4WA 4DX5A 5KFXA 4X84A 3BYPA 2P9EA 1PYTA 3DLEB 3UQSA 4DN0A 1TAUA 4CO1A 3W1YC 1KN6A 1NNDA 2Y8WA 2GJFA 2BANA 2E66A 2LXFA 1TR0A 3HSDA 4KE5A 4TKTA 3ZNJ1 2EBEA 1J5EF 1DQ9A 3M8PB 4M5GA 1RU1A 2V34A 4LIWA 2DPJA 4H4MB 2DGVA 2AJ2A 2BJ8A 4GKKF 2E7VA 4U95A 4I6WA 3CULA 2X3DA 2R7SA 4ILMA 2BM1A 1F2GA 4QWBA 5HN0A 3V81A 3A3OB 1KLMA 4F3MA 1WC0A 4JI6F 2EFNA 1OMSA 5DLGA 2LCWA 2GJ2A 3MM8A 4NA1A 4EU0A 5LMNJ 3IBCB 4ECTA 1HHTP 1HBMB 2GNKA 4PAAA 5ETLA 3GJRB 1JB0C 3D6FB 3TW0A 5E3QA 2VDHA 1B7FA 1NZ8A 4NWBA 4C9DA 5K8OA 3JTOA 3T41A 5SUHA 3T1HF 5H1SV 2HS3A 1OYDA 4F67A 2YWHA 3NWGA 4NA2A 3V6DB 4LF4J 2P5VA 4I64A 3T1YF 3M2UA 4WK3A 3R27A 1X9SA 3DN9A 3RR8A 1RWOB 4X4NA 3M8QB 4LVOP 1ZM3A 3PNIA 3DI6A 3FCWA 2MQPA 4LF1A 2P9GA 2KZMA 1WC1A 2OTJS 5IM0A 5FLXU 2ZHOA 1WI8A 4PEOA 5KT3A 4ZLPA 1XMOJ 3AJDA 5KG1A 1L3UA 4JV5J 3OVAA 2UXDF 4NYOA 2NZCA 3GIMA 4CLKA 2OPSB 2HHHF 3DOLA 1AFIA 3M8WA 4GMKA 3ZTPA 1OJ4A 1AUDA 3IM9A 2HK3A 4KBIA 2A2CA 1FXLA 1VIXA 1L3KA 3I0RB 1HWIA 4H4KA 4TLRA 3EXCX 3O2IA 4ID5B 5HBMB 5DG9A 1FE0A 4DR5F 5CYMA 1JLAB 1VI7A 4FXVA 4NA3A 4OHXA 3T3FA 2FLNA 3QAUA 1IUJA 2HQ3A 3NAIA 2Y1RI 3DXSX 1Y00A 2IRXA 4QOTA 5C5JA 5EWFA 4BCAA 1E6VB 2GQ2A 2K06A 2ATLA 1RK8A 4DI6A 3CEDA 1OYEA 4A48A 1VOMA 4C8MA 1U1PA 4ZHRB 3KUEA 1U48A 3PW4A 3O1LA 4ZCKA 3CJKB 1BMQB 2V67A 1YDLA 2HVEA 2FTRA 2HNDB 3QT5A 4KSEB 5LT5A 2GGPA 5JUMA 2EI5A 3AD9C 2QL7B 4GKKJ 4P72A 3ZNUA 2W7AA 4CYUB 5G4DA 1PJ6A 2WRMA 5CCLA 2GV1A 3IBWA 2YNIB 4JI4F 4PPZA 3D2WA 3K5OA 3S01A 2HWTA 2PFFB 2Z56B 3HT0A 2WOMA 4OYPA 2VKRA 2G1DA 4OV6A 1P9YA 1Q8BA 4Q2LA 3CD7A 2UV8G 4F7VA 3V4IA 1ZTWA 2HBZB 3NOGA 4CLPA 2VQEJ 4WP8A 1N6QA 1S6PA 5BYSA 4YR3A 4O23A 4NCBA 2JHEA 3RYLA 2RHSB 2M8HA 3ZZ0A 5B09A 1TKTB 2VBWA 1T0TV 4F3QA 3QZ7A 1OSDA 1CULA 1Q95G 4I2PB 4JV0A 4XO0A 4HACA 4DV5F 1IBLJ 4DJBA 4K7QA 3UN3A 3DM2A 2VG7B 3MEEB 4YDDB 1ZYQA 1FJCA 4LF7J 3G8TA 1N52B 1VDHA 2YKMA 4WKRA 1NPKA 4H54A 3Q8UA 3H2VE 3RAQA 3MUMP 3CSKA 3AQOA 1R0CB 1S9EA 1UFLA 4J9NA 2J6SA 3ENAA 1KVJA 1U1RA 2X1GA 3VAJA 1TUWA 1FFWB 1ZAWA 2NPFA 2J7UA 4UZCA 3ZZOA 2DRBA 2AJ4A 1WOOA 3M7VA 2HGMA 4LQ3A 4LRDA 4CO3A 1FERA 2F63A 1RT2A 2XEXA 5FDLB 3VHQA 4YUDA 2KM8C 3AQPA 2VONA 1P6TA 2E1PA 2V4QA 1RI7A 2XMJA 3E51A 4GVLA 3BN7A 3HX9A 2VASA 3KWMA 2FHMA 3M30B 3I4PA 2JX2A 2KHCA 3BSAA 2MKKA 5LMUJ 2E5GA 2ZC3A 1IKWA 2CJXB 3RTVA 2RRNA 3CW2C 2HZAA 2FVPA 1KBRA 1P1TA 4KKOA 2C3PA 1S0OA 2EWHA 4L6V3 2PSZA 5HVHA 3CJQA 1UEVA 4U67Q 1HBOB 1RWVB 2GAGC 2GMJA 3K2YA 1NHVA 3EVMA 2R7QA 3R5JB 2LA4A 5T7LB 2B0GA 3VAKA 5C24A 3OXFA 3BB5A 3N9UC 5D6GA 1CC7A 3L9ZA 4NLWA 2AYGA 3ITHA 5DG8A 2OD6A 2H3EB 3OVSA 4LF5F 1H2TZ 4YP3A 1KC8T 3HHNB 1FWPA 2B8QA 2ZBQA 4A8XA 2JVRA 4L3NA 2Q6CA 5BR8F 3SQGB 1NU4A 3DGVA 4JI4J 1WOPA 2NSCA 2YX1A 2KU7A 2WW4A 3FSXA 3TZZA 3I87A 1HHSA 4XDDA 2MY8A 3GFZA 2BW2A 4DV4J 2V63A 3OXGA 3M6WA 3JAMU 2B3TB 3EE3A 1NSAA 3MR6A 5D0RA 2QEXS 2K1RB 1XBWA 2YNHA 4OZ3A 1H3DA 2HPUA 2NREA 4DCJB 3O8WA 5B7WA 4PWDA 1HWKA 2VG6B 1FD2A 2X3GA 4WFZA 1KQFB 1FRLA 1DQAA 4MK9A 1HYSB 1YZ6A 3G8QA 3G82A 2POKA 4E8UA 3G96A 1S72S 3RBEA 4LF4F 2AIRB 2BM0A 1IQTA 3QZ8A 4MJKA 2WSFC 5AXMA 3BQ0A 2Z30B 3BBCA 2NLWA 3AFGA 1NRKA 2LVWA 2R3VA 3IRXA 4NX9A 4ATNA 1RT7B 1CJUA 3A8EA 1RAEB 2SXLA 3ISND 4DPTA 3W63A 4U9RA 5LOQA 2QT7A 4USVA 4A46A 2XB2D 4P2XA 4CTAB 1RADB 4DFMA 4WXWA 4KPCA 5B0BA 5U47A 3SI8A 3F0NA 4OX8A 1REVB 2HGNA 4IUFA 1K1SA 4J9VA 4N56A 4NLGA 2WVFA 4P73A 5EHHA 3AXMA 3CJ5A 3MEKA 4ZVGA 5GAEI 4FBTA 2HHSA 1Q79A 2BE7D 1D1UA 2KZZA 2O5DA 1TV6A 1HQUA 1IBCB 3MHYA 4OYOA 4XK8C 1SJ3P 4F3OA 4X64F 3H42A 2AD9A 1RA7A 2C3YA 2CRLA 2RF2A 2QLBB 3U7JA 5HVGA 1T05B 2KL8A 3NMAA 1QSLA 3ILIA 4B9MA 2M3DA 5DGBA 2MJNA 4MIAA 4OJGA 4JI2J 2XULA 4IFYA 1NJYA 2L9DA 4KJIA 3FQLA 1JMTA 2MY7A 3HSZA 3CCJS 1I6JA 2ZNZA 1RABB 1TU0B 2BUNA 1WC3A 2LU2A 2WSCC 1UA0A 3PO4A 2MQQA 2IVYA 3SV3A 1H73A 3KG0A 2IMWP 1NHKL 2VV5A 2ZEJA 5T41A 2DCLA 5H9FJ 2R2RA 1S0VA 4ANEA 1EZZB 1GMVA 1Z2ZA 1ZA2B 2HS4A 1NHUA 1XTZA 5CYQA 1JLBA 3RB3A 5I3PA 2DRDA 4KO0A 4CZCA 3CJTA 2AJ0A 2JL9A 3CDUA 1K1QA 3KG1A 1WWHA 3W9IA 2RU3A 2K7KA 4C7QA 1M5HA 2LMIA 5ITHA 5DDPC 3GV5B 4AT1B 3BO3A 5KFHA 3MD1A 2A10A 1EAYC 2BKOA 3FMWA 2PD1A 4P7TA 5M2UA 1LWEB 2K2PA 2BYCA 1C0TB 1S4EA 2OI2A 1N4LA 4PUOB 4P2SA 1GXTA 1U0SA 4M8LA 4P7VA 2K8GA 2CKWA 1HBNB 1IM6A 1SQFA 4NI2A 3TVZA 2RS2A 4YB6A 5KFKA 4DR4J 2HRYA 1RQ0A 3B4MA 1PILA 3I31A 4WF9Q 5CYJA 4KC5A 2VFSA 2ZZTA 2ASLA 2M52A 2NS1B 4RLEA 2YY3A 3VCDA 4PQUB 1FRMA 5IXUA 4ILRA 4DEZA 4URGA 4USHA 3TJAA 5KFDA 3DU6A 4K50A 4B3OA 1GQEA 3MM9B 3ZZRA 4ZN3A 3KLGA 4GKJF 2G2OA 2OPQB 1CJTB 5HMZA 1S4FA 4ED0A 2AX0A 1RUSA 3FBBA 2I1RA 2OMLA 4J9OA 2Z8QA 5L39A 1VQ7S 1G3OA 2J0SD 2DVIA 3RGIA 2O66A 3BREA 4IDKB 1EIYB 2QJ3A 3N6MA 3NGSA 2DKOB 2EKYA 2XLJA 4DUYJ 1SL2A 2HHVA 3PEJA 1JLEA 2HKEA 1B70B 2CJBA 1SPBP 2HNZB 3MEDB 4U7UK 2HZVA 4DV2J 4ZPTR 2CQ3A 1RTJA 1UWBB 1QAIA 3BSOA 4WFAQ 1NH8A 3GCXP 3LANA 2V4JA 1S7IA 1YLXA 2VKZG 4WBFA 3GYNA 3B78A 2V2VA 3GG0A 3QQCD 5IT4A 1UKUA 2UP1A 3UD5A 9ATCB 1D0EA 2N4CA 1ZZNA 1FA0A 3ONQA 5D0HA 3W5XA 2AZ1A 3P4UB 4HT5A 2AJQA 2IVMA 3IS9A 2O67A 1OQ3A 2M5YA 4KIAA 4M5IA 3CCRS 1HIYA 2BKNA 1NB2A 2BVZA 3TARA 4NLSA 2FHJA 4KH1B 3NGUA 5AXNA 3J7A1 4OZ1A 5HP1A 4O0NA 3I5BA 1WORA 3W5YA 4B3SF 1WG1A 2MDAA 2ZFHA 1UVNA 1GNKA 3EVOA 4WK1A 2KXHA 3W66A 3W9JA 3G2XA 3TZXA 3J81j 3SV4A 1WELA 5J2MB 1KLMB 4M5DB 1OS5A 1V3RA 3HKZD 4FF1A 1W2IA 4F50A 4U96A 4PR6A 1TKXB 3TQEA 4QW9A 1RT6B 1TKXA 1O51A 3KJVB 1XC9A 4P9SA 2EFGA 3FSIA 4LIRA 4OYZA 1H2UX 1KTQA 2GA7A 3T6BA 3NOCA 1BQMB 3H5YA 4Y2KA 4DV1F 2Q1LA 2CJQA 2MKCA 3T1YJ 4Y65A 3DRSB 4IH5A 5ETPA 2W25A 1XK8A 4ZK7M 1D8ZA 3J7Z5 3V6DA 1FK9B 2D3ZA 2ZKUA 3OHBA 1RTZA 2XS5A 4A47A 3C6UB 2JNJA 5B0GA 3SCIE 4C8ZA 1AYEA 3SDEA 4X66F 2JFDA 3HHEA 2FVCA 2J9DA 3D1OA 3PDNA 5KOXA 1CBKA 1X4CA 4DLEA 4B9LA 4MT1A 4LF8F 3JQJA 2BZ2A 3GR1A 2B6AA 1OY8A 2JLFA 1SUQB 3QT7A 4TN2A 5DDQC 4DX7A 4DV7J 3O44A 3I82A 2HBYB 3LWMA 2BQ3A 1C1BA 3HLUA 4CT8A 1MROB 2D69A 3LP0A 1IWGA 1GT8A 5KFBA 3KK2A 1JLAA 3K8VA 3MD3A 2XZTB 4PZVA 2HSEB 5JMNA 3JB9k 3QT6A 4Z7CA 4IRCA 3L7PA 5C2CA 2Z2ZA 3LQVA 1KQGB 4FPIA 1NZAA 2YKNB 4IRKA 2YKNA 2JSXA 1VMBA 1AZSA 3DLGA 2C2KB 2LFVA 1AZSB 3N28A 5ETMA 2KFNA 2ZBRA 3KLFB 1SV5B 2QA2A 1PJ5A 4YEAA 1S1TB 3JSMA 2BQUA 2Z58B 1VRQC 5MLCV 4JV2A 1NO8A 1Q8LA 1J27A 3C66A 2HWHA 4A8MP 2RUSA 4NOHA 4ZITA 4OI0A 1HNZJ 4FXDA 3KHHA 1BQNB 2CQIA 4F36A 2CG4A 4QWCA 4JBCA 2OSQA 4R0JA 1ZPVA 4Q5VA 3OL8A 4UF4A 3V4IB 4DF8A 4W98A 3T19A 2AU0A 2C28A 2KT2A 4YDXA 1VCTA 4DCOB 5H9EK 2DHGA 1KOOA 1RT3A 2PA8D 3EWGA 4OYAA 2RIJA 4XTTA 4J91A 3QSIA 2DNLA 1IBKF 4XAKA 5IOLA 4OI3A 3SFUA 3M9OB 3PIOQ 1NPRA 2YKPA 6FD1A 1P1LA 3I6PA 4V1Ak 5CABA 2U2FA 3I5AA 5KG6A 3FRYA 3L95X 4YY3J 4TQRA 1TL1B 4G6VB 3K5LA 2HVIA 3T9NA 2IRYA 1NEEA 1JLCB 1Y3KA 2OEKA 2O01C 3LAMA 2PC6A 3RBXA 1QJHA 2XWYA 2HBQB 4RW6B 3LGHA 2R7OA 1IQZA 3CC2S 2RH3A 2JDJA 3DCAA 3M2VB 4ZIWA 3PR4A 4Q43A 3V6KA 1S1UB 5B0DA 2XMKA 1BWVA 1MNEA 3PCOB 1S1UA 2DNPA 2PIIA 3HD1A 3MWBA 4L76A 2VOPA 1N0VC 3DYAB 1JNZB 4MKBA 2IM0A 3NP5A 3MR5A 2R8IA 3C2PA 1D9AA 1U6FA 2BE2B 3FZBA 5E3AA 2ZUGA 2MMYA 1RT4B 4TU8A 2NXUA 1RJJA 2KT5A 3R6GB 3TZWA 5CHCB 4JI2F 2QGFB 2CQPA 2CNOB 2BX6A 2Q79A 1NK8A 1ITPA 3AOCA 2LEBA 4RNNA 2EEYA 5A8WA 3Q0AA 3DLBA 3Q8QB 4Y3CA 1FWLA 2HRTA 5J2NB 2ZHAA 3KUGA 3T1AA 4WE1A 3HP6A 3IRWP 2HQDA 3AOAA 4CP5A 2V8VA 1LWFB 2YNGB 2KFYA 2DGOA 2RRAA 3P96A 4E2FB 4MKYA 2AYMA 2CAJA 5BYRA 4AQYF 3VGUA 1HNZF 4IR1A 1C1CB 1M1KT 3CO0P 3BPDA 1F3VA 1Q81T 2VL1A 5HROB 2XCPA 1D9DA 1SH0A 2L9WA 3TVYA 2LP4A 3VTIA 1K0TA 5F9NA 1RCOB 3MM5B 4N7TA 4PG5A 4F0MA 1X60A 2ZH9A 4OYIA 3TRGA 4DR5J 2KYZA 2WB1D 2YWEA 2RDJA 4MAKA 1WEYA 2HLUA 5L1LA 2AKWB 3GB0A 3DRRB 2QZ8A 4RBUA 2IVFB 4F25A 3MR2A 5D0EA 3KKFA 4FS2A 2C22A 3QATA 3AY0A 3FEZA 1SQGA 4X4SA 1R0AA 1XNRF 4B3RJ 3SQOP 1S79A 1WHVA 1XNQJ 2Z0GA 4RW8A 2C2DA 4O44B 4Y0FA 5IWAF 4KGMA 2JLEA 4DG1A 4TQSA 2M7SA 3N4WA 1OQ6A 2B7BB 3AOBA 5ADZA 4KV8B 2ZJQQ 4G1PA 1UVLA 5JVHQ 4LUBA 4DV3F 4URQU 4CLUA 1SI9A 3W5ZA 1Y3JA 1FX2A 3PEHA 2VIHA 2QA4S 2F65A 4CH1A 4RW7B 1X4FA 2V8PA 4NRUA 3JTPA 4AXIA 4YHHJ 1RTHA 1H2VZ 2IDLA 3KFWX 2ZE2A 4I7FB 4PRFA 2XM3A 1SH2A 3KJNB 4M5NA 1K0VA 1IKYA 1RWXB 4TLQA 4G1QA 3U1MA 4C2MA 4DSIA 3KG4A 2HHQA 3BBFA 3GPAA 1S1XA 2FGOA 3QBCA 4DR1J 1RT1B 3OQ2A 3VWSA 1M90T 3D67A 5J1EB 4DSJA 2AWZA 5A8KB 1WF1A 5IQQA 4ED2A 3IN5A 2CDRB 4DLGA 2ILZA 1UVJA 2PFDA 3GJQB 1NK4A 1HL6A 4BC7A 3MF5A 3KHGA 3SSRA 1QAXA 3NBPB 1FJEB 2CPDA 4EI2A 2C2MB 2DHXA 1GH8A 2DH7A 2FJEB 1S1WA 3CD5A 1MLAA 4LF2A 2W2PP 3GJTB 2QG9B 1PG5B 2WCXA 1S7HA 2BOAA 4FVCA 4DFPA 4Q0BB 4NZ6A 1LK7A 5CCMA 1J5OB 5KT5A 2RS8A 4M5LA 4KPYA 4NZ7A 4P6QA 4QIEA 5DETA 4NZ0A 2FY1A 2LQ8A 1HQEA 5CYQB 5GAGU 1VIOA 1BD6A 3HSJA 2YWWA 3GU0A 3J81U 4GKJJ 2H9ZA 2ZUAA 1XQIA 1N36F 1N32J 1VBZA 2EFOA 3C15B 4K8RA 3W9HA 2W8KA 2DRAA 5GMDA 4WTYA 1XMQJ 1CJKB 4J9LA 3PHEA 2NZ4A 1FDBA 2QX0A 1KOHA 2J7KA 1WTFA 4RW9A 4E98A 3SCLE 2RDIA 1BXNA 3T5LA 2I5JA 2YQ3A 3M6UA 4KB7A 1NDCA 4QYZJ 2OELA 3POTA 4DUYF 4DFKA 5IS2A 3HFZB 3ET6B 3L09A 2VQFJ 2IM3A 4LBHA 3G6ES 2H65B 3K57A 2VG5B 2H48B 1I94F 4HT7A 3BS9A 5AE1A 1RHMB 4HDGA 4J9UE 1I1GA 1V5IB 1WKJA 3NGDA 2N3OA 1NCLA 3DGPB 3KLHB 1Y4ZB 4PQUA 3ETOA 2F8MA 2XYPB 3DOKB 1J2VA 1RAJA 3PHTA 2KT3A 4IOBA 4XPEA 4LFAF 3G71S 4CM2A 1VBKA 2AHOB 1HNVB 2LECA 1BC6A 1HMVA 4G65A 1U1QA 3RAXA 1U1MA 4ED3A 2BJEA 4DX8H 3UVJB 3TA0A 1FT8A 1DTQB 3VAFA 1ZPWX 3F56A 3JTNA 4ECWA 4DSFA 4J9SA 1W25A 2YNFB 2DITA 1SC3B 2RNEA 5IFMA 4KAIA 2ZJRQ 1TELA 2M8DB 4ZP7A 3EPIA 3AD7C 4CH7A 3CMAS 2F3JA 3QFHA 5ETOA 3QYYA 2OTLS 3CWJA 4ZDNA 2VD3A 2NXJA 3NL0A 1F1BB 2HQFA 4OZ0A 1T3NA 1F9FA 1RTJB 1UWBA 2QSFA 3HULA 1VBXA 1ICEB 2XYGB 3NAHA 4HYKA 2WONA 2B5JA 3DLHA 1PYSB 2CZ9A 2ALYB 2W4DA 4WU2A 5J1PA 3OTOJ 4LF7F 4FF3A 2Q6BA 2GS8A 3DOMB 3TZYA 2MZRA 3CMQA 3DXBA 3M8QA 2DH9A 3TUJC 4FYXB 4H4KC 4JV5F 1NK9A 4YQWA 1UEKA 1GMWA 3MPWA 4MTPA 3PXGa 3A3PB 4Y2AA 2UU9F 1Q7YT 4MFBB 3V81B 2CQDA 4O3OA 3IGNA 5ETRA 1YJUA 2JFKA 4PXEA 4DL3A 2OH2A 4W92B 3EZOA 4M5DA 2DGSA 1SKRA 2H5IB 1UETA 2DNQA 1KQSR 3MAAB 2MPUA 3FBFA 1XNQF 1T03A 2XI3A 5AT1B 3THVA 3HF5A 5EX0A 1T03B 2GVZB 2DO0A 3MCNA 5HLFA 4I68A 4ZPAA 3UN2A 1XWLA 2A3JA 1IKVA 1GEHA 2E29A 2WW8A 3BR8A 3QNWB 4LRCA 4YN3B 4DFJA 2VFUA 3M6XA 5D4NA 3UDCA 5A2QU 1JX4A 1VJWA 2IAJB 1X4DA 2JRSA 1SB6A 4HL9A 4NLUA 4ZA1A 3K58A 2ADCA 1B3TA 4IG3B 4LF5J 4IG0A 2CPJA 3QRQA 1MMNA 2R2TA 2RRBA 4OI2A 3DI6B 3OPKA 4ZVQB 1VQNS 3WDOA 1JLFB 2MQ8A 1RE1B 2BA9A 2C3OA 2I8EA 2F1FA 3MCMA 1YJTA 1LKZA 5KFSA 2KVQE 4CNZA 1N5TA 2VU5A 3DRXA 1V3SA 4AQYJ 3TI0A 1IM4A 4A4JA 2VUGA 3DFEA 3QRPA 2CZVC 1SJRA 2HQCA 2J5AA 2WOMB 4ZLLA 2CWKA 3LP2B 3ZTRA 3CXCR 4C0BA 2ZOMA 1Q53A 2YX7A 4S0MA 1YVFA 5D8HB 2GO9A 4C11B 3PACA 3UNYA 4URSA 4W4MA 3VVUA 1U47A 4ES3A 1MMLA 2ZDOA 3KDOA 4KGKA 3R5CA 2CQ2A 5KFVA 4CO2A 2MQLA 4CIOA 4AYBD 4RR5A 3HM9A 2CG8A 1RHJB 2P6SA 3LUYA 2FUG9 2LQJA 2RMLA 3MM6A 2Y9HA 2CPXA 2LA6A 3OTCA 2CFXA 5B0FA 2V2KA 1IR1A 3BGRA 4WFYA 3CT9A 1IBMJ 4DR3F 1KR4A 7FD1A 5A6WA 4C98A 4R8UA 2QO3A 5I4MA 2YH1A 3EGNA 5HI7A 2ZM6J 3OTOF 4R25A 3G86A 3QIDA 1RT7A 2LU1A 3BKTA 3RJMB 5C42A 1NPPA 3HZEA 3OR2B 2W7OA 3VAIA 4B3TF 4F4AA 3BV8A 1JQGA 2G13A 4QWDA 5D78A 3I4HX 2A18A 2DNOA 3LO3A 4QBUA 4LF6F 2DHSA 3G8SA 2XS2A 3TEGA 5DM6Q 4USTA 4B9UA 1WOSA 3QJLA 2HVDA 2KO1A 3BO2A 4EBEA 4RL1A 1RWNB 1YTYA 1IBKJ 1OPIA 3AB4B 1YJVA 3IWNC 5KFZA 4Y00A 3GTYX 2VQFF 2VFTA 5GADI 3HHLD 2YXLA 2V5HG 2KG0A 3IG1B 4KY3A 5CA5A 3C6TA 4RU2A 2MGZA 4DR4F 3WHIA 2OHDA 1FDAA 4N8NA 1PJ7A 4LT6A 4ZP8A 3MPUB 4EGLA 3O6QA 1JLGB 5GAGI 4UY8T 3ELHA 2DHHA 5A6PA 3PKMA 3H4DA 1Q78A 4X4TA 4WU3A 5DLFA 5KT4A 3QRRA 2F8EX 4DUZJ 3AHPA 1VC6A 2CJKA 1UVMA 1FRJA 2QYCA 3CDWA 3N6LA 4A8KA 3R2CJ 1N54B 3C16B 4YS2A 4BLGA 3M2VA 1UMJA 2XGQA 3NNHA 3MR7A 4KO0B 3ULHA 4A8FA 1HKAA 2EG1A 2DR9A 1S6OA 1WHYA 4TYBA 5E2QA 3IC1A 2HQIA 4M95A 3UFCX 2Q43A 4A8QA 2JH3A 4UUWA 1FO1A 4OJHA 9RUBA 2UUBJ 4CO5A 2QLWA 5DDOC 2MSSA 5F8IA 3H2LA 5LJ3Y 5KFTA 3I0SB 1X5PA 3RBDA 4LQ9A 1X9MA 4KRWA 2E9RX 3CJ3A 4L3KA 1N0UA 1WDTA 2OMOA 5DRKA 4YOEA 2PMHA 4NLDA 2D3O1 3ETMA 4DF4A 2X7IA 2QLFB 2LKZA 1RHQB 1PKUA 1O0PA 5KG5A 1NSKL 3KUHA 2HFZA 2JVOA 3J80Y 3BSNA 3NCRA 4WTOB 3HJVA 3TUPA 1PO6A 2G0JA 4OQJA 5IC6B 1SC4B 4C4WA 2G2YA 3NNAA 2ZM6F 4PXDA 3DDKA 2XBPA 2ASYA 3R5AA 3BQ2A 3D28A 2VOOA 2D1CA 3MXHP 4B3OB 3VF0B 3IAS9 5AJ3F 3D68A 4DQQA 2VBYA 1REVA 3A3NB 4MYTA 4QU7A 1NKBA 1AA1B 3W60A 1N5YB 4IH7A 3CIMA 3AAWB 3BDEA 3Q83A 4RO0A 2AEFA 2J7WA 2QFJA 3MMAA 2I2YA 3R2DJ 5KT2A 1RTIB 2MLXA 2ZWOA 3OJSA 5F8GA 3RRHA 3BM7A 2PT0A 5A8RB 2W4CA 5F3ZA 4J9KA 4WP3A 1SJFA 4AL5A 4AL6A 1TMJA 1SKUB 1PC5A 2OFHX 1ULRA 4WCEQ 1T05A 1IKXB 5DO2A 4KFBB 1R8BA 1RAHB 3CDAA 1EJ7L 3D7SB 3DLKA 5CD4A 3DLEA 1X0PA 3VR1A 1U1NA 1TL3A 3C14B 1RBLA 4UOHA 3VAGA 3B82A 4WFBQ 4KV8A 4USWA 3IRXB 2DNGA 2FB0A 4M5KA 3HHKA 1L3SA 4LFBF 4RW4B 2NSBA 3MPYA 2F4VF 3G4SS 3DKDA 4CTAA 3QLHA 4DV7F 2NQPA 1QDUB 4O3RA 1HLWA 1R89A 1AUSL 4HTIA 1PBAA 2M0GB 4CLYA 3CUNA 5F8NA 3MEGB 1FE4A 3CJSA 2HS0A 4YMEA 1FNXH 2CPIA 2M88A 2PE8A 4G1QB 3ZTQA 4RWXA 1ZETA 2E5LJ 3GFYA 2OIHA 4CDIA 3PYDA 1TV6B 1YJRA 3MM8B 2HAIA 2FC8A 2PI4A 4NXNJ 1HBMA 1SJ4P 5LXYA 2CPFA 4A8OA 1MG7A 1L3TA 1FDDA 2B4OA 4NLRA 1SQEA 1KVKA 1VQ8S 1IR2A 4AUKA 1NJZA 2G0CA 3OUYB 1GX5A 5CZVA 1MW7A 1HR0J 1N5SA 5GMEA 5I3UB 3DRSA 1YBAA 5IWAJ 5T14A 1RU2A 2QMUB 4C8YA 1RGVA 4DCPB 4K4UA 4NASA 1VISA 1KP6A 2QYGA 3LPEA 1JLQB 4C48A 3SBMA 4DR2J 3RB4A 5AJ3J 3EPGA 4Q2MA 4UT4A 2DT9A 4ZKAA 3KLGB 2CNLB 2FVRA 5HMXA 1YX2A 2X51A 2DNKA 4LFAJ 3G9CA 4R5PB 2ABYA 2FQQB 3AH6A 1HI8A 2BJ3A 1MMDA 1FKPB 1GX6A 2WVCA 1D09B 3EDQB 3PFOA 4QJVA 3OL9A 1S99A 2JEJA 3DMJA 1EX8A 5EN1A 1T11A 4CQ1A 2KXNB 3HHLB 3VAMA 4CO4A 4GC7A 3PJWA 3HHLA 1FXRA 2MHEA 3FJ2A 4I6AA 4RUHA 1MN7A 3H25A 3QO9A 2YVSA 4QZVB 2JWNA 1Q4RA 3H20A 4OZ2A 1U6ZA 5F41A 3R8YA 4DV2F 3D9BA 2BACA 2HFUA 2L3MA 2R42A 1EP4B 1RA6A 1UFKA 1CQNA 3IGVA 4C3KA 3SYZA 2VC0A 3QGGA 3M8PA 1LK5A 3CJ8A 2FVQA 1CG2A 3NRBA 2ZH2A 2HLTA 3DRPA 1ZM2A 2YQ0A 3HI9A 5IC4B 2BMBA 1RTDB 4ZLJA 1WSRA 3EICA 1TKZA 3Q8SB 3BPSP 1FEHA 2OPQA 1RHKB 1Z4UA 2VICA 3NGRA 3E2EA 1X5OA 4NCAA 2HWIA 1YI2S 4IDKA 4LSLA 1O6XA 1FJGF 3MOJB 4R0EA 4ZVOB 4RBVA 3JQKA 3GE9A 4IH6A 3KLEB 1MN9A 3RRGA 4NXMF 5KFAA 4ES1A 2KM8B 4HI2A 1U49A 4GRSA 2PA3A 1XN9A 4RUBA 3R7SB 4NXNF 2FD2A 2NXEA 2D9PA 4IOCQ 1O8BA 3P5BP 3IP0A 3VZHA 4PABA 2YWKA 2VG7A 3BKUA 4L75A 3JS9A 3CGIA 4OFZA 2X1FA 1S6QB 1HPZB 3MZIA 2GFFA 2B5JB 3FCVA 3MCSA 4ED6A 4ELVA 2JLGA 2Z57B 1FVQA 4LRAA 4OL8A 3QT8A 3J81Y 4GVBA 4RJVA 4X65J 4OLOA 1WI6A 1YBUA 2AT1B 4I2QA 1CLFA 1URRA 5IZHA 2LDYA 1BHNA 1FXDA 3T9ZA 4AFFA 1VQYA 4Z7YA 1KLNA 3SDEB 4OHWA 3PRDA 3SSSA 4W90B 3R6LB 2IIHA 2UUCF 1EARA 4MFBA 3IAM9 4YHHF 2XC9A 5CXTA 2DB1A 1TQLA 2LDIA 4ANCA 8ATCB 5DDRC 3CCMS 2FHJD 4I67A 3I0RA 1RB0A 1LW2A 4MK7A 4CH0S 3TAQA 2B43A 1FRKA 1LW2B 3KJVA 2XCAA 3NNCA 4DV0F 2ZH4A 4FVMA 1HBOA 2D7SA 2JOQA 4M5MA 4IO9Q 2DY1A 2IRUA 3J7AN 4KH0B 1HWLA 3T6JA 4DQPA 3KJQB 4I4BA 4GO7X 3CE8A 3HSGA 3QMQA 4UQGA 2CQ0A 2QFIA 4X4QA 2QA1A 3HT3A 4CLWA 4FP9A 3CJKA 3LP1B 1G7CB 3ENQA 5F0WA 3VZIA 3SQGA 5KFJA 2GMHA 3QWUA 4H4OB 5GAHU 2BQRA 3UCUP 5JXSA 4ZPDA 3PKYA 5E3RA 4KHMA 1HBUA 1WEXA 3O5TB 3TA2A 5IV4A 5L1IA 3GJSB 2YNIA 1QD1A 3NGTA 4NL5A 4BHQA 2E1RA 2ZWPA 1JIHA 3SXLA 5L9NA 3QJJA 1YG0A 3SCJE 2XMMA 4DR6J 2UU9J 4LR8A 1DBDA 5DJBA 2Y0SD 2R7VA 1DRZA 1UJ5A 5CH7B 2BRLA 2YH0A 1RT5A 2LQ5A 2VFVA 1RWKB 1PAEX 2HNYA 1KSPA 1E6YB 1JKHB 2B9WA 2VDIA 3T1HJ 3K5PA 4MIBA 1Y5NB 2B56A 2GHVC 3IR6B 4PG7A 2V4RA 4NXMJ 1HYSA 1NAQA 4HACB 5F8MA 3Q8VA 1ZM9A 1JJ2R 2OLWA 3CD0A 4C6AA 5F3TA 4NMXA 4B3RF 1JJHA 2VZ9A 1KS2A 1VK3A 3P8BB 2XS7A 2BJ1A 1WC6A 2E5HA 3FBCA 5F8JA 3PIPQ 3KLFA 4FNHA 2KRRA 2HNDA 2MTLA 3DDNA 3TJ9A 5L1KA 5M2RA 4F4ZA 1S48A 1KFDA 1NLKL 1TVRA 2P6TA 3Q89A 5FIIA 1HNWF 4ICLB 3H59A 4LMZA 3PYEA 3A13A 1F0XA 1A6LA 4ECSA 3W7BA 4LF9J 4Q8FA 1S10A 2XNQA 2B4UA 5H9EJ 1K44A 3VGVA 1YKWA 2Y1JA 3ISZA 2Z2LA 3L7OA 3TVKA 3QJPA 1IR0A 1NDPA 1WKLA 4F26A 5EWGA 3KHLA 4K5SA 1WHXA 2AEMA 3KTQA 1QLNA 3IMQJ 2EBGA 2PEBA 1IKWB 3CNQP 4EMDA 3UNGC 2DGQA 1N6QB 1Z1ZA 1LFWA 2IPOB 2KHDA 4EEYA 1NKCA 2DO4A 5D3GA 1RT4A 1FJGJ 3MM7A 3OFHA 4JOUA 1CULB 4I2PA 2ZH8A 4QPXA 3MM7B 4LFCJ 4RNOA 2MEWA 2UXDJ 4ALZA 5C24B 1KNZA 4BWMA 1RLDA 1D3WA 4FXWA 1NB7A 1PCAA 4DQRA 1HWJA 3NBPA 3M8YA 3N01A 2W2MP 2A6OA 3R97A 2FY8A 1TUGB 5KT7A 4B9NA 2AQ4A 4IQXA 3A12A 1R7IA 2BW7A 4ENOA 4J9PA 1Y11A 2ROGA 1M5SA 2RD5C 4ZMMA 1X5SA 3BYRA 3QGHA 1RT2B 4UOCA 3GFHA 4RZRA 1J5OA 2LQ9A 2KFZA 4DV6J 4FYWB 3TOQA 3VAHA 2A2DA 1PAUB 2DNHA 2K7JA 1PBUA 1T3OA 4OHZA 5HMYA 2UXCJ 1TFYA 1MSWD 4ED7A 1T9YA 1X7VA 3BGLA 2KI2A 2JZ5A 4DR6F 4DDFA 1T7PA 4LF6J 1HNIA 3M1VB 3NEKA 2CWXA 4M5JA 2XMUA 3LF0A 1UW9A 2ACMA 2FLOA 2IBOA 4J90A 4U8YA 3K8WA 2ZH5A 1SKWA 1HWUA 4ZJQA 2H51B 1R0AB 1F3FA 4FN5A 1VGYA 1RP5A 2KKHA 3LALA 4WPAA 3EX7B 2AJ1A 4X64J 1QVGR 2W1BA 3CCWA 3JXOA 1RXOB 4OX9F 4MK8A 5KFWA 3HPOA 2BR0A 1BUXA 3OW2R 5J2NA 4EYIB 2HFOA 2CNKB 1U2FA 5LM7E 3M2RB 1WEZA 3WC0A 4CLFA 2IC3A 3M2RA 4IRDA 2BXJA 3W62A 1C4AA 3WX4A 1Y7PA 2IC3B 4RBTA 5GMKa 4JI1F 3W2WB 3J7YU 5E3CA 5HMWA 2DGWA 1KEKA 1G2EA 3TO8A 3PZPA 4FS1A 1H98A 4ED5A 1AFJA 4IR9A 3KK3B 1S9GA 1DQ8A 1S9GB 1KKHA 1U0HA 1M0SA 3IR7B 3P3DA 2E44A 5E0OA 4B02A 1TK8A 1RWUA 3S8SA 3BQ1A 3JSYA 2J76E 1CSJA 4U8VA 2K1RA 3U1NA 3UW1A 4EZ9A 3UO0A 3X1LB 4FKYA 2I0XA 1X31C 2H5EA 3MMAB 3V6JA 3SSQA 3D5MA 1B0TA 2WVBA 1DTTA 2YNFA 1RYRA 1BE4A 1JLEB 2H5JB 3US5A 4ED1A 3D6MB 3BDPA 2HNZA 1CS4A 2OKQA 3GV8B 2RQMA 5KTQA 4G3IA 5GAEU 4DG1B 5J2QA 2CVEA 2VFRA 2WZ1A 3LGNA 1GTHA 4PKDB 2XMAA 4K4YA 5J2QB 2AV5A 3MTKA 2D9OA 2E7XA 1UPMB 2CQGA 1RKJA 1IWAA 3M2UB 1NSQA 3RG6A 4K2XA 3OR1B 2EW9A 2HHTA 2QTWA 2ZH6A 4ECXA 3AT1B 3ICLA 1H74A 8RUCA 2U1AA 3H5UA 5HVFA 3UCGA 4ZPBA 4DZDA 3Q23A 2ZDPA 1IN0A 4L74A 4OYMA 4I6YA 3RAMA 2O3DA 2HHHJ 3KXDA 2PI5A 3F44A 4AL7A 3NY0A 2DNZA 4P52A 4YB5A 4DR7F 1DFDA 1YZ7A 3J7YI 1DY3A 3H90A 4TU7A 1VC0A 2ZZMA 2YPYA 5J1EA 4MYUA 4HHHA 3S1TA 2DIUA 3NG8A 4RUAA 1YIJS 1KD1T 2QV6A 1LWEA 2EVZA 2MKYA 2RQ4A 2V68A 3BF4A 5HJXA 5K14B 2GHPA 4I56A 4AD6A 4GC6A 3TAPA 4C8KA 2Q66A 4ZS6A 1MU2A 3SMZA 5GADU 4FF4A 1KHVA 1BY9A 3MPVA 3OUYA 3W2VB 1X9WA 3QIPA 4OLPA 1RAFB 4PYDA 3UI3A 1J5EJ 4OX9J 3R1HA 4C3MA 4Y28C 2AW0A 3NS7B 2QRRA 1HD0A 2VPXB 4F0KA 2N7YA 2OO4A 2DTJA 4Q0BA 1F5CA 1U26A 4HH0A 3R7BB 3KLHA 3C6UA 3DHXA 3C46A 4Y2MA 4KT0C 5IM0B 2XSJA 1N33F 2GW8A 1F6TA 1QSSA 2MB0B 2V9KA 2XSJB 2B9EA 4RNHA 4DPWA 4ELTA 5F8LA 4XPCA 1RWMB 4ED8A 5CQGA 1A7GE 3MCOA 2J0XA 1Y0HA 3OSPA 2ZD1A 4Q45A 1QE1B 3CCSS 2DR8A 2UUBF 4C8NA 2ZD1B 3UDEA 3D6TB 1N56A 5HAOA 1ZM4A 1U1LA 4F4KA 4ZCLA 3LP0B 2QLXA 2RDDA 2HHWA 3G6YA 4J7CA 1RHUB 2MSTA 3RW6A 3MEDA 2K3KA 3OJUA 1CJVA 1T8EA 4HHUA 1YJNS 5K5MA 2W9BA 2FIUA 3NCPA 3DHWC 2C42A 4LJMA 5ETVA 3HVRA 2RILA 2GIQA 3GYGA 4WP9A 3TR5A 1FNOA 2AMCB 3AA8A 5G0RB 1HR0F 1EETA 1YRXA 4BS2A 1WF0A 1LNQA 3EGWB 4K2JA 1REGX 2C1EB 4YB7A 3DGPA 1TP7A 1BQXA 4KGVB 5KFRA 5KG0A 4CLTA 5KG2A 2R8GA 3MI7X 3LOUA 5KG7A 1VBYA 3IS9B 1DURA 4QU6A 2BOPA 1WNEA 1B0PA 5FDLA 3M8ZA 1A9NB 1HNVA 4DR2F 1HMVB 2AYEA 5LMUF 3QAEA 4HEA9 2CA9A 2FHOB 4NRTA 3MFHA 3LW5C 5J2MA 3M30A 4F04B 4Z37A 4LSLB 4KGZB 5A0YB 3GILA 2XHCA 3VALA 3PX4A 3M05A 3TUIC 1S1VA 3P6YC 1RACB 1HHQA 5EX3A 5LL6d 1YJWS 2RU9A 1U6BA 3NWRA 2F4FA 3GYXB 3ZFVA 1SC1B 4Y34A 5D77A 3H98A 2XMWA 2W9AA 3KDNA 1JXVA 4WJBA 5HLFB 1VC5A 2ZOGA 2JJ4D 1NSPA 3PW7A 2ASDA 2C2EA 2YKMB 2QN6B 2VH7A 3Q86A 1LV5A 2N4DA 3KYLA 1OPZA 2DCUB 1KWMA 2ZBCA 3PFEA 3BN4A 1S9EB 4TY9A 2KDOA 2W9CB 2DNYA 4DN9A 1AB8A 2DISA 4ECVA 2VA3A 4F0HA 2FC9A 4NLYA 2J8AA 2LXIA 2MXYA 5CZXA 1SJ1A 7FDRA 4F8RA 1QSYA 2VJUA 4Q8EA 1SXLA 2F9JA 1R3NA 2A1BA 2M2BA 3GIJA 4FYDA 4OMFG 1YSJA 4ZP6A 3N5FA 1N33J 1AW0A 2UUTA 1U45A 3ZC4A 4EWTA 2OGUA 4JI5F 3IXQA 4QIFA 2MZ1A 2XWXA 4DR7J 3JYTA 2KXFA 3N5BA 5HSPA 1YITS 2RKIB 4ZJLA 2RKIA 4QPTA 1XJWB 1R6VA 3HVTA 5T7LA 3GIIA 2DEIA 1TUVA 1VHFA 3FC9A 2KVIA 3DLGB 3M32A 1R31A 4P71A 4ETXA 3M32B 4UOGA 3LH2S 4M94A 1FVSA 2MQNA 1FKAF 5BYQA 1UJ6A 3B4DA 3PM9A 2UVWA 4IG3A 5ETKA 2XLIA 2C2NA 4IG0B 5BJRA 2YX4A 4K4VA 2NUHA 2CJ9A 1GMWD 1GAOA 1S57A 1DHMA 2CPEA 2XSFA 2QC3A 3FEYB 4OJ3A 3WQPA 4CYUA 3LWLA 3PW0A 1OWXA 5ETTA 5BXIA 1HBUB 3T5JA 4OYBA 4LSNA 3OFEA 2D3OR 4DMZA 3ZTSA 2M70A 2B6AB 1S5ZA 2Z2MA 1TMMA 1W26A 5LJ5Y 2QMXA 3ZXWA 1RYSA 2OEMA 1R6YA 2LQBA 2V8HA 4N5SA 3M6VA 4PCQA 3K5NA 3PX6A 5C2GA 3OVBA 3GCWP 5C25A 4NLXA 5J1NA 5GAHI 2CADA 1FNMA 5C25B 4P2MA 4DU8A 1X8DA 5KFLA 2HFNA 2ZOFA 4C11A 3GWCA 4ZPVR 3KK2B 2JEFA 2VG6A 3CC7S 1TK5A 2IA0A 1F5AA 3PY8A 5A8RA 3HVWA 3G82B 3CIZA 4EO6A 1NK7A 4DV0J 2RQCA 1LOUA 3TP2A 3CTRA 5KOWA 1X4EA 2VHGA 4MIWA 2MGZB 3NS6A 2HBRB 1FF2A 3MURP 2HRUA 2Q3PA 3ADAC 1H38A 1VYAA 4CLZA 1SKSA 4ZVPB 4N8OA 4ELUA 2DBBA 4R8UB 5M2PA 3PR5B 3BH6B 4QIVA 2E9TA 6AT1B 4F2SA 2MLZA 3HZGA 1M5PC 4X4OA 1TKDA 2D3UA 2EK6A 2ASJA 3MECB 4QYZK 1UL3A 3B6BA 1Y9OA 2ZZNA 1M1GA 2B4PA 1X4BA 2CPZA 2EK1A 2XTJP 5DS7A 2UXBF 3QLHB 1NXIA 2HW3A 3CB4A 1X4HA 2EKNA 1SJQA 2CQCA 4NLTA 4WIQA 4P10A 3CPWR 1HI0P 1WC4A 3QFWA 2W4PA 4A8SA 5DG7A 3W65A 1BWEA 1S97A 1CPZA 2UXCF 2IYGA 1I3OB 2YKAA 5DQGA 4ECUA 2UVRA 4JI0J 2IBKA 2CQHA 3CCVS 3MMCA 2MKHA 3BZQA 4O4RA 2I6WA 4K4TA 3MMCB 4FZVA 2R2SA 3I0SA 4L73A 2CJYB 1EQ0A 4IQMA 3SEOA 3E01A 1BGXT 3E01B 1JXLA 3RW7A 3ITHB 4OI1A 1HBNA 2CQ4A 1UZHA 3FZ2A 2ZITA 3WIVA 1MWZA 3NKYA 2XNRA 3EUNA 1OO0B 1UAWA 2PN6A 3NLCA 4M63A 4P2FA 2YNGA 4J5OA 4CLLA 2J9EA 2R2UA 1VLOA 3CCQS 4X62F 3HVAA 3K89A 4A8WA 4G1IA 2I38A 2BE9B 3NS5A 1S0MA 2XY5A 3GLJA 3EXYA 1VRUB 1VK8A 5DM7Q 2HFSA 1D9FA 1AROP 3CVKA 1R0BG 4TY8A 2BDPA 2Y8YA 1CJTA 4Y2CA 1KFSA 4TY8B 4ZCMA 3NMRA 5EWEA 3M8SA 3BKFA 5DGAA 5D4PA 1LW0B 1UWAA 3G6VA 4K0KJ 2DPIA 5E5NA 2VJVA 3I32A 2GO8A 1C0UB 3HMJG 1CJKA 1VRTA 3MUTP 4FYYB 4PWDB 3JAMY 2WK4A 2EFQA 2ALZA 1C0TA 2UVVA 3B54A 4V19X 2YKQA 5LSOA 1UCNA 1Q7LB 1N88A 2IHR1 4QR1A 2ZH1A 2W2QP 2ROPA 4MKAA 4BWJA 2VBZA 5KFOA 3CJ0A 5THWA 3TYTA 4ECZA 3D0IE 1I94J 4FF2A 2R7XA 4NI2B 1DAXA 1FRXA 2G0IA 3PYGA 3G6XA 4LBPA 3V2UC 1HNWJ 4V19J 3BH7B 4Y6IA 4YFUA 1N8RT 3QSYB 4EZ6A 2G4BA 4O4GB 2NYHA 4O4GA 5IT9U 5F8HA 1CJUB 1HW8A 1T9TA 3FRZA 3MR3A 5KFQA 1U09A 3JSRA 3HKWA 3OD2A 1Q5YA 5L8RC 2B4VA 5KFPA 3K59A 4ZVSB 3S7RA 4X4PA 1RTDA 2HVHA 1VQ4S 2DGTA 2ZE2B 2DH8A 2KYXA 4I7FA 1Y5IB 4K4XA 1N5QA 5HP1B 2EC0A 4WZMA 2FPHX 1YRTA 3E8OA 3FSYA 3CJ2A 2CPYA 4DQSA 3PW5A 5HL7Q 1S77D 2V6AA 1ROFA 1S1XB 5A76A 4IYQA 4KQZA 1M5VC 4LRFA 5FLXY 1DTTB 2RF2B 2J9DE 5KFEA 1G6BA 4CLSA 1WTBA 1QUVA 2HQGA 2Y0BB 4I69A 3H7HB 3AA9A 2YTCA 4WFNQ 2PMZD 3PYFA 2E1MC 2XZWA 1IVZA 1UA1A 1Q16B 1FKOB 1OSCA 2BANB 1IXKA 5LSRA 1HPZA 4DV3J 2HVZA 3QWPA 4LVNP 1NK0A 3D0HE 3OBIA 1YK9A 1FK9A 2B8PA 3ILLA 1R8CA 2DGUA 3EM1A 3THTA 4DOZA 1TL4A 5KFFA 1XMOF 1QAJA 4KHPF 3VQTA 3MOZA 4DBQA 2WSEC 2MLYA 4NLVA 2DY9A 1NJWA 2GMLA 5D4OA 4LFBJ 4UOFA 2V0NA 1T95A 2W2NP 1UVIA 3KNGA 3OFGA 3UD4P 2XG8A 2OPSA 1GTEA 1HQ2A 3F73A 1T9VA 4ECRA 3GP9A 4P74A 1WDDA 2Y1IA 1XNRJ 1XERA 2ZVSA 3FNNA 2MZTA 1FHTA 3N0VA 1MROA 3FCHA 3MAAA 4AXJA 4ID5A 5HBMA 5A8KA 3CF5Q 3RB6A 1SC6A 1SIZA 4KYZA 3LPYA 4PPDA 2R7WA 3U27A 3RB0A 1M5KC 3KJFB 2HG4A 4J9RA 3CCLS 4HH1A 2HHPA 1U8SA 1QUPA 3DU5A 1IKVB 3OFFA 4J9QA 4DWIA 3DNCA 5KFUA 3W2VA 2B9XA 1R8PA 3ZZUA 2Z2YB 4DL0C 5IT0A 1S1WB 2IYIA 4DUZF 4N76A 4DR3J 1FDNA 1X4AA 3VGTA 4ED4A 4ID8A 5F0UA 2E1AA 4K5RA 2GC8A 1ZAXA 4B3MJ 4DV6F 1FWKA 2MQMA 4H4OA 1GMUA 4DV4F 1FD8A 2BV3A 2OPPB 1JWWA 3CJ4A 2XGPA 2MKJA 2AJFE 4CRJA 4X4RA 4C8LA 4LSZB 4DUTA 2FJVA 4CCHA 1B99A 4ZVRB 1SUQA 2G2ZA 4PXBA 5EDWA 2JC0A 3RUBL 3TX8A 2M9KA 3QPIA 4OX7A 3IR5B 3FMBA 5KAKA 1YRUA 1FKPA 2K3IA 4NPOA 2FJWA 2ADBA 1T9XA 3M4XA 3KLIB 4DL4A 1FJ7A 3BEGB 4DL2A 1V5VA 1KONA 5CYMB 1S6PB 4PG8A 1RBOB 4DL5A 2YWFA 3POTB 3TJ8A 2ILYA 2LXUA 1E6YA 1JKHA 1PIEA 1VLYA 3AB2B 3QO9B 3ET6A 4ZN1A 1YWXA 1HNXF 2FJXA 2RB7A 1Q5VA 3DDIA 2YQ1A 4USUA 2HHUA 1FESA 1SBRA 4OZJA 5ETQA 2V4JB 2W9BB 2E9ZA 3VQSA 1S6QA 1EP4A 4O3QA 3UDLA 2Y3YA 5K20B 3JSMB 3QGIA 2D74B 4HDHA 3CCZA 4C8OA 3Q8RB 4B08A 3BGOP 5ETSA 2B51A 2ZH7A 2VODA 3UCZP 4OHYA 2EFVA 5ETNA 2YWGA 4C97A 4LF9F 5D4LA 1UFWA 3GFXA 4EBCA 1FTRA 4PG4A 4PWWA 3ISNC 4NCGA 2C2OB 2CIMA 4NCGB 3AXKA 1WHWA 3HCXA 4ETZA 1XEZA 1S6UA 3BGUA 1OIAA 3N6NA 4Y2IA 4DPUA 1KRPA 3DYAA 3P49B 1Y5LB 1HI1A 1HW9A 3R5BA 5A0YA 4NLQA 1RT3B 2XO6A 1NKEA 1AT1B 2A0FB 1S1VB 1RT6A 2BE2A 2RJZA 2RT3A 3Q8YA 1M5OC 3CD6S 1TKTA 2GX8A 1IBLF 2FVSA 4E0DA 1O5JA 2R7TA 3OLAA 1ZS6A 5J2PA 1L3VA 1BQMA 3HHLC 5KFIA 4ZLNA 4IKAA 5L46A 2PGCA 5J2PB 2ZH3A 3IG1A 4YR0A 3CCUS 4JI7J 3CDBA 5A8WB 1JXEA 3OHAA 2J0QD 4RNMA 2DYAA 2UZAA 4B9TA 3NCQA 1FRHA 1VQKS 2YKOA 1NMEB 4QR0A 4ITSA 3CCTA 3WBZA 1S12A 4I1TA 4NYPA 3M9MB 4JV1A 3TEHB 2EPIA 1I51B 3C16A 2FLPA 4ZPCA 2UV8A 1VFJA 1WD6A 4IOAQ 3SFGA 2C3MA 1QY7A 3DOLB 1FRIA 3GIRA 2HGLA 2QIFA 4WXOA 2KJWA 3T5HA 2E5LF 1XMQF 2DR6A 2KB2A 1F2HA 4OYWA 2C3UA 1Y10A 2DXFA 4CM0A 2LEPA 3MDFA 1HARA 1LEOA 1XR7A 3IWXA 1N32F 3HDSA 2HFVA 2YNHB 2I9SA 2IA6A 4KKOB 2AEJA 3S6EA 1U4BA 3OTBA 3C3LA 2HYIB 1RAAB 4Z2XA 2DIVA 4P75A 2ZNYA 4DR1F 2QE5A 2VPWB 4RNFA 5AE3A 1RHRB 1GXUA 2G1HA 4MH8A 2BJDA 4DPXA 5LXRA 2UUWA 1VQ5S 3KMQA 4F02A 3FBEA 4U7CA 1XMBA 1SL1A 2OJ3A 4B9VA 1H6KX 4OIXA 4ZVUB 4N41A 2V2ZA 2YBVA 4ZHRA 3HXMA 1URNA 2ZC4A 5IT9Y 1EKSA 1QM9A 3V6HA 4HR2A 1B7YB 1WC5A 4UW2A 3H4BA 3PG9A 1VQPS 1GFWB 2VC1A 1PYOB 2BJ9A 3A8JA 1FI4A 2VPZB 4ICLA 2CQBA 1Q82T 2CUYA 2E5IA 1F9HA 3DC2A 3L7UA 1CC8A 2VPYB 1NM2A 2WVEA 3VV2B 3D3CJ 3K17A 3L3CA 2E1CA 1BQNA 1DJ0A 2HEKA 2R4FA 5HANA 1NK6A 4TNOA 1QTMA 1RSCA 3KMSA 3ZZZA 4F4XA 1S0NA 3IA0A 2V94A 1WJ9A 4RKUC 2OPRB 4A8YA 1YJ7A 4LBIA 4PG6A 4OHVA 2OPRA 3OTDA 4ZVFA 1RT1A 2VF3A 1JJ4A 3CC4S 2DR7A 1VS3A 3OV7A 3EGVA 2J6TA 4C3LA 1VQ6S 1X0FA 2NYIA 3UE2A 1S59A 4JB8B 4C0HA 3ENVA 4IFYB 5IQ6A 3HO1A 3W8PA 1RLCL 2N3LA 1TL3B 3C14A 4ERDA 3SCKE 3H2UB 4QR2A 1U8WA 4K59A 4PYAA 2JEGA 2AGQA 1PC4A 5C42B 3MAQA 2R7UA 1FEEA 4K4SA 4JI3J 1NDKA 3FVYA 4O3NA 5IV3A 3H40A 1U7LA 2R8JA 1PGZA 3W64A 3PV8A 2LLZA 1U24A 5L38A 1TZ0A 2OEJA 2B7CB 5E41A 5KT6A 4MMOA 3IM8A 3BBBA 3SZ2A 1F9EB 1UJ4A 5AXLA 4NLPA 4ES2A 5FD1A 3KLVA 4OI4A 3KK1B 4FDFA 2PO4A 3TQ1A 2P2CB 4USIA 2W2OP 3C15A 3GV7B 3QGPA 5RUBA 1ZH5A 3H5XA 3FEXB 5A2QY 2XO7A 1ZTTA 1K73T 5HK4A 3M1VA 5D3GB 1WF2A 1HFEL 5LSLA 3BJYA 1N5VA 3D66A 3BGFA 2ZBIA 4WYLA 2I5JB 5E3PA 2GVDA 3UPFA 2WVDA 2VQEF 4FPRA 5KFMA 1WG5A 2GVDB 4B9SA 1D8YA 2XLKA 3UN5A 1NK5A 3F41A 4PWUA 1ZAVA 1T9WA 2GHWA 2IDEA 3LA0A 3P5TL 1ZOTA 2LYVA 3RRKA 1TL5A 3QIPB 1UZDA 3EYZA 3KOAA 3UWTA 1NUEA 2FJAB 5CD4H 3ZTOA 3PJXA 5E7OB 2X1AA 1TFWA 3I55S 5D0GA 5KFGA 3Q2SC 3IBFB 4USKA 2OFGX 2QSWA 2ROEA 1JLQA 3A8IA 3HHDA 4O3PA 3GQCA 2AGOA 4WIIA 1CQMA 1HQEB 2HZCA 4OZNA 4HTJA 3RBZA 5KFCA 1SL0A 4JI3F 1HD1A 2RQKA 2GIFA 2BKPA 3OL6A 2FJBB 1MWQA 1VHIA 3FFIA 1CEZA 1N5YA 1YHQS 4TXSA 4QYRA 1IJFB 2R8KA 2P9CA 3DRRA 2HAFA 3EVWA 4B17A 1BLUA 4CI0B 3I56S 3DLLQ 1VRTB 4LFCF 4OV1A 4UY85 4NEYA 1EB0A 3DLJA 1RDRA 4JUZA 4RU9A 2EC2A 3G87A 4DXLA 1U1KA 2WBRA 3GONA 4O44A 2FZGB 2XI2A 3AJ2A 3EDRB 2QA4G 3CMES 2XY7A 1H72C 1QAYA 3I96A 3JSBA 3OTEA 5EGYA 4DL6A 1HNXJ 1IBMF 2DR5A 3ILJA 1ZZFA 1YBTA 1JNRB 1UPPA 4USMA 2ZJPQ 3PVXA 5K8NA 3SIPB 3TANA 5JVGQ 3TX0A 2IJRA 1WSVA 3OT9A 4H4MA 1K8AT 3OR1A 3H0PA 3H8YA 4MKVA 1V6HA 4CO0A 4RW7A 1N34J 3PRVA 3UR3C 3VGSA 1RTHB 2FJDB 1R27B 1U0HB 4X66J 1X4GA 1S9FA 4HVZA 3J7ZT 4B3TJ 3LTOA 3C8YA 5DQIA 3NGKA 5DZ6A 1K47A 4ZCIA 1T02A 3D54A 2N82B 4DSLA 5C7PA 2KH9A 1DTQA 1HQUB 2FHKA
chains in the Genus database with same CATH topology
4OYPA 5IV4A 3UVJB 4P2FA 4CLPA 4CLLA 4WP8A 4OYIA 1CULA 1CS4A 1WC3A 1AB8A 5D0EA 1CJTA 2WZ1A 3C14A 3C16B 3ET6A 1CS4B 1CJKA 1CJVB 4USUA 3MR7A 1WC6A 5IV3A 4OYMA 4OZ2A 4NI2B 1AZSA 4CLUA 1AZSB 1FX2A 2GVZA 3C15A 3MAAB 1CJUB 4NI2A 2QV6A 2GVDA 1WC0A 2GVZB 2W01A 2GVDB 1FX4A 1CULB 4OYBA 1CJTB 4OYAA 5D15A 5D0GA 1TL7A 3UVJA 4CLSA 1TL7B 4P2MA 2BW7A 1Y11A 4OYXA 5D0RA 1WC1A 3G82B 4WP3A 3C16A 4OZ3A 1YK9A 3R5GA 4CLKA 1YBUA 4CM0A 4OYWA 1Y10A 3C14B 3C15B 4CLZA 3G82A 1CJKB 4USWA 1CJVA 5D0HA 4WP9A 1YBTA 4WPAA 3ET6B 3MAAA 4CLYA 1CJUA 4CLTA 1WC4A 4USVA 1WC5A 4CLFA 4P2XA 1U0HB 4CLWA 4OYZA 4CM2A 4USTA 1U0HA 4OYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYP A;  5IV4 A;  3UVJ B;  4P2F A;  4CLP A;  4CLL A;  4WP8 A;  4OYI A;  1CUL A;  1CS4 A;  1WC3 A;  1AB8 A;  5D0E A;  1CJT A;  2WZ1 A;  3C14 A;  3C16 B;  3ET6 A;  1CS4 B;  1CJK A;  1CJV B;  4USU A;  3MR7 A;  1WC6 A;  5IV3 A;  4OYM A;  4OZ2 A;  4NI2 B;  1AZS A;  4CLU A;  1AZS B;  1FX2 A;  2GVZ A;  3C15 A;  3MAA B;  1CJU B;  4NI2 A;  2QV6 A;  2GVD A;  1WC0 A;  2GVZ B;  2W01 A;  2GVD B;  1FX4 A;  1CUL B;  4OYB A;  1CJT B;  4OYA A;  5D15 A;  5D0G A;  1TL7 A;  3UVJ A;  4CLS A;  1TL7 B;  4P2M A;  2BW7 A;  1Y11 A;  4OYX A;  5D0R A;  1WC1 A;  3G82 B;  4WP3 A;  3C16 A;  4OZ3 A;  1YK9 A;  3R5G A;  4CLK A;  1YBU A;  4CM0 A;  4OYW A;  1Y10 A;  3C14 B;  3C15 B;  4CLZ A;  3G82 A;  1CJK B;  4USW A;  1CJV A;  5D0H A;  4WP9 A;  1YBT A;  4WPA A;  3ET6 B;  3MAA A;  4CLY A;  1CJU A;  4CLT A;  1WC4 A;  4USV A;  1WC5 A;  4CLF A;  4P2X A;  1U0H B;  4CLW A;  4OYZ A;  4CM2 A;  4UST A;  1U0H A;  4OYO A; 
#chains in the Genus database with same CATH topology
 1RAI B;  3MPD A;  3MGJ A;  3ZO7 A;  5EUH A;  2FZK B;  3R9L A;  3R7N B;  4WWS A;  3D3B J;  2XHW A;  4KR0 B;  3EZU A;  5MAO A;  1Q8I A;  3A8K A;  2JC1 A;  3GZ7 A;  3M8R A;  1GK8 A;  4EBD A;  3CCE S;  4JI1 J;  4KHP J;  4QIW D;  2IAJ A;  2P8I A;  2GIR A;  3DOM A;  3LAK A;  4ZJO A;  1RKI A;  4GVB B;  1ZBT A;  4U6P A;  1VQ9 S;  3THP A;  1C2P A;  1A0O B;  4RX6 A;  4RW4 A;  8AT1 B;  4X2B A;  1ACM B;  3DRY A;  2UUC J;  1Q86 T;  3PRB A;  1JLB B;  2F9D A;  5SZT A;  3FKB A;  2XQC A;  2GZO A;  4M5H A;  3MEG A;  3TNV A;  4JI5 J;  4X4U A;  3RZA A;  4R5P A;  4JI6 J;  3BR9 A;  5LMN F;  4D3H A;  1OY6 A;  4NE9 C;  3LP2 A;  1C4C A;  1LWX A;  1V9O A;  3NXZ A;  4OI6 A;  3UR0 A;  1VQO S;  2MZJ A;  2OAU A;  4TU9 A;  2JEI A;  4IFV B;  5B0C A;  4WZQ A;  4IFV A;  2M4M A;  1WG4 A;  4QIG A;  4J37 A;  2D41 A;  2RVJ A;  2ZBP A;  2QMW A;  3I5C A;  5B0A A;  4DPY A;  2GQQ A;  2AZ3 A;  1F5B A;  2GVZ A;  2HK2 A;  2VA2 A;  1MU2 B;  3HVT B;  3HK2 A;  2DJW A;  1E6V A;  2BRK A;  2DHA A;  2NXN A;  4NLO A;  1U25 A;  4ECY A;  1H7X A;  5I3U A;  2VG5 A;  4LRE A;  1XR6 A;  1SIW B;  2R7R A;  1SV5 A;  2W01 A;  4YB1 P;  2R9L A;  4KHR A;  3HD2 A;  2GGP B;  3IWL A;  1EET B;  1G4C A;  2CVI A;  2MHN A;  1B4S A;  1F60 B;  3LP1 A;  3WIU A;  4J9M A;  2C2R A;  4JYA F;  1N34 F;  2GCF A;  3DOK A;  1MWY A;  2F7V A;  2H4Y B;  3V4M A;  2GAH C;  3VVT A;  3BO4 A;  3HFK A;  1AXQ A;  1U02 A;  4LSN B;  5HJY A;  3GSI A;  2O1P A;  4LR9 A;  5AE2 A;  4O0I A;  2V2Q A;  2RAQ A;  4OJ1 A;  5D15 A;  1U2R A;  3OL7 A;  2UUA F;  3U1L A;  4DHV A;  1LXN A;  5FJ4 A;  3TUZ C;  1TL7 A;  1WAC A;  3AOD A;  1C1B B;  3D0G E;  5AXK A;  1P27 B;  1TL7 B;  3UVJ A;  1NJX A;  1CVJ A;  1P8G A;  3KLI A;  3LGM A;  4EFA C;  2W7P A;  1QTN B;  4K0K F;  5H9F K;  4DZ6 A;  1TK0 A;  3KLE A;  4DPO A;  1I5O B;  1RT5 B;  2PEH A;  4X4V A;  1YJ9 S;  1U1O A;  4Q44 A;  4KGX B;  4N77 A;  4OYX A;  5KG4 A;  2HHX A;  4UTG A;  4FBU A;  2CDQ A;  3KNA A;  4F2R A;  4GO5 X;  4ZOS A;  1YQH A;  3FQK A;  5K8M A;  3DM2 B;  3FDS A;  3MEE A;  3R5G A;  5DZ7 A;  4HLB A;  3MM6 B;  4QQB A;  2CPH A;  6FDR A;  1NBE B;  4QW8 A;  2WON B;  3BGR B;  2NPI A;  4X62 J;  2B9Y A;  5G0R A;  4JI7 F;  3MMJ A;  2NUU G;  3I9Z A;  1M1H A;  4ZVE A;  5HQ8 A;  1VQL S;  3B8H A;  3T5K A;  3DRP B;  2DK2 A;  4AND A;  2MKI A;  2PDA A;  2Y1L B;  2ZKT A;  1HA1 A;  3OR2 A;  2AP6 A;  4JP8 A;  4PXC A;  4ZP9 A;  4F4Y A;  1T9U A;  4ZVH A;  3MAH A;  3D1H A;  4OZL A;  2RUG A;  3AD8 C;  3GG1 A;  2PMW A;  2XMT A;  3EGZ A;  4PUO A;  1FCA A;  3FK4 A;  4TVA B;  3EZ5 A;  3MTJ A;  3E3X A;  4JI0 F;  1H0H B;  3CDE A;  1N36 J;  4BBY A;  1B64 A;  2AX1 A;  4RPF A;  4EUV A;  3JYT B;  5K8P A;  3WC2 A;  5F9L A;  2MQO A;  1RIS A;  2L9N A;  2OUG A;  2L41 A;  2EXU A;  2VBX A;  2F40 A;  5KFY A;  1Q1K A;  3OLB A;  1UEU A;  1QVF R;  2V9W A;  2QL9 B;  3W8G A;  4CT9 A;  1LWC B;  3FUY A;  2ZVI A;  2L48 A;  1LWC A;  2QL5 B;  4EYH B;  1P9Q C;  1FFS B;  3RU0 A;  1JLG A;  1JLC A;  4B3M F;  3MUV P;  2W9C A;  4JI8 J;  1T94 A;  2CQ1 A;  2E5J A;  3W3S A;  4UQT A;  4DQI A;  3K0J A;  2IMO A;  3ILO A;  3TA1 A;  4I2Q B;  4DSK A;  1X5T A;  2BEF A;  4RW6 A;  1DAR A;  1JLF A;  5HO4 A;  3R1L A;  1S49 A;  3PTW A;  4NYZ A;  1NH7 A;  2CJA A;  2CNN B;  1U2C A;  2IJN A;  2XMV A;  5K9F A;  5HQM A;  1LXJ A;  2FZC B;  2BJ7 A;  4XDC A;  3W61 A;  2ATC B;  5B0E A;  2F4V J;  1UP1 A;  5L9X A;  4OX6 A;  2EG2 A;  4LF8 J;  2UXB J;  2J9C A;  3BSC A;  3A4T A;  4NML A;  2R8H A;  3PJ9 A;  4FNI A;  4L72 B;  1RWP B;  4YR2 A;  2IFX A;  3I9V 9;  4NEZ A;  3OSN A;  1L5U A;  2X1B A;  1HNI B;  4FKX A;  1IJE B;  1TAQ A;  2HMI B;  4CNY A;  4EO8 A;  5I3Q A;  2W8L A;  2HMI A;  2WAQ D;  1SH3 A;  1Z2L A;  3Q8P B;  4K4Z A;  2NCK L;  4WFX A;  2V50 A;  1EKR A;  3L4B C;  4LR7 A;  1Q8K A;  4LRB A;  2J0W A;  5CAA A;  2YPZ A;  1W2B R;  1ZA1 B;  2RE1 A;  2V8G A;  4PQA A;  3EMT A;  1APS A;  2QLJ B;  1R8A A;  4WE1 B;  1KDN A;  1KTV A;  2NR0 A;  4K4W A;  1NJI T;  1S1T A;  1G1X A;  1LWF A;  4WKY A;  3ZZT A;  1UTA A;  4USJ C;  4KTQ A;  3Q2T C;  4ILL A;  4TYA A;  3ENW A;  2UVU A;  2IM2 A;  1VR6 A;  2DD8 S;  3W2W A;  1FFG B;  2G9O A;  2MZS A;  2DNR A;  1RZM A;  2DNM A;  1WKK A;  2F5G A;  3D1Q A;  4DX6 A;  5HRO A;  2XYH B;  1R8H A;  2GQC A;  5B08 A;  4ZIV A;  4HKQ A;  3Q24 A;  1UW4 A;  3WZ0 A;  1VQM S;  1FTC A;  1ELO A;  2E7W A;  3ZZY A;  1TTH B;  3P45 B;  1S76 D;  2WB4 A;  2APO A;  3UDV A;  2OD4 A;  1FX4 A;  3K5M A;  1XR5 A;  1IKY B;  4B3S J;  1YGY A;  2IJF A;  2L08 A;  3HFV A;  2KJV A;  2ERR A;  2DNN A;  1R43 A;  2A6M A;  1RTI A;  4ZPW R;  1XIQ A;  2HNY B;  3K7R A;  3Q22 A;  4RWW A;  4DU7 A;  3PW2 A;  2KTQ A;  3R3T A;  4DV1 J;  4RW8 B;  3C19 A;  2FLL A;  3KHR A;  4CWB A;  5E33 A;  3IO1 A;  5L1J A;  1VQS A;  2DEJ A;  3C6T B;  2OSR A;  3EJM A;  4I0W A;  4KFB A;  5DQH A;  3GIK A;  3DLK B;  1TL1 A;  4JI8 F;  4N47 A;  2RHQ B;  1FKO A;  1JJC B;  2HIY A;  3N79 A;  4XIU A;  1TVR B;  3R5D A;  2IM1 A;  2VB6 A;  4DL7 A;  3GSD A;  4IO1 A;  1LFP A;  1RBA A;  3D6H B;  2J8S A;  2WTF A;  2NXC A;  1LQ9 A;  2KRB A;  2H4W B;  3MEC A;  1B0V A;  2CXE A;  2AGP A;  3TWZ A;  1VRU A;  4AE5 A;  3MMB B;  5HAT A;  4X65 F;  3HJF A;  3MMB A;  2COL A;  4HHJ A;  3D4J A;  5JJB A;  5I42 A;  1JK9 B;  1KQK A;  5I42 B;  4HI1 A;  2H54 B;  2ACY A;  4BC9 A;  3KK1 A;  3PO5 A;  3J80 U;  4EK2 A;  2H1Y A;  1H7W A;  1SVD A;  3GMG A;  4UZB A;  1DLO B;  5HQL A;  4BDP A;  2V69 A;  1RAO A;  2FGC A;  1DLO A;  3DMJ B;  3H5S A;  2HUR A;  3IFE A;  4RW9 B;  1N48 A;  2DGX A;  4Q7A A;  1Q0N A;  5K14 A;  4UUX A;  2N7C A;  2V8D A;  3RR7 A;  4RUC A;  2KN4 A;  3TAM B;  1NDL A;  3TAM A;  4WYW A;  1KVI A;  1RAG B;  2BBE A;  2MJU A;  4C0O C;  5BR8 J;  1K9M T;  5KFN A;  5GVQ A;  3UD3 P;  2MYF A;  2WHO A;  2IY5 B;  2FDN A;  2AYB A;  2Z4P A;  4YY3 F;  4D3G A;  4QWA A;  3PX0 A;  2DXD A;  3AJ1 A;  3FGV A;  5KG3 A;  2KG1 A;  1C1C A;  3M9N B;  2J6U A;  4ZVT B;  4QCL A;  2W24 A;  7AT1 B;  2OP5 A;  3U02 A;  2GJI A;  4U7U D;  3MM9 A;  4JYA J;  2OPP A;  3MFI A;  3KK3 A;  1TKZ B;  2EFP A;  1RWW B;  1V3Z A;  2DXE A;  1GXL A;  2F8H A;  2MKS A;  3A1Y G;  3MM5 A;  4ECQ A;  4DSE A;  1LW0 A;  1KHW A;  3FFI B;  3V5R A;  3WX8 A;  1EHW A;  4DS4 A;  2CYY A;  2XY6 A;  4DS5 A;  3O3L A;  1C0U A;  2UUA J;  1QE1 A;  2AF6 A;  1UVK A;  1SCJ B;  2FYX A;  2LEA A;  1OY9 A;  2RSQ A;  2XZD B;  1VJQ A;  2BAB A;  3OXL A;  4OZ5 A;  4DV5 J;  3CO9 A;  1PSD A;  1RCX B;  3GR0 A;  4QWE A;  2ZHB A;  1WUU A;  3X3U A;  2CZ4 A;  2WBM A;  4M1K A;  1EQM A;  3JQM A;  3ZZP A;  1W7W A;  4ER8 A;  4FYV B;  1DZ5 A;  1CS4 B;  3CJR A;  4O3S A;  1CJV B;  1IKX A;  2C2Z B;  2HIQ A;  2MZQ A;  4F4W A;  4DX5 A;  5KFX A;  4X84 A;  3BYP A;  2P9E A;  1PYT A;  3DLE B;  3UQS A;  4DN0 A;  1TAU A;  4CO1 A;  3W1Y C;  1KN6 A;  1NND A;  2Y8W A;  2GJF A;  2BAN A;  2E66 A;  2LXF A;  1TR0 A;  3HSD A;  4KE5 A;  4TKT A;  3ZNJ 1;  2EBE A;  1J5E F;  1DQ9 A;  3M8P B;  4M5G A;  1RU1 A;  2V34 A;  4LIW A;  2DPJ A;  4H4M B;  2DGV A;  2AJ2 A;  2BJ8 A;  4GKK F;  2E7V A;  4U95 A;  4I6W A;  3CUL A;  2X3D A;  2R7S A;  4ILM A;  2BM1 A;  1F2G A;  4QWB A;  5HN0 A;  3V81 A;  3A3O B;  1KLM A;  4F3M A;  1WC0 A;  4JI6 F;  2EFN A;  1OMS A;  5DLG A;  2LCW A;  2GJ2 A;  3MM8 A;  4NA1 A;  4EU0 A;  5LMN J;  3IBC B;  4ECT A;  1HHT P;  1HBM B;  2GNK A;  4PAA A;  5ETL A;  3GJR B;  1JB0 C;  3D6F B;  3TW0 A;  5E3Q A;  2VDH A;  1B7F A;  1NZ8 A;  4NWB A;  4C9D A;  5K8O A;  3JTO A;  3T41 A;  5SUH A;  3T1H F;  5H1S V;  2HS3 A;  1OYD A;  4F67 A;  2YWH A;  3NWG A;  4NA2 A;  3V6D B;  4LF4 J;  2P5V A;  4I64 A;  3T1Y F;  3M2U A;  4WK3 A;  3R27 A;  1X9S A;  3DN9 A;  3RR8 A;  1RWO B;  4X4N A;  3M8Q B;  4LVO P;  1ZM3 A;  3PNI A;  3DI6 A;  3FCW A;  2MQP A;  4LF1 A;  2P9G A;  2KZM A;  1WC1 A;  2OTJ S;  5IM0 A;  5FLX U;  2ZHO A;  1WI8 A;  4PEO A;  5KT3 A;  4ZLP A;  1XMO J;  3AJD A;  5KG1 A;  1L3U A;  4JV5 J;  3OVA A;  2UXD F;  4NYO A;  2NZC A;  3GIM A;  4CLK A;  2OPS B;  2HHH F;  3DOL A;  1AFI A;  3M8W A;  4GMK A;  3ZTP A;  1OJ4 A;  1AUD A;  3IM9 A;  2HK3 A;  4KBI A;  2A2C A;  1FXL A;  1VIX A;  1L3K A;  3I0R B;  1HWI A;  4H4K A;  4TLR A;  3EXC X;  3O2I A;  4ID5 B;  5HBM B;  5DG9 A;  1FE0 A;  4DR5 F;  5CYM A;  1JLA B;  1VI7 A;  4FXV A;  4NA3 A;  4OHX A;  3T3F A;  2FLN A;  3QAU A;  1IUJ A;  2HQ3 A;  3NAI A;  2Y1R I;  3DXS X;  1Y00 A;  2IRX A;  4QOT A;  5C5J A;  5EWF A;  4BCA A;  1E6V B;  2GQ2 A;  2K06 A;  2ATL A;  1RK8 A;  4DI6 A;  3CED A;  1OYE A;  4A48 A;  1VOM A;  4C8M A;  1U1P A;  4ZHR B;  3KUE A;  1U48 A;  3PW4 A;  3O1L A;  4ZCK A;  3CJK B;  1BMQ B;  2V67 A;  1YDL A;  2HVE A;  2FTR A;  2HND B;  3QT5 A;  4KSE B;  5LT5 A;  2GGP A;  5JUM A;  2EI5 A;  3AD9 C;  2QL7 B;  4GKK J;  4P72 A;  3ZNU A;  2W7A A;  4CYU B;  5G4D A;  1PJ6 A;  2WRM A;  5CCL A;  2GV1 A;  3IBW A;  2YNI B;  4JI4 F;  4PPZ A;  3D2W A;  3K5O A;  3S01 A;  2HWT A;  2PFF B;  2Z56 B;  3HT0 A;  2WOM A;  4OYP A;  2VKR A;  2G1D A;  4OV6 A;  1P9Y A;  1Q8B A;  4Q2L A;  3CD7 A;  2UV8 G;  4F7V A;  3V4I A;  1ZTW A;  2HBZ B;  3NOG A;  4CLP A;  2VQE J;  4WP8 A;  1N6Q A;  1S6P A;  5BYS A;  4YR3 A;  4O23 A;  4NCB A;  2JHE A;  3RYL A;  2RHS B;  2M8H A;  3ZZ0 A;  5B09 A;  1TKT B;  2VBW A;  1T0T V;  4F3Q A;  3QZ7 A;  1OSD A;  1CUL A;  1Q95 G;  4I2P B;  4JV0 A;  4XO0 A;  4HAC A;  4DV5 F;  1IBL J;  4DJB A;  4K7Q A;  3UN3 A;  3DM2 A;  2VG7 B;  3MEE B;  4YDD B;  1ZYQ A;  1FJC A;  4LF7 J;  3G8T A;  1N52 B;  1VDH A;  2YKM A;  4WKR A;  1NPK A;  4H54 A;  3Q8U A;  3H2V E;  3RAQ A;  3MUM P;  3CSK A;  3AQO A;  1R0C B;  1S9E A;  1UFL A;  4J9N A;  2J6S A;  3ENA A;  1KVJ A;  1U1R A;  2X1G A;  3VAJ A;  1TUW A;  1FFW B;  1ZAW A;  2NPF A;  2J7U A;  4UZC A;  3ZZO A;  2DRB A;  2AJ4 A;  1WOO A;  3M7V A;  2HGM A;  4LQ3 A;  4LRD A;  4CO3 A;  1FER A;  2F63 A;  1RT2 A;  2XEX A;  5FDL B;  3VHQ A;  4YUD A;  2KM8 C;  3AQP A;  2VON A;  1P6T A;  2E1P A;  2V4Q A;  1RI7 A;  2XMJ A;  3E51 A;  4GVL A;  3BN7 A;  3HX9 A;  2VAS A;  3KWM A;  2FHM A;  3M30 B;  3I4P A;  2JX2 A;  2KHC A;  3BSA A;  2MKK A;  5LMU J;  2E5G A;  2ZC3 A;  1IKW A;  2CJX B;  3RTV A;  2RRN A;  3CW2 C;  2HZA A;  2FVP A;  1KBR A;  1P1T A;  4KKO A;  2C3P A;  1S0O A;  2EWH A;  4L6V 3;  2PSZ A;  5HVH A;  3CJQ A;  1UEV A;  4U67 Q;  1HBO B;  1RWV B;  2GAG C;  2GMJ A;  3K2Y A;  1NHV A;  3EVM A;  2R7Q A;  3R5J B;  2LA4 A;  5T7L B;  2B0G A;  3VAK A;  5C24 A;  3OXF A;  3BB5 A;  3N9U C;  5D6G A;  1CC7 A;  3L9Z A;  4NLW A;  2AYG A;  3ITH A;  5DG8 A;  2OD6 A;  2H3E B;  3OVS A;  4LF5 F;  1H2T Z;  4YP3 A;  1KC8 T;  3HHN B;  1FWP A;  2B8Q A;  2ZBQ A;  4A8X A;  2JVR A;  4L3N A;  2Q6C A;  5BR8 F;  3SQG B;  1NU4 A;  3DGV A;  4JI4 J;  1WOP A;  2NSC A;  2YX1 A;  2KU7 A;  2WW4 A;  3FSX A;  3TZZ A;  3I87 A;  1HHS A;  4XDD A;  2MY8 A;  3GFZ A;  2BW2 A;  4DV4 J;  2V63 A;  3OXG A;  3M6W A;  3JAM U;  2B3T B;  3EE3 A;  1NSA A;  3MR6 A;  5D0R A;  2QEX S;  2K1R B;  1XBW A;  2YNH A;  4OZ3 A;  1H3D A;  2HPU A;  2NRE A;  4DCJ B;  3O8W A;  5B7W A;  4PWD A;  1HWK A;  2VG6 B;  1FD2 A;  2X3G A;  4WFZ A;  1KQF B;  1FRL A;  1DQA A;  4MK9 A;  1HYS B;  1YZ6 A;  3G8Q A;  3G82 A;  2POK A;  4E8U A;  3G96 A;  1S72 S;  3RBE A;  4LF4 F;  2AIR B;  2BM0 A;  1IQT A;  3QZ8 A;  4MJK A;  2WSF C;  5AXM A;  3BQ0 A;  2Z30 B;  3BBC A;  2NLW A;  3AFG A;  1NRK A;  2LVW A;  2R3V A;  3IRX A;  4NX9 A;  4ATN A;  1RT7 B;  1CJU A;  3A8E A;  1RAE B;  2SXL A;  3ISN D;  4DPT A;  3W63 A;  4U9R A;  5LOQ A;  2QT7 A;  4USV A;  4A46 A;  2XB2 D;  4P2X A;  4CTA B;  1RAD B;  4DFM A;  4WXW A;  4KPC A;  5B0B A;  5U47 A;  3SI8 A;  3F0N A;  4OX8 A;  1REV B;  2HGN A;  4IUF A;  1K1S A;  4J9V A;  4N56 A;  4NLG A;  2WVF A;  4P73 A;  5EHH A;  3AXM A;  3CJ5 A;  3MEK A;  4ZVG A;  5GAE I;  4FBT A;  2HHS A;  1Q79 A;  2BE7 D;  1D1U A;  2KZZ A;  2O5D A;  1TV6 A;  1HQU A;  1IBC B;  3MHY A;  4OYO A;  4XK8 C;  1SJ3 P;  4F3O A;  4X64 F;  3H42 A;  2AD9 A;  1RA7 A;  2C3Y A;  2CRL A;  2RF2 A;  2QLB B;  3U7J A;  5HVG A;  1T05 B;  2KL8 A;  3NMA A;  1QSL A;  3ILI A;  4B9M A;  2M3D A;  5DGB A;  2MJN A;  4MIA A;  4OJG A;  4JI2 J;  2XUL A;  4IFY A;  1NJY A;  2L9D A;  4KJI A;  3FQL A;  1JMT A;  2MY7 A;  3HSZ A;  3CCJ S;  1I6J A;  2ZNZ A;  1RAB B;  1TU0 B;  2BUN A;  1WC3 A;  2LU2 A;  2WSC C;  1UA0 A;  3PO4 A;  2MQQ A;  2IVY A;  3SV3 A;  1H73 A;  3KG0 A;  2IMW P;  1NHK L;  2VV5 A;  2ZEJ A;  5T41 A;  2DCL A;  5H9F J;  2R2R A;  1S0V A;  4ANE A;  1EZZ B;  1GMV A;  1Z2Z A;  1ZA2 B;  2HS4 A;  1NHU A;  1XTZ A;  5CYQ A;  1JLB A;  3RB3 A;  5I3P A;  2DRD A;  4KO0 A;  4CZC A;  3CJT A;  2AJ0 A;  2JL9 A;  3CDU A;  1K1Q A;  3KG1 A;  1WWH A;  3W9I A;  2RU3 A;  2K7K A;  4C7Q A;  1M5H A;  2LMI A;  5ITH A;  5DDP C;  3GV5 B;  4AT1 B;  3BO3 A;  5KFH A;  3MD1 A;  2A10 A;  1EAY C;  2BKO A;  3FMW A;  2PD1 A;  4P7T A;  5M2U A;  1LWE B;  2K2P A;  2BYC A;  1C0T B;  1S4E A;  2OI2 A;  1N4L A;  4PUO B;  4P2S A;  1GXT A;  1U0S A;  4M8L A;  4P7V A;  2K8G A;  2CKW A;  1HBN B;  1IM6 A;  1SQF A;  4NI2 A;  3TVZ A;  2RS2 A;  4YB6 A;  5KFK A;  4DR4 J;  2HRY A;  1RQ0 A;  3B4M A;  1PIL A;  3I31 A;  4WF9 Q;  5CYJ A;  4KC5 A;  2VFS A;  2ZZT A;  2ASL A;  2M52 A;  2NS1 B;  4RLE A;  2YY3 A;  3VCD A;  4PQU B;  1FRM A;  5IXU A;  4ILR A;  4DEZ A;  4URG A;  4USH A;  3TJA A;  5KFD A;  3DU6 A;  4K50 A;  4B3O A;  1GQE A;  3MM9 B;  3ZZR A;  4ZN3 A;  3KLG A;  4GKJ F;  2G2O A;  2OPQ B;  1CJT B;  5HMZ A;  1S4F A;  4ED0 A;  2AX0 A;  1RUS A;  3FBB A;  2I1R A;  2OML A;  4J9O A;  2Z8Q A;  5L39 A;  1VQ7 S;  1G3O A;  2J0S D;  2DVI A;  3RGI A;  2O66 A;  3BRE A;  4IDK B;  1EIY B;  2QJ3 A;  3N6M A;  3NGS A;  2DKO B;  2EKY A;  2XLJ A;  4DUY J;  1SL2 A;  2HHV A;  3PEJ A;  1JLE A;  2HKE A;  1B70 B;  2CJB A;  1SPB P;  2HNZ B;  3MED B;  4U7U K;  2HZV A;  4DV2 J;  4ZPT R;  2CQ3 A;  1RTJ A;  1UWB B;  1QAI A;  3BSO A;  4WFA Q;  1NH8 A;  3GCX P;  3LAN A;  2V4J A;  1S7I A;  1YLX A;  2VKZ G;  4WBF A;  3GYN A;  3B78 A;  2V2V A;  3GG0 A;  3QQC D;  5IT4 A;  1UKU A;  2UP1 A;  3UD5 A;  9ATC B;  1D0E A;  2N4C A;  1ZZN A;  1FA0 A;  3ONQ A;  5D0H A;  3W5X A;  2AZ1 A;  3P4U B;  4HT5 A;  2AJQ A;  2IVM A;  3IS9 A;  2O67 A;  1OQ3 A;  2M5Y A;  4KIA A;  4M5I A;  3CCR S;  1HIY A;  2BKN A;  1NB2 A;  2BVZ A;  3TAR A;  4NLS A;  2FHJ A;  4KH1 B;  3NGU A;  5AXN A;  3J7A 1;  4OZ1 A;  5HP1 A;  4O0N A;  3I5B A;  1WOR A;  3W5Y A;  4B3S F;  1WG1 A;  2MDA A;  2ZFH A;  1UVN A;  1GNK A;  3EVO A;  4WK1 A;  2KXH A;  3W66 A;  3W9J A;  3G2X A;  3TZX A;  3J81 j;  3SV4 A;  1WEL A;  5J2M B;  1KLM B;  4M5D B;  1OS5 A;  1V3R A;  3HKZ D;  4FF1 A;  1W2I A;  4F50 A;  4U96 A;  4PR6 A;  1TKX B;  3TQE A;  4QW9 A;  1RT6 B;  1TKX A;  1O51 A;  3KJV B;  1XC9 A;  4P9S A;  2EFG A;  3FSI A;  4LIR A;  4OYZ A;  1H2U X;  1KTQ A;  2GA7 A;  3T6B A;  3NOC A;  1BQM B;  3H5Y A;  4Y2K A;  4DV1 F;  2Q1L A;  2CJQ A;  2MKC A;  3T1Y J;  4Y65 A;  3DRS B;  4IH5 A;  5ETP A;  2W25 A;  1XK8 A;  4ZK7 M;  1D8Z A;  3J7Z 5;  3V6D A;  1FK9 B;  2D3Z A;  2ZKU A;  3OHB A;  1RTZ A;  2XS5 A;  4A47 A;  3C6U B;  2JNJ A;  5B0G A;  3SCI E;  4C8Z A;  1AYE A;  3SDE A;  4X66 F;  2JFD A;  3HHE A;  2FVC A;  2J9D A;  3D1O A;  3PDN A;  5KOX A;  1CBK A;  1X4C A;  4DLE A;  4B9L A;  4MT1 A;  4LF8 F;  3JQJ A;  2BZ2 A;  3GR1 A;  2B6A A;  1OY8 A;  2JLF A;  1SUQ B;  3QT7 A;  4TN2 A;  5DDQ C;  4DX7 A;  4DV7 J;  3O44 A;  3I82 A;  2HBY B;  3LWM A;  2BQ3 A;  1C1B A;  3HLU A;  4CT8 A;  1MRO B;  2D69 A;  3LP0 A;  1IWG A;  1GT8 A;  5KFB A;  3KK2 A;  1JLA A;  3K8V A;  3MD3 A;  2XZT B;  4PZV A;  2HSE B;  5JMN A;  3JB9 k;  3QT6 A;  4Z7C A;  4IRC A;  3L7P A;  5C2C A;  2Z2Z A;  3LQV A;  1KQG B;  4FPI A;  1NZA A;  2YKN B;  4IRK A;  2YKN A;  2JSX A;  1VMB A;  1AZS A;  3DLG A;  2C2K B;  2LFV A;  1AZS B;  3N28 A;  5ETM A;  2KFN A;  2ZBR A;  3KLF B;  1SV5 B;  2QA2 A;  1PJ5 A;  4YEA A;  1S1T B;  3JSM A;  2BQU A;  2Z58 B;  1VRQ C;  5MLC V;  4JV2 A;  1NO8 A;  1Q8L A;  1J27 A;  3C66 A;  2HWH A;  4A8M P;  2RUS A;  4NOH A;  4ZIT A;  4OI0 A;  1HNZ J;  4FXD A;  3KHH A;  1BQN B;  2CQI A;  4F36 A;  2CG4 A;  4QWC A;  4JBC A;  2OSQ A;  4R0J A;  1ZPV A;  4Q5V A;  3OL8 A;  4UF4 A;  3V4I B;  4DF8 A;  4W98 A;  3T19 A;  2AU0 A;  2C28 A;  2KT2 A;  4YDX A;  1VCT A;  4DCO B;  5H9E K;  2DHG A;  1KOO A;  1RT3 A;  2PA8 D;  3EWG A;  4OYA A;  2RIJ A;  4XTT A;  4J91 A;  3QSI A;  2DNL A;  1IBK F;  4XAK A;  5IOL A;  4OI3 A;  3SFU A;  3M9O B;  3PIO Q;  1NPR A;  2YKP A;  6FD1 A;  1P1L A;  3I6P A;  4V1A k;  5CAB A;  2U2F A;  3I5A A;  5KG6 A;  3FRY A;  3L95 X;  4YY3 J;  4TQR A;  1TL1 B;  4G6V B;  3K5L A;  2HVI A;  3T9N A;  2IRY A;  1NEE A;  1JLC B;  1Y3K A;  2OEK A;  2O01 C;  3LAM A;  2PC6 A;  3RBX A;  1QJH A;  2XWY A;  2HBQ B;  4RW6 B;  3LGH A;  2R7O A;  1IQZ A;  3CC2 S;  2RH3 A;  2JDJ A;  3DCA A;  3M2V B;  4ZIW A;  3PR4 A;  4Q43 A;  3V6K A;  1S1U B;  5B0D A;  2XMK A;  1BWV A;  1MNE A;  3PCO B;  1S1U A;  2DNP A;  2PII A;  3HD1 A;  3MWB A;  4L76 A;  2VOP A;  1N0V C;  3DYA B;  1JNZ B;  4MKB A;  2IM0 A;  3NP5 A;  3MR5 A;  2R8I A;  3C2P A;  1D9A A;  1U6F A;  2BE2 B;  3FZB A;  5E3A A;  2ZUG A;  2MMY A;  1RT4 B;  4TU8 A;  2NXU A;  1RJJ A;  2KT5 A;  3R6G B;  3TZW A;  5CHC B;  4JI2 F;  2QGF B;  2CQP A;  2CNO B;  2BX6 A;  2Q79 A;  1NK8 A;  1ITP A;  3AOC A;  2LEB A;  4RNN A;  2EEY A;  5A8W A;  3Q0A A;  3DLB A;  3Q8Q B;  4Y3C A;  1FWL A;  2HRT A;  5J2N B;  2ZHA A;  3KUG A;  3T1A A;  4WE1 A;  3HP6 A;  3IRW P;  2HQD A;  3AOA A;  4CP5 A;  2V8V A;  1LWF B;  2YNG B;  2KFY A;  2DGO A;  2RRA A;  3P96 A;  4E2F B;  4MKY A;  2AYM A;  2CAJ A;  5BYR A;  4AQY F;  3VGU A;  1HNZ F;  4IR1 A;  1C1C B;  1M1K T;  3CO0 P;  3BPD A;  1F3V A;  1Q81 T;  2VL1 A;  5HRO B;  2XCP A;  1D9D A;  1SH0 A;  2L9W A;  3TVY A;  2LP4 A;  3VTI A;  1K0T A;  5F9N A;  1RCO B;  3MM5 B;  4N7T A;  4PG5 A;  4F0M A;  1X60 A;  2ZH9 A;  4OYI A;  3TRG A;  4DR5 J;  2KYZ A;  2WB1 D;  2YWE A;  2RDJ A;  4MAK A;  1WEY A;  2HLU A;  5L1L A;  2AKW B;  3GB0 A;  3DRR B;  2QZ8 A;  4RBU A;  2IVF B;  4F25 A;  3MR2 A;  5D0E A;  3KKF A;  4FS2 A;  2C22 A;  3QAT A;  3AY0 A;  3FEZ A;  1SQG A;  4X4S A;  1R0A A;  1XNR F;  4B3R J;  3SQO P;  1S79 A;  1WHV A;  1XNQ J;  2Z0G A;  4RW8 A;  2C2D A;  4O44 B;  4Y0F A;  5IWA F;  4KGM A;  2JLE A;  4DG1 A;  4TQS A;  2M7S A;  3N4W A;  1OQ6 A;  2B7B B;  3AOB A;  5ADZ A;  4KV8 B;  2ZJQ Q;  4G1P A;  1UVL A;  5JVH Q;  4LUB A;  4DV3 F;  4URQ U;  4CLU A;  1SI9 A;  3W5Z A;  1Y3J A;  1FX2 A;  3PEH A;  2VIH A;  2QA4 S;  2F65 A;  4CH1 A;  4RW7 B;  1X4F A;  2V8P A;  4NRU A;  3JTP A;  4AXI A;  4YHH J;  1RTH A;  1H2V Z;  2IDL A;  3KFW X;  2ZE2 A;  4I7F B;  4PRF A;  2XM3 A;  1SH2 A;  3KJN B;  4M5N A;  1K0V A;  1IKY A;  1RWX B;  4TLQ A;  4G1Q A;  3U1M A;  4C2M A;  4DSI A;  3KG4 A;  2HHQ A;  3BBF A;  3GPA A;  1S1X A;  2FGO A;  3QBC A;  4DR1 J;  1RT1 B;  3OQ2 A;  3VWS A;  1M90 T;  3D67 A;  5J1E B;  4DSJ A;  2AWZ A;  5A8K B;  1WF1 A;  5IQQ A;  4ED2 A;  3IN5 A;  2CDR B;  4DLG A;  2ILZ A;  1UVJ A;  2PFD A;  3GJQ B;  1NK4 A;  1HL6 A;  4BC7 A;  3MF5 A;  3KHG A;  3SSR A;  1QAX A;  3NBP B;  1FJE B;  2CPD A;  4EI2 A;  2C2M B;  2DHX A;  1GH8 A;  2DH7 A;  2FJE B;  1S1W A;  3CD5 A;  1MLA A;  4LF2 A;  2W2P P;  3GJT B;  2QG9 B;  1PG5 B;  2WCX A;  1S7H A;  2BOA A;  4FVC A;  4DFP A;  4Q0B B;  4NZ6 A;  1LK7 A;  5CCM A;  1J5O B;  5KT5 A;  2RS8 A;  4M5L A;  4KPY A;  4NZ7 A;  4P6Q A;  4QIE A;  5DET A;  4NZ0 A;  2FY1 A;  2LQ8 A;  1HQE A;  5CYQ B;  5GAG U;  1VIO A;  1BD6 A;  3HSJ A;  2YWW A;  3GU0 A;  3J81 U;  4GKJ J;  2H9Z A;  2ZUA A;  1XQI A;  1N36 F;  1N32 J;  1VBZ A;  2EFO A;  3C15 B;  4K8R A;  3W9H A;  2W8K A;  2DRA A;  5GMD A;  4WTY A;  1XMQ J;  1CJK B;  4J9L A;  3PHE A;  2NZ4 A;  1FDB A;  2QX0 A;  1KOH A;  2J7K A;  1WTF A;  4RW9 A;  4E98 A;  3SCL E;  2RDI A;  1BXN A;  3T5L A;  2I5J A;  2YQ3 A;  3M6U A;  4KB7 A;  1NDC A;  4QYZ J;  2OEL A;  3POT A;  4DUY F;  4DFK A;  5IS2 A;  3HFZ B;  3ET6 B;  3L09 A;  2VQF J;  2IM3 A;  4LBH A;  3G6E S;  2H65 B;  3K57 A;  2VG5 B;  2H48 B;  1I94 F;  4HT7 A;  3BS9 A;  5AE1 A;  1RHM B;  4HDG A;  4J9U E;  1I1G A;  1V5I B;  1WKJ A;  3NGD A;  2N3O A;  1NCL A;  3DGP B;  3KLH B;  1Y4Z B;  4PQU A;  3ETO A;  2F8M A;  2XYP B;  3DOK B;  1J2V A;  1RAJ A;  3PHT A;  2KT3 A;  4IOB A;  4XPE A;  4LFA F;  3G71 S;  4CM2 A;  1VBK A;  2AHO B;  1HNV B;  2LEC A;  1BC6 A;  1HMV A;  4G65 A;  1U1Q A;  3RAX A;  1U1M A;  4ED3 A;  2BJE A;  4DX8 H;  3UVJ B;  3TA0 A;  1FT8 A;  1DTQ B;  3VAF A;  1ZPW X;  3F56 A;  3JTN A;  4ECW A;  4DSF A;  4J9S A;  1W25 A;  2YNF B;  2DIT A;  1SC3 B;  2RNE A;  5IFM A;  4KAI A;  2ZJR Q;  1TEL A;  2M8D B;  4ZP7 A;  3EPI A;  3AD7 C;  4CH7 A;  3CMA S;  2F3J A;  3QFH A;  5ETO A;  3QYY A;  2OTL S;  3CWJ A;  4ZDN A;  2VD3 A;  2NXJ A;  3NL0 A;  1F1B B;  2HQF A;  4OZ0 A;  1T3N A;  1F9F A;  1RTJ B;  1UWB A;  2QSF A;  3HUL A;  1VBX A;  1ICE B;  2XYG B;  3NAH A;  4HYK A;  2WON A;  2B5J A;  3DLH A;  1PYS B;  2CZ9 A;  2ALY B;  2W4D A;  4WU2 A;  5J1P A;  3OTO J;  4LF7 F;  4FF3 A;  2Q6B A;  2GS8 A;  3DOM B;  3TZY A;  2MZR A;  3CMQ A;  3DXB A;  3M8Q A;  2DH9 A;  3TUJ C;  4FYX B;  4H4K C;  4JV5 F;  1NK9 A;  4YQW A;  1UEK A;  1GMW A;  3MPW A;  4MTP A;  3PXG a;  3A3P B;  4Y2A A;  2UU9 F;  1Q7Y T;  4MFB B;  3V81 B;  2CQD A;  4O3O A;  3IGN A;  5ETR A;  1YJU A;  2JFK A;  4PXE A;  4DL3 A;  2OH2 A;  4W92 B;  3EZO A;  4M5D A;  2DGS A;  1SKR A;  2H5I B;  1UET A;  2DNQ A;  1KQS R;  3MAA B;  2MPU A;  3FBF A;  1XNQ F;  1T03 A;  2XI3 A;  5AT1 B;  3THV A;  3HF5 A;  5EX0 A;  1T03 B;  2GVZ B;  2DO0 A;  3MCN A;  5HLF A;  4I68 A;  4ZPA A;  3UN2 A;  1XWL A;  2A3J A;  1IKV A;  1GEH A;  2E29 A;  2WW8 A;  3BR8 A;  3QNW B;  4LRC A;  4YN3 B;  4DFJ A;  2VFU A;  3M6X A;  5D4N A;  3UDC A;  5A2Q U;  1JX4 A;  1VJW A;  2IAJ B;  1X4D A;  2JRS A;  1SB6 A;  4HL9 A;  4NLU A;  4ZA1 A;  3K58 A;  2ADC A;  1B3T A;  4IG3 B;  4LF5 J;  4IG0 A;  2CPJ A;  3QRQ A;  1MMN A;  2R2T A;  2RRB A;  4OI2 A;  3DI6 B;  3OPK A;  4ZVQ B;  1VQN S;  3WDO A;  1JLF B;  2MQ8 A;  1RE1 B;  2BA9 A;  2C3O A;  2I8E A;  2F1F A;  3MCM A;  1YJT A;  1LKZ A;  5KFS A;  2KVQ E;  4CNZ A;  1N5T A;  2VU5 A;  3DRX A;  1V3S A;  4AQY J;  3TI0 A;  1IM4 A;  4A4J A;  2VUG A;  3DFE A;  3QRP A;  2CZV C;  1SJR A;  2HQC A;  2J5A A;  2WOM B;  4ZLL A;  2CWK A;  3LP2 B;  3ZTR A;  3CXC R;  4C0B A;  2ZOM A;  1Q53 A;  2YX7 A;  4S0M A;  1YVF A;  5D8H B;  2GO9 A;  4C11 B;  3PAC A;  3UNY A;  4URS A;  4W4M A;  3VVU A;  1U47 A;  4ES3 A;  1MML A;  2ZDO A;  3KDO A;  4KGK A;  3R5C A;  2CQ2 A;  5KFV A;  4CO2 A;  2MQL A;  4CIO A;  4AYB D;  4RR5 A;  3HM9 A;  2CG8 A;  1RHJ B;  2P6S A;  3LUY A;  2FUG 9;  2LQJ A;  2RML A;  3MM6 A;  2Y9H A;  2CPX A;  2LA6 A;  3OTC A;  2CFX A;  5B0F A;  2V2K A;  1IR1 A;  3BGR A;  4WFY A;  3CT9 A;  1IBM J;  4DR3 F;  1KR4 A;  7FD1 A;  5A6W A;  4C98 A;  4R8U A;  2QO3 A;  5I4M A;  2YH1 A;  3EGN A;  5HI7 A;  2ZM6 J;  3OTO F;  4R25 A;  3G86 A;  3QID A;  1RT7 A;  2LU1 A;  3BKT A;  3RJM B;  5C42 A;  1NPP A;  3HZE A;  3OR2 B;  2W7O A;  3VAI A;  4B3T F;  4F4A A;  3BV8 A;  1JQG A;  2G13 A;  4QWD A;  5D78 A;  3I4H X;  2A18 A;  2DNO A;  3LO3 A;  4QBU A;  4LF6 F;  2DHS A;  3G8S A;  2XS2 A;  3TEG A;  5DM6 Q;  4UST A;  4B9U A;  1WOS A;  3QJL A;  2HVD A;  2KO1 A;  3BO2 A;  4EBE A;  4RL1 A;  1RWN B;  1YTY A;  1IBK J;  1OPI A;  3AB4 B;  1YJV A;  3IWN C;  5KFZ A;  4Y00 A;  3GTY X;  2VQF F;  2VFT A;  5GAD I;  3HHL D;  2YXL A;  2V5H G;  2KG0 A;  3IG1 B;  4KY3 A;  5CA5 A;  3C6T A;  4RU2 A;  2MGZ A;  4DR4 F;  3WHI A;  2OHD A;  1FDA A;  4N8N A;  1PJ7 A;  4LT6 A;  4ZP8 A;  3MPU B;  4EGL A;  3O6Q A;  1JLG B;  5GAG I;  4UY8 T;  3ELH A;  2DHH A;  5A6P A;  3PKM A;  3H4D A;  1Q78 A;  4X4T A;  4WU3 A;  5DLF A;  5KT4 A;  3QRR A;  2F8E X;  4DUZ J;  3AHP A;  1VC6 A;  2CJK A;  1UVM A;  1FRJ A;  2QYC A;  3CDW A;  3N6L A;  4A8K A;  3R2C J;  1N54 B;  3C16 B;  4YS2 A;  4BLG A;  3M2V A;  1UMJ A;  2XGQ A;  3NNH A;  3MR7 A;  4KO0 B;  3ULH A;  4A8F A;  1HKA A;  2EG1 A;  2DR9 A;  1S6O A;  1WHY A;  4TYB A;  5E2Q A;  3IC1 A;  2HQI A;  4M95 A;  3UFC X;  2Q43 A;  4A8Q A;  2JH3 A;  4UUW A;  1FO1 A;  4OJH A;  9RUB A;  2UUB J;  4CO5 A;  2QLW A;  5DDO C;  2MSS A;  5F8I A;  3H2L A;  5LJ3 Y;  5KFT A;  3I0S B;  1X5P A;  3RBD A;  4LQ9 A;  1X9M A;  4KRW A;  2E9R X;  3CJ3 A;  4L3K A;  1N0U A;  1WDT A;  2OMO A;  5DRK A;  4YOE A;  2PMH A;  4NLD A;  2D3O 1;  3ETM A;  4DF4 A;  2X7I A;  2QLF B;  2LKZ A;  1RHQ B;  1PKU A;  1O0P A;  5KG5 A;  1NSK L;  3KUH A;  2HFZ A;  2JVO A;  3J80 Y;  3BSN A;  3NCR A;  4WTO B;  3HJV A;  3TUP A;  1PO6 A;  2G0J A;  4OQJ A;  5IC6 B;  1SC4 B;  4C4W A;  2G2Y A;  3NNA A;  2ZM6 F;  4PXD A;  3DDK A;  2XBP A;  2ASY A;  3R5A A;  3BQ2 A;  3D28 A;  2VOO A;  2D1C A;  3MXH P;  4B3O B;  3VF0 B;  3IAS 9;  5AJ3 F;  3D68 A;  4DQQ A;  2VBY A;  1REV A;  3A3N B;  4MYT A;  4QU7 A;  1NKB A;  1AA1 B;  3W60 A;  1N5Y B;  4IH7 A;  3CIM A;  3AAW B;  3BDE A;  3Q83 A;  4RO0 A;  2AEF A;  2J7W A;  2QFJ A;  3MMA A;  2I2Y A;  3R2D J;  5KT2 A;  1RTI B;  2MLX A;  2ZWO A;  3OJS A;  5F8G A;  3RRH A;  3BM7 A;  2PT0 A;  5A8R B;  2W4C A;  5F3Z A;  4J9K A;  4WP3 A;  1SJF A;  4AL5 A;  4AL6 A;  1TMJ A;  1SKU B;  1PC5 A;  2OFH X;  1ULR A;  4WCE Q;  1T05 A;  1IKX B;  5DO2 A;  4KFB B;  1R8B A;  1RAH B;  3CDA A;  1EJ7 L;  3D7S B;  3DLK A;  5CD4 A;  3DLE A;  1X0P A;  3VR1 A;  1U1N A;  1TL3 A;  3C14 B;  1RBL A;  4UOH A;  3VAG A;  3B82 A;  4WFB Q;  4KV8 A;  4USW A;  3IRX B;  2DNG A;  2FB0 A;  4M5K A;  3HHK A;  1L3S A;  4LFB F;  4RW4 B;  2NSB A;  3MPY A;  2F4V F;  3G4S S;  3DKD A;  4CTA A;  3QLH A;  4DV7 F;  2NQP A;  1QDU B;  4O3R A;  1HLW A;  1R89 A;  1AUS L;  4HTI A;  1PBA A;  2M0G B;  4CLY A;  3CUN A;  5F8N A;  3MEG B;  1FE4 A;  3CJS A;  2HS0 A;  4YME A;  1FNX H;  2CPI A;  2M88 A;  2PE8 A;  4G1Q B;  3ZTQ A;  4RWX A;  1ZET A;  2E5L J;  3GFY A;  2OIH A;  4CDI A;  3PYD A;  1TV6 B;  1YJR A;  3MM8 B;  2HAI A;  2FC8 A;  2PI4 A;  4NXN J;  1HBM A;  1SJ4 P;  5LXY A;  2CPF A;  4A8O A;  1MG7 A;  1L3T A;  1FDD A;  2B4O A;  4NLR A;  1SQE A;  1KVK A;  1VQ8 S;  1IR2 A;  4AUK A;  1NJZ A;  2G0C A;  3OUY B;  1GX5 A;  5CZV A;  1MW7 A;  1HR0 J;  1N5S A;  5GME A;  5I3U B;  3DRS A;  1YBA A;  5IWA J;  5T14 A;  1RU2 A;  2QMU B;  4C8Y A;  1RGV A;  4DCP B;  4K4U A;  4NAS A;  1VIS A;  1KP6 A;  2QYG A;  3LPE A;  1JLQ B;  4C48 A;  3SBM A;  4DR2 J;  3RB4 A;  5AJ3 J;  3EPG A;  4Q2M A;  4UT4 A;  2DT9 A;  4ZKA A;  3KLG B;  2CNL B;  2FVR A;  5HMX A;  1YX2 A;  2X51 A;  2DNK A;  4LFA J;  3G9C A;  4R5P B;  2ABY A;  2FQQ B;  3AH6 A;  1HI8 A;  2BJ3 A;  1MMD A;  1FKP B;  1GX6 A;  2WVC A;  1D09 B;  3EDQ B;  3PFO A;  4QJV A;  3OL9 A;  1S99 A;  2JEJ A;  3DMJ A;  1EX8 A;  5EN1 A;  1T11 A;  4CQ1 A;  2KXN B;  3HHL B;  3VAM A;  4CO4 A;  4GC7 A;  3PJW A;  3HHL A;  1FXR A;  2MHE A;  3FJ2 A;  4I6A A;  4RUH A;  1MN7 A;  3H25 A;  3QO9 A;  2YVS A;  4QZV B;  2JWN A;  1Q4R A;  3H20 A;  4OZ2 A;  1U6Z A;  5F41 A;  3R8Y A;  4DV2 F;  3D9B A;  2BAC A;  2HFU A;  2L3M A;  2R42 A;  1EP4 B;  1RA6 A;  1UFK A;  1CQN A;  3IGV A;  4C3K A;  3SYZ A;  2VC0 A;  3QGG A;  3M8P A;  1LK5 A;  3CJ8 A;  2FVQ A;  1CG2 A;  3NRB A;  2ZH2 A;  2HLT A;  3DRP A;  1ZM2 A;  2YQ0 A;  3HI9 A;  5IC4 B;  2BMB A;  1RTD B;  4ZLJ A;  1WSR A;  3EIC A;  1TKZ A;  3Q8S B;  3BPS P;  1FEH A;  2OPQ A;  1RHK B;  1Z4U A;  2VIC A;  3NGR A;  3E2E A;  1X5O A;  4NCA A;  2HWI A;  1YI2 S;  4IDK A;  4LSL A;  1O6X A;  1FJG F;  3MOJ B;  4R0E A;  4ZVO B;  4RBV A;  3JQK A;  3GE9 A;  4IH6 A;  3KLE B;  1MN9 A;  3RRG A;  4NXM F;  5KFA A;  4ES1 A;  2KM8 B;  4HI2 A;  1U49 A;  4GRS A;  2PA3 A;  1XN9 A;  4RUB A;  3R7S B;  4NXN F;  2FD2 A;  2NXE A;  2D9P A;  4IOC Q;  1O8B A;  3P5B P;  3IP0 A;  3VZH A;  4PAB A;  2YWK A;  2VG7 A;  3BKU A;  4L75 A;  3JS9 A;  3CGI A;  4OFZ A;  2X1F A;  1S6Q B;  1HPZ B;  3MZI A;  2GFF A;  2B5J B;  3FCV A;  3MCS A;  4ED6 A;  4ELV A;  2JLG A;  2Z57 B;  1FVQ A;  4LRA A;  4OL8 A;  3QT8 A;  3J81 Y;  4GVB A;  4RJV A;  4X65 J;  4OLO A;  1WI6 A;  1YBU A;  2AT1 B;  4I2Q A;  1CLF A;  1URR A;  5IZH A;  2LDY A;  1BHN A;  1FXD A;  3T9Z A;  4AFF A;  1VQY A;  4Z7Y A;  1KLN A;  3SDE B;  4OHW A;  3PRD A;  3SSS A;  4W90 B;  3R6L B;  2IIH A;  2UUC F;  1EAR A;  4MFB A;  3IAM 9;  4YHH F;  2XC9 A;  5CXT A;  2DB1 A;  1TQL A;  2LDI A;  4ANC A;  8ATC B;  5DDR C;  3CCM S;  2FHJ D;  4I67 A;  3I0R A;  1RB0 A;  1LW2 A;  4MK7 A;  4CH0 S;  3TAQ A;  2B43 A;  1FRK A;  1LW2 B;  3KJV A;  2XCA A;  3NNC A;  4DV0 F;  2ZH4 A;  4FVM A;  1HBO A;  2D7S A;  2JOQ A;  4M5M A;  4IO9 Q;  2DY1 A;  2IRU A;  3J7A N;  4KH0 B;  1HWL A;  3T6J A;  4DQP A;  3KJQ B;  4I4B A;  4GO7 X;  3CE8 A;  3HSG A;  3QMQ A;  4UQG A;  2CQ0 A;  2QFI A;  4X4Q A;  2QA1 A;  3HT3 A;  4CLW A;  4FP9 A;  3CJK A;  3LP1 B;  1G7C B;  3ENQ A;  5F0W A;  3VZI A;  3SQG A;  5KFJ A;  2GMH A;  3QWU A;  4H4O B;  5GAH U;  2BQR A;  3UCU P;  5JXS A;  4ZPD A;  3PKY A;  5E3R A;  4KHM A;  1HBU A;  1WEX A;  3O5T B;  3TA2 A;  5IV4 A;  5L1I A;  3GJS B;  2YNI A;  1QD1 A;  3NGT A;  4NL5 A;  4BHQ A;  2E1R A;  2ZWP A;  1JIH A;  3SXL A;  5L9N A;  3QJJ A;  1YG0 A;  3SCJ E;  2XMM A;  4DR6 J;  2UU9 J;  4LR8 A;  1DBD A;  5DJB A;  2Y0S D;  2R7V A;  1DRZ A;  1UJ5 A;  5CH7 B;  2BRL A;  2YH0 A;  1RT5 A;  2LQ5 A;  2VFV A;  1RWK B;  1PAE X;  2HNY A;  1KSP A;  1E6Y B;  1JKH B;  2B9W A;  2VDI A;  3T1H J;  3K5P A;  4MIB A;  1Y5N B;  2B56 A;  2GHV C;  3IR6 B;  4PG7 A;  2V4R A;  4NXM J;  1HYS A;  1NAQ A;  4HAC B;  5F8M A;  3Q8V A;  1ZM9 A;  1JJ2 R;  2OLW A;  3CD0 A;  4C6A A;  5F3T A;  4NMX A;  4B3R F;  1JJH A;  2VZ9 A;  1KS2 A;  1VK3 A;  3P8B B;  2XS7 A;  2BJ1 A;  1WC6 A;  2E5H A;  3FBC A;  5F8J A;  3PIP Q;  3KLF A;  4FNH A;  2KRR A;  2HND A;  2MTL A;  3DDN A;  3TJ9 A;  5L1K A;  5M2R A;  4F4Z A;  1S48 A;  1KFD A;  1NLK L;  1TVR A;  2P6T A;  3Q89 A;  5FII A;  1HNW F;  4ICL B;  3H59 A;  4LMZ A;  3PYE A;  3A13 A;  1F0X A;  1A6L A;  4ECS A;  3W7B A;  4LF9 J;  4Q8F A;  1S10 A;  2XNQ A;  2B4U A;  5H9E J;  1K44 A;  3VGV A;  1YKW A;  2Y1J A;  3ISZ A;  2Z2L A;  3L7O A;  3TVK A;  3QJP A;  1IR0 A;  1NDP A;  1WKL A;  4F26 A;  5EWG A;  3KHL A;  4K5S A;  1WHX A;  2AEM A;  3KTQ A;  1QLN A;  3IMQ J;  2EBG A;  2PEB A;  1IKW B;  3CNQ P;  4EMD A;  3UNG C;  2DGQ A;  1N6Q B;  1Z1Z A;  1LFW A;  2IPO B;  2KHD A;  4EEY A;  1NKC A;  2DO4 A;  5D3G A;  1RT4 A;  1FJG J;  3MM7 A;  3OFH A;  4JOU A;  1CUL B;  4I2P A;  2ZH8 A;  4QPX A;  3MM7 B;  4LFC J;  4RNO A;  2MEW A;  2UXD J;  4ALZ A;  5C24 B;  1KNZ A;  4BWM A;  1RLD A;  1D3W A;  4FXW A;  1NB7 A;  1PCA A;  4DQR A;  1HWJ A;  3NBP A;  3M8Y A;  3N01 A;  2W2M P;  2A6O A;  3R97 A;  2FY8 A;  1TUG B;  5KT7 A;  4B9N A;  2AQ4 A;  4IQX A;  3A12 A;  1R7I A;  2BW7 A;  4ENO A;  4J9P A;  1Y11 A;  2ROG A;  1M5S A;  2RD5 C;  4ZMM A;  1X5S A;  3BYR A;  3QGH A;  1RT2 B;  4UOC A;  3GFH A;  4RZR A;  1J5O A;  2LQ9 A;  2KFZ A;  4DV6 J;  4FYW B;  3TOQ A;  3VAH A;  2A2D A;  1PAU B;  2DNH A;  2K7J A;  1PBU A;  1T3O A;  4OHZ A;  5HMY A;  2UXC J;  1TFY A;  1MSW D;  4ED7 A;  1T9Y A;  1X7V A;  3BGL A;  2KI2 A;  2JZ5 A;  4DR6 F;  4DDF A;  1T7P A;  4LF6 J;  1HNI A;  3M1V B;  3NEK A;  2CWX A;  4M5J A;  2XMU A;  3LF0 A;  1UW9 A;  2ACM A;  2FLO A;  2IBO A;  4J90 A;  4U8Y A;  3K8W A;  2ZH5 A;  1SKW A;  1HWU A;  4ZJQ A;  2H51 B;  1R0A B;  1F3F A;  4FN5 A;  1VGY A;  1RP5 A;  2KKH A;  3LAL A;  4WPA A;  3EX7 B;  2AJ1 A;  4X64 J;  1QVG R;  2W1B A;  3CCW A;  3JXO A;  1RXO B;  4OX9 F;  4MK8 A;  5KFW A;  3HPO A;  2BR0 A;  1BUX A;  3OW2 R;  5J2N A;  4EYI B;  2HFO A;  2CNK B;  1U2F A;  5LM7 E;  3M2R B;  1WEZ A;  3WC0 A;  4CLF A;  2IC3 A;  3M2R A;  4IRD A;  2BXJ A;  3W62 A;  1C4A A;  3WX4 A;  1Y7P A;  2IC3 B;  4RBT A;  5GMK a;  4JI1 F;  3W2W B;  3J7Y U;  5E3C A;  5HMW A;  2DGW A;  1KEK A;  1G2E A;  3TO8 A;  3PZP A;  4FS1 A;  1H98 A;  4ED5 A;  1AFJ A;  4IR9 A;  3KK3 B;  1S9G A;  1DQ8 A;  1S9G B;  1KKH A;  1U0H A;  1M0S A;  3IR7 B;  3P3D A;  2E44 A;  5E0O A;  4B02 A;  1TK8 A;  1RWU A;  3S8S A;  3BQ1 A;  3JSY A;  2J76 E;  1CSJ A;  4U8V A;  2K1R A;  3U1N A;  3UW1 A;  4EZ9 A;  3UO0 A;  3X1L B;  4FKY A;  2I0X A;  1X31 C;  2H5E A;  3MMA B;  3V6J A;  3SSQ A;  3D5M A;  1B0T A;  2WVB A;  1DTT A;  2YNF A;  1RYR A;  1BE4 A;  1JLE B;  2H5J B;  3US5 A;  4ED1 A;  3D6M B;  3BDP A;  2HNZ A;  1CS4 A;  2OKQ A;  3GV8 B;  2RQM A;  5KTQ A;  4G3I A;  5GAE U;  4DG1 B;  5J2Q A;  2CVE A;  2VFR A;  2WZ1 A;  3LGN A;  1GTH A;  4PKD B;  2XMA A;  4K4Y A;  5J2Q B;  2AV5 A;  3MTK A;  2D9O A;  2E7X A;  1UPM B;  2CQG A;  1RKJ A;  1IWA A;  3M2U B;  1NSQ A;  3RG6 A;  4K2X A;  3OR1 B;  2EW9 A;  2HHT A;  2QTW A;  2ZH6 A;  4ECX A;  3AT1 B;  3ICL A;  1H74 A;  8RUC A;  2U1A A;  3H5U A;  5HVF A;  3UCG A;  4ZPB A;  4DZD A;  3Q23 A;  2ZDP A;  1IN0 A;  4L74 A;  4OYM A;  4I6Y A;  3RAM A;  2O3D A;  2HHH J;  3KXD A;  2PI5 A;  3F44 A;  4AL7 A;  3NY0 A;  2DNZ A;  4P52 A;  4YB5 A;  4DR7 F;  1DFD A;  1YZ7 A;  3J7Y I;  1DY3 A;  3H90 A;  4TU7 A;  1VC0 A;  2ZZM A;  2YPY A;  5J1E A;  4MYU A;  4HHH A;  3S1T A;  2DIU A;  3NG8 A;  4RUA A;  1YIJ S;  1KD1 T;  2QV6 A;  1LWE A;  2EVZ A;  2MKY A;  2RQ4 A;  2V68 A;  3BF4 A;  5HJX A;  5K14 B;  2GHP A;  4I56 A;  4AD6 A;  4GC6 A;  3TAP A;  4C8K A;  2Q66 A;  4ZS6 A;  1MU2 A;  3SMZ A;  5GAD U;  4FF4 A;  1KHV A;  1BY9 A;  3MPV A;  3OUY A;  3W2V B;  1X9W A;  3QIP A;  4OLP A;  1RAF B;  4PYD A;  3UI3 A;  1J5E J;  4OX9 J;  3R1H A;  4C3M A;  4Y28 C;  2AW0 A;  3NS7 B;  2QRR A;  1HD0 A;  2VPX B;  4F0K A;  2N7Y A;  2OO4 A;  2DTJ A;  4Q0B A;  1F5C A;  1U26 A;  4HH0 A;  3R7B B;  3KLH A;  3C6U A;  3DHX A;  3C46 A;  4Y2M A;  4KT0 C;  5IM0 B;  2XSJ A;  1N33 F;  2GW8 A;  1F6T A;  1QSS A;  2MB0 B;  2V9K A;  2XSJ B;  2B9E A;  4RNH A;  4DPW A;  4ELT A;  5F8L A;  4XPC A;  1RWM B;  4ED8 A;  5CQG A;  1A7G E;  3MCO A;  2J0X A;  1Y0H A;  3OSP A;  2ZD1 A;  4Q45 A;  1QE1 B;  3CCS S;  2DR8 A;  2UUB F;  4C8N A;  2ZD1 B;  3UDE A;  3D6T B;  1N56 A;  5HAO A;  1ZM4 A;  1U1L A;  4F4K A;  4ZCL A;  3LP0 B;  2QLX A;  2RDD A;  2HHW A;  3G6Y A;  4J7C A;  1RHU B;  2MST A;  3RW6 A;  3MED A;  2K3K A;  3OJU A;  1CJV A;  1T8E A;  4HHU A;  1YJN S;  5K5M A;  2W9B A;  2FIU A;  3NCP A;  3DHW C;  2C42 A;  4LJM A;  5ETV A;  3HVR A;  2RIL A;  2GIQ A;  3GYG A;  4WP9 A;  3TR5 A;  1FNO A;  2AMC B;  3AA8 A;  5G0R B;  1HR0 F;  1EET A;  1YRX A;  4BS2 A;  1WF0 A;  1LNQ A;  3EGW B;  4K2J A;  1REG X;  2C1E B;  4YB7 A;  3DGP A;  1TP7 A;  1BQX A;  4KGV B;  5KFR A;  5KG0 A;  4CLT A;  5KG2 A;  2R8G A;  3MI7 X;  3LOU A;  5KG7 A;  1VBY A;  3IS9 B;  1DUR A;  4QU6 A;  2BOP A;  1WNE A;  1B0P A;  5FDL A;  3M8Z A;  1A9N B;  1HNV A;  4DR2 F;  1HMV B;  2AYE A;  5LMU F;  3QAE A;  4HEA 9;  2CA9 A;  2FHO B;  4NRT A;  3MFH A;  3LW5 C;  5J2M A;  3M30 A;  4F04 B;  4Z37 A;  4LSL B;  4KGZ B;  5A0Y B;  3GIL A;  2XHC A;  3VAL A;  3PX4 A;  3M05 A;  3TUI C;  1S1V A;  3P6Y C;  1RAC B;  1HHQ A;  5EX3 A;  5LL6 d;  1YJW S;  2RU9 A;  1U6B A;  3NWR A;  2F4F A;  3GYX B;  3ZFV A;  1SC1 B;  4Y34 A;  5D77 A;  3H98 A;  2XMW A;  2W9A A;  3KDN A;  1JXV A;  4WJB A;  5HLF B;  1VC5 A;  2ZOG A;  2JJ4 D;  1NSP A;  3PW7 A;  2ASD A;  2C2E A;  2YKM B;  2QN6 B;  2VH7 A;  3Q86 A;  1LV5 A;  2N4D A;  3KYL A;  1OPZ A;  2DCU B;  1KWM A;  2ZBC A;  3PFE A;  3BN4 A;  1S9E B;  4TY9 A;  2KDO A;  2W9C B;  2DNY A;  4DN9 A;  1AB8 A;  2DIS A;  4ECV A;  2VA3 A;  4F0H A;  2FC9 A;  4NLY A;  2J8A A;  2LXI A;  2MXY A;  5CZX A;  1SJ1 A;  7FDR A;  4F8R A;  1QSY A;  2VJU A;  4Q8E A;  1SXL A;  2F9J A;  1R3N A;  2A1B A;  2M2B A;  3GIJ A;  4FYD A;  4OMF G;  1YSJ A;  4ZP6 A;  3N5F A;  1N33 J;  1AW0 A;  2UUT A;  1U45 A;  3ZC4 A;  4EWT A;  2OGU A;  4JI5 F;  3IXQ A;  4QIF A;  2MZ1 A;  2XWX A;  4DR7 J;  3JYT A;  2KXF A;  3N5B A;  5HSP A;  1YIT S;  2RKI B;  4ZJL A;  2RKI A;  4QPT A;  1XJW B;  1R6V A;  3HVT A;  5T7L A;  3GII A;  2DEI A;  1TUV A;  1VHF A;  3FC9 A;  2KVI A;  3DLG B;  3M32 A;  1R31 A;  4P71 A;  4ETX A;  3M32 B;  4UOG A;  3LH2 S;  4M94 A;  1FVS A;  2MQN A;  1FKA F;  5BYQ A;  1UJ6 A;  3B4D A;  3PM9 A;  2UVW A;  4IG3 A;  5ETK A;  2XLI A;  2C2N A;  4IG0 B;  5BJR A;  2YX4 A;  4K4V A;  2NUH A;  2CJ9 A;  1GMW D;  1GAO A;  1S57 A;  1DHM A;  2CPE A;  2XSF A;  2QC3 A;  3FEY B;  4OJ3 A;  3WQP A;  4CYU A;  3LWL A;  3PW0 A;  1OWX A;  5ETT A;  5BXI A;  1HBU B;  3T5J A;  4OYB A;  4LSN A;  3OFE A;  2D3O R;  4DMZ A;  3ZTS A;  2M70 A;  2B6A B;  1S5Z A;  2Z2M A;  1TMM A;  1W26 A;  5LJ5 Y;  2QMX A;  3ZXW A;  1RYS A;  2OEM A;  1R6Y A;  2LQB A;  2V8H A;  4N5S A;  3M6V A;  4PCQ A;  3K5N A;  3PX6 A;  5C2G A;  3OVB A;  3GCW P;  5C25 A;  4NLX A;  5J1N A;  5GAH I;  2CAD A;  1FNM A;  5C25 B;  4P2M A;  4DU8 A;  1X8D A;  5KFL A;  2HFN A;  2ZOF A;  4C11 A;  3GWC A;  4ZPV R;  3KK2 B;  2JEF A;  2VG6 A;  3CC7 S;  1TK5 A;  2IA0 A;  1F5A A;  3PY8 A;  5A8R A;  3HVW A;  3G82 B;  3CIZ A;  4EO6 A;  1NK7 A;  4DV0 J;  2RQC A;  1LOU A;  3TP2 A;  3CTR A;  5KOW A;  1X4E A;  2VHG A;  4MIW A;  2MGZ B;  3NS6 A;  2HBR B;  1FF2 A;  3MUR P;  2HRU A;  2Q3P A;  3ADA C;  1H38 A;  1VYA A;  4CLZ A;  1SKS A;  4ZVP B;  4N8O A;  4ELU A;  2DBB A;  4R8U B;  5M2P A;  3PR5 B;  3BH6 B;  4QIV A;  2E9T A;  6AT1 B;  4F2S A;  2MLZ A;  3HZG A;  1M5P C;  4X4O A;  1TKD A;  2D3U A;  2EK6 A;  2ASJ A;  3MEC B;  4QYZ K;  1UL3 A;  3B6B A;  1Y9O A;  2ZZN A;  1M1G A;  2B4P A;  1X4B A;  2CPZ A;  2EK1 A;  2XTJ P;  5DS7 A;  2UXB F;  3QLH B;  1NXI A;  2HW3 A;  3CB4 A;  1X4H A;  2EKN A;  1SJQ A;  2CQC A;  4NLT A;  4WIQ A;  4P10 A;  3CPW R;  1HI0 P;  1WC4 A;  3QFW A;  2W4P A;  4A8S A;  5DG7 A;  3W65 A;  1BWE A;  1S97 A;  1CPZ A;  2UXC F;  2IYG A;  1I3O B;  2YKA A;  5DQG A;  4ECU A;  2UVR A;  4JI0 J;  2IBK A;  2CQH A;  3CCV S;  3MMC A;  2MKH A;  3BZQ A;  4O4R A;  2I6W A;  4K4T A;  3MMC B;  4FZV A;  2R2S A;  3I0S A;  4L73 A;  2CJY B;  1EQ0 A;  4IQM A;  3SEO A;  3E01 A;  1BGX T;  3E01 B;  1JXL A;  3RW7 A;  3ITH B;  4OI1 A;  1HBN A;  2CQ4 A;  1UZH A;  3FZ2 A;  2ZIT A;  3WIV A;  1MWZ A;  3NKY A;  2XNR A;  3EUN A;  1OO0 B;  1UAW A;  2PN6 A;  3NLC A;  4M63 A;  4P2F A;  2YNG A;  4J5O A;  4CLL A;  2J9E A;  2R2U A;  1VLO A;  3CCQ S;  4X62 F;  3HVA A;  3K89 A;  4A8W A;  4G1I A;  2I38 A;  2BE9 B;  3NS5 A;  1S0M A;  2XY5 A;  3GLJ A;  3EXY A;  1VRU B;  1VK8 A;  5DM7 Q;  2HFS A;  1D9F A;  1ARO P;  3CVK A;  1R0B G;  4TY8 A;  2BDP A;  2Y8Y A;  1CJT A;  4Y2C A;  1KFS A;  4TY8 B;  4ZCM A;  3NMR A;  5EWE A;  3M8S A;  3BKF A;  5DGA A;  5D4P A;  1LW0 B;  1UWA A;  3G6V A;  4K0K J;  2DPI A;  5E5N A;  2VJV A;  3I32 A;  2GO8 A;  1C0U B;  3HMJ G;  1CJK A;  1VRT A;  3MUT P;  4FYY B;  4PWD B;  3JAM Y;  2WK4 A;  2EFQ A;  2ALZ A;  1C0T A;  2UVV A;  3B54 A;  4V19 X;  2YKQ A;  5LSO A;  1UCN A;  1Q7L B;  1N88 A;  2IHR 1;  4QR1 A;  2ZH1 A;  2W2Q P;  2ROP A;  4MKA A;  4BWJ A;  2VBZ A;  5KFO A;  3CJ0 A;  5THW A;  3TYT A;  4ECZ A;  3D0I E;  1I94 J;  4FF2 A;  2R7X A;  4NI2 B;  1DAX A;  1FRX A;  2G0I A;  3PYG A;  3G6X A;  4LBP A;  3V2U C;  1HNW J;  4V19 J;  3BH7 B;  4Y6I A;  4YFU A;  1N8R T;  3QSY B;  4EZ6 A;  2G4B A;  4O4G B;  2NYH A;  4O4G A;  5IT9 U;  5F8H A;  1CJU B;  1HW8 A;  1T9T A;  3FRZ A;  3MR3 A;  5KFQ A;  1U09 A;  3JSR A;  3HKW A;  3OD2 A;  1Q5Y A;  5L8R C;  2B4V A;  5KFP A;  3K59 A;  4ZVS B;  3S7R A;  4X4P A;  1RTD A;  2HVH A;  1VQ4 S;  2DGT A;  2ZE2 B;  2DH8 A;  2KYX A;  4I7F A;  1Y5I B;  4K4X A;  1N5Q A;  5HP1 B;  2EC0 A;  4WZM A;  2FPH X;  1YRT A;  3E8O A;  3FSY A;  3CJ2 A;  2CPY A;  4DQS A;  3PW5 A;  5HL7 Q;  1S77 D;  2V6A A;  1ROF A;  1S1X B;  5A76 A;  4IYQ A;  4KQZ A;  1M5V C;  4LRF A;  5FLX Y;  1DTT B;  2RF2 B;  2J9D E;  5KFE A;  1G6B A;  4CLS A;  1WTB A;  1QUV A;  2HQG A;  2Y0B B;  4I69 A;  3H7H B;  3AA9 A;  2YTC A;  4WFN Q;  2PMZ D;  3PYF A;  2E1M C;  2XZW A;  1IVZ A;  1UA1 A;  1Q16 B;  1FKO B;  1OSC A;  2BAN B;  1IXK A;  5LSR A;  1HPZ A;  4DV3 J;  2HVZ A;  3QWP A;  4LVN P;  1NK0 A;  3D0H E;  3OBI A;  1YK9 A;  1FK9 A;  2B8P A;  3ILL A;  1R8C A;  2DGU A;  3EM1 A;  3THT A;  4DOZ A;  1TL4 A;  5KFF A;  1XMO F;  1QAJ A;  4KHP F;  3VQT A;  3MOZ A;  4DBQ A;  2WSE C;  2MLY A;  4NLV A;  2DY9 A;  1NJW A;  2GML A;  5D4O A;  4LFB J;  4UOF A;  2V0N A;  1T95 A;  2W2N P;  1UVI A;  3KNG A;  3OFG A;  3UD4 P;  2XG8 A;  2OPS A;  1GTE A;  1HQ2 A;  3F73 A;  1T9V A;  4ECR A;  3GP9 A;  4P74 A;  1WDD A;  2Y1I A;  1XNR J;  1XER A;  2ZVS A;  3FNN A;  2MZT A;  1FHT A;  3N0V A;  1MRO A;  3FCH A;  3MAA A;  4AXJ A;  4ID5 A;  5HBM A;  5A8K A;  3CF5 Q;  3RB6 A;  1SC6 A;  1SIZ A;  4KYZ A;  3LPY A;  4PPD A;  2R7W A;  3U27 A;  3RB0 A;  1M5K C;  3KJF B;  2HG4 A;  4J9R A;  3CCL S;  4HH1 A;  2HHP A;  1U8S A;  1QUP A;  3DU5 A;  1IKV B;  3OFF A;  4J9Q A;  4DWI A;  3DNC A;  5KFU A;  3W2V A;  2B9X A;  1R8P A;  3ZZU A;  2Z2Y B;  4DL0 C;  5IT0 A;  1S1W B;  2IYI A;  4DUZ F;  4N76 A;  4DR3 J;  1FDN A;  1X4A A;  3VGT A;  4ED4 A;  4ID8 A;  5F0U A;  2E1A A;  4K5R A;  2GC8 A;  1ZAX A;  4B3M J;  4DV6 F;  1FWK A;  2MQM A;  4H4O A;  1GMU A;  4DV4 F;  1FD8 A;  2BV3 A;  2OPP B;  1JWW A;  3CJ4 A;  2XGP A;  2MKJ A;  2AJF E;  4CRJ A;  4X4R A;  4C8L A;  4LSZ B;  4DUT A;  2FJV A;  4CCH A;  1B99 A;  4ZVR B;  1SUQ A;  2G2Z A;  4PXB A;  5EDW A;  2JC0 A;  3RUB L;  3TX8 A;  2M9K A;  3QPI A;  4OX7 A;  3IR5 B;  3FMB A;  5KAK A;  1YRU A;  1FKP A;  2K3I A;  4NPO A;  2FJW A;  2ADB A;  1T9X A;  3M4X A;  3KLI B;  4DL4 A;  1FJ7 A;  3BEG B;  4DL2 A;  1V5V A;  1KON A;  5CYM B;  1S6P B;  4PG8 A;  1RBO B;  4DL5 A;  2YWF A;  3POT B;  3TJ8 A;  2ILY A;  2LXU A;  1E6Y A;  1JKH A;  1PIE A;  1VLY A;  3AB2 B;  3QO9 B;  3ET6 A;  4ZN1 A;  1YWX A;  1HNX F;  2FJX A;  2RB7 A;  1Q5V A;  3DDI A;  2YQ1 A;  4USU A;  2HHU A;  1FES A;  1SBR A;  4OZJ A;  5ETQ A;  2V4J B;  2W9B B;  2E9Z A;  3VQS A;  1S6Q A;  1EP4 A;  4O3Q A;  3UDL A;  2Y3Y A;  5K20 B;  3JSM B;  3QGI A;  2D74 B;  4HDH A;  3CCZ A;  4C8O A;  3Q8R B;  4B08 A;  3BGO P;  5ETS A;  2B51 A;  2ZH7 A;  2VOD A;  3UCZ P;  4OHY A;  2EFV A;  5ETN A;  2YWG A;  4C97 A;  4LF9 F;  5D4L A;  1UFW A;  3GFX A;  4EBC A;  1FTR A;  4PG4 A;  4PWW A;  3ISN C;  4NCG A;  2C2O B;  2CIM A;  4NCG B;  3AXK A;  1WHW A;  3HCX A;  4ETZ A;  1XEZ A;  1S6U A;  3BGU A;  1OIA A;  3N6N A;  4Y2I A;  4DPU A;  1KRP A;  3DYA A;  3P49 B;  1Y5L B;  1HI1 A;  1HW9 A;  3R5B A;  5A0Y A;  4NLQ A;  1RT3 B;  2XO6 A;  1NKE A;  1AT1 B;  2A0F B;  1S1V B;  1RT6 A;  2BE2 A;  2RJZ A;  2RT3 A;  3Q8Y A;  1M5O C;  3CD6 S;  1TKT A;  2GX8 A;  1IBL F;  2FVS A;  4E0D A;  1O5J A;  2R7T A;  3OLA A;  1ZS6 A;  5J2P A;  1L3V A;  1BQM A;  3HHL C;  5KFI A;  4ZLN A;  4IKA A;  5L46 A;  2PGC A;  5J2P B;  2ZH3 A;  3IG1 A;  4YR0 A;  3CCU S;  4JI7 J;  3CDB A;  5A8W B;  1JXE A;  3OHA A;  2J0Q D;  4RNM A;  2DYA A;  2UZA A;  4B9T A;  3NCQ A;  1FRH A;  1VQK S;  2YKO A;  1NME B;  4QR0 A;  4ITS A;  3CCT A;  3WBZ A;  1S12 A;  4I1T A;  4NYP A;  3M9M B;  4JV1 A;  3TEH B;  2EPI A;  1I51 B;  3C16 A;  2FLP A;  4ZPC A;  2UV8 A;  1VFJ A;  1WD6 A;  4IOA Q;  3SFG A;  2C3M A;  1QY7 A;  3DOL B;  1FRI A;  3GIR A;  2HGL A;  2QIF A;  4WXO A;  2KJW A;  3T5H A;  2E5L F;  1XMQ F;  2DR6 A;  2KB2 A;  1F2H A;  4OYW A;  2C3U A;  1Y10 A;  2DXF A;  4CM0 A;  2LEP A;  3MDF A;  1HAR A;  1LEO A;  1XR7 A;  3IWX A;  1N32 F;  3HDS A;  2HFV A;  2YNH B;  2I9S A;  2IA6 A;  4KKO B;  2AEJ A;  3S6E A;  1U4B A;  3OTB A;  3C3L A;  2HYI B;  1RAA B;  4Z2X A;  2DIV A;  4P75 A;  2ZNY A;  4DR1 F;  2QE5 A;  2VPW B;  4RNF A;  5AE3 A;  1RHR B;  1GXU A;  2G1H A;  4MH8 A;  2BJD A;  4DPX A;  5LXR A;  2UUW A;  1VQ5 S;  3KMQ A;  4F02 A;  3FBE A;  4U7C A;  1XMB A;  1SL1 A;  2OJ3 A;  4B9V A;  1H6K X;  4OIX A;  4ZVU B;  4N41 A;  2V2Z A;  2YBV A;  4ZHR A;  3HXM A;  1URN A;  2ZC4 A;  5IT9 Y;  1EKS A;  1QM9 A;  3V6H A;  4HR2 A;  1B7Y B;  1WC5 A;  4UW2 A;  3H4B A;  3PG9 A;  1VQP S;  1GFW B;  2VC1 A;  1PYO B;  2BJ9 A;  3A8J A;  1FI4 A;  2VPZ B;  4ICL A;  2CQB A;  1Q82 T;  2CUY A;  2E5I A;  1F9H A;  3DC2 A;  3L7U A;  1CC8 A;  2VPY B;  1NM2 A;  2WVE A;  3VV2 B;  3D3C J;  3K17 A;  3L3C A;  2E1C A;  1BQN A;  1DJ0 A;  2HEK A;  2R4F A;  5HAN A;  1NK6 A;  4TNO A;  1QTM A;  1RSC A;  3KMS A;  3ZZZ A;  4F4X A;  1S0N A;  3IA0 A;  2V94 A;  1WJ9 A;  4RKU C;  2OPR B;  4A8Y A;  1YJ7 A;  4LBI A;  4PG6 A;  4OHV A;  2OPR A;  3OTD A;  4ZVF A;  1RT1 A;  2VF3 A;  1JJ4 A;  3CC4 S;  2DR7 A;  1VS3 A;  3OV7 A;  3EGV A;  2J6T A;  4C3L A;  1VQ6 S;  1X0F A;  2NYI A;  3UE2 A;  1S59 A;  4JB8 B;  4C0H A;  3ENV A;  4IFY B;  5IQ6 A;  3HO1 A;  3W8P A;  1RLC L;  2N3L A;  1TL3 B;  3C14 A;  4ERD A;  3SCK E;  3H2U B;  4QR2 A;  1U8W A;  4K59 A;  4PYA A;  2JEG A;  2AGQ A;  1PC4 A;  5C42 B;  3MAQ A;  2R7U A;  1FEE A;  4K4S A;  4JI3 J;  1NDK A;  3FVY A;  4O3N A;  5IV3 A;  3H40 A;  1U7L A;  2R8J A;  1PGZ A;  3W64 A;  3PV8 A;  2LLZ A;  1U24 A;  5L38 A;  1TZ0 A;  2OEJ A;  2B7C B;  5E41 A;  5KT6 A;  4MMO A;  3IM8 A;  3BBB A;  3SZ2 A;  1F9E B;  1UJ4 A;  5AXL A;  4NLP A;  4ES2 A;  5FD1 A;  3KLV A;  4OI4 A;  3KK1 B;  4FDF A;  2PO4 A;  3TQ1 A;  2P2C B;  4USI A;  2W2O P;  3C15 A;  3GV7 B;  3QGP A;  5RUB A;  1ZH5 A;  3H5X A;  3FEX B;  5A2Q Y;  2XO7 A;  1ZTT A;  1K73 T;  5HK4 A;  3M1V A;  5D3G B;  1WF2 A;  1HFE L;  5LSL A;  3BJY A;  1N5V A;  3D66 A;  3BGF A;  2ZBI A;  4WYL A;  2I5J B;  5E3P A;  2GVD A;  3UPF A;  2WVD A;  2VQE F;  4FPR A;  5KFM A;  1WG5 A;  2GVD B;  4B9S A;  1D8Y A;  2XLK A;  3UN5 A;  1NK5 A;  3F41 A;  4PWU A;  1ZAV A;  1T9W A;  2GHW A;  2IDE A;  3LA0 A;  3P5T L;  1ZOT A;  2LYV A;  3RRK A;  1TL5 A;  3QIP B;  1UZD A;  3EYZ A;  3KOA A;  3UWT A;  1NUE A;  2FJA B;  5CD4 H;  3ZTO A;  3PJX A;  5E7O B;  2X1A A;  1TFW A;  3I55 S;  5D0G A;  5KFG A;  3Q2S C;  3IBF B;  4USK A;  2OFG X;  2QSW A;  2ROE A;  1JLQ A;  3A8I A;  3HHD A;  4O3P A;  3GQC A;  2AGO A;  4WII A;  1CQM A;  1HQE B;  2HZC A;  4OZN A;  4HTJ A;  3RBZ A;  5KFC A;  1SL0 A;  4JI3 F;  1HD1 A;  2RQK A;  2GIF A;  2BKP A;  3OL6 A;  2FJB B;  1MWQ A;  1VHI A;  3FFI A;  1CEZ A;  1N5Y A;  1YHQ S;  4TXS A;  4QYR A;  1IJF B;  2R8K A;  2P9C A;  3DRR A;  2HAF A;  3EVW A;  4B17 A;  1BLU A;  4CI0 B;  3I56 S;  3DLL Q;  1VRT B;  4LFC F;  4OV1 A;  4UY8 5;  4NEY A;  1EB0 A;  3DLJ A;  1RDR A;  4JUZ A;  4RU9 A;  2EC2 A;  3G87 A;  4DXL A;  1U1K A;  2WBR A;  3GON A;  4O44 A;  2FZG B;  2XI2 A;  3AJ2 A;  3EDR B;  2QA4 G;  3CME S;  2XY7 A;  1H72 C;  1QAY A;  3I96 A;  3JSB A;  3OTE A;  5EGY A;  4DL6 A;  1HNX J;  1IBM F;  2DR5 A;  3ILJ A;  1ZZF A;  1YBT A;  1JNR B;  1UPP A;  4USM A;  2ZJP Q;  3PVX A;  5K8N A;  3SIP B;  3TAN A;  5JVG Q;  3TX0 A;  2IJR A;  1WSV A;  3OT9 A;  4H4M A;  1K8A T;  3OR1 A;  3H0P A;  3H8Y A;  4MKV A;  1V6H A;  4CO0 A;  4RW7 A;  1N34 J;  3PRV A;  3UR3 C;  3VGS A;  1RTH B;  2FJD B;  1R27 B;  1U0H B;  4X66 J;  1X4G A;  1S9F A;  4HVZ A;  3J7Z T;  4B3T J;  3LTO A;  3C8Y A;  5DQI A;  3NGK A;  5DZ6 A;  1K47 A;  4ZCI A;  1T02 A;  3D54 A;  2N82 B;  4DSL A;  5C7P A;  2KH9 A;  1DTQ A;  1HQU B;  2FHK A; 
#chains in the Genus database with same CATH homology
 4OYP A;  5IV4 A;  3UVJ B;  4P2F A;  4CLP A;  4CLL A;  4WP8 A;  4OYI A;  1CUL A;  1CS4 A;  1WC3 A;  1AB8 A;  5D0E A;  1CJT A;  2WZ1 A;  3C14 A;  3C16 B;  3ET6 A;  1CS4 B;  1CJK A;  1CJV B;  4USU A;  3MR7 A;  1WC6 A;  5IV3 A;  4OYM A;  4OZ2 A;  4NI2 B;  1AZS A;  4CLU A;  1AZS B;  1FX2 A;  2GVZ A;  3C15 A;  3MAA B;  1CJU B;  4NI2 A;  2QV6 A;  2GVD A;  1WC0 A;  2GVZ B;  2W01 A;  2GVD B;  1FX4 A;  1CUL B;  4OYB A;  1CJT B;  4OYA A;  5D15 A;  5D0G A;  1TL7 A;  3UVJ A;  4CLS A;  1TL7 B;  4P2M A;  2BW7 A;  1Y11 A;  4OYX A;  5D0R A;  1WC1 A;  3G82 B;  4WP3 A;  3C16 A;  4OZ3 A;  1YK9 A;  3R5G A;  4CLK A;  1YBU A;  4CM0 A;  4OYW A;  1Y10 A;  3C14 B;  3C15 B;  4CLZ A;  3G82 A;  1CJK B;  4USW A;  1CJV A;  5D0H A;  4WP9 A;  1YBT A;  4WPA A;  3ET6 B;  3MAA A;  4CLY A;  1CJU A;  4CLT A;  1WC4 A;  4USV A;  1WC5 A;  4CLF A;  4P2X A;  1U0H B;  4CLW A;  4OYZ A;  4CM2 A;  4UST A;  1U0H A;  4OYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...