1CJVA

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mg, and zn
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
189
Chain Sequence
b'MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLATE CYCLASE, TYPE V
publication title Two-metal-Ion catalysis in adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
total genus 55
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cjvA00
1CJVA 2BW7A 1YK9A 3R5GA 1CJKA 4CLWA 4USVA 4CLLA 3C16A 5D15A 3C14A 3ET6B 4OYWA 1CJTA 1CJVB 5D0RA 4CLUA 4USWA 5IV4A 2GVZA 1CJKB 4OYZA 4CLYA 4CLSA 3MAAA 2W01A 5D0HA 3C16B 1WC0A 4USUA 3G82A 3C14B 1YBUA 4NI2A 4CLFA 1CJTB 1WC6A 1CS4A 1CJUB 3C15A 1U0HA 2GVZB 4OYAA 3MAAB 1CULA 4WP9A 5D0GA 4OYMA 3G82B 1WC5A 4NI2B 4WP3A 5D0EA 1CS4B 3C15B 3MR7A 1U0HB 4OYPA 1YBTA 4CLPA 4P2FA 1CULB 4CLTA 4CM0A 4WPAA 4P2MA 4P2XA 1Y10A 3UVJA 1TL7A 4OYOA 4OZ2A 1WC3A 2GVDB 4CLKA 1FX4A 4OYXA 1AZSA 2WZ1A 4OYBA 1WC1A 1WC4A 4CLZA 3UVJB 1TL7B 1Y11A 2GVDA 1AB8A 4OYIA 2QV6A 5IV3A 1CJUA 1AZSB 4WP8A 1FX2A 4OZ3A 4CM2A 3ET6A 4USTA
chains in the Genus database with same CATH superfamily
2MKJA 4OQJA 2ALYB 1RT3B 5LOQA 4G6VB 2HGLA 4USVA 1DY3A 3IAS9 3RTVA 4EBEA 1YI2S 2HEKA 3LAMA 4QIEA 4ED3A 4LFCJ 3Q0AA 5AXKA 4DN0A 2FHOB 2XMUA 4HHUA 4URSA 2GAGC 4CO2A 3FMBA 3PVXA 2VPWB 1GXTA 4NE9C 2CWXA 2PD1A 4QZVB 3TJ8A 1S0VA 1MN9A 4ZVSB 2A6OA 5KFPA 4TQRA 3LP2A 4PUOB 1RLDA 4AL5A 1JMTA 5GAHU 2CVEA 2LLZA 3Q8UA 3QIDA 3I4PA 2NZ4A 3W1YC 2QIFA 2WSFC 4HDGA 4LF5J 1TKZB 5A8WA 4DS5A 3IGNA 3M8ZA 3AD9C 1RHRB 3TW0A 3RRGA 1RB0A 2QMUB 2KXHA 2ZH3A 1HQ2A 5IV3A 2XGQA 3EICA 1FJGJ 3DRRA 3PO4A 3CSKA 3HD2A 1EJ7L 1LW0B 1BQNA 1ULRA 4DQRA 2HWTA 2L08A 2R3VA 1VQOS 3S01A 4MFBB 2G0CA 4F0MA 3ZNUA 4FF3A 3MM7A 2HBZB 2K2PA 2MQOA 3B78A 4U8YA 1HIYA 2FJDB 5C25B 4DR6F 5FIIA 4F4YA 2RQMA 4KTQA 3VGUA 4LF8F 4K4UA 1G1XA 3N6MA 4JI4J 5HSPA 2EFPA 4DHVA 2FGCA 1C1BA 4IG0B 4ZPBA 4LR7A 1YBTA 3KLFA 2DPJA 2RD5C 1OQ3A 4DSEA 4EU0A 4J9NA 3BO4A 4DPUA 2V2ZA 2CWKA 2KI2A 2HMIA 3PW7A 4F4AA 4YDDB 1WJ9A 4LBPA 1HYSB 5B0DA 2B0GA 3KHLA 5F0UA 1J5EF 2B51A 1TK5A 1R7IA 2LFVA 3GONA 1JNRB 3CC7S 2KVIA 2VASA 3L7OA 1HI0P 1AFIA 3MPUB 3P4UB 4ZLPA 1FFSB 3TVYA 2AHOB 3TOQA 3DLEB 2QLJB 2IA0A 3GV5B 1WKJA 1L3KA 2LYVA 2NXJA 2DY1A 2HSEB 5KT4A 3NCQA 5KFSA 1GMWA 4DSFA 1NSPA 3TUIC 1FVSA 4PG5A 2BJ3A 3KLHB 5CZVA 5KFCA 4DV0F 1RYSA 4UQGA 1CS4B 4UZCA 1S72S 4OI2A 1NJWA 1WOPA 2ABYA 2MJNA 1GNKA 1VDHA 4ED6A 4U7UK 2UXCF 4FXVA 4OLOA 5L1KA 2IDLA 3J7YU 3ITHB 4NMLA 4RL1A 1I5OB 4UF4A 2PA3A 4EZ9A 3CCES 4ZPVR 2PMHA 1FRLA 4NYPA 4OZ3A 3N28A 1FCAA 3AA8A 3DCAA 2EG2A 2V8PA 1IXKA 2VOOA 4WK1A 3OTDA 2KM8B 1R43A 2M9KA 3OTOJ 2E44A 3V4MA 4DV7J 1XC9A 1BHNA 1YVFA 4MKAA 5F0WA 4FXDA 1XWLA 4PXEA 2W01A 3JQKA 3KLVA 5SZTA 2NSCA 1M5HA 1HA1A 2RKIB 1I94J 2BANA 5HP1B 4A8FA 1Q8BA 2VDHA 1S1TB 1S1UB 4FPIA 4V1Ak 3TANA 4M94A 3M9OB 1O0PA 2FLNA 5ETQA 3HM9A 1VQ4S 1RHUB 3LF0A 1IJFB 3N4WA 4P2MA 4YN3B 4DZ6A 4M95A 3GCXP 1HNVB 3QFWA 4DS4A 2VFSA 5I3UA 5KG1A 4KT0C 2CQ4A 4V19X 3N9UC 3B8HA 3W3SA 1Q86T 2XHCA 1ZA2B 2D74B 5DETA 2ADCA 1S48A 1HBOB 4WZMA 2ZH1A 4RW8A 2VKZG 3QRQA 2CQ3A 4CI0B 4B3MJ 4DV6J 3GFXA 3HF5A 1TP7A 3CE8A 1H0HB 5LXRA 2Q43A 3DOLB 3MAAA 1VRTA 4DZDA 2RQKA 4LRAA 3O8WA 4UY85 1N0VC 5IT4A 1P9YA 3MEGA 3J7Z5 3PY8A 1GFWB 1GTHA 2XLJA 1NZAA 3K57A 3EGWB 3I32A 1RACB 3KUHA 4DI6A 4EEYA 4P2FA 3F44A 2YKMB 4U8VA 3DOKA 5ETMA 1Q7YT 1TL7A 3RZAA 2M52A 1REGX 1KKHA 1TAQA 2C42A 1XBWA 1W25A 4DQSA 1FHTA 2CKWA 2ZBIA 3T1YJ 2QYCA 3EZOA 1AZSA 5CYMB 2DH8A 3GE9A 4M63A 1HQEB 2GGPB 4KGVB 2FIUA 3IWLA 4HTIA 3UI3A 3A8KA 2P9GA 4Q7AA 1C1CA 1KHWA 2B7BB 2FPHX 2HHSA 2I6WA 4JI7F 2YXLA 4C3MA 2CDRB 2OPQA 4C4WA 3MM5A 3RW7A 3G6VA 3T9NA 3MCOA 3G8QA 3IG1B 2M8HA 2FY1A 5C24B 1TV6A 3CJ8A 3EVMA 4L3KA 2W4PA 3HULA 3H59A 4C9DA 3MHYA 3JYTB 4LSNB 4C98A 4ZVTB 4ZCKA 4JI8F 4DBQA 4AL7A 1Q7LB 2DJWA 4HACA 5D0EA 3OFHA 4ED7A 1T9VA 4ZN1A 1YX2A 4QWAA 3KK2A 1S9EB 2A2CA 2HFOA 1U2FA 3M7VA 5C2GA 1S6PB 3WC0A 1NNDA 1HI8A 4OZ0A 5L39A 2R2UA 2VA3A 4NZ7A 3W61A 1KQSR 5KFJA 3CPWR 1QVGR 4ANDA 1AFJA 3C6UA 3T5HA 4USKA 1NKBA 1VQ8S 3M2UB 2NCKL 4ZLNA 2IMOA 1QJHA 2VA2A 2QMXA 4F36A 4B9LA 3VAMA 4I4BA 4RW9B 3PIOQ 4WFAQ 4I6WA 1S9FA 2CJ9A 1TKXB 4DCJB 2M7SA 5EHHA 5DDOC 1JXLA 1QUPA 3PFEA 2DH9A 2RHSB 3MPYA 5KOWA 1RAGB 2XQCA 3W5YA 2Y8WA 4TY8A 1DARA 5HN0A 4HI2A 1T9WA 2YTCA 3DM2A 5CCMA 1YITS 4ER8A 3VGTA 4LF6J 3K0JA 1WUUA 2OPSA 5KFGA 4MYUA 2Y1LB 5T14A 2E1CA 3CCJS 4GKJJ 4MK7A 3BGFA 1PG5B 3SQOP 3FC9A 4DL0C 1Y0HA 3T19A 1CQMA 4DF8A 3CUNA 4NLVA 2V68A 5E3AA 2GQ2A 2ZOMA 3L95X 4IH7A 2ZE2A 3GB0A 2KHCA 1U4BA 3ZNJ1 2HYIB 1EQMA 4HR2A 1EETB 3QAEA 3GCWP 4K4YA 4USTA 2A18A 2VBXA 3AOBA 2QYGA 1URRA 5F8HA 2ZM6F 2E29A 2J6UA 4DWIA 2WOMA 1SC1B 2PFFB 1S7IA 4OLPA 4RBUA 4OYWA 4J90A 1HHSA 1VQLS 2BXJA 1K47A 1MMDA 1WG4A 4YMEA 4RW4B 2Y0BB 3DI6B 3LOUA 3V6DB 2VU5A 1RBOB 3MZIA 4W4MA 2YPYA 3G6XA 5K14A 2O01C 3HI9A 1RU2A 1QSYA 1UFKA 4DF4A 1UKUA 2HNZB 5ETTA 2C3UA 2XO6A 4KAIA 1SKUB 2FHJD 1UWBB 1RT1A 2PI5A 1FWLA 3VZIA 1TUVA 2EI5A 2K1RA 2HK2A 1VQMS 1RT4A 5F8NA 2QG9B 2XY6A 2DBBA 1NK4A 3KWMA 3K7RA 5F9LA 3OT9A 2X1FA 1M1GA 4PR6A 3GWCA 2N82B 2W8LA 4G1QB 3TWZA 3BQ1A 4ZP6A 5LMNF 3S6EA 2J7WA 4MKBA 2R2RA 2DNGA 4JUZA 2G0IA 2FD2A 4YB7A 4JI0F 4U7UD 3F73A 2I2YA 4Y65A 5IZHA 2C2DA 3D66A 2GA7A 5KFOA 2GS8A 2YWGA 2VDIA 4MK9A 2HHHJ 2J9EA 3QT7A 2PC6A 3MUMP 3HFKA 3KLIA 5L9NA 4JI2J 4MKVA 1RAAB 2PMWA 1VMBA 3TAQA 4Z37A 2AYBA 1PAEX 3G87A 2JLFA 4F0KA 1IKVA 2RT3A 2GQQA 2HS0A 4Q5VA 3EDRB 3CCQS 3H8YA 2MHNA 2MZRA 1FNMA 5F8GA 3QWUA 2V2QA 4C97A 1NO8A 5A8WB 3LA0A 2RE1A 1FEHA 2CQGA 1WG5A 3C19A 1T05B 2LU2A 3N5BA 4ID5A 4ID8A 1FJCA 4B9NA 5CABA 1SVDA 1HNZF 4C11A 1T11A 3DRRB 3U02A 3CMES 3K89A 2FDNA 1BQNB 5F8JA 2NQPA 4PPDA 5A8RA 2QFIA 2HFNA 4IQXA 3I9ZA 1IWGA 4C0BA 3UD3P 1Q5VA 3MM7B 3BPDA 4XK8C 3PXGa 4L75A 2MKIA 2XWXA 5D4PA 2ZH4A 3BREA 4FVCA 3ZC4A 4ECUA 3R7SB 3GZ7A 3HKWA 4IRCA 3Q86A 3R7BB 2CPIA 1C1BB 3KLFB 2O3DA 4O4RA 3PIPQ 4GKKF 2W4DA 2CJYB 3MCMA 2HMIB 1R89A 3FEXB 4LRFA 4DV4J 4WK3A 1PGZA 3RYLA 3R1HA 5H9FJ 1PSDA 4GO7X 4PEOA 3LPEA 1RAHB 4WCEQ 3KHHA 5CQGA 1FEEA 1KFSA 2QLBB 1LK7A 2KJVA 2V9WA 4OZNA 4WE1A 4ZIWA 3I5CA 4XPCA 2N3OA 4FS1A 3J81Y 4C2MA 2CPZA 3MUVP 4G1IA 2CQ0A 2MQ8A 4E98A 2UUCJ 4RU9A 1CJUB 1S1XA 3JSRA 4RX6A 3GP9A 4E0DA 2OUGA 2HFUA 2MKSA 1LW2A 3VV2B 1FRIA 2CQDA 5ETNA 3S1TA 2RS8A 3RB0A 3OHAA 4JI6F 2KO1A 1T9XA 3R3TA 1S79A 3VZHA 2A1BA 3T6BA 1ELOA 1BWVA 1CG2A 4ZPCA 1KQFB 4OZ2A 2FHKA 3V81B 2WSEC 1UETA 5IT9Y 2VG7A 3NGKA 2HZVA 4Y6IA 6FD1A 4A8KA 3DDKA 2F63A 4LF4F 3MR6A 4LT6A 4K5RA 3OBIA 1KWMA 1XMBA 1NJIT 1WI8A 1SL0A 4PG6A 3PRVA 3P5BP 2ZJRQ 2R8JA 2W4CA 2YX7A 1UPPA 2AP6A 5H9EK 1FDBA 2O67A 2OFGX 3I0SA 1JLBA 3PHEA 5KFXA 2PDAA 4X4TA 4O4GA 3QPIA 3HP6A 3K2YA 4J9LA 1D9DA 2YNGA 3EDQB 4NLTA 1WEZA 1RCXB 3BO2A 4F4WA 4OX7A 4C8KA 3J80Y 1IWAA 2IMWP 4ZCLA 4DV3F 4DR2J 3CGIA 1BE4A 2NZCA 3CC4S 3A8IA 2YX4A 3DDIA 2W9AA 1HNXJ 2YWEA 1PJ6A 3NXZA 4RW6A 2HBYB 1F9HA 2APOA 4J9VA 5BR8J 2YNFA 2FHMA 4XDCA 1VOMA 3TI0A 4ZLJA 4I69A 3R5CA 5CA5A 3R8YA 3OSPA 2QRRA 1WTBA 3GFHA 5FLXU 1WOSA 4N41A 4ZVQB 5I3UB 4ANEA 4Y28C 3VAJA 4I67A 2CNOB 2BM1A 4I0WA 5A6WA 2W9BA 1J2VA 3MECA 2HRYA 4FYWB 1K8AT 3KMSA 2R7WA 3T1HF 3D68A 4RNOA 1F3VA 3CTRA 4RW8B 2FJBB 3UN2A 4YS2A 2BEFA 4IKAA 2FC8A 2VQEJ 4B9TA 2BMBA 1ZTWA 3W8PA 2JC1A 3PX0A 3T41A 3MAAB 1VRTB 5LSRA 2U1AA 3EE3A 1HBMA 2HNDA 3MEGB 5DDQC 4J9PA 3TEGA 4RNHA 3ETOA 1U1NA 2CJXB 2YKPA 4MKYA 1E6YA 3JTNA 3KJNB 2QLFB 1Y5NB 1NK0A 3M9NB 2I38A 3DLBA 3NGSA 4OX8A 4A48A 4LFAJ 3V6HA 2HHQA 2GFFA 4PCQA 1RHQB 3DOKB 3K5PA 3IR6B 1RZMA 2AYEA 5EX0A 5IFMA 2VG6A 1TL7B 2UXCJ 2HZAA 4IUFA 5JXSA 1XK8A 5EWGA 1ACMB 1AZSB 1DRZA 3GIIA 4HT5A 2D1CA 2HRTA 4TU8A 4NZ0A 5KTQA 2FVPA 1MN7A 1Q8LA 4Y3CA 1S6QA 3E3XA 3W5XA 5DO2A 3WHIA 1HW9A 2GMJA 1C1CB 4B3OA 2ERRA 4HYKA 3TZWA 4PG7A 5J1EA 4IO9Q 3RB6A 2QLXA 4ZITA 5K8OA 2B7CB 2YWWA 2OPQB 4OZ1A 3MM5B 2ZH5A 3QRRA 3AQOA 1TV6B 2KHDA 1Q95G 1OSCA 2E5LF 3H7HB 2JDJA 1HD1A 4OV6A 4UT4A 1ZS6A 2QA1A 1APSA 2OSQA 4DL2A 3HCXA 2DNKA 1Z1ZA 3R97A 4HACB 1YWXA 2DRAA 4OHZA 5EUHA 4N5SA 2QJ3A 2H5IB 3ILJA 3KHRA 4XDDA 3BDEA 3CCSS 1T3OA 2J0XA 2GX8A 1WSRA 4JBCA 1EX8A 5IQQA 2LA4A 2DPIA 3H40A 1BQMA 1FESA 3OV7A 1P6TA 3C6UB 5B7WA 3DLHA 1MSWD 3RRKA 2LXIA 2JVRA 1W2BR 4IR1A 3LP0A 4R5PA 5JVGQ 4FKXA 2DVIA 3LQVA 3MTJA 1D3WA 4FDFA 3NMAA 1MMLA 1BXNA 4NXMJ 2EFNA 2I0XA 3DRXA 4ELUA 5F3TA 3GPAA 3CJ3A 3PR4A 1BUXA 4TY8B 1SJRA 2D9OA 4ZA1A 5K8PA 3BB5A 3DM2B 2L48A 1Z4UA 2I8EA 4TLQA 2VH7A 5KG3A 2WB1D 3OL9A 2ACYA 2YKOA 5LXYA 1U49A 1SUQA 1ZAXA 3R2CJ 3IBCB 2KVQE 3U1MA 1UEUA 4FS2A 3IO1A 1TL3A 2W7PA 1RGVA 2CNKB 4BC7A 3IBFB 1KONA 1CJVA 4OI1A 2ZE2B 4W90B 5LSLA 3NNHA 1YG0A 5GMEA 2OLWA 4ANCA 2MZJA 3DRPB 2ACMA 4JOUA 1CJTA 1SJ1A 2ATLA 1RHJB 2WOMB 3ENWA 4UW2A 1FA0A 4B3RF 4K4WA 3J7AN 3P45B 4JI7J 2QX0A 3NAHA 1TL4A 2ZHAA 2VFRA 1TU0B 3VQSA 5K14B 4KHPF 2E1PA 3R9LA 1QAXA 4CO0A 4QIWD 3K8VA 4MIAA 2DO0A 4DU8A 3DOMA 4TXSA 2W2PP 1RT6A 1NUEA 2BDPA 1M1KT 3MMBB 2HAIA 5EWEA 4RNMA 2N3LA 5H1SV 1Q79A 3CMAS 2SXLA 5JVHQ 2B9XA 2M4MA 2ZDOA 2K1RB 1UTAA 3OPKA 1RT4B 2AYMA 3VAIA 2G2ZA 1WEXA 3FSXA 4EK2A 2UUBF 3R5AA 1D8YA 5RUBA 1H2TZ 1HPZA 4A4JA 3NL0A 1YGYA 3KLEA 4WYLA 5J2NA 1G4CA 1NSQA 4K2XA 5D0HA 4LF7F 4OV1A 2ATCB 3OD2A 2J6SA 2HQ3A 1OQ6A 4FBUA 1DHMA 1T03A 2XNQA 4OI0A 4OYMA 4KV8B 5KFTA 4LF9F 3KLIB 4CWBA 4X4OA 2ZFHA 3C2PA 4NLSA 1UEVA 2HIQA 4CLTA 2IY5B 1BD6A 4TVAB 1K9MT 1IKVB 1U1MA 2CUYA 3LUYA 1RWNB 1JNZB 2K7KA 3A3NB 1KDNA 1B7YB 4CLZA 1FERA 4Y2KA 3HKZD 2UV8G 2POKA 1JLCA 2PEHA 2WVBA 3QGPA 4DXLA 1RTHA 3BKUA 4I1TA 1WHYA 3OQ2A 4AQYJ 2C2MB 1Q81T 2JLGA 5ETLA 5ETSA 1RWVB 4JB8B 3U1LA 2F5GA 4XPEA 2DITA 1D0EA 3C46A 1RI7A 4ID5B 4QYRA 1JB0C 2Z2YB 4CO3A 2MEWA 3NS6A 4F4ZA 1O5JA 4OJGA 4LF5F 2NLWA 4FPRA 4C11B 1TVRB 4Y2MA 3FBEA 1H73A 2V69A 1F5AA 1H6KX 2Y3YA 3PJXA 4UOGA 3SCLE 2V2KA 3B6BA 3KG0A 2DNNA 3CD7A 4OX6A 2QGFB 1MNEA 5DZ7A 5A8RB 3RU0A 1FJGF 5HLFA 3IWNC 2B5JA 5F8MA 3PG9A 1IM6A 2EBEA 1NK8A 2VPYB 1VIXA 1X0PA 2ASJA 5A0YB 2UVUA 1NK9A 1UMJA 1ZZFA 4ED1A 5J2QB 2MKYA 1Y10A 3IMQJ 2D3UA 2CQHA 1QVFR 4X84A 4OYOA 3WX8A 3PW5A 1WC3A 2Y1JA 2CNNB 4DLGA 2MXYA 2OPPA 3BR8A 3ZZZA 2DHXA 4N47A 2DHAA 3H2VE 1TZ0A 1RTIA 4A46A 2GHVC 3DHXA 5B0CA 1RU1A 2ZDPA 4YP3A 4HDHA 2AWZA 2XZTB 1PYOB 1N52B 3IR7B 1BMQB 1SJFA 4J9QA 1HWJA 1Y3KA 3JSYA 4OI4A 4USWA 1KVIA 2E1AA 4QR0A 4BWMA 3CEDA 4WE1B 4CNZA 4FNIA 3THPA 5J1NA 3CCTA 1RA7A 5CYJA 3CNQP 2KN4A 3OJSA 2DHGA 4YOEA 2H4WB 2H9ZA 3R27A 2WTFA 4I68A 3BKFA 2J5AA 5ADZA 4OI6A 2ASYA 3MEEA 3P8BB 1C0UB 1S1XB 4IG3A 3D0HE 2HHPA 4USMA 4X62J 1QSLA 1LW2B 2XZDB 2C2RA 4FYVB 3W65A 2BJ7A 3HZGA 3GIMA 5HL7Q 1TKDA 3NGDA 3FFIA 3RBXA 4ALZA 4DX6A 1Q4RA 3IP0A 2R2TA 1TK0A 1M5KC 2Z58B 2LQ5A 2JEFA 1X60A 3CULA 5DS7A 2CJQA 2A0FB 2V9KA 4U96A 5HAOA 3F0NA 2VG7B 2V94A 2ZUAA 2ZBQA 2COLA 3BS9A 4ZPDA 4O23A 4OFZA 4RWWA 2CPYA 4CLUA 2D3O1 2NXEA 1ZM3A 4JI1J 3N01A 3TZZA 1NB7A 2KXNB 3TNVA 1IKXA 2KXFA 4ETZA 4KE5A 3SXLA 3I0SB 5CHCB 2VJUA 1JLBB 2LECA 4O4GB 2HRUA 2B4VA 1FTCA 1S5ZA 5ETRA 2B43A 2F8HA 2G1DA 4RWXA 4ECSA 2EPIA 2B4UA 3Q8VA 2HFSA 1FFWB 2HW3A 1L3SA 3OTOF 1WORA 4DV7F 4A8SA 2DR6A 3M9MB 2ILZA 1FX4A 4RW6B 3BBBA 4OYBA 4RZRA 2KB2A 2JEGA 1S4FA 2YNFB 2IBOA 3FJ2A 2NXNA 1YJ7A 2BACA 4ELVA 1I94F 2MY7A 3FDSA 2XYPB 5L1IA 2CADA 1ROFA 1QE1A 3AXKA 1F60B 2KL8A 4F25A 3I9V9 1WWHA 5THWA 2M5YA 4DFKA 4B9UA 3MI7X 2JFDA 1LQ9A 3FBBA 3ETMA 2W9BB 3MECB 1RP5A 2RUGA 8ATCB 5KFWA 6AT1B 4WBFA 2JFKA 5K8MA 1JJ4A 2XG8A 2XY5A 1EHWA 3Q89A 1GMWD 4ES3A 1NH7A 3RJMB 4OHXA 2K8GA 4R0JA 1HBMB 4M5IA 2YQ0A 2HNDB 2JVOA 3D0GE 2H5EA 4ECVA 4B3MF 3DLJA 5AXNA 4DV6F 3BF4A 2ZUGA 5SUHA 3FQKA 1N5SA 3FCVA 1N4LA 2UVWA 2V6AA 1JLFA 1E6YB 1HBNB 3K5NA 1VBYA 1ZM9A 2YPZA 4ZDNA 2ZH7A 4X65F 3Q24A 2HHUA 3D6TB 1SJ4P 3EZ5A 2HAFA 2XMMA 4ECXA 3QZ7A 1FX2A 2EWHA 4O3QA 1ZM4A 2VG6B 3H98A 1M5VC 1HWLA 1R8AA 1VISA 3AOAA 2HBRB 4K50A 2WSCC 2ADBA 4YY3J 2VD3A 2R7RA 2XZWA 4J9RA 1VBKA 5K5MA 1U8WA 2V50A 1WF0A 3HPOA 2B8QA 4B17A 2EC2A 5M2PA 4ES1A 2NREA 3RBZA 1NHVA 3TRGA 2PE8A 3JXOA 1QDUB 1N6QA 4U67Q 1S6QB 3T1YF 2DNZA 2HVIA 3UNYA 3A8JA 1ZAVA 2MZTA 1K0TA 2CNLB 3UNGC 1B3TA 1WD6A 4B3OB 2DIUA 2U2FA 4MJKA 2V4QA 3EGVA 4RO0A 5DGBA 5J1EB 2OKQA 3FRYA 4DFPA 3BH6B 1FXRA 4K4ZA 2ZJPQ 2HFVA 1GX5A 2EVZA 2Z4PA 4C48A 2DNHA 4OZLA 4U95A 2HZCA 2FLPA 2FUG9 2OHDA 3A3PB 2YX1A 2QA2A 3M2VA 3V4IB 3LANA 3BSOA 3GLJA 2DHHA 3ZTSA 2MKKA 1RWUA 2XO7A 2X3GA 4LMZA 1E6VA 4WJBA 4ZK7M 2VF3A 1M5SA 4CH7A 3R5GA 1FWPA 5A8KA 1R3NA 1JQGA 1RA6A 1X4CA 4CZCA 1SXLA 4GVBA 1BQMB 2N4DA 1C4CA 2C1EB 1H2VZ 2KFZA 5C2CA 4P72A 4UQTA 1L5UA 3LP0B 1VJQA 4R5PB 2RVJA 2OSRA 2RRAA 1VGYA 4JV2A 1N32F 3GQCA 2WVFA 2N7CA 1PJ5A 2KU7A 2XGPA 2IJRA 4K59A 2IM2A 2VQFJ 4IOBA 1OIAA 1ZETA 2C22A 2FTRA 2RQCA 3GR0A 3SFGA 2ZNZA 1R0BG 2C3YA 2ZZNA 3UD5A 3TUZC 2DXFA 1TKTA 4NX9A 4UOCA 3CJ4A 2HHVA 1VQNS 1SUQB 4M5NA 3PKYA 1RWKB 4NASA 3TVKA 4LSLA 5KFQA 1B0TA 2DGVA 3DHWC 1TL3B 3RB3A 3LTOA 2P6SA 4WIIA 1MW7A 5GMDA 1TAUA 2FVQA 5HBMB 4ZOSA 4Q2LA 3OHBA 3HJVA 2MZSA 4TU9A 1XNQF 2YKMA 1WELA 1CJVB 1MWQA 2GVZA 1UJ5A 4GKJF 1BLUA 1FT8A 1OJ4A 2YQ3A 4Z7YA 1FE0A 1CJTB 2HVZA 4ZVUB 3IR5B 3QT5A 2WW8A 3DXSX 1CVJA 2HWIA 2VZ9A 1QTMA 1HQEA 2MMYA 3K8WA 3KFWX 4C3KA 1KC8T 5J2PA 4NXNF 4HLBA 3CXCR 4LVNP 1VC6A 4DDFA 1VQ6S 1MMNA 4D3GA 4ATNA 3OXFA 3UN3A 1OPIA 4F2SA 1SKSA 3HHLA 9ATCB 1T3NA 4ZCIA 2YKNA 4C8NA 1F9FA 4PQAA 3DOMB 2QZ8A 1UFWA 1RT6B 2F8EX 3FKBA 5KFKA 3KUEA 3VQTA 5G4DA 4EWTA 3W66A 1MWZA 4TYAA 5I42A 5LM7E 3MR3A 4I56A 4KGXB 3HHNB 3DFEA 2C3OA 3VVTA 4Y00A 5IV4A 4RLEA 4F04B 2RMLA 4F3QA 4Z2XA 1HPZB 2KYZA 3KLEB 2HQDA 1WOOA 4DV2J 3I5AA 5JJBA 2XLIA 4ERDA 2QA4S 3PYEA 4C0HA 3NCRA 1LV5A 1NJXA 4HT7A 1T03B 4N7TA 4DR1F 2H48B 2VKRA 4ZVRB 4A8WA 4K2JA 2UP1A 2VONA 1U09A 1ZH5A 4B9VA 1X4DA 3LH2S 3THVA 2HVHA 1HARA 1DJ0A 4DL6A 1S7HA 3MWBA 4CH0S 3M8RA 1FXDA 1TKXA 4E2FB 2HHHF 2R42A 4G3IA 1SKWA 2W2OP 2UXDF 3VAGA 9RUBA 3RUBL 4K8RA 1RTHB 1N88A 2HGMA 3S8SA 1I6JA 1RTJA 1NPKA 4NLRA 4F2RA 4LQ9A 3TO8A 3ICLA 4C8LA 5GAGI 1H2UX 3SSSA 3GIRA 4DR7J 3JQJA 3SCIE 3ELHA 2G13A 4XO0A 1GEHA 1UP1A 1VJWA 3W7BA 2HHWA 3J81U 4ITSA 4R8UA 2HNYA 4M8LA 3KUGA 4M5DA 2KT3A 5H9EJ 1X4HA 5HLFB 4BDPA 4CCHA 2CQ1A 1O51A 5KFZA 3DKDA 1V5VA 2RDDA 2J7UA 4ZVEA 3HHLC 3Q2TC 3GJRB 3QGGA 4WTYA 2BOPA 3NS7B 4JV0A 1PILA 2ZVIA 1IQZA 5J2MA 3IRXA 3HHKA 2OPPB 1AT1B 3HSZA 1B99A 3KDOA 2K3IA 3QQCD 3M6UA 3AQPA 1WF1A 1RTIB 4PYDA 5IT9U 2MQLA 5ETPA 2HNZA 3CJ2A 1Q78A 4C0OC 3JAMY 2BQRA 4FVMA 4LF1A 2XBPA 2FB0A 2OH2A 2BABA 2NR0A 2FJVA 4YUDA 2W7OA 1UFLA 4LBHA 4IOCQ 5D0GA 5KFFA 2FZGB 3AB4B 4RNFA 2IM1A 4ZPWR 1UVMA 2J76E 3DGPA 2CQBA 1N5YA 3MFHA 4A8XA 2BVZA 2LXUA 3GIJA 2VBWA 3GSIA 4MIBA 4ECTA 3MEEB 3UVJA 2VC0A 4IG3B 2CJBA 3J80U 1SQEA 3EUNA 2ZNYA 3CVKA 2FJAB 3UO0A 3N6LA 3ENAA 2HS3A 2MLZA 3MDFA 1RCOB 4CRJA 5DDRC 2HPUA 2IFXA 4UY8T 2UUCF 5F9NA 4EBCA 1Q8IA 1S1VA 2YWKA 4CIOA 3TQEA 3EJMA 3J7ZT 1NK6A 1BWEA 1TUGB 3FFIB 2DR5A 2A10A 3CIMA 5E7OB 3I4HX 1F0XA 4HL9A 5CH7B 2V8HA 4H4OA 2AW0A 4KFBA 3HFZB 4ILRA 2VICA 3SI8A 2AX0A 5AXMA 3MMJA 1UW9A 3TR5A 2MY8A 3UDCA 3MURP 3HX9A 2VL1A 4AD6A 1IKXB 4DR4J 1VI7A 2F1FA 3M30A 1N54B 2LQBA 1C0TA 1T05A 4DX5A 4I2PA 4QWBA 1OY6A 2GIFA 1JJCB 1FRKA 1WHVA 1OYDA 2D69A 2ZH2A 1RWPB 3H20A 2L9WA 1Y9OA 5F8LA 5DRKA 3QAUA 2B4PA 1DZ5A 3PR5B 2KZMA 3RAQA 1AROP 3HDSA 4ZP7A 1N5VA 3PKMA 5JUMA 4DR2F 3MD1A 1DLOA 1R8CA 1TL1A 3EGNA 2CXEA 3AY0A 3HMJG 3LGNA 3C16A 3ZZRA 1KVJA 4F4XA 1NCLA 4PG4A 1HNXF 2JEJA 3OXGA 1QE1B 3Q8PB 4U6PA 5BR8F 3QMQA 5KG0A 3PYFA 2K7JA 1TMJA 3MM6A 2OEKA 4FZVA 5KT3A 4FYYB 4GC6A 3HT0A 1ZA1B 4WWSA 5GAGU 1M0SA 2IIHA 5LMUJ 1U1PA 4ZMMA 4AYBD 1FTRA 3UCUP 3MFIA 3KOAA 2DYAA 4DSIA 4IH6A 3MR5A 2BR0A 1Q53A 2VQEF 2QE5A 4X4VA 1SL2A 1IKYA 1CC8A 2ZZTA 2YWFA 3RAXA 1CJUA 1JLFB 3FZ2A 2F9DA 3GJQB 3BV8A 1X9WA 2QFJA 2J6TA 4FKYA 4FYDA 1SCJB 4HVZA 1XNRJ 2BQUA 3SQGA 1T8EA 3GFYA 2DGUA 3OJUA 1VFJA 3CJKB 4Q8FA 2OJ3A 3M8PA 2CZVC 3T6JA 1KBRA 4LFAF 2GIRA 3KHGA 4V19J 3V81A 3A3OB 2UXBJ 1U0HA 3FEZA 3I0RA 1N6QB 1O8BA 1SBRA 2VFUA 1RUSA 4F02A 2GZOA 4P75A 3RAMA 2LEAA 1KOHA 1C2PA 4P71A 3CO9A 2E9TA 5LJ5Y 2W2QP 5GAEI 2DK2A 2GV1A 1CSJA 2I9SA 2L3MA 2VIHA 3RRHA 1VLOA 2MGZA 2B8PA 2Q66A 3Q83A 2HK3A 4TU7A 2E5HA 2HQIA 2CPXA 3M6XA 3M2VB 1JXVA 1Y5LB 1GTEA 2CZ4A 3CD5A 5D4LA 4NCBA 1PAUB 2GMLA 2H65B 1E6VB 2DXDA 1U1OA 2XMJA 1ZOTA 4KYZA 1I51B 1VRQC 5A8KB 1RABB 4F8RA 5E2QA 2QEXS 4CYUA 4GVBB 2HIYA 1GT8A 2VPXB 2GW8A 1REVA 1RT7A 2FGOA 1UAWA 3W62A 3VAKA 3WX4A 4CQ1A 1FNOA 1KLMA 2DIVA 3D6MB 3ZTPA 1KLNA 5B0EA 5DQIA 2HQCA 2E9ZA 1WEYA 3AD8C 3OLBA 2OMOA 1SQFA 3SEOA 1XMOJ 2LQ8A 4DPTA 4Z7CA 1OS5A 4H4KA 3TJAA 3QNWB 1EB0A 2PSZA 1NLKL 1V3SA 4IH5A 5D6GA 1HFEL 4OYIA 4EGLA 4NXMF 3SBMA 1K1QA 2WHOA 7AT1B 3MGJA 3IN5A 2DRBA 1LWXA 1NSKL 1TKTB 1X7VA 4M1KA 2FJWA 2MKHA 2R8HA 3E8OA 3G8TA 1SV5A 3HHEA 4X65J 3FCHA 3B82A 4X4UA 3VVUA 4LSLB 1Y5IB 4N77A 1LKZA 4J5OA 2KJWA 2ZKTA 3EZUA 1JLAA 4XIUA 1WDDA 3FK4A 2DGSA 4WXWA 3M6VA 4PPZA 1FDDA 1B70B 1ZBTA 2GVZB 1QTNB 5DG9A 5HVGA 4F3MA 1F1BB 1WACA 3FSIA 2RU9A 5D4OA 3MR7A 4CLPA 5DM6Q 1IBMJ 1WHXA 4O3NA 1IKWA 3CCVS 3T1AA 5J2PB 1HLWA 4HI1A 4QBUA 2C3PA 1T94A 5KT6A 3ZZ0A 1TK8A 4KC5A 3TA2A 3W8GA 3AXMA 3PJ9A 4R25A 3WBZA 2R7SA 3O2IA 3HHLB 3RGIA 3G2XA 4M5HA 3BQ2A 5CAAA 3KLGA 1PYSB 2YKNB 1HHQA 3GV8B 5ETKA 3W9JA 3SFUA 2PMZD 3QRPA 1U02A 2VG5A 5I42B 2LVWA 2BV3A 4QWDA 1S6OA 2WONA 2VODA 1JLQA 3VAHA 2AJ2A 3R1LA 4P6QA 2IDEA 3LO3A 3PDNA 3KNAA 3OL6A 4IRKA 3C3LA 2XNRA 1GMUA 4LUBA 5D3GA 4NRTA 4TN2A 4I7FA 5HQ8A 3OTCA 4ZP8A 1DTTA 1S0MA 1YTYA 5FJ4A 1N32J 2LQ9A 3M2RA 1SIZA 3I5BA 1LK5A 1LFPA 1KQGB 4FN5A 2M3DA 4H4KC 1P9QC 1AUSL 2HVEA 4JI3J 4Y0FA 1K73T 3OXLA 2MYFA 5C5JA 1H98A 5AT1B 1GXUA 5GAEU 1R8PA 5DLGA 4WIQA 4ZHRA 4P7VA 5BYRA 3GTYX 4EI2A 1JX4A 5HVHA 5HQLA 1V9OA 5HQMA 3TAPA 3GR1A 2LDIA 3D0IE 4PWWA 1NJZA 1SJ3P 1LEOA 4OHWA 2VC1A 3NWGA 4RR5A 3H4DA 4UUXA 4ZVOB 1RTJB 1GMVA 1WC6A 1XNQJ 2Q3PA 4H4MA 2GIQA 1N34F 1UA1A 4AQYF 3N0VA 5HVFA 1GK8A 4QYZJ 3ISNC 1FF2A 2IC3B 3PZPA 1TL5A 4B3TF 1RAJA 1HWUA 4R8UB 2HNYB 3IXQA 4NXNJ 2V5HG 1FVQA 4M5DB 3DRPA 2DO4A 2G1HA 2CJAA 4X4PA 1Q1KA 2KG0A 3NCPA 1URNA 3JSBA 2AJ4A 4ZP9A 5G0RB 2EXUA 3JQMA 3CO0P 4RUAA 2LP4A 1EQ0A 4HTJA 4USHA 3KJQB 2WK4A 4M5KA 3CJQA 2EKNA 2MQNA 3TUJC 1YRXA 3T5JA 2HKEA 5J2MB 5L9XA 3IRXB 4O3PA 3ZXWA 4C8ZA 1MU2A 2KT2A 3QGIA 3LWMA 2B3TB 4R0EA 3H5SA 1WC0A 4DV5F 3CJ0A 3QJJA 2BW2A 3MMBA 1P8GA 3C15A 2DR9A 3TA1A 4WP9A 1RKJA 2X1BA 3H25A 3TX8A 1S59A 5HJYA 1KOOA 2R7UA 1Y3JA 4DUZF 5CZXA 1RAOA 2AGQA 4EYHB 1QAIA 3DGPB 4DR1J 2IHR1 3RW6A 1DBDA 1N5YB 1HR0F 1FDNA 3UVJB 1XR5A 1UPMB 1IUJA 1W7WA 3LW5C 5KT2A 5AXLA 2LXFA 1F5CA 4WFNQ 1DTQA 2CQPA 2BJEA 2IM0A 2I1RA 2JZ5A 2HHXA 1TELA 2BW7A 1R31A 4KV8A 1S1VB 3HFVA 1TMMA 1AA1B 3E01A 1SKRA 1U25A 1WI6A 2IRYA 1P1TA 4MT1A 4OI3A 4X62F 3C14A 1FE4A 3QIPA 2UXDJ 1QSSA 3VTIA 3HVTA 4NLQA 4H4OB 5IXUA 4KFBB 1U1QA 2NYIA 1JIHA 3CT9A 3JB9k 4Q8EA 2AZ3A 1Z2LA 4Y2IA 3OVSA 2AQ4A 1U1KA 1A0OB 3C8YA 4J91A 1VLYA 4CM0A 4KO0A 3M30B 2RQ4A 3O3LA 4WXOA 4WU2A 1C0TB 4I2PB 4ILMA 3R5JB 3EXYA 1TTHB 3UW1A 2WVCA 2AD9A 4F26A 4JI1F 1U2RA 4OYXA 1M90T 2JHEA 3QSYB 1SQGA 2GMHA 3WIVA 1TVRA 5F8IA 2O5DA 4RW7A 4IDKA 3BBFA 5GADI 2DEJA 2VPZB 2PEBA 3ZZTA 3CD6S 2ZC3A 4ED8A 3AD7C 3TAMA 3DMJA 4QQBA 3BO3A 1WG1A 3P5TL 4ZLLA 1YBAA 5A0YA 4ZCMA 5IM0A 5E0OA 1DLOB 2WB4A 1HMVA 1FWKA 4YR3A 1TL1B 1PCAA 3PYGA 5J2QA 4IO1A 2DNRA 5HMZA 3W64A 3C16B 1X0FA 1UA0A 2X7IA 4BWJA 5I3PA 3NGTA 4TYBA 2IAJA 2G2OA 1UJ4A 3GFZA 4C8MA 3PFOA 3P96A 2LCWA 3TZYA 7FDRA 2YVSA 2QL7B 3MM6B 4ZN3A 3K5OA 3N5FA 1B64A 2OTJS 3X1LB 4YR2A 2DH7A 3OR2A 1VHFA 3VCDA 3PEHA 2VB6A 2DCUB 1VIOA 3H5YA 4DSKA 3UE2A 1KTVA 3FZBA 1S4EA 2J8SA 4KQZA 4AXIA 1YDLA 3T5LA 3OL7A 3OTEA 4EFAC 1K44A 3FBCA 3CWJA 1NKCA 1YJRA 3FMWA 1X4AA 2IJNA 2ZBPA 4X66J 1YRTA 2CYYA 3MF5A 2FZCB 1IKYB 2B9WA 3HVWA 3VF0B 3TUPA 4F67A 3TARA 5B0FA 1C0UA 3VAFA 1RISA 4DL4A 3MAHA 3U27A 4KKOA 2BKPA 4ZVHA 4QW9A 2BM0A 1NM2A 3SQGB 3UQSA 4ENOA 1T95A 2LEPA 3QBCA 3M8PB 2E1MC 2UU9J 2MDAA 1HHTP 5B09A 2ZVSA 2Z30B 1NJYA 1VR6A 1CC7A 1JKHA 4QJVA 2B9EA 2XLKA 1U0HB 3DLGA 3GYGA 1SJQA 1NZ8A 2GJFA 4NCGA 3I0RB 3JTOA 5LSOA 4YY3F 2UZAA 2H3EB 2BRKA 2V8GA 1H74A 4I64A 4C6AA 2V63A 2MKCA 3M05A 2DNOA 3THTA 1HNIA 4ZIVA 3MR2A 2EC0A 5KAKA 1RJJA 5ETVA 3HD1A 4KHRA 4ECYA 3DLKA 2AF6A 2E5JA 1X5TA 1U6BA 2BA9A 4CT9A 4DUTA 5EDWA 2MGZB 3US5A 2FVRA 4TKTA 2A3JA 3T9ZA 4O3RA 4FXWA 5KG6A 2NYHA 3CJ5A 4U7CA 4URQU 4CLWA 2HG4A 3PO5A 4XAKA 2XB2D 2CFXA 2D41A 2IA6A 3TP2A 1UWAA 4PABA 3EX7B 2KH9A 2DTJA 1IBLJ 4YDXA 3MEDA 4NI2A 1TFYA 3NNCA 3EGZA 3D1HA 2AJQA 4FNHA 3PV8A 4CYUB 5A76A 3CCLS 3VALA 1IBCB 1REVB 1RT7B 4WU3A 3SIPB 3ISZA 2Z2MA 1Q5YA 2DD8S 1KLMB 2MLYA 1RKIA 2RSQA 4HHHA 1ZZNA 1NDPA 1YQHA 1Y7PA 1F6TA 5DDPC 3K59A 5I4MA 1DQ9A 3W2WB 2H54B 2HVDA 4J37A 3MM9A 3G6ES 2XI2A 2DT9A 2FC9A 3BGOP 2HWHA 3GJSB 4RU2A 4DPXA 4RKUC 4NWBA 3PNIA 2HHTA 3PW2A 5LJ3Y 5A2QY 4L74A 4DL7A 3I87A 2VQFF 4USJC 1XMQJ 5GADU 2F4VJ 1FK9A 4ZJOA 3W9IA 4C7QA 3QSIA 4UZBA 4DPYA 1SV5B 3VHQA 1XN9A 1UVJA 2ZHOA 3EMTA 2MQPA 1YBUA 2J9DA 4CLFA 3MMCA 1P1LA 2Y8YA 3RR7A 2Y1RI 1X4FA 3K58A 4YB6A 3L3CA 3SV3A 1JLAB 1U1LA 1HBNA 4DJBA 2R8KA 3KYLA 3IFEA 8AT1B 4S0MA 2JC0A 3BN4A 1RTDA 1F5BA 1HQUA 5L8RC 2PA8D 4DQPA 2YNHA 3BDPA 3EPGA 2F3JA 2MLXA 4U9RA 1Q0NA 2F40A 8RUCA 3GIKA 5T7LA 1QY7A 3POTA 2E1RA 3M8QA 2JNJA 1AXQA 1IKWB 3ILLA 4JYAF 2KRBA 1NHUA 2VBYA 1T9TA 4B9MA 3Q23A 3S7RA 3FBFA 2VOPA 5HO4A 2ROEA 2ROPA 1NRKA 2RHQB 4MMOA 4HH1A 2B4OA 1X31C 3UFCX 4W92B 5DQGA 1QUVA 3D3BJ 4P74A 3KLGB 3HHDA 1CBKA 3TJ9A 1NPPA 4YB1P 2VFTA 3MPWA 1UZDA 2CG4A 2VG5B 1LWFA 3CDUA 3C6TA 3TVZA 1T0TV 4BBYA 2DGOA 4D3HA 3V4IA 2Z2LA 1F3FA 2EKYA 4OYAA 2WONB 1S10A 1JLQB 4EZ6A 5KT5A 3TEHB 1LNQA 1X4EA 4NZ6A 3CJSA 5K9FA 1U26A 1UJ6A 3PW0A 4WPAA 2VJVA 2PI4A 5D3GB 3IGVA 4I7FB 1U0SA 1DTTB 2HLTA 1TR0A 3A4TA 2DRDA 5CD4H 3M2RB 1HWIA 4IRDA 1HW8A 2VBZA 4PXCA 1JJ2R 3NMRA 3MPDA 5HROB 4DV2F 2OEJA 3MD3A 5B0BA 3AFGA 1SIWB 2BZ2A 1S0NA 4AE5A 2Q79A 4ZHRB 1R0AA 3H5XA 4TQSA 4ZKAA 3KK3B 3QT6A 2BE7D 2GJIA 2KRRA 4HKQA 3Q22A 2OAUA 4RUHA 3E2EA 1GX6A 3F56A 3CC2S 3AOCA 4WZQA 5AJ3J 1XTZA 4DUYJ 3ZFVA 4ECZA 3D5MA 1S0OA 3JAMU 4M5JA 5CYQA 3Q8QB 4CO4A 3NY0A 4ETXA 4H4MB 1PIEA 4DX8H 4L73A 3GSDA 3KG1A 4KSEB 3HSGA 3D67A 3CCUS 5HBMA 3BGRA 3OSNA 3R5DA 3SCJE 4OJ1A 1EP4B 1KTQA 4K4SA 5D4NA 3O1LA 3O6QA 4DR7F 2EW9A 3HHLD 2OMLA 4O3OA 3RB4A 3X3UA 2CVIA 3QZ8A 2PGCA 3QWPA 2R9LA 4KGZB 5KG7A 5KT7A 3MPVA 3EYZA 2KZZA 2ILYA 1X9SA 2K3KA 3KK1A 1MU2B 2AJFE 4IR9A 3G82A 3LWLA 5D77A 4PXDA 4P9SA 2XMKA 2J0WA 1OY8A 2QC3A 4JV5J 5HATA 3TA0A 3CCRS 3KG4A 2M0GB 2BKNA 2B6AA 3C15B 3KJFB 3SDEB 1V5IB 3D1QA 4Y2CA 3WZ0A 4WYWA 4PAAA 3W2VA 5L46A 4L72B 1RHKB 1X8DA 1XQIA 2V2VA 2M8DB 4I2QA 2WZ1A 2KYXA 2RIJA 4JI5J 3T5KA 5D8HB 3PRDA 3I6PA 4QR1A 2XMVA 1OO0B 2V4JA 1YIJS 1NDCA 3FRZA 2C28A 1DTQB 1FJEB 4NA1A 4L6V3 2ZD1A 3WQPA 3I55S 1XIQA 2LA6A 4NLWA 2C3MA 2IJFA 4DQIA 1RLCL 3E01B 4KH0B 4YFUA 1FO1A 1J5OA 5KFIA 3C14B 5T41A 3QIPB 1DURA 1ZPVA 4K4TA 2JOQA 1RWOB 5KFYA 3HVTB 4LFBJ 1D9FA 2UUWA 3CCWA 1QAYA 2DEIA 2RRNA 2PFDA 2GC8A 3UDVA 4NPOA 1CQNA 4PYAA 3AJDA 1N34J 2DISA 2I5JA 3NGUA 2AV5A 4RBTA 2E9RX 1HBUA 1TFWA 1YJVA 2HGNA 4K4XA 2BE2B 2GHPA 1RDRA 3G71S 2WAQD 4KO0B 4QW8A 4B3TJ 1D8ZA 2M70A 1TQLA 2DNMA 2R7VA 4CP5A 3GJTB 1NKEA 1VS3A 5HMYA 1K0VA 4LVOP 4DR4F 2AMCB 4RW7B 4IDKB 3HK2A 3L9ZA 4EBDA 4RUBA 3TAMB 3DMJB 4ED0A 5E33A 3K5LA 3ENQA 3MOZA 2IM3A 3TYTA 1FRJA 4DG1A 5KG5A 4KBIA 2OD6A 2XMWA 5ETOA 5IM0B 1HMVB 1JXEA 4DFMA 4K0KF 1EARA 3Q2SC 3HO1A 2RJZA 4DV5J 1FNXH 5IS2A 1M5OC 2IAJB 3L7UA 2KT5A 4A8QA 2P9EA 4WKRA 4PWDA 1T7PA 2VFVA 2RF2A 2XHWA 2D3ZA 2RUSA 3BH7B 2IBKA 5IWAJ 1Y4ZB 4H54A 2GO9A 3DRSA 2FJXA 3OR2B 2AZ1A 2RAQA 4Q44A 1R27B 4DUZJ 1WC4A 4OX9J 2R4FA 3HLUA 4NLXA 3OLAA 3CB4A 2JJ4D 5IOLA 4ZPAA 2GAHC 3BSCA 1HR0J 1MLAA 4F50A 2G0JA 1VK3A 1OSDA 1MROA 2Z56B 2AIRB 3ZO7A 2EFQA 5LMUF 1N36F 3NLCA 1H3DA 4X64J 3IS9A 3CF5Q 2DNPA 3H5UA 2FVCA 1UVLA 3R6LB 3SMZA 2FLLA 1S9GA 1X4GA 3M4XA 4CNYA 4DV1J 3PACA 3QT8A 1H38A 4KKOB 4ELTA 3PX4A 5DGAA 4WF9Q 5IT0A 1HNWJ 3QGHA 2GNKA 4PWUA 3T3FA 1FD2A 1LOUA 2FYXA 3QLHA 2XS2A 1XNRF 3AT1B 2ZZMA 1JKHB 2YNIA 1IBKJ 4ECWA 1N33J 3DLGB 5BYQA 2WCXA 4NCGB 1HKAA 1DFDA 1JLGA 3AAWB 3J81j 3M8YA 2ZJQQ 3GU0A 2Z0GA 4DL5A 2YBVA 5HMWA 5KFLA 2OELA 3UD4P 3BJYA 3QJPA 2UXBF 1NHKL 4YEAA 1HNIB 1KQKA 3NGRA 3LP2B 1VQSA 2DY9A 4W98A 2XMTA 4QPXA 3EM1A 3DLKB 5FD1A 1NDLA 3ILIA 4CTAA 1XR6A 5KFHA 1FRXA 4KIAA 5M2UA 2IYGA 1CPZA 4OZ5A 1M1HA 4YQWA 1W2IA 1VQ5S 1UZHA 1X5OA 4DCPB 3OFEA 4QCLA 1VCTA 1S1WA 3QJLA 5LL6d 1I1GA 2PT0A 3MEDB 4NI2B 2RRBA 2IRXA 4YHHJ 3AB2B 1ZAWA 3AODA 1S57A 3NP5A 1PKUA 3D2WA 4OHYA 4I6AA 1VQKS 3UPFA 1J27A 2BJDA 2ZBCA 4ECQA 2OTLS 1VQ9S 1RBAA 2W2MP 5KG4A 2GQCA 2G2YA 2F7VA 4CLKA 5KG2A 3PRBA 4DQQA 4NLYA 1Z2ZA 2ZH6A 5DZ6A 2EEYA 5GVQA 4GVLA 1AW0A 2D3OR 2NS1B 4C8OA 3A8EA 5EGYA 5CCLA 2AT1B 2BBEA 3G96A 4ZPTR 3FEYB 2V8DA 3DYAA 3MM9B 4WFZA 2J9DE 1RBLA 2Q1LA 4FF1A 1KHVA 2W9CA 2VHGA 2JWNA 4FYXB 2OGUA 1WF2A 4K5SA 3NBPA 3PCOB 1XMOF 4X2BA 5HI7A 1YKWA 2RS2A 3W5ZA 1FK9B 3VGVA 4KPCA 1JLEA 1NMEB 3GMGA 2XMAA 4X4QA 2AKWB 2QTWA 1G3OA 2KFNA 2D9PA 2KFYA 3L7PA 4G65A 3CMQA 2NUUG 3MMCB 4ICLA 4EYIB 3MCNA 3KXDA 4K7QA 1RTDB 1HQUB 4AUKA 2F4FA 1OY9A 2YNHB 2BUNA 1NU4A 4ED4A 5EWFA 3HSDA 3M32A 3CJKA 2HLUA 2GVDA 2GHWA 3DU5A 5T7LB 3U7JA 3POTB 3LP1A 3M8QB 4M5LA 3UDLA 1C4AA 5E3RA 4F7VA 2CQIA 3MEKA 3VR1A 5KFNA 1IBMF 3I96A 1SL1A 3LGMA 4GRSA 4N56A 2J0SD 2V34A 4RJVA 2R8GA 3I56S 2BYCA 4QWEA 5J1PA 4F4KA 1FKPA 3H90A 4HH0A 4J9KA 1LWFB 3GILA 1RAEB 3C6TB 4IFVA 3QFHA 2CJKA 4O44A 4KGKA 1SC3B 1XERA 1EIYB 3BR9A 4YB5A 1RAIB 2XS7A 1ZTTA 3BQ0A 3KJVA 2YH0A 4JP8A 1VC5A 4BS2A 3P6YC 4DCOB 1IJEB 5L38A 3W60A 5K8NA 2BANB 4DR6J 4LF8J 3OUYA 4AL6A 3H2LA 2OD4A 1WKKA 2R7OA 2P5VA 2WVDA 2Z8QA 2AEMA 5AE3A 1SI9A 4A8YA 3FVYA 5D15A 4F0HA 3FUYA 4MYTA 4NA3A 3CDWA 1AYEA 2E5GA 4OYZA 1R0AB 3OVBA 1J5EJ 4DR3F 4DX7A 2XSFA 4P7TA 2HQFA 2DGXA 4JI3F 3G8SA 1U2CA 2QO3A 1MWYA 4RBVA 2GJ2A 4Q0BA 2IVYA 1NK5A 2AYGA 2CIMA 2M88A 4DMZA 1ZPWX 5KFUA 1R6YA 2H51B 3G86A 1BC6A 5CYQB 1U45A 2BRLA 3ISND 4P52A 2W25A 4KH1B 3RG6A 2R8IA 1TUWA 3RBEA 4ZVFA 4CO1A 4EUVA 4AFFA 3ZZPA 2CA9A 1UW4A 2C2ZB 4DV0J 2HS4A 3BGRB 4O0NA 1PYTA 4X4RA 4KPYA 3HT3A 4KRWA 3D4JA 4JYAJ 3V6JA 2QA4G 2AJ0A 1HI1A 4B9SA 3KDNA 4QIVA 2ZH8A 2YH1A 1RSCA 4B08A 3I31A 4KY3A 3SZ2A 2FJEB 2P2CB 3ULHA 5EN1A 4QPTA 2WBRA 3GYNA 1EKSA 3F41A 2CDQA 3KK1B 2XTJP 4A47A 4HEA9 3G82B 2Q6CA 3CJTA 2G4BA 1VK8A 4GC7A 5KFBA 1OYEA 2WW4A 5IC4B 3WC2A 1DQ8A 3IWXA 1YJ9S 4PQUA 2D7SA 5FDLA 2B6AB 3OFFA 3IAM9 1UEKA 2ASLA 2JEIA 3HJFA 5KFMA 4PG8A 5M2RA 2EFVA 3PX6A 3W2VB 2RH3A 5E5NA 1CLFA 4I2QB 5CXTA 1PBAA 2MZQA 4K4VA 4KGMA 1S12A 4PKDB 2M2BA 1VHIA 2MSSA 3IM8A 3KK2B 3K5MA 2OIHA 4DSLA 2W24A 1RHMB 3MTKA 2KDOA 3UR3C 4BHQA 4NYOA 2V4JB 5E3PA 4IFYA 4PRFA 3R2DJ 2ZD1B 1WNEA 1XR7A 4TY9A 3B54A 4NLUA 1FKOA 4B3SF 5BYSA 3HZEA 2MQQA 1SH0A 3UWTA 1J5OB 2N7YA 1R8BA 4LSZB 3R5BA 3C66A 2BQ3A 4KB7A 1DAXA 4BCAA 4DLEA 4P2XA 1X5SA 2R7QA 2AEJA 2XULA 1RT2A 1D9AA 2C2KB 4OMFG 4RNNA 1IN0A 3SSQA 2MJUA 4EO8A 2I5JB 1SB6A 1HBUB 1T9YA 3HSJA 3U1NA 1RAFB 4N8OA 3CDEA 2RILA 2BE9B 3DRYA 3HVAA 2E7XA 4DPWA 2XSJA 3ET6A 2OPSB 4X4NA 1B4SA 3IM9A 1V6HA 4USIA 4DOZA 1LXJA 2IC3A 2E5IA 1LWEA 2ZHBA 1RYRA 5ITHA 1GAOA 4O3SA 3ENVA 3AJ2A 4URGA 1NK7A 2RDJA 1N8RT 1KRPA 1H7XA 3P3DA 2QT7A 3SYZA 5KFAA 1JWWA 5G0RA 4DG1B 4M5GA 2IVFB 3BYPA 2IVMA 4N76A 1RT5A 2PN6A 4IYQA 3A1YG 5B08A 3BBCA 2LU1A 4PWDB 2RF2B 3D7SB 3LALA 4J7CA 4LIRA 4NLGA 1AB8A 2DHSA 5BXIA 1Q16B 4JI8J 3DRSB 1RADB 1F2GA 4A8OA 4ED5A 3EPIA 1RK8A 1KS2A 1VBZA 1CJKA 1H72C 4PXBA 2UVVA 1U6ZA 3MM8A 2NXUA 4E8UA 4ILLA 1RT1B 3D28A 4DR5F 3D9BA 2RB7A 2DXEA 1MROB 5CD4A 4LIWA 4QR2A 2AU0A 4DSJA 2H5JB 2W2NP 3O44A 3IS9B 3OR1A 2UUAF 4NMXA 1OWXA 2HBQB 1S77D 2RDIA 2P8IA 4A8MP 4IOAQ 1S9GB 4L3NA 2EK6A 4LR9A 2O1PA 2EFGA 4X66F 5GMKa 3FNNA 4OIXA 2FHJA 2ZC4A 2EK1A 2NSBA 1G6BA 2J8AA 4P73A 1B0VA 4LQ3A 4F3OA 4DN9A 1WKLA 4DU7A 3CDAA 4NLPA 3GG0A 3QLHB 3SV4A 1KR4A 3M6WA 4DL3A 3DGVA 1RXOB 2BJ8A 2YNIB 4QIGA 4ES2A 2AGOA 1YJNS 2UU9F 2W7AA 1S76D 1JLGB 4WP8A 4DFJA 3MMAA 2EBGA 2AJ1A 4AXJA 1KVKA 4LFCF 2H1YA 4IQMA 2JSXA 1IR0A 2Y1IA 2E66A 1R8HA 3ILOA 3HXMA 2WBMA 3OW2R 4RPFA 5DJBA 2Z57B 1JJHA 1WTFA 4CTAB 5D78A 3QO9A 2BOAA 1NB2A 5A2QU 1S49A 2V4RA 3GV7B 3NOCA 1CULA 1LXNA 2V8VA 3L4BC 4WP3A 4DEZA 1YJUA 2ZM6J 2GCFA 2XCPA 1S1WB 1HWKA 2R2SA 4QU6A 1WHWA 1P27B 4K0KJ 4FF2A 3V5RA 2ZOFA 1KN6A 3IC1A 5DQHA 3UR0A 1VQYA 2C2EA 2HFZA 1IBLF 6FDRA 1L3TA 1N56A 2ZBRA 3BZQA 4O0IA 1LWCA 3JSMA 4CM2A 4XTTA 5U47A 5C42A 2IRUA 4NYZA 2DCLA 1F9EB 3BM7A 3CDBA 1PBUA 4CLLA 2E7VA 1OPZA 1SC4B 2N4CA 3DYAB 3G9CA 2OPRA 2CPFA 3VWSA 2R7TA 4JI4F 4UTGA 2W9CB 1U6FA 1KP6A 1VRUA 2QL5B 3OFGA 2OFHX 5KFVA 3NBPB 4RUCA 1N36J 3ZTOA 2ZITA 2ASDA 3M1VA 4NOHA 5EX3A 5F41A 1RTZA 2LQJA 5HK4A 2CQ2A 1FFGB 1JLEB 4MK8A 5LMNJ 3BYRA 2L9DA 1YHQS 2DGQA 4JI0J 1XMQF 2F4VF 4Q45A 4Y2AA 3K17A 3H2UB 4ICLB 1HD0A 1Q8KA 1QAJA 4MTPA 2XS5A 2DR7A 4LRBA 3M32B 1RT3A 4WKYA 5C7PA 3H42A 4MIWA 2ALZA 2QSWA 3NRBA 2A6MA 1KNZA 3AH6A 2HQGA 2GVDB 2JH3A 1R0CB 5E3CA 3LP1B 5E41A 3JS9A 3M8WA 1IVZA 7FD1A 3QATA 4NCAA 1ZYQA 4NLOA 5K20B 2Y9HA 5DG7A 2CPJA 3GG1A 3I82A 3KMQA 2PO4A 4QYZK 4UOHA 2XC9A 4TNOA 5KFRA 2GO8A 4PUOA 1VBXA 2QL9B 1X4BA 2OP5A 1FKPB 2LEBA 1TKZA 1HNZJ 4LRDA 1KFDA 4IFVB 3Q8YA 2C2NA 1FRHA 2W1BA 2NPIA 1D09B 4O44B 1UVIA 3BSAA 4C3LA 3FCWA 1KSPA 3ZTQA 1CEZA 1NAQA 2YNGB 3KJVB 2DB1A 1LW0A 1YLXA 2DNYA 2RU3A 1YZ7A 2Q6BA 2BJ9A 2QN6B 4MFBA 3D6FB 4GMKA 1Y00A 4P2SA 3WDOA 1U7LA 3WIUA 3OUYB 1GQEA 1RWXB 1PJ7A 1U24A 2YWHA 3SSRA 2KTQA 3UCGA 3NG8A 3FSYA 3MUTP 3D3CJ 2B56A 1S97A 5C25A 3G6YA 3EXCX 2OEMA 3W9HA 1T02A 3QYYA 4NRUA 4GKKJ 2CZ9A 3NS5A 1PO6A 1F2HA 3NKYA 1QD1A 1NPRA 4UUWA 5L1JA 2J9CA 4IG0A 3W2WA 4G1PA 3IA0A 4YR0A 1I3OB 2F8MA 1NXIA 2L9NA 3L09A 2E7WA 1DQAA 2V0NA 4TLRA 1UVKA 1HYSA 4ED2A 1RE1B 1VQPS 4Q0BB 3BN7A 1SPBP 5B0AA 2FLOA 1IR1A 1H7WA 1FJ7A 4AT1B 2X51A 1X5PA 3Q8SB 4MAKA 5I3QA 3DXBA 2YKAA 2EFOA 5AJ3F 2QV6A 4KJIA 4DUYF 3IBWA 3DLEA 3G4SS 4OZJA 2P6TA 3GYXB 1UVNA 2YQ1A 2JRSA 4JI6J 3A12A 5LT5A 2AEFA 3O5TB 5AE1A 1S6UA 2XCAA 5DG8A 1SH3A 3UCZP 4EO6A 1BQXA 3ZTRA 3KLHA 2QLWA 1N5QA 1FDAA 4GO5X 2CAJA 4ECRA 1N48A 4KHMA 4X4SA 4EMDA 1NH8A 3UDEA 3OVAA 4JV1A 2UV8A 1CS4A 3SCKE 4DPOA 5DM7Q 3TZXA 2UVRA 4LF4J 2ZOGA 1KD1T 1L3VA 3CCZA 1IM4A 4N8NA 3CCMS 4KR0B 1N5TA 3ITHA 1B0PA 4WTOB 2C2OB 5F3ZA 3W63A 3A13A 1SH2A 3R6GB 3V2UC 3EVOA 2B9YA 4J9SA 3H0PA 4QOTA 4PQUB 5FDLB 1D1UA 2QSFA 1U1RA 2YY3A 1FRMA 3Q8RB 4JV5F 4DV3J 4WFYA 3PHTA 4Q43A 2IPOB 2K06A 2MQMA 1YK9A 4LREA 1AUDA 4LF2A 2XEXA 3AA9A 1X9MA 3ZZOA 1RWMB 2W8KA 3DLLQ 3P49B 2RKIA 1M5PC 2JLEA 5HP1A 3PEJA 3B4MA 1S1TA 1S1UA 3BEGB 2WVEA 3ZZYA 2XI3A 4JI5F 3IRWP 3JTPA 4IFYB 3NEKA 1PC4A 5H9FK 4DR3J 5HROA 2R7XA 5KFDA 1HNVA 2ZH9A 3PYDA 1FKOB 2X3DA 2VV5A 2F9JA 3T1HJ 1BY9A 3BKTA 4I6YA 5AE2A 3KK3A 1U8SA 1ITPA 3PW4A 5BJRA 1FI4A 2AGPA 1HBOA 1WC1A 4CO5A 3CW2C 3KKFA 2Z2ZA 1RT2B 1U48A 4ZVPB 2QMWA 3MAQA 2V67A 3DU6A 1IR2A 4M5MA 4LFBF 2ROGA 2FZKB 1R6VA 2G9OA 3DNCA 1S99A 5IC6B 4NLDA 3FGVA 1NDKA 2P9CA 3DOLA 2XSJB 3RBDA 2A2DA 3ET6B 5L1LA 5D0RA 2FVSA 3PM9A 2CPDA 2ZEJA 1O6XA 4ZVGA 1B7FA 4QWCA 2NXCA 2F65A 1XEZA 4LRCA 5MAOA 2CPEA 3ZZUA 1LWEB 4NA2A 1EAYC 4LF6F 2PIIA 1EP4A 2HURA 3PTWA 2J7KA 4PZVA 2OI2A 1RWWB 1SC6A 2DR8A 3DC2A 5FLXY 3TX0A 4LBIA 4C8YA 5CYMA 3MXHP 4MH8A 4CT8A 1OMSA 2ZWPA 1HL6A 3ADAC 4FP9A 1G7CB 2GGPA 2CQCA 1U47A 1XJWB 4CH1A 5A6PA 3M8SA 1RT5B 1VYAA 3R7NB 2MSTA 3BPSP 4FF4A 2AX1A 3D1OA 4P10A 1N0UA 3LAKA 1NSAA 1VC0A 3VGSA 2E5LJ 4J9UE 2KM8C 1EKRA 2BX6A 2RNEA 2NUHA 5JMNA 3NAIA 3EVWA 1KEKA 1GXLA 4OL8A 3ONQA 3J7A1 3IG1A 3NOGA 3H4BA 1VQ7S 5C24A 3SDEA 4ZJLA 2DNLA 3CIZA 1CJKB 5B0GA 5IWAF 3JYTA 4HHJA 4LSNA 2MZ1A 4QU7A 3MM8B 4WFBQ 1UL3A 4CDIA 3NWRA 4OX9F 2XY7A 5GAHI 3KTQA 2Y0SD 1S9EA 1Q82T 2J0QD 4NL5A 3TQ1A 2FQQB 4UOFA 3OR1B 1S6PA 1LFWA 3E51A 4J9OA 2JX2A 2OO4A 3D54A 4B3SJ 3OTBA 3LPYA 5J2NB 1WDTA 3RR8A 1ICEB 2MPUA 1FKAF 4X64F 3N6NA 3KNGA 1IQTA 3HVRA 1YZ6A 2EG1A 4ZS6A 2MTLA 3M2UA 1Y11A 4DV1F 3PJWA 3NNAA 3EWGA 4LJMA 5DLFA 1FXLA 3N79A 1YJWS 1MG7A 2BKOA 2KKHA 3LGHA 4BC9A 2JL9A 4RW9A 3FQLA 1HNWF 4ZJQA 2NPFA 3D6HB 1A7GE 1EZZB 2CG8A 2VUGA 4FBTA 3MMAB 4WFXA 5KOXA 3DN9A 2DGWA 1NEEA 1IBKF 2LMIA 4JI2F 1N33F 4CLYA 4OJ3A 5KFEA 1FD8A 1JLCB 2BE2A 3MCSA 3AHPA 2DNQA 3DDNA 2YKQA 4BLGA 2CRLA 2H4YB 1YSJA 1BGXT 5IQ6A 3QO9B 2XM3A 4Y34A 5HMXA 4OHVA 1A9NB 4OYPA 1CULB 5HJXA 2MB0B 1V3RA 1A6LA 2CPHA 2FY8A 4B3RJ 5MLCV 1V3ZA 2XYHB 5HANA 3BGLA 4NEYA 1EETA 3CJRA 1JK9B 3V6KA 2BJ1A 1G2EA 2B5JB 2ZWOA 1L3UA 4L76A 4J9MA 2DKOB 4YHHF 4KHPJ 4QIFA 4RW4A 5E3QA 3UN5A 1LWCB 3JSMB 2UUTA 5C42B 3DI6A 4OJHA 3V6DA 1NBEB 1T9UA 4CLSA 1YJTA 2O66A 4USUA 2XYGB 2XWYA 2LKZA 2OPRB 2L41A 3BSNA 2IYIA 4Q2MA 4DR5J 2ZKUA 1QM9A 1RQ0A 1GH8A 3AJ1A 2X1GA 1VRUB 1WC5A 1K1SA 2X1AA 3J7YI 1W26A 3MOJB 2UUBJ 2UUAJ 3M1VB 3B4DA 4NEZA 1UWBA 3OL8A 2WRMA 4DV4F 3CD0A 1WSVA 1UCNA 4B02A 4LF7J 1QLNA 1ZM2A 2DGTA 2LDYA 2MHEA 3BGUA 4G1QA 1PC5A 4LF9J 4LR8A 1YRUA 2KG1A
chains in the Genus database with same CATH topology
1CJVA 2BW7A 1YK9A 3R5GA 1CJKA 4CLWA 4USVA 4CLLA 3C16A 5D15A 3C14A 3ET6B 4OYWA 1CJTA 1CJVB 5D0RA 4CLUA 4USWA 5IV4A 2GVZA 1CJKB 4OYZA 4CLYA 4CLSA 3MAAA 2W01A 5D0HA 3C16B 1WC0A 4USUA 3G82A 3C14B 1YBUA 4NI2A 4CLFA 1CJTB 1WC6A 1CS4A 1CJUB 3C15A 1U0HA 2GVZB 4OYAA 3MAAB 1CULA 4WP9A 5D0GA 4OYMA 3G82B 1WC5A 4NI2B 4WP3A 5D0EA 1CS4B 3C15B 3MR7A 1U0HB 4OYPA 1YBTA 4CLPA 4P2FA 1CULB 4CLTA 4CM0A 4WPAA 4P2MA 4P2XA 1Y10A 3UVJA 1TL7A 4OYOA 4OZ2A 1WC3A 2GVDB 4CLKA 1FX4A 4OYXA 1AZSA 2WZ1A 4OYBA 1WC1A 1WC4A 4CLZA 3UVJB 1TL7B 1Y11A 2GVDA 1AB8A 4OYIA 2QV6A 5IV3A 1CJUA 1AZSB 4WP8A 1FX2A 4OZ3A 4CM2A 3ET6A 4USTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJV A;  2BW7 A;  1YK9 A;  3R5G A;  1CJK A;  4CLW A;  4USV A;  4CLL A;  3C16 A;  5D15 A;  3C14 A;  3ET6 B;  4OYW A;  1CJT A;  1CJV B;  5D0R A;  4CLU A;  4USW A;  5IV4 A;  2GVZ A;  1CJK B;  4OYZ A;  4CLY A;  4CLS A;  3MAA A;  2W01 A;  5D0H A;  3C16 B;  1WC0 A;  4USU A;  3G82 A;  3C14 B;  1YBU A;  4NI2 A;  4CLF A;  1CJT B;  1WC6 A;  1CS4 A;  1CJU B;  3C15 A;  1U0H A;  2GVZ B;  4OYA A;  3MAA B;  1CUL A;  4WP9 A;  5D0G A;  4OYM A;  3G82 B;  1WC5 A;  4NI2 B;  4WP3 A;  5D0E A;  1CS4 B;  3C15 B;  3MR7 A;  1U0H B;  4OYP A;  1YBT A;  4CLP A;  4P2F A;  1CUL B;  4CLT A;  4CM0 A;  4WPA A;  4P2M A;  4P2X A;  1Y10 A;  3UVJ A;  1TL7 A;  4OYO A;  4OZ2 A;  1WC3 A;  2GVD B;  4CLK A;  1FX4 A;  4OYX A;  1AZS A;  2WZ1 A;  4OYB A;  1WC1 A;  1WC4 A;  4CLZ A;  3UVJ B;  1TL7 B;  1Y11 A;  2GVD A;  1AB8 A;  4OYI A;  2QV6 A;  5IV3 A;  1CJU A;  1AZS B;  4WP8 A;  1FX2 A;  4OZ3 A;  4CM2 A;  3ET6 A;  4UST A; 
#chains in the Genus database with same CATH topology
 2MKJ A;  4OQJ A;  2ALY B;  1RT3 B;  5LOQ A;  4G6V B;  2HGL A;  4USV A;  1DY3 A;  3IAS 9;  3RTV A;  4EBE A;  1YI2 S;  2HEK A;  3LAM A;  4QIE A;  4ED3 A;  4LFC J;  3Q0A A;  5AXK A;  4DN0 A;  2FHO B;  2XMU A;  4HHU A;  4URS A;  2GAG C;  4CO2 A;  3FMB A;  3PVX A;  2VPW B;  1GXT A;  4NE9 C;  2CWX A;  2PD1 A;  4QZV B;  3TJ8 A;  1S0V A;  1MN9 A;  4ZVS B;  2A6O A;  5KFP A;  4TQR A;  3LP2 A;  4PUO B;  1RLD A;  4AL5 A;  1JMT A;  5GAH U;  2CVE A;  2LLZ A;  3Q8U A;  3QID A;  3I4P A;  2NZ4 A;  3W1Y C;  2QIF A;  2WSF C;  4HDG A;  4LF5 J;  1TKZ B;  5A8W A;  4DS5 A;  3IGN A;  3M8Z A;  3AD9 C;  1RHR B;  3TW0 A;  3RRG A;  1RB0 A;  2QMU B;  2KXH A;  2ZH3 A;  1HQ2 A;  5IV3 A;  2XGQ A;  3EIC A;  1FJG J;  3DRR A;  3PO4 A;  3CSK A;  3HD2 A;  1EJ7 L;  1LW0 B;  1BQN A;  1ULR A;  4DQR A;  2HWT A;  2L08 A;  2R3V A;  1VQO S;  3S01 A;  4MFB B;  2G0C A;  4F0M A;  3ZNU A;  4FF3 A;  3MM7 A;  2HBZ B;  2K2P A;  2MQO A;  3B78 A;  4U8Y A;  1HIY A;  2FJD B;  5C25 B;  4DR6 F;  5FII A;  4F4Y A;  2RQM A;  4KTQ A;  3VGU A;  4LF8 F;  4K4U A;  1G1X A;  3N6M A;  4JI4 J;  5HSP A;  2EFP A;  4DHV A;  2FGC A;  1C1B A;  4IG0 B;  4ZPB A;  4LR7 A;  1YBT A;  3KLF A;  2DPJ A;  2RD5 C;  1OQ3 A;  4DSE A;  4EU0 A;  4J9N A;  3BO4 A;  4DPU A;  2V2Z A;  2CWK A;  2KI2 A;  2HMI A;  3PW7 A;  4F4A A;  4YDD B;  1WJ9 A;  4LBP A;  1HYS B;  5B0D A;  2B0G A;  3KHL A;  5F0U A;  1J5E F;  2B51 A;  1TK5 A;  1R7I A;  2LFV A;  3GON A;  1JNR B;  3CC7 S;  2KVI A;  2VAS A;  3L7O A;  1HI0 P;  1AFI A;  3MPU B;  3P4U B;  4ZLP A;  1FFS B;  3TVY A;  2AHO B;  3TOQ A;  3DLE B;  2QLJ B;  2IA0 A;  3GV5 B;  1WKJ A;  1L3K A;  2LYV A;  2NXJ A;  2DY1 A;  2HSE B;  5KT4 A;  3NCQ A;  5KFS A;  1GMW A;  4DSF A;  1NSP A;  3TUI C;  1FVS A;  4PG5 A;  2BJ3 A;  3KLH B;  5CZV A;  5KFC A;  4DV0 F;  1RYS A;  4UQG A;  1CS4 B;  4UZC A;  1S72 S;  4OI2 A;  1NJW A;  1WOP A;  2ABY A;  2MJN A;  1GNK A;  1VDH A;  4ED6 A;  4U7U K;  2UXC F;  4FXV A;  4OLO A;  5L1K A;  2IDL A;  3J7Y U;  3ITH B;  4NML A;  4RL1 A;  1I5O B;  4UF4 A;  2PA3 A;  4EZ9 A;  3CCE S;  4ZPV R;  2PMH A;  1FRL A;  4NYP A;  4OZ3 A;  3N28 A;  1FCA A;  3AA8 A;  3DCA A;  2EG2 A;  2V8P A;  1IXK A;  2VOO A;  4WK1 A;  3OTD A;  2KM8 B;  1R43 A;  2M9K A;  3OTO J;  2E44 A;  3V4M A;  4DV7 J;  1XC9 A;  1BHN A;  1YVF A;  4MKA A;  5F0W A;  4FXD A;  1XWL A;  4PXE A;  2W01 A;  3JQK A;  3KLV A;  5SZT A;  2NSC A;  1M5H A;  1HA1 A;  2RKI B;  1I94 J;  2BAN A;  5HP1 B;  4A8F A;  1Q8B A;  2VDH A;  1S1T B;  1S1U B;  4FPI A;  4V1A k;  3TAN A;  4M94 A;  3M9O B;  1O0P A;  2FLN A;  5ETQ A;  3HM9 A;  1VQ4 S;  1RHU B;  3LF0 A;  1IJF B;  3N4W A;  4P2M A;  4YN3 B;  4DZ6 A;  4M95 A;  3GCX P;  1HNV B;  3QFW A;  4DS4 A;  2VFS A;  5I3U A;  5KG1 A;  4KT0 C;  2CQ4 A;  4V19 X;  3N9U C;  3B8H A;  3W3S A;  1Q86 T;  2XHC A;  1ZA2 B;  2D74 B;  5DET A;  2ADC A;  1S48 A;  1HBO B;  4WZM A;  2ZH1 A;  4RW8 A;  2VKZ G;  3QRQ A;  2CQ3 A;  4CI0 B;  4B3M J;  4DV6 J;  3GFX A;  3HF5 A;  1TP7 A;  3CE8 A;  1H0H B;  5LXR A;  2Q43 A;  3DOL B;  3MAA A;  1VRT A;  4DZD A;  2RQK A;  4LRA A;  3O8W A;  4UY8 5;  1N0V C;  5IT4 A;  1P9Y A;  3MEG A;  3J7Z 5;  3PY8 A;  1GFW B;  1GTH A;  2XLJ A;  1NZA A;  3K57 A;  3EGW B;  3I32 A;  1RAC B;  3KUH A;  4DI6 A;  4EEY A;  4P2F A;  3F44 A;  2YKM B;  4U8V A;  3DOK A;  5ETM A;  1Q7Y T;  1TL7 A;  3RZA A;  2M52 A;  1REG X;  1KKH A;  1TAQ A;  2C42 A;  1XBW A;  1W25 A;  4DQS A;  1FHT A;  2CKW A;  2ZBI A;  3T1Y J;  2QYC A;  3EZO A;  1AZS A;  5CYM B;  2DH8 A;  3GE9 A;  4M63 A;  1HQE B;  2GGP B;  4KGV B;  2FIU A;  3IWL A;  4HTI A;  3UI3 A;  3A8K A;  2P9G A;  4Q7A A;  1C1C A;  1KHW A;  2B7B B;  2FPH X;  2HHS A;  2I6W A;  4JI7 F;  2YXL A;  4C3M A;  2CDR B;  2OPQ A;  4C4W A;  3MM5 A;  3RW7 A;  3G6V A;  3T9N A;  3MCO A;  3G8Q A;  3IG1 B;  2M8H A;  2FY1 A;  5C24 B;  1TV6 A;  3CJ8 A;  3EVM A;  4L3K A;  2W4P A;  3HUL A;  3H59 A;  4C9D A;  3MHY A;  3JYT B;  4LSN B;  4C98 A;  4ZVT B;  4ZCK A;  4JI8 F;  4DBQ A;  4AL7 A;  1Q7L B;  2DJW A;  4HAC A;  5D0E A;  3OFH A;  4ED7 A;  1T9V A;  4ZN1 A;  1YX2 A;  4QWA A;  3KK2 A;  1S9E B;  2A2C A;  2HFO A;  1U2F A;  3M7V A;  5C2G A;  1S6P B;  3WC0 A;  1NND A;  1HI8 A;  4OZ0 A;  5L39 A;  2R2U A;  2VA3 A;  4NZ7 A;  3W61 A;  1KQS R;  5KFJ A;  3CPW R;  1QVG R;  4AND A;  1AFJ A;  3C6U A;  3T5H A;  4USK A;  1NKB A;  1VQ8 S;  3M2U B;  2NCK L;  4ZLN A;  2IMO A;  1QJH A;  2VA2 A;  2QMX A;  4F36 A;  4B9L A;  3VAM A;  4I4B A;  4RW9 B;  3PIO Q;  4WFA Q;  4I6W A;  1S9F A;  2CJ9 A;  1TKX B;  4DCJ B;  2M7S A;  5EHH A;  5DDO C;  1JXL A;  1QUP A;  3PFE A;  2DH9 A;  2RHS B;  3MPY A;  5KOW A;  1RAG B;  2XQC A;  3W5Y A;  2Y8W A;  4TY8 A;  1DAR A;  5HN0 A;  4HI2 A;  1T9W A;  2YTC A;  3DM2 A;  5CCM A;  1YIT S;  4ER8 A;  3VGT A;  4LF6 J;  3K0J A;  1WUU A;  2OPS A;  5KFG A;  4MYU A;  2Y1L B;  5T14 A;  2E1C A;  3CCJ S;  4GKJ J;  4MK7 A;  3BGF A;  1PG5 B;  3SQO P;  3FC9 A;  4DL0 C;  1Y0H A;  3T19 A;  1CQM A;  4DF8 A;  3CUN A;  4NLV A;  2V68 A;  5E3A A;  2GQ2 A;  2ZOM A;  3L95 X;  4IH7 A;  2ZE2 A;  3GB0 A;  2KHC A;  1U4B A;  3ZNJ 1;  2HYI B;  1EQM A;  4HR2 A;  1EET B;  3QAE A;  3GCW P;  4K4Y A;  4UST A;  2A18 A;  2VBX A;  3AOB A;  2QYG A;  1URR A;  5F8H A;  2ZM6 F;  2E29 A;  2J6U A;  4DWI A;  2WOM A;  1SC1 B;  2PFF B;  1S7I A;  4OLP A;  4RBU A;  4OYW A;  4J90 A;  1HHS A;  1VQL S;  2BXJ A;  1K47 A;  1MMD A;  1WG4 A;  4YME A;  4RW4 B;  2Y0B B;  3DI6 B;  3LOU A;  3V6D B;  2VU5 A;  1RBO B;  3MZI A;  4W4M A;  2YPY A;  3G6X A;  5K14 A;  2O01 C;  3HI9 A;  1RU2 A;  1QSY A;  1UFK A;  4DF4 A;  1UKU A;  2HNZ B;  5ETT A;  2C3U A;  2XO6 A;  4KAI A;  1SKU B;  2FHJ D;  1UWB B;  1RT1 A;  2PI5 A;  1FWL A;  3VZI A;  1TUV A;  2EI5 A;  2K1R A;  2HK2 A;  1VQM S;  1RT4 A;  5F8N A;  2QG9 B;  2XY6 A;  2DBB A;  1NK4 A;  3KWM A;  3K7R A;  5F9L A;  3OT9 A;  2X1F A;  1M1G A;  4PR6 A;  3GWC A;  2N82 B;  2W8L A;  4G1Q B;  3TWZ A;  3BQ1 A;  4ZP6 A;  5LMN F;  3S6E A;  2J7W A;  4MKB A;  2R2R A;  2DNG A;  4JUZ A;  2G0I A;  2FD2 A;  4YB7 A;  4JI0 F;  4U7U D;  3F73 A;  2I2Y A;  4Y65 A;  5IZH A;  2C2D A;  3D66 A;  2GA7 A;  5KFO A;  2GS8 A;  2YWG A;  2VDI A;  4MK9 A;  2HHH J;  2J9E A;  3QT7 A;  2PC6 A;  3MUM P;  3HFK A;  3KLI A;  5L9N A;  4JI2 J;  4MKV A;  1RAA B;  2PMW A;  1VMB A;  3TAQ A;  4Z37 A;  2AYB A;  1PAE X;  3G87 A;  2JLF A;  4F0K A;  1IKV A;  2RT3 A;  2GQQ A;  2HS0 A;  4Q5V A;  3EDR B;  3CCQ S;  3H8Y A;  2MHN A;  2MZR A;  1FNM A;  5F8G A;  3QWU A;  2V2Q A;  4C97 A;  1NO8 A;  5A8W B;  3LA0 A;  2RE1 A;  1FEH A;  2CQG A;  1WG5 A;  3C19 A;  1T05 B;  2LU2 A;  3N5B A;  4ID5 A;  4ID8 A;  1FJC A;  4B9N A;  5CAB A;  1SVD A;  1HNZ F;  4C11 A;  1T11 A;  3DRR B;  3U02 A;  3CME S;  3K89 A;  2FDN A;  1BQN B;  5F8J A;  2NQP A;  4PPD A;  5A8R A;  2QFI A;  2HFN A;  4IQX A;  3I9Z A;  1IWG A;  4C0B A;  3UD3 P;  1Q5V A;  3MM7 B;  3BPD A;  4XK8 C;  3PXG a;  4L75 A;  2MKI A;  2XWX A;  5D4P A;  2ZH4 A;  3BRE A;  4FVC A;  3ZC4 A;  4ECU A;  3R7S B;  3GZ7 A;  3HKW A;  4IRC A;  3Q86 A;  3R7B B;  2CPI A;  1C1B B;  3KLF B;  2O3D A;  4O4R A;  3PIP Q;  4GKK F;  2W4D A;  2CJY B;  3MCM A;  2HMI B;  1R89 A;  3FEX B;  4LRF A;  4DV4 J;  4WK3 A;  1PGZ A;  3RYL A;  3R1H A;  5H9F J;  1PSD A;  4GO7 X;  4PEO A;  3LPE A;  1RAH B;  4WCE Q;  3KHH A;  5CQG A;  1FEE A;  1KFS A;  2QLB B;  1LK7 A;  2KJV A;  2V9W A;  4OZN A;  4WE1 A;  4ZIW A;  3I5C A;  4XPC A;  2N3O A;  4FS1 A;  3J81 Y;  4C2M A;  2CPZ A;  3MUV P;  4G1I A;  2CQ0 A;  2MQ8 A;  4E98 A;  2UUC J;  4RU9 A;  1CJU B;  1S1X A;  3JSR A;  4RX6 A;  3GP9 A;  4E0D A;  2OUG A;  2HFU A;  2MKS A;  1LW2 A;  3VV2 B;  1FRI A;  2CQD A;  5ETN A;  3S1T A;  2RS8 A;  3RB0 A;  3OHA A;  4JI6 F;  2KO1 A;  1T9X A;  3R3T A;  1S79 A;  3VZH A;  2A1B A;  3T6B A;  1ELO A;  1BWV A;  1CG2 A;  4ZPC A;  1KQF B;  4OZ2 A;  2FHK A;  3V81 B;  2WSE C;  1UET A;  5IT9 Y;  2VG7 A;  3NGK A;  2HZV A;  4Y6I A;  6FD1 A;  4A8K A;  3DDK A;  2F63 A;  4LF4 F;  3MR6 A;  4LT6 A;  4K5R A;  3OBI A;  1KWM A;  1XMB A;  1NJI T;  1WI8 A;  1SL0 A;  4PG6 A;  3PRV A;  3P5B P;  2ZJR Q;  2R8J A;  2W4C A;  2YX7 A;  1UPP A;  2AP6 A;  5H9E K;  1FDB A;  2O67 A;  2OFG X;  3I0S A;  1JLB A;  3PHE A;  5KFX A;  2PDA A;  4X4T A;  4O4G A;  3QPI A;  3HP6 A;  3K2Y A;  4J9L A;  1D9D A;  2YNG A;  3EDQ B;  4NLT A;  1WEZ A;  1RCX B;  3BO2 A;  4F4W A;  4OX7 A;  4C8K A;  3J80 Y;  1IWA A;  2IMW P;  4ZCL A;  4DV3 F;  4DR2 J;  3CGI A;  1BE4 A;  2NZC A;  3CC4 S;  3A8I A;  2YX4 A;  3DDI A;  2W9A A;  1HNX J;  2YWE A;  1PJ6 A;  3NXZ A;  4RW6 A;  2HBY B;  1F9H A;  2APO A;  4J9V A;  5BR8 J;  2YNF A;  2FHM A;  4XDC A;  1VOM A;  3TI0 A;  4ZLJ A;  4I69 A;  3R5C A;  5CA5 A;  3R8Y A;  3OSP A;  2QRR A;  1WTB A;  3GFH A;  5FLX U;  1WOS A;  4N41 A;  4ZVQ B;  5I3U B;  4ANE A;  4Y28 C;  3VAJ A;  4I67 A;  2CNO B;  2BM1 A;  4I0W A;  5A6W A;  2W9B A;  1J2V A;  3MEC A;  2HRY A;  4FYW B;  1K8A T;  3KMS A;  2R7W A;  3T1H F;  3D68 A;  4RNO A;  1F3V A;  3CTR A;  4RW8 B;  2FJB B;  3UN2 A;  4YS2 A;  2BEF A;  4IKA A;  2FC8 A;  2VQE J;  4B9T A;  2BMB A;  1ZTW A;  3W8P A;  2JC1 A;  3PX0 A;  3T41 A;  3MAA B;  1VRT B;  5LSR A;  2U1A A;  3EE3 A;  1HBM A;  2HND A;  3MEG B;  5DDQ C;  4J9P A;  3TEG A;  4RNH A;  3ETO A;  1U1N A;  2CJX B;  2YKP A;  4MKY A;  1E6Y A;  3JTN A;  3KJN B;  2QLF B;  1Y5N B;  1NK0 A;  3M9N B;  2I38 A;  3DLB A;  3NGS A;  4OX8 A;  4A48 A;  4LFA J;  3V6H A;  2HHQ A;  2GFF A;  4PCQ A;  1RHQ B;  3DOK B;  3K5P A;  3IR6 B;  1RZM A;  2AYE A;  5EX0 A;  5IFM A;  2VG6 A;  1TL7 B;  2UXC J;  2HZA A;  4IUF A;  5JXS A;  1XK8 A;  5EWG A;  1ACM B;  1AZS B;  1DRZ A;  3GII A;  4HT5 A;  2D1C A;  2HRT A;  4TU8 A;  4NZ0 A;  5KTQ A;  2FVP A;  1MN7 A;  1Q8L A;  4Y3C A;  1S6Q A;  3E3X A;  3W5X A;  5DO2 A;  3WHI A;  1HW9 A;  2GMJ A;  1C1C B;  4B3O A;  2ERR A;  4HYK A;  3TZW A;  4PG7 A;  5J1E A;  4IO9 Q;  3RB6 A;  2QLX A;  4ZIT A;  5K8O A;  2B7C B;  2YWW A;  2OPQ B;  4OZ1 A;  3MM5 B;  2ZH5 A;  3QRR A;  3AQO A;  1TV6 B;  2KHD A;  1Q95 G;  1OSC A;  2E5L F;  3H7H B;  2JDJ A;  1HD1 A;  4OV6 A;  4UT4 A;  1ZS6 A;  2QA1 A;  1APS A;  2OSQ A;  4DL2 A;  3HCX A;  2DNK A;  1Z1Z A;  3R97 A;  4HAC B;  1YWX A;  2DRA A;  4OHZ A;  5EUH A;  4N5S A;  2QJ3 A;  2H5I B;  3ILJ A;  3KHR A;  4XDD A;  3BDE A;  3CCS S;  1T3O A;  2J0X A;  2GX8 A;  1WSR A;  4JBC A;  1EX8 A;  5IQQ A;  2LA4 A;  2DPI A;  3H40 A;  1BQM A;  1FES A;  3OV7 A;  1P6T A;  3C6U B;  5B7W A;  3DLH A;  1MSW D;  3RRK A;  2LXI A;  2JVR A;  1W2B R;  4IR1 A;  3LP0 A;  4R5P A;  5JVG Q;  4FKX A;  2DVI A;  3LQV A;  3MTJ A;  1D3W A;  4FDF A;  3NMA A;  1MML A;  1BXN A;  4NXM J;  2EFN A;  2I0X A;  3DRX A;  4ELU A;  5F3T A;  3GPA A;  3CJ3 A;  3PR4 A;  1BUX A;  4TY8 B;  1SJR A;  2D9O A;  4ZA1 A;  5K8P A;  3BB5 A;  3DM2 B;  2L48 A;  1Z4U A;  2I8E A;  4TLQ A;  2VH7 A;  5KG3 A;  2WB1 D;  3OL9 A;  2ACY A;  2YKO A;  5LXY A;  1U49 A;  1SUQ A;  1ZAX A;  3R2C J;  3IBC B;  2KVQ E;  3U1M A;  1UEU A;  4FS2 A;  3IO1 A;  1TL3 A;  2W7P A;  1RGV A;  2CNK B;  4BC7 A;  3IBF B;  1KON A;  1CJV A;  4OI1 A;  2ZE2 B;  4W90 B;  5LSL A;  3NNH A;  1YG0 A;  5GME A;  2OLW A;  4ANC A;  2MZJ A;  3DRP B;  2ACM A;  4JOU A;  1CJT A;  1SJ1 A;  2ATL A;  1RHJ B;  2WOM B;  3ENW A;  4UW2 A;  1FA0 A;  4B3R F;  4K4W A;  3J7A N;  3P45 B;  4JI7 J;  2QX0 A;  3NAH A;  1TL4 A;  2ZHA A;  2VFR A;  1TU0 B;  3VQS A;  5K14 B;  4KHP F;  2E1P A;  3R9L A;  1QAX A;  4CO0 A;  4QIW D;  3K8V A;  4MIA A;  2DO0 A;  4DU8 A;  3DOM A;  4TXS A;  2W2P P;  1RT6 A;  1NUE A;  2BDP A;  1M1K T;  3MMB B;  2HAI A;  5EWE A;  4RNM A;  2N3L A;  5H1S V;  1Q79 A;  3CMA S;  2SXL A;  5JVH Q;  2B9X A;  2M4M A;  2ZDO A;  2K1R B;  1UTA A;  3OPK A;  1RT4 B;  2AYM A;  3VAI A;  2G2Z A;  1WEX A;  3FSX A;  4EK2 A;  2UUB F;  3R5A A;  1D8Y A;  5RUB A;  1H2T Z;  1HPZ A;  4A4J A;  3NL0 A;  1YGY A;  3KLE A;  4WYL A;  5J2N A;  1G4C A;  1NSQ A;  4K2X A;  5D0H A;  4LF7 F;  4OV1 A;  2ATC B;  3OD2 A;  2J6S A;  2HQ3 A;  1OQ6 A;  4FBU A;  1DHM A;  1T03 A;  2XNQ A;  4OI0 A;  4OYM A;  4KV8 B;  5KFT A;  4LF9 F;  3KLI B;  4CWB A;  4X4O A;  2ZFH A;  3C2P A;  4NLS A;  1UEV A;  2HIQ A;  4CLT A;  2IY5 B;  1BD6 A;  4TVA B;  1K9M T;  1IKV B;  1U1M A;  2CUY A;  3LUY A;  1RWN B;  1JNZ B;  2K7K A;  3A3N B;  1KDN A;  1B7Y B;  4CLZ A;  1FER A;  4Y2K A;  3HKZ D;  2UV8 G;  2POK A;  1JLC A;  2PEH A;  2WVB A;  3QGP A;  4DXL A;  1RTH A;  3BKU A;  4I1T A;  1WHY A;  3OQ2 A;  4AQY J;  2C2M B;  1Q81 T;  2JLG A;  5ETL A;  5ETS A;  1RWV B;  4JB8 B;  3U1L A;  2F5G A;  4XPE A;  2DIT A;  1D0E A;  3C46 A;  1RI7 A;  4ID5 B;  4QYR A;  1JB0 C;  2Z2Y B;  4CO3 A;  2MEW A;  3NS6 A;  4F4Z A;  1O5J A;  4OJG A;  4LF5 F;  2NLW A;  4FPR A;  4C11 B;  1TVR B;  4Y2M A;  3FBE A;  1H73 A;  2V69 A;  1F5A A;  1H6K X;  2Y3Y A;  3PJX A;  4UOG A;  3SCL E;  2V2K A;  3B6B A;  3KG0 A;  2DNN A;  3CD7 A;  4OX6 A;  2QGF B;  1MNE A;  5DZ7 A;  5A8R B;  3RU0 A;  1FJG F;  5HLF A;  3IWN C;  2B5J A;  5F8M A;  3PG9 A;  1IM6 A;  2EBE A;  1NK8 A;  2VPY B;  1VIX A;  1X0P A;  2ASJ A;  5A0Y B;  2UVU A;  1NK9 A;  1UMJ A;  1ZZF A;  4ED1 A;  5J2Q B;  2MKY A;  1Y10 A;  3IMQ J;  2D3U A;  2CQH A;  1QVF R;  4X84 A;  4OYO A;  3WX8 A;  3PW5 A;  1WC3 A;  2Y1J A;  2CNN B;  4DLG A;  2MXY A;  2OPP A;  3BR8 A;  3ZZZ A;  2DHX A;  4N47 A;  2DHA A;  3H2V E;  1TZ0 A;  1RTI A;  4A46 A;  2GHV C;  3DHX A;  5B0C A;  1RU1 A;  2ZDP A;  4YP3 A;  4HDH A;  2AWZ A;  2XZT B;  1PYO B;  1N52 B;  3IR7 B;  1BMQ B;  1SJF A;  4J9Q A;  1HWJ A;  1Y3K A;  3JSY A;  4OI4 A;  4USW A;  1KVI A;  2E1A A;  4QR0 A;  4BWM A;  3CED A;  4WE1 B;  4CNZ A;  4FNI A;  3THP A;  5J1N A;  3CCT A;  1RA7 A;  5CYJ A;  3CNQ P;  2KN4 A;  3OJS A;  2DHG A;  4YOE A;  2H4W B;  2H9Z A;  3R27 A;  2WTF A;  4I68 A;  3BKF A;  2J5A A;  5ADZ A;  4OI6 A;  2ASY A;  3MEE A;  3P8B B;  1C0U B;  1S1X B;  4IG3 A;  3D0H E;  2HHP A;  4USM A;  4X62 J;  1QSL A;  1LW2 B;  2XZD B;  2C2R A;  4FYV B;  3W65 A;  2BJ7 A;  3HZG A;  3GIM A;  5HL7 Q;  1TKD A;  3NGD A;  3FFI A;  3RBX A;  4ALZ A;  4DX6 A;  1Q4R A;  3IP0 A;  2R2T A;  1TK0 A;  1M5K C;  2Z58 B;  2LQ5 A;  2JEF A;  1X60 A;  3CUL A;  5DS7 A;  2CJQ A;  2A0F B;  2V9K A;  4U96 A;  5HAO A;  3F0N A;  2VG7 B;  2V94 A;  2ZUA A;  2ZBQ A;  2COL A;  3BS9 A;  4ZPD A;  4O23 A;  4OFZ A;  4RWW A;  2CPY A;  4CLU A;  2D3O 1;  2NXE A;  1ZM3 A;  4JI1 J;  3N01 A;  3TZZ A;  1NB7 A;  2KXN B;  3TNV A;  1IKX A;  2KXF A;  4ETZ A;  4KE5 A;  3SXL A;  3I0S B;  5CHC B;  2VJU A;  1JLB B;  2LEC A;  4O4G B;  2HRU A;  2B4V A;  1FTC A;  1S5Z A;  5ETR A;  2B43 A;  2F8H A;  2G1D A;  4RWX A;  4ECS A;  2EPI A;  2B4U A;  3Q8V A;  2HFS A;  1FFW B;  2HW3 A;  1L3S A;  3OTO F;  1WOR A;  4DV7 F;  4A8S A;  2DR6 A;  3M9M B;  2ILZ A;  1FX4 A;  4RW6 B;  3BBB A;  4OYB A;  4RZR A;  2KB2 A;  2JEG A;  1S4F A;  2YNF B;  2IBO A;  3FJ2 A;  2NXN A;  1YJ7 A;  2BAC A;  4ELV A;  1I94 F;  2MY7 A;  3FDS A;  2XYP B;  5L1I A;  2CAD A;  1ROF A;  1QE1 A;  3AXK A;  1F60 B;  2KL8 A;  4F25 A;  3I9V 9;  1WWH A;  5THW A;  2M5Y A;  4DFK A;  4B9U A;  3MI7 X;  2JFD A;  1LQ9 A;  3FBB A;  3ETM A;  2W9B B;  3MEC B;  1RP5 A;  2RUG A;  8ATC B;  5KFW A;  6AT1 B;  4WBF A;  2JFK A;  5K8M A;  1JJ4 A;  2XG8 A;  2XY5 A;  1EHW A;  3Q89 A;  1GMW D;  4ES3 A;  1NH7 A;  3RJM B;  4OHX A;  2K8G A;  4R0J A;  1HBM B;  4M5I A;  2YQ0 A;  2HND B;  2JVO A;  3D0G E;  2H5E A;  4ECV A;  4B3M F;  3DLJ A;  5AXN A;  4DV6 F;  3BF4 A;  2ZUG A;  5SUH A;  3FQK A;  1N5S A;  3FCV A;  1N4L A;  2UVW A;  2V6A A;  1JLF A;  1E6Y B;  1HBN B;  3K5N A;  1VBY A;  1ZM9 A;  2YPZ A;  4ZDN A;  2ZH7 A;  4X65 F;  3Q24 A;  2HHU A;  3D6T B;  1SJ4 P;  3EZ5 A;  2HAF A;  2XMM A;  4ECX A;  3QZ7 A;  1FX2 A;  2EWH A;  4O3Q A;  1ZM4 A;  2VG6 B;  3H98 A;  1M5V C;  1HWL A;  1R8A A;  1VIS A;  3AOA A;  2HBR B;  4K50 A;  2WSC C;  2ADB A;  4YY3 J;  2VD3 A;  2R7R A;  2XZW A;  4J9R A;  1VBK A;  5K5M A;  1U8W A;  2V50 A;  1WF0 A;  3HPO A;  2B8Q A;  4B17 A;  2EC2 A;  5M2P A;  4ES1 A;  2NRE A;  3RBZ A;  1NHV A;  3TRG A;  2PE8 A;  3JXO A;  1QDU B;  1N6Q A;  4U67 Q;  1S6Q B;  3T1Y F;  2DNZ A;  2HVI A;  3UNY A;  3A8J A;  1ZAV A;  2MZT A;  1K0T A;  2CNL B;  3UNG C;  1B3T A;  1WD6 A;  4B3O B;  2DIU A;  2U2F A;  4MJK A;  2V4Q A;  3EGV A;  4RO0 A;  5DGB A;  5J1E B;  2OKQ A;  3FRY A;  4DFP A;  3BH6 B;  1FXR A;  4K4Z A;  2ZJP Q;  2HFV A;  1GX5 A;  2EVZ A;  2Z4P A;  4C48 A;  2DNH A;  4OZL A;  4U95 A;  2HZC A;  2FLP A;  2FUG 9;  2OHD A;  3A3P B;  2YX1 A;  2QA2 A;  3M2V A;  3V4I B;  3LAN A;  3BSO A;  3GLJ A;  2DHH A;  3ZTS A;  2MKK A;  1RWU A;  2XO7 A;  2X3G A;  4LMZ A;  1E6V A;  4WJB A;  4ZK7 M;  2VF3 A;  1M5S A;  4CH7 A;  3R5G A;  1FWP A;  5A8K A;  1R3N A;  1JQG A;  1RA6 A;  1X4C A;  4CZC A;  1SXL A;  4GVB A;  1BQM B;  2N4D A;  1C4C A;  2C1E B;  1H2V Z;  2KFZ A;  5C2C A;  4P72 A;  4UQT A;  1L5U A;  3LP0 B;  1VJQ A;  4R5P B;  2RVJ A;  2OSR A;  2RRA A;  1VGY A;  4JV2 A;  1N32 F;  3GQC A;  2WVF A;  2N7C A;  1PJ5 A;  2KU7 A;  2XGP A;  2IJR A;  4K59 A;  2IM2 A;  2VQF J;  4IOB A;  1OIA A;  1ZET A;  2C22 A;  2FTR A;  2RQC A;  3GR0 A;  3SFG A;  2ZNZ A;  1R0B G;  2C3Y A;  2ZZN A;  3UD5 A;  3TUZ C;  2DXF A;  1TKT A;  4NX9 A;  4UOC A;  3CJ4 A;  2HHV A;  1VQN S;  1SUQ B;  4M5N A;  3PKY A;  1RWK B;  4NAS A;  3TVK A;  4LSL A;  5KFQ A;  1B0T A;  2DGV A;  3DHW C;  1TL3 B;  3RB3 A;  3LTO A;  2P6S A;  4WII A;  1MW7 A;  5GMD A;  1TAU A;  2FVQ A;  5HBM B;  4ZOS A;  4Q2L A;  3OHB A;  3HJV A;  2MZS A;  4TU9 A;  1XNQ F;  2YKM A;  1WEL A;  1CJV B;  1MWQ A;  2GVZ A;  1UJ5 A;  4GKJ F;  1BLU A;  1FT8 A;  1OJ4 A;  2YQ3 A;  4Z7Y A;  1FE0 A;  1CJT B;  2HVZ A;  4ZVU B;  3IR5 B;  3QT5 A;  2WW8 A;  3DXS X;  1CVJ A;  2HWI A;  2VZ9 A;  1QTM A;  1HQE A;  2MMY A;  3K8W A;  3KFW X;  4C3K A;  1KC8 T;  5J2P A;  4NXN F;  4HLB A;  3CXC R;  4LVN P;  1VC6 A;  4DDF A;  1VQ6 S;  1MMN A;  4D3G A;  4ATN A;  3OXF A;  3UN3 A;  1OPI A;  4F2S A;  1SKS A;  3HHL A;  9ATC B;  1T3N A;  4ZCI A;  2YKN A;  4C8N A;  1F9F A;  4PQA A;  3DOM B;  2QZ8 A;  1UFW A;  1RT6 B;  2F8E X;  3FKB A;  5KFK A;  3KUE A;  3VQT A;  5G4D A;  4EWT A;  3W66 A;  1MWZ A;  4TYA A;  5I42 A;  5LM7 E;  3MR3 A;  4I56 A;  4KGX B;  3HHN B;  3DFE A;  2C3O A;  3VVT A;  4Y00 A;  5IV4 A;  4RLE A;  4F04 B;  2RML A;  4F3Q A;  4Z2X A;  1HPZ B;  2KYZ A;  3KLE B;  2HQD A;  1WOO A;  4DV2 J;  3I5A A;  5JJB A;  2XLI A;  4ERD A;  2QA4 S;  3PYE A;  4C0H A;  3NCR A;  1LV5 A;  1NJX A;  4HT7 A;  1T03 B;  4N7T A;  4DR1 F;  2H48 B;  2VKR A;  4ZVR B;  4A8W A;  4K2J A;  2UP1 A;  2VON A;  1U09 A;  1ZH5 A;  4B9V A;  1X4D A;  3LH2 S;  3THV A;  2HVH A;  1HAR A;  1DJ0 A;  4DL6 A;  1S7H A;  3MWB A;  4CH0 S;  3M8R A;  1FXD A;  1TKX A;  4E2F B;  2HHH F;  2R42 A;  4G3I A;  1SKW A;  2W2O P;  2UXD F;  3VAG A;  9RUB A;  3RUB L;  4K8R A;  1RTH B;  1N88 A;  2HGM A;  3S8S A;  1I6J A;  1RTJ A;  1NPK A;  4NLR A;  4F2R A;  4LQ9 A;  3TO8 A;  3ICL A;  4C8L A;  5GAG I;  1H2U X;  3SSS A;  3GIR A;  4DR7 J;  3JQJ A;  3SCI E;  3ELH A;  2G13 A;  4XO0 A;  1GEH A;  1UP1 A;  1VJW A;  3W7B A;  2HHW A;  3J81 U;  4ITS A;  4R8U A;  2HNY A;  4M8L A;  3KUG A;  4M5D A;  2KT3 A;  5H9E J;  1X4H A;  5HLF B;  4BDP A;  4CCH A;  2CQ1 A;  1O51 A;  5KFZ A;  3DKD A;  1V5V A;  2RDD A;  2J7U A;  4ZVE A;  3HHL C;  3Q2T C;  3GJR B;  3QGG A;  4WTY A;  2BOP A;  3NS7 B;  4JV0 A;  1PIL A;  2ZVI A;  1IQZ A;  5J2M A;  3IRX A;  3HHK A;  2OPP B;  1AT1 B;  3HSZ A;  1B99 A;  3KDO A;  2K3I A;  3QQC D;  3M6U A;  3AQP A;  1WF1 A;  1RTI B;  4PYD A;  5IT9 U;  2MQL A;  5ETP A;  2HNZ A;  3CJ2 A;  1Q78 A;  4C0O C;  3JAM Y;  2BQR A;  4FVM A;  4LF1 A;  2XBP A;  2FB0 A;  2OH2 A;  2BAB A;  2NR0 A;  2FJV A;  4YUD A;  2W7O A;  1UFL A;  4LBH A;  4IOC Q;  5D0G A;  5KFF A;  2FZG B;  3AB4 B;  4RNF A;  2IM1 A;  4ZPW R;  1UVM A;  2J76 E;  3DGP A;  2CQB A;  1N5Y A;  3MFH A;  4A8X A;  2BVZ A;  2LXU A;  3GIJ A;  2VBW A;  3GSI A;  4MIB A;  4ECT A;  3MEE B;  3UVJ A;  2VC0 A;  4IG3 B;  2CJB A;  3J80 U;  1SQE A;  3EUN A;  2ZNY A;  3CVK A;  2FJA B;  3UO0 A;  3N6L A;  3ENA A;  2HS3 A;  2MLZ A;  3MDF A;  1RCO B;  4CRJ A;  5DDR C;  2HPU A;  2IFX A;  4UY8 T;  2UUC F;  5F9N A;  4EBC A;  1Q8I A;  1S1V A;  2YWK A;  4CIO A;  3TQE A;  3EJM A;  3J7Z T;  1NK6 A;  1BWE A;  1TUG B;  3FFI B;  2DR5 A;  2A10 A;  3CIM A;  5E7O B;  3I4H X;  1F0X A;  4HL9 A;  5CH7 B;  2V8H A;  4H4O A;  2AW0 A;  4KFB A;  3HFZ B;  4ILR A;  2VIC A;  3SI8 A;  2AX0 A;  5AXM A;  3MMJ A;  1UW9 A;  3TR5 A;  2MY8 A;  3UDC A;  3MUR P;  3HX9 A;  2VL1 A;  4AD6 A;  1IKX B;  4DR4 J;  1VI7 A;  2F1F A;  3M30 A;  1N54 B;  2LQB A;  1C0T A;  1T05 A;  4DX5 A;  4I2P A;  4QWB A;  1OY6 A;  2GIF A;  1JJC B;  1FRK A;  1WHV A;  1OYD A;  2D69 A;  2ZH2 A;  1RWP B;  3H20 A;  2L9W A;  1Y9O A;  5F8L A;  5DRK A;  3QAU A;  2B4P A;  1DZ5 A;  3PR5 B;  2KZM A;  3RAQ A;  1ARO P;  3HDS A;  4ZP7 A;  1N5V A;  3PKM A;  5JUM A;  4DR2 F;  3MD1 A;  1DLO A;  1R8C A;  1TL1 A;  3EGN A;  2CXE A;  3AY0 A;  3HMJ G;  3LGN A;  3C16 A;  3ZZR A;  1KVJ A;  4F4X A;  1NCL A;  4PG4 A;  1HNX F;  2JEJ A;  3OXG A;  1QE1 B;  3Q8P B;  4U6P A;  5BR8 F;  3QMQ A;  5KG0 A;  3PYF A;  2K7J A;  1TMJ A;  3MM6 A;  2OEK A;  4FZV A;  5KT3 A;  4FYY B;  4GC6 A;  3HT0 A;  1ZA1 B;  4WWS A;  5GAG U;  1M0S A;  2IIH A;  5LMU J;  1U1P A;  4ZMM A;  4AYB D;  1FTR A;  3UCU P;  3MFI A;  3KOA A;  2DYA A;  4DSI A;  4IH6 A;  3MR5 A;  2BR0 A;  1Q53 A;  2VQE F;  2QE5 A;  4X4V A;  1SL2 A;  1IKY A;  1CC8 A;  2ZZT A;  2YWF A;  3RAX A;  1CJU A;  1JLF B;  3FZ2 A;  2F9D A;  3GJQ B;  3BV8 A;  1X9W A;  2QFJ A;  2J6T A;  4FKY A;  4FYD A;  1SCJ B;  4HVZ A;  1XNR J;  2BQU A;  3SQG A;  1T8E A;  3GFY A;  2DGU A;  3OJU A;  1VFJ A;  3CJK B;  4Q8F A;  2OJ3 A;  3M8P A;  2CZV C;  3T6J A;  1KBR A;  4LFA F;  2GIR A;  3KHG A;  4V19 J;  3V81 A;  3A3O B;  2UXB J;  1U0H A;  3FEZ A;  3I0R A;  1N6Q B;  1O8B A;  1SBR A;  2VFU A;  1RUS A;  4F02 A;  2GZO A;  4P75 A;  3RAM A;  2LEA A;  1KOH A;  1C2P A;  4P71 A;  3CO9 A;  2E9T A;  5LJ5 Y;  2W2Q P;  5GAE I;  2DK2 A;  2GV1 A;  1CSJ A;  2I9S A;  2L3M A;  2VIH A;  3RRH A;  1VLO A;  2MGZ A;  2B8P A;  2Q66 A;  3Q83 A;  2HK3 A;  4TU7 A;  2E5H A;  2HQI A;  2CPX A;  3M6X A;  3M2V B;  1JXV A;  1Y5L B;  1GTE A;  2CZ4 A;  3CD5 A;  5D4L A;  4NCB A;  1PAU B;  2GML A;  2H65 B;  1E6V B;  2DXD A;  1U1O A;  2XMJ A;  1ZOT A;  4KYZ A;  1I51 B;  1VRQ C;  5A8K B;  1RAB B;  4F8R A;  5E2Q A;  2QEX S;  4CYU A;  4GVB B;  2HIY A;  1GT8 A;  2VPX B;  2GW8 A;  1REV A;  1RT7 A;  2FGO A;  1UAW A;  3W62 A;  3VAK A;  3WX4 A;  4CQ1 A;  1FNO A;  1KLM A;  2DIV A;  3D6M B;  3ZTP A;  1KLN A;  5B0E A;  5DQI A;  2HQC A;  2E9Z A;  1WEY A;  3AD8 C;  3OLB A;  2OMO A;  1SQF A;  3SEO A;  1XMO J;  2LQ8 A;  4DPT A;  4Z7C A;  1OS5 A;  4H4K A;  3TJA A;  3QNW B;  1EB0 A;  2PSZ A;  1NLK L;  1V3S A;  4IH5 A;  5D6G A;  1HFE L;  4OYI A;  4EGL A;  4NXM F;  3SBM A;  1K1Q A;  2WHO A;  7AT1 B;  3MGJ A;  3IN5 A;  2DRB A;  1LWX A;  1NSK L;  1TKT B;  1X7V A;  4M1K A;  2FJW A;  2MKH A;  2R8H A;  3E8O A;  3G8T A;  1SV5 A;  3HHE A;  4X65 J;  3FCH A;  3B82 A;  4X4U A;  3VVU A;  4LSL B;  1Y5I B;  4N77 A;  1LKZ A;  4J5O A;  2KJW A;  2ZKT A;  3EZU A;  1JLA A;  4XIU A;  1WDD A;  3FK4 A;  2DGS A;  4WXW A;  3M6V A;  4PPZ A;  1FDD A;  1B70 B;  1ZBT A;  2GVZ B;  1QTN B;  5DG9 A;  5HVG A;  4F3M A;  1F1B B;  1WAC A;  3FSI A;  2RU9 A;  5D4O A;  3MR7 A;  4CLP A;  5DM6 Q;  1IBM J;  1WHX A;  4O3N A;  1IKW A;  3CCV S;  3T1A A;  5J2P B;  1HLW A;  4HI1 A;  4QBU A;  2C3P A;  1T94 A;  5KT6 A;  3ZZ0 A;  1TK8 A;  4KC5 A;  3TA2 A;  3W8G A;  3AXM A;  3PJ9 A;  4R25 A;  3WBZ A;  2R7S A;  3O2I A;  3HHL B;  3RGI A;  3G2X A;  4M5H A;  3BQ2 A;  5CAA A;  3KLG A;  1PYS B;  2YKN B;  1HHQ A;  3GV8 B;  5ETK A;  3W9J A;  3SFU A;  2PMZ D;  3QRP A;  1U02 A;  2VG5 A;  5I42 B;  2LVW A;  2BV3 A;  4QWD A;  1S6O A;  2WON A;  2VOD A;  1JLQ A;  3VAH A;  2AJ2 A;  3R1L A;  4P6Q A;  2IDE A;  3LO3 A;  3PDN A;  3KNA A;  3OL6 A;  4IRK A;  3C3L A;  2XNR A;  1GMU A;  4LUB A;  5D3G A;  4NRT A;  4TN2 A;  4I7F A;  5HQ8 A;  3OTC A;  4ZP8 A;  1DTT A;  1S0M A;  1YTY A;  5FJ4 A;  1N32 J;  2LQ9 A;  3M2R A;  1SIZ A;  3I5B A;  1LK5 A;  1LFP A;  1KQG B;  4FN5 A;  2M3D A;  4H4K C;  1P9Q C;  1AUS L;  2HVE A;  4JI3 J;  4Y0F A;  1K73 T;  3OXL A;  2MYF A;  5C5J A;  1H98 A;  5AT1 B;  1GXU A;  5GAE U;  1R8P A;  5DLG A;  4WIQ A;  4ZHR A;  4P7V A;  5BYR A;  3GTY X;  4EI2 A;  1JX4 A;  5HVH A;  5HQL A;  1V9O A;  5HQM A;  3TAP A;  3GR1 A;  2LDI A;  3D0I E;  4PWW A;  1NJZ A;  1SJ3 P;  1LEO A;  4OHW A;  2VC1 A;  3NWG A;  4RR5 A;  3H4D A;  4UUX A;  4ZVO B;  1RTJ B;  1GMV A;  1WC6 A;  1XNQ J;  2Q3P A;  4H4M A;  2GIQ A;  1N34 F;  1UA1 A;  4AQY F;  3N0V A;  5HVF A;  1GK8 A;  4QYZ J;  3ISN C;  1FF2 A;  2IC3 B;  3PZP A;  1TL5 A;  4B3T F;  1RAJ A;  1HWU A;  4R8U B;  2HNY B;  3IXQ A;  4NXN J;  2V5H G;  1FVQ A;  4M5D B;  3DRP A;  2DO4 A;  2G1H A;  2CJA A;  4X4P A;  1Q1K A;  2KG0 A;  3NCP A;  1URN A;  3JSB A;  2AJ4 A;  4ZP9 A;  5G0R B;  2EXU A;  3JQM A;  3CO0 P;  4RUA A;  2LP4 A;  1EQ0 A;  4HTJ A;  4USH A;  3KJQ B;  2WK4 A;  4M5K A;  3CJQ A;  2EKN A;  2MQN A;  3TUJ C;  1YRX A;  3T5J A;  2HKE A;  5J2M B;  5L9X A;  3IRX B;  4O3P A;  3ZXW A;  4C8Z A;  1MU2 A;  2KT2 A;  3QGI A;  3LWM A;  2B3T B;  4R0E A;  3H5S A;  1WC0 A;  4DV5 F;  3CJ0 A;  3QJJ A;  2BW2 A;  3MMB A;  1P8G A;  3C15 A;  2DR9 A;  3TA1 A;  4WP9 A;  1RKJ A;  2X1B A;  3H25 A;  3TX8 A;  1S59 A;  5HJY A;  1KOO A;  2R7U A;  1Y3J A;  4DUZ F;  5CZX A;  1RAO A;  2AGQ A;  4EYH B;  1QAI A;  3DGP B;  4DR1 J;  2IHR 1;  3RW6 A;  1DBD A;  1N5Y B;  1HR0 F;  1FDN A;  3UVJ B;  1XR5 A;  1UPM B;  1IUJ A;  1W7W A;  3LW5 C;  5KT2 A;  5AXL A;  2LXF A;  1F5C A;  4WFN Q;  1DTQ A;  2CQP A;  2BJE A;  2IM0 A;  2I1R A;  2JZ5 A;  2HHX A;  1TEL A;  2BW7 A;  1R31 A;  4KV8 A;  1S1V B;  3HFV A;  1TMM A;  1AA1 B;  3E01 A;  1SKR A;  1U25 A;  1WI6 A;  2IRY A;  1P1T A;  4MT1 A;  4OI3 A;  4X62 F;  3C14 A;  1FE4 A;  3QIP A;  2UXD J;  1QSS A;  3VTI A;  3HVT A;  4NLQ A;  4H4O B;  5IXU A;  4KFB B;  1U1Q A;  2NYI A;  1JIH A;  3CT9 A;  3JB9 k;  4Q8E A;  2AZ3 A;  1Z2L A;  4Y2I A;  3OVS A;  2AQ4 A;  1U1K A;  1A0O B;  3C8Y A;  4J91 A;  1VLY A;  4CM0 A;  4KO0 A;  3M30 B;  2RQ4 A;  3O3L A;  4WXO A;  4WU2 A;  1C0T B;  4I2P B;  4ILM A;  3R5J B;  3EXY A;  1TTH B;  3UW1 A;  2WVC A;  2AD9 A;  4F26 A;  4JI1 F;  1U2R A;  4OYX A;  1M90 T;  2JHE A;  3QSY B;  1SQG A;  2GMH A;  3WIV A;  1TVR A;  5F8I A;  2O5D A;  4RW7 A;  4IDK A;  3BBF A;  5GAD I;  2DEJ A;  2VPZ B;  2PEB A;  3ZZT A;  3CD6 S;  2ZC3 A;  4ED8 A;  3AD7 C;  3TAM A;  3DMJ A;  4QQB A;  3BO3 A;  1WG1 A;  3P5T L;  4ZLL A;  1YBA A;  5A0Y A;  4ZCM A;  5IM0 A;  5E0O A;  1DLO B;  2WB4 A;  1HMV A;  1FWK A;  4YR3 A;  1TL1 B;  1PCA A;  3PYG A;  5J2Q A;  4IO1 A;  2DNR A;  5HMZ A;  3W64 A;  3C16 B;  1X0F A;  1UA0 A;  2X7I A;  4BWJ A;  5I3P A;  3NGT A;  4TYB A;  2IAJ A;  2G2O A;  1UJ4 A;  3GFZ A;  4C8M A;  3PFO A;  3P96 A;  2LCW A;  3TZY A;  7FDR A;  2YVS A;  2QL7 B;  3MM6 B;  4ZN3 A;  3K5O A;  3N5F A;  1B64 A;  2OTJ S;  3X1L B;  4YR2 A;  2DH7 A;  3OR2 A;  1VHF A;  3VCD A;  3PEH A;  2VB6 A;  2DCU B;  1VIO A;  3H5Y A;  4DSK A;  3UE2 A;  1KTV A;  3FZB A;  1S4E A;  2J8S A;  4KQZ A;  4AXI A;  1YDL A;  3T5L A;  3OL7 A;  3OTE A;  4EFA C;  1K44 A;  3FBC A;  3CWJ A;  1NKC A;  1YJR A;  3FMW A;  1X4A A;  2IJN A;  2ZBP A;  4X66 J;  1YRT A;  2CYY A;  3MF5 A;  2FZC B;  1IKY B;  2B9W A;  3HVW A;  3VF0 B;  3TUP A;  4F67 A;  3TAR A;  5B0F A;  1C0U A;  3VAF A;  1RIS A;  4DL4 A;  3MAH A;  3U27 A;  4KKO A;  2BKP A;  4ZVH A;  4QW9 A;  2BM0 A;  1NM2 A;  3SQG B;  3UQS A;  4ENO A;  1T95 A;  2LEP A;  3QBC A;  3M8P B;  2E1M C;  2UU9 J;  2MDA A;  1HHT P;  5B09 A;  2ZVS A;  2Z30 B;  1NJY A;  1VR6 A;  1CC7 A;  1JKH A;  4QJV A;  2B9E A;  2XLK A;  1U0H B;  3DLG A;  3GYG A;  1SJQ A;  1NZ8 A;  2GJF A;  4NCG A;  3I0R B;  3JTO A;  5LSO A;  4YY3 F;  2UZA A;  2H3E B;  2BRK A;  2V8G A;  1H74 A;  4I64 A;  4C6A A;  2V63 A;  2MKC A;  3M05 A;  2DNO A;  3THT A;  1HNI A;  4ZIV A;  3MR2 A;  2EC0 A;  5KAK A;  1RJJ A;  5ETV A;  3HD1 A;  4KHR A;  4ECY A;  3DLK A;  2AF6 A;  2E5J A;  1X5T A;  1U6B A;  2BA9 A;  4CT9 A;  4DUT A;  5EDW A;  2MGZ B;  3US5 A;  2FVR A;  4TKT A;  2A3J A;  3T9Z A;  4O3R A;  4FXW A;  5KG6 A;  2NYH A;  3CJ5 A;  4U7C A;  4URQ U;  4CLW A;  2HG4 A;  3PO5 A;  4XAK A;  2XB2 D;  2CFX A;  2D41 A;  2IA6 A;  3TP2 A;  1UWA A;  4PAB A;  3EX7 B;  2KH9 A;  2DTJ A;  1IBL J;  4YDX A;  3MED A;  4NI2 A;  1TFY A;  3NNC A;  3EGZ A;  3D1H A;  2AJQ A;  4FNH A;  3PV8 A;  4CYU B;  5A76 A;  3CCL S;  3VAL A;  1IBC B;  1REV B;  1RT7 B;  4WU3 A;  3SIP B;  3ISZ A;  2Z2M A;  1Q5Y A;  2DD8 S;  1KLM B;  2MLY A;  1RKI A;  2RSQ A;  4HHH A;  1ZZN A;  1NDP A;  1YQH A;  1Y7P A;  1F6T A;  5DDP C;  3K59 A;  5I4M A;  1DQ9 A;  3W2W B;  2H54 B;  2HVD A;  4J37 A;  3MM9 A;  3G6E S;  2XI2 A;  2DT9 A;  2FC9 A;  3BGO P;  2HWH A;  3GJS B;  4RU2 A;  4DPX A;  4RKU C;  4NWB A;  3PNI A;  2HHT A;  3PW2 A;  5LJ3 Y;  5A2Q Y;  4L74 A;  4DL7 A;  3I87 A;  2VQF F;  4USJ C;  1XMQ J;  5GAD U;  2F4V J;  1FK9 A;  4ZJO A;  3W9I A;  4C7Q A;  3QSI A;  4UZB A;  4DPY A;  1SV5 B;  3VHQ A;  1XN9 A;  1UVJ A;  2ZHO A;  3EMT A;  2MQP A;  1YBU A;  2J9D A;  4CLF A;  3MMC A;  1P1L A;  2Y8Y A;  3RR7 A;  2Y1R I;  1X4F A;  3K58 A;  4YB6 A;  3L3C A;  3SV3 A;  1JLA B;  1U1L A;  1HBN A;  4DJB A;  2R8K A;  3KYL A;  3IFE A;  8AT1 B;  4S0M A;  2JC0 A;  3BN4 A;  1RTD A;  1F5B A;  1HQU A;  5L8R C;  2PA8 D;  4DQP A;  2YNH A;  3BDP A;  3EPG A;  2F3J A;  2MLX A;  4U9R A;  1Q0N A;  2F40 A;  8RUC A;  3GIK A;  5T7L A;  1QY7 A;  3POT A;  2E1R A;  3M8Q A;  2JNJ A;  1AXQ A;  1IKW B;  3ILL A;  4JYA F;  2KRB A;  1NHU A;  2VBY A;  1T9T A;  4B9M A;  3Q23 A;  3S7R A;  3FBF A;  2VOP A;  5HO4 A;  2ROE A;  2ROP A;  1NRK A;  2RHQ B;  4MMO A;  4HH1 A;  2B4O A;  1X31 C;  3UFC X;  4W92 B;  5DQG A;  1QUV A;  3D3B J;  4P74 A;  3KLG B;  3HHD A;  1CBK A;  3TJ9 A;  1NPP A;  4YB1 P;  2VFT A;  3MPW A;  1UZD A;  2CG4 A;  2VG5 B;  1LWF A;  3CDU A;  3C6T A;  3TVZ A;  1T0T V;  4BBY A;  2DGO A;  4D3H A;  3V4I A;  2Z2L A;  1F3F A;  2EKY A;  4OYA A;  2WON B;  1S10 A;  1JLQ B;  4EZ6 A;  5KT5 A;  3TEH B;  1LNQ A;  1X4E A;  4NZ6 A;  3CJS A;  5K9F A;  1U26 A;  1UJ6 A;  3PW0 A;  4WPA A;  2VJV A;  2PI4 A;  5D3G B;  3IGV A;  4I7F B;  1U0S A;  1DTT B;  2HLT A;  1TR0 A;  3A4T A;  2DRD A;  5CD4 H;  3M2R B;  1HWI A;  4IRD A;  1HW8 A;  2VBZ A;  4PXC A;  1JJ2 R;  3NMR A;  3MPD A;  5HRO B;  4DV2 F;  2OEJ A;  3MD3 A;  5B0B A;  3AFG A;  1SIW B;  2BZ2 A;  1S0N A;  4AE5 A;  2Q79 A;  4ZHR B;  1R0A A;  3H5X A;  4TQS A;  4ZKA A;  3KK3 B;  3QT6 A;  2BE7 D;  2GJI A;  2KRR A;  4HKQ A;  3Q22 A;  2OAU A;  4RUH A;  3E2E A;  1GX6 A;  3F56 A;  3CC2 S;  3AOC A;  4WZQ A;  5AJ3 J;  1XTZ A;  4DUY J;  3ZFV A;  4ECZ A;  3D5M A;  1S0O A;  3JAM U;  4M5J A;  5CYQ A;  3Q8Q B;  4CO4 A;  3NY0 A;  4ETX A;  4H4M B;  1PIE A;  4DX8 H;  4L73 A;  3GSD A;  3KG1 A;  4KSE B;  3HSG A;  3D67 A;  3CCU S;  5HBM A;  3BGR A;  3OSN A;  3R5D A;  3SCJ E;  4OJ1 A;  1EP4 B;  1KTQ A;  4K4S A;  5D4N A;  3O1L A;  3O6Q A;  4DR7 F;  2EW9 A;  3HHL D;  2OML A;  4O3O A;  3RB4 A;  3X3U A;  2CVI A;  3QZ8 A;  2PGC A;  3QWP A;  2R9L A;  4KGZ B;  5KG7 A;  5KT7 A;  3MPV A;  3EYZ A;  2KZZ A;  2ILY A;  1X9S A;  2K3K A;  3KK1 A;  1MU2 B;  2AJF E;  4IR9 A;  3G82 A;  3LWL A;  5D77 A;  4PXD A;  4P9S A;  2XMK A;  2J0W A;  1OY8 A;  2QC3 A;  4JV5 J;  5HAT A;  3TA0 A;  3CCR S;  3KG4 A;  2M0G B;  2BKN A;  2B6A A;  3C15 B;  3KJF B;  3SDE B;  1V5I B;  3D1Q A;  4Y2C A;  3WZ0 A;  4WYW A;  4PAA A;  3W2V A;  5L46 A;  4L72 B;  1RHK B;  1X8D A;  1XQI A;  2V2V A;  2M8D B;  4I2Q A;  2WZ1 A;  2KYX A;  2RIJ A;  4JI5 J;  3T5K A;  5D8H B;  3PRD A;  3I6P A;  4QR1 A;  2XMV A;  1OO0 B;  2V4J A;  1YIJ S;  1NDC A;  3FRZ A;  2C28 A;  1DTQ B;  1FJE B;  4NA1 A;  4L6V 3;  2ZD1 A;  3WQP A;  3I55 S;  1XIQ A;  2LA6 A;  4NLW A;  2C3M A;  2IJF A;  4DQI A;  1RLC L;  3E01 B;  4KH0 B;  4YFU A;  1FO1 A;  1J5O A;  5KFI A;  3C14 B;  5T41 A;  3QIP B;  1DUR A;  1ZPV A;  4K4T A;  2JOQ A;  1RWO B;  5KFY A;  3HVT B;  4LFB J;  1D9F A;  2UUW A;  3CCW A;  1QAY A;  2DEI A;  2RRN A;  2PFD A;  2GC8 A;  3UDV A;  4NPO A;  1CQN A;  4PYA A;  3AJD A;  1N34 J;  2DIS A;  2I5J A;  3NGU A;  2AV5 A;  4RBT A;  2E9R X;  1HBU A;  1TFW A;  1YJV A;  2HGN A;  4K4X A;  2BE2 B;  2GHP A;  1RDR A;  3G71 S;  2WAQ D;  4KO0 B;  4QW8 A;  4B3T J;  1D8Z A;  2M70 A;  1TQL A;  2DNM A;  2R7V A;  4CP5 A;  3GJT B;  1NKE A;  1VS3 A;  5HMY A;  1K0V A;  4LVO P;  4DR4 F;  2AMC B;  4RW7 B;  4IDK B;  3HK2 A;  3L9Z A;  4EBD A;  4RUB A;  3TAM B;  3DMJ B;  4ED0 A;  5E33 A;  3K5L A;  3ENQ A;  3MOZ A;  2IM3 A;  3TYT A;  1FRJ A;  4DG1 A;  5KG5 A;  4KBI A;  2OD6 A;  2XMW A;  5ETO A;  5IM0 B;  1HMV B;  1JXE A;  4DFM A;  4K0K F;  1EAR A;  3Q2S C;  3HO1 A;  2RJZ A;  4DV5 J;  1FNX H;  5IS2 A;  1M5O C;  2IAJ B;  3L7U A;  2KT5 A;  4A8Q A;  2P9E A;  4WKR A;  4PWD A;  1T7P A;  2VFV A;  2RF2 A;  2XHW A;  2D3Z A;  2RUS A;  3BH7 B;  2IBK A;  5IWA J;  1Y4Z B;  4H54 A;  2GO9 A;  3DRS A;  2FJX A;  3OR2 B;  2AZ1 A;  2RAQ A;  4Q44 A;  1R27 B;  4DUZ J;  1WC4 A;  4OX9 J;  2R4F A;  3HLU A;  4NLX A;  3OLA A;  3CB4 A;  2JJ4 D;  5IOL A;  4ZPA A;  2GAH C;  3BSC A;  1HR0 J;  1MLA A;  4F50 A;  2G0J A;  1VK3 A;  1OSD A;  1MRO A;  2Z56 B;  2AIR B;  3ZO7 A;  2EFQ A;  5LMU F;  1N36 F;  3NLC A;  1H3D A;  4X64 J;  3IS9 A;  3CF5 Q;  2DNP A;  3H5U A;  2FVC A;  1UVL A;  3R6L B;  3SMZ A;  2FLL A;  1S9G A;  1X4G A;  3M4X A;  4CNY A;  4DV1 J;  3PAC A;  3QT8 A;  1H38 A;  4KKO B;  4ELT A;  3PX4 A;  5DGA A;  4WF9 Q;  5IT0 A;  1HNW J;  3QGH A;  2GNK A;  4PWU A;  3T3F A;  1FD2 A;  1LOU A;  2FYX A;  3QLH A;  2XS2 A;  1XNR F;  3AT1 B;  2ZZM A;  1JKH B;  2YNI A;  1IBK J;  4ECW A;  1N33 J;  3DLG B;  5BYQ A;  2WCX A;  4NCG B;  1HKA A;  1DFD A;  1JLG A;  3AAW B;  3J81 j;  3M8Y A;  2ZJQ Q;  3GU0 A;  2Z0G A;  4DL5 A;  2YBV A;  5HMW A;  5KFL A;  2OEL A;  3UD4 P;  3BJY A;  3QJP A;  2UXB F;  1NHK L;  4YEA A;  1HNI B;  1KQK A;  3NGR A;  3LP2 B;  1VQS A;  2DY9 A;  4W98 A;  2XMT A;  4QPX A;  3EM1 A;  3DLK B;  5FD1 A;  1NDL A;  3ILI A;  4CTA A;  1XR6 A;  5KFH A;  1FRX A;  4KIA A;  5M2U A;  2IYG A;  1CPZ A;  4OZ5 A;  1M1H A;  4YQW A;  1W2I A;  1VQ5 S;  1UZH A;  1X5O A;  4DCP B;  3OFE A;  4QCL A;  1VCT A;  1S1W A;  3QJL A;  5LL6 d;  1I1G A;  2PT0 A;  3MED B;  4NI2 B;  2RRB A;  2IRX A;  4YHH J;  3AB2 B;  1ZAW A;  3AOD A;  1S57 A;  3NP5 A;  1PKU A;  3D2W A;  4OHY A;  4I6A A;  1VQK S;  3UPF A;  1J27 A;  2BJD A;  2ZBC A;  4ECQ A;  2OTL S;  1VQ9 S;  1RBA A;  2W2M P;  5KG4 A;  2GQC A;  2G2Y A;  2F7V A;  4CLK A;  5KG2 A;  3PRB A;  4DQQ A;  4NLY A;  1Z2Z A;  2ZH6 A;  5DZ6 A;  2EEY A;  5GVQ A;  4GVL A;  1AW0 A;  2D3O R;  2NS1 B;  4C8O A;  3A8E A;  5EGY A;  5CCL A;  2AT1 B;  2BBE A;  3G96 A;  4ZPT R;  3FEY B;  2V8D A;  3DYA A;  3MM9 B;  4WFZ A;  2J9D E;  1RBL A;  2Q1L A;  4FF1 A;  1KHV A;  2W9C A;  2VHG A;  2JWN A;  4FYX B;  2OGU A;  1WF2 A;  4K5S A;  3NBP A;  3PCO B;  1XMO F;  4X2B A;  5HI7 A;  1YKW A;  2RS2 A;  3W5Z A;  1FK9 B;  3VGV A;  4KPC A;  1JLE A;  1NME B;  3GMG A;  2XMA A;  4X4Q A;  2AKW B;  2QTW A;  1G3O A;  2KFN A;  2D9P A;  2KFY A;  3L7P A;  4G65 A;  3CMQ A;  2NUU G;  3MMC B;  4ICL A;  4EYI B;  3MCN A;  3KXD A;  4K7Q A;  1RTD B;  1HQU B;  4AUK A;  2F4F A;  1OY9 A;  2YNH B;  2BUN A;  1NU4 A;  4ED4 A;  5EWF A;  3HSD A;  3M32 A;  3CJK A;  2HLU A;  2GVD A;  2GHW A;  3DU5 A;  5T7L B;  3U7J A;  3POT B;  3LP1 A;  3M8Q B;  4M5L A;  3UDL A;  1C4A A;  5E3R A;  4F7V A;  2CQI A;  3MEK A;  3VR1 A;  5KFN A;  1IBM F;  3I96 A;  1SL1 A;  3LGM A;  4GRS A;  4N56 A;  2J0S D;  2V34 A;  4RJV A;  2R8G A;  3I56 S;  2BYC A;  4QWE A;  5J1P A;  4F4K A;  1FKP A;  3H90 A;  4HH0 A;  4J9K A;  1LWF B;  3GIL A;  1RAE B;  3C6T B;  4IFV A;  3QFH A;  2CJK A;  4O44 A;  4KGK A;  1SC3 B;  1XER A;  1EIY B;  3BR9 A;  4YB5 A;  1RAI B;  2XS7 A;  1ZTT A;  3BQ0 A;  3KJV A;  2YH0 A;  4JP8 A;  1VC5 A;  4BS2 A;  3P6Y C;  4DCO B;  1IJE B;  5L38 A;  3W60 A;  5K8N A;  2BAN B;  4DR6 J;  4LF8 J;  3OUY A;  4AL6 A;  3H2L A;  2OD4 A;  1WKK A;  2R7O A;  2P5V A;  2WVD A;  2Z8Q A;  2AEM A;  5AE3 A;  1SI9 A;  4A8Y A;  3FVY A;  5D15 A;  4F0H A;  3FUY A;  4MYT A;  4NA3 A;  3CDW A;  1AYE A;  2E5G A;  4OYZ A;  1R0A B;  3OVB A;  1J5E J;  4DR3 F;  4DX7 A;  2XSF A;  4P7T A;  2HQF A;  2DGX A;  4JI3 F;  3G8S A;  1U2C A;  2QO3 A;  1MWY A;  4RBV A;  2GJ2 A;  4Q0B A;  2IVY A;  1NK5 A;  2AYG A;  2CIM A;  2M88 A;  4DMZ A;  1ZPW X;  5KFU A;  1R6Y A;  2H51 B;  3G86 A;  1BC6 A;  5CYQ B;  1U45 A;  2BRL A;  3ISN D;  4P52 A;  2W25 A;  4KH1 B;  3RG6 A;  2R8I A;  1TUW A;  3RBE A;  4ZVF A;  4CO1 A;  4EUV A;  4AFF A;  3ZZP A;  2CA9 A;  1UW4 A;  2C2Z B;  4DV0 J;  2HS4 A;  3BGR B;  4O0N A;  1PYT A;  4X4R A;  4KPY A;  3HT3 A;  4KRW A;  3D4J A;  4JYA J;  3V6J A;  2QA4 G;  2AJ0 A;  1HI1 A;  4B9S A;  3KDN A;  4QIV A;  2ZH8 A;  2YH1 A;  1RSC A;  4B08 A;  3I31 A;  4KY3 A;  3SZ2 A;  2FJE B;  2P2C B;  3ULH A;  5EN1 A;  4QPT A;  2WBR A;  3GYN A;  1EKS A;  3F41 A;  2CDQ A;  3KK1 B;  2XTJ P;  4A47 A;  4HEA 9;  3G82 B;  2Q6C A;  3CJT A;  2G4B A;  1VK8 A;  4GC7 A;  5KFB A;  1OYE A;  2WW4 A;  5IC4 B;  3WC2 A;  1DQ8 A;  3IWX A;  1YJ9 S;  4PQU A;  2D7S A;  5FDL A;  2B6A B;  3OFF A;  3IAM 9;  1UEK A;  2ASL A;  2JEI A;  3HJF A;  5KFM A;  4PG8 A;  5M2R A;  2EFV A;  3PX6 A;  3W2V B;  2RH3 A;  5E5N A;  1CLF A;  4I2Q B;  5CXT A;  1PBA A;  2MZQ A;  4K4V A;  4KGM A;  1S12 A;  4PKD B;  2M2B A;  1VHI A;  2MSS A;  3IM8 A;  3KK2 B;  3K5M A;  2OIH A;  4DSL A;  2W24 A;  1RHM B;  3MTK A;  2KDO A;  3UR3 C;  4BHQ A;  4NYO A;  2V4J B;  5E3P A;  4IFY A;  4PRF A;  3R2D J;  2ZD1 B;  1WNE A;  1XR7 A;  4TY9 A;  3B54 A;  4NLU A;  1FKO A;  4B3S F;  5BYS A;  3HZE A;  2MQQ A;  1SH0 A;  3UWT A;  1J5O B;  2N7Y A;  1R8B A;  4LSZ B;  3R5B A;  3C66 A;  2BQ3 A;  4KB7 A;  1DAX A;  4BCA A;  4DLE A;  4P2X A;  1X5S A;  2R7Q A;  2AEJ A;  2XUL A;  1RT2 A;  1D9A A;  2C2K B;  4OMF G;  4RNN A;  1IN0 A;  3SSQ A;  2MJU A;  4EO8 A;  2I5J B;  1SB6 A;  1HBU B;  1T9Y A;  3HSJ A;  3U1N A;  1RAF B;  4N8O A;  3CDE A;  2RIL A;  2BE9 B;  3DRY A;  3HVA A;  2E7X A;  4DPW A;  2XSJ A;  3ET6 A;  2OPS B;  4X4N A;  1B4S A;  3IM9 A;  1V6H A;  4USI A;  4DOZ A;  1LXJ A;  2IC3 A;  2E5I A;  1LWE A;  2ZHB A;  1RYR A;  5ITH A;  1GAO A;  4O3S A;  3ENV A;  3AJ2 A;  4URG A;  1NK7 A;  2RDJ A;  1N8R T;  1KRP A;  1H7X A;  3P3D A;  2QT7 A;  3SYZ A;  5KFA A;  1JWW A;  5G0R A;  4DG1 B;  4M5G A;  2IVF B;  3BYP A;  2IVM A;  4N76 A;  1RT5 A;  2PN6 A;  4IYQ A;  3A1Y G;  5B08 A;  3BBC A;  2LU1 A;  4PWD B;  2RF2 B;  3D7S B;  3LAL A;  4J7C A;  4LIR A;  4NLG A;  1AB8 A;  2DHS A;  5BXI A;  1Q16 B;  4JI8 J;  3DRS B;  1RAD B;  1F2G A;  4A8O A;  4ED5 A;  3EPI A;  1RK8 A;  1KS2 A;  1VBZ A;  1CJK A;  1H72 C;  4PXB A;  2UVV A;  1U6Z A;  3MM8 A;  2NXU A;  4E8U A;  4ILL A;  1RT1 B;  3D28 A;  4DR5 F;  3D9B A;  2RB7 A;  2DXE A;  1MRO B;  5CD4 A;  4LIW A;  4QR2 A;  2AU0 A;  4DSJ A;  2H5J B;  2W2N P;  3O44 A;  3IS9 B;  3OR1 A;  2UUA F;  4NMX A;  1OWX A;  2HBQ B;  1S77 D;  2RDI A;  2P8I A;  4A8M P;  4IOA Q;  1S9G B;  4L3N A;  2EK6 A;  4LR9 A;  2O1P A;  2EFG A;  4X66 F;  5GMK a;  3FNN A;  4OIX A;  2FHJ A;  2ZC4 A;  2EK1 A;  2NSB A;  1G6B A;  2J8A A;  4P73 A;  1B0V A;  4LQ3 A;  4F3O A;  4DN9 A;  1WKL A;  4DU7 A;  3CDA A;  4NLP A;  3GG0 A;  3QLH B;  3SV4 A;  1KR4 A;  3M6W A;  4DL3 A;  3DGV A;  1RXO B;  2BJ8 A;  2YNI B;  4QIG A;  4ES2 A;  2AGO A;  1YJN S;  2UU9 F;  2W7A A;  1S76 D;  1JLG B;  4WP8 A;  4DFJ A;  3MMA A;  2EBG A;  2AJ1 A;  4AXJ A;  1KVK A;  4LFC F;  2H1Y A;  4IQM A;  2JSX A;  1IR0 A;  2Y1I A;  2E66 A;  1R8H A;  3ILO A;  3HXM A;  2WBM A;  3OW2 R;  4RPF A;  5DJB A;  2Z57 B;  1JJH A;  1WTF A;  4CTA B;  5D78 A;  3QO9 A;  2BOA A;  1NB2 A;  5A2Q U;  1S49 A;  2V4R A;  3GV7 B;  3NOC A;  1CUL A;  1LXN A;  2V8V A;  3L4B C;  4WP3 A;  4DEZ A;  1YJU A;  2ZM6 J;  2GCF A;  2XCP A;  1S1W B;  1HWK A;  2R2S A;  4QU6 A;  1WHW A;  1P27 B;  4K0K J;  4FF2 A;  3V5R A;  2ZOF A;  1KN6 A;  3IC1 A;  5DQH A;  3UR0 A;  1VQY A;  2C2E A;  2HFZ A;  1IBL F;  6FDR A;  1L3T A;  1N56 A;  2ZBR A;  3BZQ A;  4O0I A;  1LWC A;  3JSM A;  4CM2 A;  4XTT A;  5U47 A;  5C42 A;  2IRU A;  4NYZ A;  2DCL A;  1F9E B;  3BM7 A;  3CDB A;  1PBU A;  4CLL A;  2E7V A;  1OPZ A;  1SC4 B;  2N4C A;  3DYA B;  3G9C A;  2OPR A;  2CPF A;  3VWS A;  2R7T A;  4JI4 F;  4UTG A;  2W9C B;  1U6F A;  1KP6 A;  1VRU A;  2QL5 B;  3OFG A;  2OFH X;  5KFV A;  3NBP B;  4RUC A;  1N36 J;  3ZTO A;  2ZIT A;  2ASD A;  3M1V A;  4NOH A;  5EX3 A;  5F41 A;  1RTZ A;  2LQJ A;  5HK4 A;  2CQ2 A;  1FFG B;  1JLE B;  4MK8 A;  5LMN J;  3BYR A;  2L9D A;  1YHQ S;  2DGQ A;  4JI0 J;  1XMQ F;  2F4V F;  4Q45 A;  4Y2A A;  3K17 A;  3H2U B;  4ICL B;  1HD0 A;  1Q8K A;  1QAJ A;  4MTP A;  2XS5 A;  2DR7 A;  4LRB A;  3M32 B;  1RT3 A;  4WKY A;  5C7P A;  3H42 A;  4MIW A;  2ALZ A;  2QSW A;  3NRB A;  2A6M A;  1KNZ A;  3AH6 A;  2HQG A;  2GVD B;  2JH3 A;  1R0C B;  5E3C A;  3LP1 B;  5E41 A;  3JS9 A;  3M8W A;  1IVZ A;  7FD1 A;  3QAT A;  4NCA A;  1ZYQ A;  4NLO A;  5K20 B;  2Y9H A;  5DG7 A;  2CPJ A;  3GG1 A;  3I82 A;  3KMQ A;  2PO4 A;  4QYZ K;  4UOH A;  2XC9 A;  4TNO A;  5KFR A;  2GO8 A;  4PUO A;  1VBX A;  2QL9 B;  1X4B A;  2OP5 A;  1FKP B;  2LEB A;  1TKZ A;  1HNZ J;  4LRD A;  1KFD A;  4IFV B;  3Q8Y A;  2C2N A;  1FRH A;  2W1B A;  2NPI A;  1D09 B;  4O44 B;  1UVI A;  3BSA A;  4C3L A;  3FCW A;  1KSP A;  3ZTQ A;  1CEZ A;  1NAQ A;  2YNG B;  3KJV B;  2DB1 A;  1LW0 A;  1YLX A;  2DNY A;  2RU3 A;  1YZ7 A;  2Q6B A;  2BJ9 A;  2QN6 B;  4MFB A;  3D6F B;  4GMK A;  1Y00 A;  4P2S A;  3WDO A;  1U7L A;  3WIU A;  3OUY B;  1GQE A;  1RWX B;  1PJ7 A;  1U24 A;  2YWH A;  3SSR A;  2KTQ A;  3UCG A;  3NG8 A;  3FSY A;  3MUT P;  3D3C J;  2B56 A;  1S97 A;  5C25 A;  3G6Y A;  3EXC X;  2OEM A;  3W9H A;  1T02 A;  3QYY A;  4NRU A;  4GKK J;  2CZ9 A;  3NS5 A;  1PO6 A;  1F2H A;  3NKY A;  1QD1 A;  1NPR A;  4UUW A;  5L1J A;  2J9C A;  4IG0 A;  3W2W A;  4G1P A;  3IA0 A;  4YR0 A;  1I3O B;  2F8M A;  1NXI A;  2L9N A;  3L09 A;  2E7W A;  1DQA A;  2V0N A;  4TLR A;  1UVK A;  1HYS A;  4ED2 A;  1RE1 B;  1VQP S;  4Q0B B;  3BN7 A;  1SPB P;  5B0A A;  2FLO A;  1IR1 A;  1H7W A;  1FJ7 A;  4AT1 B;  2X51 A;  1X5P A;  3Q8S B;  4MAK A;  5I3Q A;  3DXB A;  2YKA A;  2EFO A;  5AJ3 F;  2QV6 A;  4KJI A;  4DUY F;  3IBW A;  3DLE A;  3G4S S;  4OZJ A;  2P6T A;  3GYX B;  1UVN A;  2YQ1 A;  2JRS A;  4JI6 J;  3A12 A;  5LT5 A;  2AEF A;  3O5T B;  5AE1 A;  1S6U A;  2XCA A;  5DG8 A;  1SH3 A;  3UCZ P;  4EO6 A;  1BQX A;  3ZTR A;  3KLH A;  2QLW A;  1N5Q A;  1FDA A;  4GO5 X;  2CAJ A;  4ECR A;  1N48 A;  4KHM A;  4X4S A;  4EMD A;  1NH8 A;  3UDE A;  3OVA A;  4JV1 A;  2UV8 A;  1CS4 A;  3SCK E;  4DPO A;  5DM7 Q;  3TZX A;  2UVR A;  4LF4 J;  2ZOG A;  1KD1 T;  1L3V A;  3CCZ A;  1IM4 A;  4N8N A;  3CCM S;  4KR0 B;  1N5T A;  3ITH A;  1B0P A;  4WTO B;  2C2O B;  5F3Z A;  3W63 A;  3A13 A;  1SH2 A;  3R6G B;  3V2U C;  3EVO A;  2B9Y A;  4J9S A;  3H0P A;  4QOT A;  4PQU B;  5FDL B;  1D1U A;  2QSF A;  1U1R A;  2YY3 A;  1FRM A;  3Q8R B;  4JV5 F;  4DV3 J;  4WFY A;  3PHT A;  4Q43 A;  2IPO B;  2K06 A;  2MQM A;  1YK9 A;  4LRE A;  1AUD A;  4LF2 A;  2XEX A;  3AA9 A;  1X9M A;  3ZZO A;  1RWM B;  2W8K A;  3DLL Q;  3P49 B;  2RKI A;  1M5P C;  2JLE A;  5HP1 A;  3PEJ A;  3B4M A;  1S1T A;  1S1U A;  3BEG B;  2WVE A;  3ZZY A;  2XI3 A;  4JI5 F;  3IRW P;  3JTP A;  4IFY B;  3NEK A;  1PC4 A;  5H9F K;  4DR3 J;  5HRO A;  2R7X A;  5KFD A;  1HNV A;  2ZH9 A;  3PYD A;  1FKO B;  2X3D A;  2VV5 A;  2F9J A;  3T1H J;  1BY9 A;  3BKT A;  4I6Y A;  5AE2 A;  3KK3 A;  1U8S A;  1ITP A;  3PW4 A;  5BJR A;  1FI4 A;  2AGP A;  1HBO A;  1WC1 A;  4CO5 A;  3CW2 C;  3KKF A;  2Z2Z A;  1RT2 B;  1U48 A;  4ZVP B;  2QMW A;  3MAQ A;  2V67 A;  3DU6 A;  1IR2 A;  4M5M A;  4LFB F;  2ROG A;  2FZK B;  1R6V A;  2G9O A;  3DNC A;  1S99 A;  5IC6 B;  4NLD A;  3FGV A;  1NDK A;  2P9C A;  3DOL A;  2XSJ B;  3RBD A;  2A2D A;  3ET6 B;  5L1L A;  5D0R A;  2FVS A;  3PM9 A;  2CPD A;  2ZEJ A;  1O6X A;  4ZVG A;  1B7F A;  4QWC A;  2NXC A;  2F65 A;  1XEZ A;  4LRC A;  5MAO A;  2CPE A;  3ZZU A;  1LWE B;  4NA2 A;  1EAY C;  4LF6 F;  2PII A;  1EP4 A;  2HUR A;  3PTW A;  2J7K A;  4PZV A;  2OI2 A;  1RWW B;  1SC6 A;  2DR8 A;  3DC2 A;  5FLX Y;  3TX0 A;  4LBI A;  4C8Y A;  5CYM A;  3MXH P;  4MH8 A;  4CT8 A;  1OMS A;  2ZWP A;  1HL6 A;  3ADA C;  4FP9 A;  1G7C B;  2GGP A;  2CQC A;  1U47 A;  1XJW B;  4CH1 A;  5A6P A;  3M8S A;  1RT5 B;  1VYA A;  3R7N B;  2MST A;  3BPS P;  4FF4 A;  2AX1 A;  3D1O A;  4P10 A;  1N0U A;  3LAK A;  1NSA A;  1VC0 A;  3VGS A;  2E5L J;  4J9U E;  2KM8 C;  1EKR A;  2BX6 A;  2RNE A;  2NUH A;  5JMN A;  3NAI A;  3EVW A;  1KEK A;  1GXL A;  4OL8 A;  3ONQ A;  3J7A 1;  3IG1 A;  3NOG A;  3H4B A;  1VQ7 S;  5C24 A;  3SDE A;  4ZJL A;  2DNL A;  3CIZ A;  1CJK B;  5B0G A;  5IWA F;  3JYT A;  4HHJ A;  4LSN A;  2MZ1 A;  4QU7 A;  3MM8 B;  4WFB Q;  1UL3 A;  4CDI A;  3NWR A;  4OX9 F;  2XY7 A;  5GAH I;  3KTQ A;  2Y0S D;  1S9E A;  1Q82 T;  2J0Q D;  4NL5 A;  3TQ1 A;  2FQQ B;  4UOF A;  3OR1 B;  1S6P A;  1LFW A;  3E51 A;  4J9O A;  2JX2 A;  2OO4 A;  3D54 A;  4B3S J;  3OTB A;  3LPY A;  5J2N B;  1WDT A;  3RR8 A;  1ICE B;  2MPU A;  1FKA F;  4X64 F;  3N6N A;  3KNG A;  1IQT A;  3HVR A;  1YZ6 A;  2EG1 A;  4ZS6 A;  2MTL A;  3M2U A;  1Y11 A;  4DV1 F;  3PJW A;  3NNA A;  3EWG A;  4LJM A;  5DLF A;  1FXL A;  3N79 A;  1YJW S;  1MG7 A;  2BKO A;  2KKH A;  3LGH A;  4BC9 A;  2JL9 A;  4RW9 A;  3FQL A;  1HNW F;  4ZJQ A;  2NPF A;  3D6H B;  1A7G E;  1EZZ B;  2CG8 A;  2VUG A;  4FBT A;  3MMA B;  4WFX A;  5KOX A;  3DN9 A;  2DGW A;  1NEE A;  1IBK F;  2LMI A;  4JI2 F;  1N33 F;  4CLY A;  4OJ3 A;  5KFE A;  1FD8 A;  1JLC B;  2BE2 A;  3MCS A;  3AHP A;  2DNQ A;  3DDN A;  2YKQ A;  4BLG A;  2CRL A;  2H4Y B;  1YSJ A;  1BGX T;  5IQ6 A;  3QO9 B;  2XM3 A;  4Y34 A;  5HMX A;  4OHV A;  1A9N B;  4OYP A;  1CUL B;  5HJX A;  2MB0 B;  1V3R A;  1A6L A;  2CPH A;  2FY8 A;  4B3R J;  5MLC V;  1V3Z A;  2XYH B;  5HAN A;  3BGL A;  4NEY A;  1EET A;  3CJR A;  1JK9 B;  3V6K A;  2BJ1 A;  1G2E A;  2B5J B;  2ZWO A;  1L3U A;  4L76 A;  4J9M A;  2DKO B;  4YHH F;  4KHP J;  4QIF A;  4RW4 A;  5E3Q A;  3UN5 A;  1LWC B;  3JSM B;  2UUT A;  5C42 B;  3DI6 A;  4OJH A;  3V6D A;  1NBE B;  1T9U A;  4CLS A;  1YJT A;  2O66 A;  4USU A;  2XYG B;  2XWY A;  2LKZ A;  2OPR B;  2L41 A;  3BSN A;  2IYI A;  4Q2M A;  4DR5 J;  2ZKU A;  1QM9 A;  1RQ0 A;  1GH8 A;  3AJ1 A;  2X1G A;  1VRU B;  1WC5 A;  1K1S A;  2X1A A;  3J7Y I;  1W26 A;  3MOJ B;  2UUB J;  2UUA J;  3M1V B;  3B4D A;  4NEZ A;  1UWB A;  3OL8 A;  2WRM A;  4DV4 F;  3CD0 A;  1WSV A;  1UCN A;  4B02 A;  4LF7 J;  1QLN A;  1ZM2 A;  2DGT A;  2LDY A;  2MHE A;  3BGU A;  4G1Q A;  1PC5 A;  4LF9 J;  4LR8 A;  1YRU A;  2KG1 A; 
#chains in the Genus database with same CATH homology
 1CJV A;  2BW7 A;  1YK9 A;  3R5G A;  1CJK A;  4CLW A;  4USV A;  4CLL A;  3C16 A;  5D15 A;  3C14 A;  3ET6 B;  4OYW A;  1CJT A;  1CJV B;  5D0R A;  4CLU A;  4USW A;  5IV4 A;  2GVZ A;  1CJK B;  4OYZ A;  4CLY A;  4CLS A;  3MAA A;  2W01 A;  5D0H A;  3C16 B;  1WC0 A;  4USU A;  3G82 A;  3C14 B;  1YBU A;  4NI2 A;  4CLF A;  1CJT B;  1WC6 A;  1CS4 A;  1CJU B;  3C15 A;  1U0H A;  2GVZ B;  4OYA A;  3MAA B;  1CUL A;  4WP9 A;  5D0G A;  4OYM A;  3G82 B;  1WC5 A;  4NI2 B;  4WP3 A;  5D0E A;  1CS4 B;  3C15 B;  3MR7 A;  1U0H B;  4OYP A;  1YBT A;  4CLP A;  4P2F A;  1CUL B;  4CLT A;  4CM0 A;  4WPA A;  4P2M A;  4P2X A;  1Y10 A;  3UVJ A;  1TL7 A;  4OYO A;  4OZ2 A;  1WC3 A;  2GVD B;  4CLK A;  1FX4 A;  4OYX A;  1AZS A;  2WZ1 A;  4OYB A;  1WC1 A;  1WC4 A;  4CLZ A;  3UVJ B;  1TL7 B;  1Y11 A;  2GVD A;  1AB8 A;  4OYI A;  2QV6 A;  5IV3 A;  1CJU A;  1AZS B;  4WP8 A;  1FX2 A;  4OZ3 A;  4CM2 A;  3ET6 A;  4UST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...