1CK2A

Yeast (saccharomyces cerevisiae) ribosomal protein l30
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
104
structure length
104
Chain Sequence
APVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Local folding coupled to RNA binding in the yeast ribosomal protein L30
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 60S RIBOSOMAL PROTEIN L30
total genus 43
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 1999-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1ck2A00
4BW0B 5IT9M 1CN7A 1W3EX 3WXMB 3ON1A 1ZWZA 2VGMA 3E20B 5FJ4C 1QVGF 3NVIB 3NK6A 3LWQC 2LBXA 2KG4A 3FFMA 3CCQF 3OBWA 4TZZA 1VQ7F 3CC4F 3J7AR 3J81M 1VQ9F 1XBIA 1KC8H 1NMUB 1RLGA 3G71F 3LWOC 3AGKA 1X7PA 1GZ0A 1PXWA 3RA5A 5G4VC 5DCVA 2QI2A 3CCLF 3MCAB 1K8AH 2OTLF 3CPQA 3N4ZA 1VQOF 1QVFF 3V7QA 1Q82H 5GANK 3N4YA 2JNBA 1K9MH 1CK2A 3SIVA 2AIFA 1VQLF 4C4WC 3LWRC 5GIPC 3E1YA 3RA6A 5EO3A 3LWVC 3CMAF 3VMFB 2KTVA 1NJIH 1X52A 1K73H 2WALA 1H7MA 1W2BF 2OZBA 3NMUC 4X3MA 3CXCF 3IR9A 1Q81H 1N8RH 3G6EF 3PAFA 2I6DA 1YITF 1X7OA 3J80M 3LWPC 2OHWA 1VQNF 1VQ4F 3CPWF 1IPAA 1YJ9F 1W41A 4X3LA 1SDSA 1GO1A 5GAPK 3CC2F 3I55F 2ALEA 3PLAC 3V7EA 5FLXM 2KTUA 2VGNA 5GIOC 1RA4A 1YJWF 4NUTA 3CC7F 3OW2F 1YIJF 3NK7A 3CCEF 1Q7YH 1Q86H 1S72F 2CZWA 3G4SF 3CCRF 3CCSF 1VQ8F 3OBYA 1E7KA 3GYQA 3CCJF 1YHQF 1JJ2F 1GO0A 1T0KB 3O85A 2QEXF 1YI2F 1KQSF 1VQKF 3HJWC 1W42A 1VQ6F 5A2QM 4LCKA 3LFOA 5G4UC 2OTJF 1YJNF 2FC3A 2BO1A 3CCUF 3CCVF 2HVYD 5EWRA 1VQPF 1M90H 3NVKE 3JAMM 3I56F 2LBWA 3CMEF 3CD6F 3HAXD 3VI6A 1KD1H 1VQMF 4BY9D 5GINC 3CG6A 1M1KH 3JCMM 2QA4F 3SIUA 1DT9A 1VQ5F 3CCMF 1W40A
chains in the Genus database with same CATH superfamily
2AIZP 1U3PA 2ZVZA 1FFXB 4E6EA 1OAPA 4BVQA 5FJ4C 4HNAB 2GVIA 3NVIB 3C9SA 5MN6A 3CCQF 4ZHWA 2YYEA 1W57A 5JVDB 2RB9A 4TUYB 3VYSC 2L26A 4ZI7A 5LXTA 3WPWA 5J2UB 4BT2A 1PXWA 4TV8A 5DCVA 3CPQA 5CA1A 2VAWA 4IHJB 4G88A 3ESJA 2AIFA 5HP7A 1VQLF 1W581 4C4WC 3F6MA 3LWRC 3E1YA 3LDTA 2HS4A 4B62A 1VQVA 2GZLA 3LWVC 3D54A 1X52A 3JAWB 1K73H 4ZI7B 3S0HA 3M84A 4G4YA 2QTPA 2UZHA 2I6RA 1Q81H 1N8RH 3GHZA 3E22B 3RYCB 5IJ0A 1TUBB 4G4ZA 3J80M 1TVKB 3D01A 1YJ9F 4IIJB 3K14A 1XRGA 3MCQA 3V7EA 4WBNB 5LYJA 3TD5A 2IAFA 3N2KB 2HS0A 3LMEA 5CA0A 1CLIA 2W8BC 4C8GA 1VQ8F 4I4TA 5BMVB 1JJ2F 1T0KB 1TUBA 2QEXF 1YI2F 1U43A 2B33A 2LCAA 3ZOPA 2EWCA 2CWJA 1IV3A 5JCOC 2ZOVA 3JALA 3HWUA 4EI8A 2Q1XA 2ZVYA 3CCUF 3CCVF 3S0WA 1VQPF 3IKEA 3NVKE 3CD6F 5HY2A 4HNAA 2UYJA 4I4TB 2RHOA 3VI6A 5KX5A 4BY9D 4ZOLA 5GINC 3KJKA 4F6RA 1XHOA 1W55A 5IJ0B 2QA4F 3GTZA 1RQ7A 2CSLA 5IT9M 4LNUB 5LP6A 4B45A 2HP0A 1CN7A 3MDOA 2PHNA 3Q8HA 5IJ9A 3C9RA 3JVHA 3E20B 3M1XA 5EB0A 3UT5B 1RQ2A 4WBNA 1ODEA 4BVTA 1H48A 3FFMA 4F6RB 4TZZA 4X1IA 4TV9B 4RHAA 5JCOA 4ERHA 1RLGA 3F0FA 3G71F 3VOBA 3RYCA 5AVMA 4B5CA 3R0PA 2Z01A 4ZHQB 2K1SA 1VH8A 1W5FA 2QI2A 3MCAB 3HKEB 4O4HA 2H8EA 1VQOF 3HKCA 1QVFF 1Q82H 5GANK 3N4YA 4FFBA 1K9MH 3MBMA 3WGNA 5CA1B 3JATB 5CB4A 5JQGA 3JASB 3VMFB 1FNJA 3FD5A 3L7QA 2WALA 4KWEA 4DXDA 5KX5B 1W2BF 4C81A 2OZBA 4X3MA 4BT7A 3NMUC 3CXCF 3IR9A 3G6EF 4EI9A 3RYHB 1IV2A 1X7OA 2BTUA 2LBTA 3LWPC 3I7TA 3JALB 5LOVB 3WJPA 2HRUA 1GO1A 4EB6A 3VIUA 3VTIC 5FLXM 4X20B 4I50B 5J2TB 1YJWF 1VK3A 4G4XA 5KMGB 3OW2F 3WPXA 4ZOLB 3CCEF 2H8CA 4O4LA 4BT6A 2RHLA 3G4SF 3CCJF 4U3JB 4C8EA 1GO0A 2UYPA 4YJ3A 1GX1A 3RYFA 4R40B 1IV1A 4EB6B 1KQSF 3HJWC 5FNVA 3VO8A 5A2QM 4O2AA 2HP3A 3C9TA 3DC2A 3HKBA 1YJNF 5JVDA 1TVKA 5HY0A 1DBFA 2CVLA 3RYIB 2AMTA 3JAMM 2Z1EA 3WGKA 4U3JA 3HAXD 1KD1H 3C9UA 1Z5VA 3CG6A 3U0OA 2IG8A 3CMAF 3WGJA 3K2XA 3S0YA 3HKDB 4ZHQA 3WXMB 1RLUA 4ZHYB 3ON1A 3MQWA 4X20A 3TD4A 3QUWA 1QVGF 1COMA 5JQGB 1XV2A 3NK6A 2KG4A 3JARA 4C8IA 2YXZA 3OBWA 3CC4F 3J7AR 3J81M 5EIBC 1NQ3A 5LXTB 1XBIA 4DRXA 3KJJA 3FPIA 5IYZB 1X7PA 1GZ0A 1QU9A 2CHSA 1R1MA 5MN5A 1W5AA 3RA5A 3RYFB 1H47A 3P10A 4O2BA 4X1YB 3VCZA 3V7QA 5C8YA 2JNBA 1FFXA 4IHJA 4O4JA 3SIVA 2F9ZC 5CB4B 3V4DA 3HTNA 3IEQA 3F0EA 5IYZA 3ERNA 1NJIH 5HWEA 4YJ2A 2UYNA 1H7MA 5KMGA 1FNKA 5EIBD 5J2TA 3K12A 3KE1A 3P0ZA 3ELCA 1Z5WA 3E22A 2OTMA 5J2UA 1IV4A 2HS3A 2RHJA 2OHWA 1VQNF 3CYPB 1VQ4F 3S06A 1IPAA 4IIJA 1W41A 4X3LA 2ZF8A 5FNVB 1SDSA 5JH7B 1QAHA 3WJQA 3CC2F 4G4VA 3I55F 3PLAC 2G9IA 1KNJA 5LYJB 2VGNA 2KGWA 2V9YA 1RA4A 5GIOC 4NUTA 5EZYB 3CC7F 3IMPA 4RQOA 3WGLA 2N48A 3NK7A 1T0AA 3I3FA 3P4EA 1YIJF 3JAWA 1Q7YH 4O4LB 1Q86H 1S72F 2CZWA 4LNUA 3F0GA 3ZP4A 4C82A 3OBYA 3CCRF 1E7KA 3GYQA 3ZO8A 1JFFB 1W5EA 1VHAA 3QHDA 4M8IA 2RHHA 3T80A 3M4SA 3V3TA 4PWTA 3UT5A 1W42A 1SA0B 1VQ6F 5HXUA 4LCKA 2FGYA 5C8YB 3LYBA 5G4UC 2PMPA 2VAMA 2ZAUA 4TV9A 1W5BA 3RE3A 3CYQA 2HVYD 4EI7A 3CMEF 1JFFA 2NMUA 5EYPA 2UYNB 4YJ2B 3ZP7A 1VQMF 1X25A 3SIUA 4BT3A 1DT9A 1OFUA 2R751 3N2KA 3CCMF 2HP0B 3WJRA 3HKDA 3BYQA 4BW0B 5MN4A 5EB1B 3N2GA 1W3EX 3S02A 4XCQA 5JH7A 1ZWZA 3KIZA 2VGMA 2Z1UA 2Q1YA 2Z1TA 5HP8A 5EYPB 4NWOB 5ITZB 3IEWA 2LBXA 2IQQA 4I55B 3LWQC 4X1KA 3EORA 4BVSA 4O4JB 1VQ7F 1VQ9F 4TUYA 2CHTA 1KC8H 4BVRA 1JY8A 1NMUB 3N2GB 3LWOC 3AGKA 3RYHA 2CW4A 5G4VC 3CCLF 1K8AH 2OTLF 2HQSC 1J7HA 2R6R1 3N4ZA 1JD1A 4FFBB 3TD3A 2DYYA 5IJ9B 3QTYA 2P6YA 4B46A 5LP6B 1CK2A 1Q8RA 3JASA 5CA0B 4BT4A 1PF5A 4U39A 5GIPC 3RA6A 4NQ3A 5EO3A 3JATA 3JAKB 3IKFA 5GONA 2KTVA 2GLZA 2MQEA 5EZYA 3VOAA 5LP6C 1FSZA 3VYUC 2VXYA 4X1IB 3VYTC 2VAPA 3PAFA 2BTOA 5EAZA 3CB2A 2I6DA 1YITF 3K0TA 4O4IA 1QD9A 3C8LA 1UI9A 4O2AB 3CPWF 1U40A 5LOVA 3WGMA 1ONIA 2BTQB 3JAKA 5GAPK 1UFYA 2H6LA 4X1KB 4X1YA 2ALEA 1SA0A 1YQNA 2DT4A 3RYIA 5ITZA 3FD6A 2KTUA 4I50A 1U3LA 5LA6A 1KNKA 3KHNA 4ZK7A 4BT5A 3DDNA 3CCSF 1YHQF 3D00A 4O2BB 4YJ3B 3O85A 4O4IB 5HXZA 4TV8B 2ZODA 5HY1A 1VQKF 3F0DA 1W59A 2UYKA 3LFOA 1SZQA 3HKBB 2OTJF 3HKEA 4O4HB 5LA6B 4G4WA 2FC3A 4I55A 2BO1A 3OONA 5GONB 1JN1A 3JARB 5EWRA 3S03A 1M90H 3I56F 2LBWA 5HY4A 4DRXB 1YGYA 4ZHVA 5B8FA 2Z1FA 1M1KH 3FBAA 3B6NA 3JCMM 3HKCB 1VQ5F 2HX0A 1W40A 2HRYA 5BMVA
chains in the Genus database with same CATH topology
4BW0B 5IT9M 1CN7A 1W3EX 3WXMB 3ON1A 4XCQA 1ZWZA 2VGMA 4BVQA 3E20B 5FJ4C 1QVGF 3NVIB 3NK6A 3LWQC 2LBXA 4BVTA 2KG4A 3FFMA 4BVSA 3CCQF 3OBWA 4TZZA 1VQ7F 3CC4F 3J7AR 3J81M 1VQ9F 1XBIA 1KC8H 4BVRA 1NMUB 1RLGA 3G71F 3LWOC 3AGKA 1X7PA 1GZ0A 1PXWA 3RA5A 5G4VC 5DCVA 2QI2A 3CCLF 3MCAB 1K8AH 2OTLF 3CPQA 3N4ZA 1VQOF 1QVFF 3V7QA 1Q82H 5GANK 3N4YA 2JNBA 1K9MH 1CK2A 3SIVA 2AIFA 1VQLF 2F9ZC 4C4WC 3LWRC 5GIPC 3E1YA 3RA6A 4NQ3A 5EO3A 3LWVC 3CMAF 3VMFB 2KTVA 1NJIH 1X52A 2GLZA 5HWEA 1K73H 2WALA 1H7MA 1W2BF 2OZBA 3NMUC 4X3MA 3CXCF 3IR9A 1Q81H 1N8RH 3G6EF 3PAFA 4EI9A 2I6DA 1YITF 1X7OA 3J80M 3LWPC 2OHWA 1VQNF 1VQ4F 3CPWF 1IPAA 1YJ9F 1W41A 4X3LA 1SDSA 1GO1A 5GAPK 3CC2F 3I55F 2ALEA 3PLAC 3V7EA 5FLXM 2KTUA 2VGNA 5GIOC 1RA4A 1YJWF 4NUTA 3CC7F 3OW2F 1YIJF 3NK7A 3CCEF 1Q7YH 1Q86H 1S72F 2CZWA 3G4SF 3CCRF 3CCSF 1VQ8F 3OBYA 1E7KA 3GYQA 3CCJF 1YHQF 3D00A 1JJ2F 1GO0A 1T0KB 3O85A 2QEXF 1YI2F 5HXZA 1KQSF 5HY1A 3V3TA 1VQKF 3HJWC 1W42A 1VQ6F 5HXUA 5A2QM 4LCKA 2FGYA 3LFOA 5G4UC 2OTJF 4EI8A 1YJNF 2FC3A 5HY0A 2BO1A 3CCUF 3CCVF 2HVYD 5EWRA 1VQPF 1M90H 3NVKE 3JAMM 3I56F 2LBWA 4EI7A 3CMEF 3CD6F 5HY2A 3HAXD 5HY4A 3VI6A 1KD1H 1VQMF 4BY9D 5GINC 3CG6A 1M1KH 3JCMM 2QA4F 3SIUA 1DT9A 1VQ5F 3CCMF 1W40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BW0 B;  5IT9 M;  1CN7 A;  1W3E X;  3WXM B;  3ON1 A;  1ZWZ A;  2VGM A;  3E20 B;  5FJ4 C;  1QVG F;  3NVI B;  3NK6 A;  3LWQ C;  2LBX A;  2KG4 A;  3FFM A;  3CCQ F;  3OBW A;  4TZZ A;  1VQ7 F;  3CC4 F;  3J7A R;  3J81 M;  1VQ9 F;  1XBI A;  1KC8 H;  1NMU B;  1RLG A;  3G71 F;  3LWO C;  3AGK A;  1X7P A;  1GZ0 A;  1PXW A;  3RA5 A;  5G4V C;  5DCV A;  2QI2 A;  3CCL F;  3MCA B;  1K8A H;  2OTL F;  3CPQ A;  3N4Z A;  1VQO F;  1QVF F;  3V7Q A;  1Q82 H;  5GAN K;  3N4Y A;  2JNB A;  1K9M H;  1CK2 A;  3SIV A;  2AIF A;  1VQL F;  4C4W C;  3LWR C;  5GIP C;  3E1Y A;  3RA6 A;  5EO3 A;  3LWV C;  3CMA F;  3VMF B;  2KTV A;  1NJI H;  1X52 A;  1K73 H;  2WAL A;  1H7M A;  1W2B F;  2OZB A;  3NMU C;  4X3M A;  3CXC F;  3IR9 A;  1Q81 H;  1N8R H;  3G6E F;  3PAF A;  2I6D A;  1YIT F;  1X7O A;  3J80 M;  3LWP C;  2OHW A;  1VQN F;  1VQ4 F;  3CPW F;  1IPA A;  1YJ9 F;  1W41 A;  4X3L A;  1SDS A;  1GO1 A;  5GAP K;  3CC2 F;  3I55 F;  2ALE A;  3PLA C;  3V7E A;  5FLX M;  2KTU A;  2VGN A;  5GIO C;  1RA4 A;  1YJW F;  4NUT A;  3CC7 F;  3OW2 F;  1YIJ F;  3NK7 A;  3CCE F;  1Q7Y H;  1Q86 H;  1S72 F;  2CZW A;  3G4S F;  3CCR F;  3CCS F;  1VQ8 F;  3OBY A;  1E7K A;  3GYQ A;  3CCJ F;  1YHQ F;  1JJ2 F;  1GO0 A;  1T0K B;  3O85 A;  2QEX F;  1YI2 F;  1KQS F;  1VQK F;  3HJW C;  1W42 A;  1VQ6 F;  5A2Q M;  4LCK A;  3LFO A;  5G4U C;  2OTJ F;  1YJN F;  2FC3 A;  2BO1 A;  3CCU F;  3CCV F;  2HVY D;  5EWR A;  1VQP F;  1M90 H;  3NVK E;  3JAM M;  3I56 F;  2LBW A;  3CME F;  3CD6 F;  3HAX D;  3VI6 A;  1KD1 H;  1VQM F;  4BY9 D;  5GIN C;  3CG6 A;  1M1K H;  3JCM M;  2QA4 F;  3SIU A;  1DT9 A;  1VQ5 F;  3CCM F;  1W40 A; 
#chains in the Genus database with same CATH topology
 2AIZ P;  1U3P A;  2ZVZ A;  1FFX B;  4E6E A;  1OAP A;  4BVQ A;  5FJ4 C;  4HNA B;  2GVI A;  3NVI B;  3C9S A;  5MN6 A;  3CCQ F;  4ZHW A;  2YYE A;  1W57 A;  5JVD B;  2RB9 A;  4TUY B;  3VYS C;  2L26 A;  4ZI7 A;  5LXT A;  3WPW A;  5J2U B;  4BT2 A;  1PXW A;  4TV8 A;  5DCV A;  3CPQ A;  5CA1 A;  2VAW A;  4IHJ B;  4G88 A;  3ESJ A;  2AIF A;  5HP7 A;  1VQL F;  1W58 1;  4C4W C;  3F6M A;  3LWR C;  3E1Y A;  3LDT A;  2HS4 A;  4B62 A;  1VQV A;  2GZL A;  3LWV C;  3D54 A;  1X52 A;  3JAW B;  1K73 H;  4ZI7 B;  3S0H A;  3M84 A;  4G4Y A;  2QTP A;  2UZH A;  2I6R A;  1Q81 H;  1N8R H;  3GHZ A;  3E22 B;  3RYC B;  5IJ0 A;  1TUB B;  4G4Z A;  3J80 M;  1TVK B;  3D01 A;  1YJ9 F;  4IIJ B;  3K14 A;  1XRG A;  3MCQ A;  3V7E A;  4WBN B;  5LYJ A;  3TD5 A;  2IAF A;  3N2K B;  2HS0 A;  3LME A;  5CA0 A;  1CLI A;  2W8B C;  4C8G A;  1VQ8 F;  4I4T A;  5BMV B;  1JJ2 F;  1T0K B;  1TUB A;  2QEX F;  1YI2 F;  1U43 A;  2B33 A;  2LCA A;  3ZOP A;  2EWC A;  2CWJ A;  1IV3 A;  5JCO C;  2ZOV A;  3JAL A;  3HWU A;  4EI8 A;  2Q1X A;  2ZVY A;  3CCU F;  3CCV F;  3S0W A;  1VQP F;  3IKE A;  3NVK E;  3CD6 F;  5HY2 A;  4HNA A;  2UYJ A;  4I4T B;  2RHO A;  3VI6 A;  5KX5 A;  4BY9 D;  4ZOL A;  5GIN C;  3KJK A;  4F6R A;  1XHO A;  1W55 A;  5IJ0 B;  2QA4 F;  3GTZ A;  1RQ7 A;  2CSL A;  5IT9 M;  4LNU B;  5LP6 A;  4B45 A;  2HP0 A;  1CN7 A;  3MDO A;  2PHN A;  3Q8H A;  5IJ9 A;  3C9R A;  3JVH A;  3E20 B;  3M1X A;  5EB0 A;  3UT5 B;  1RQ2 A;  4WBN A;  1ODE A;  4BVT A;  1H48 A;  3FFM A;  4F6R B;  4TZZ A;  4X1I A;  4TV9 B;  4RHA A;  5JCO A;  4ERH A;  1RLG A;  3F0F A;  3G71 F;  3VOB A;  3RYC A;  5AVM A;  4B5C A;  3R0P A;  2Z01 A;  4ZHQ B;  2K1S A;  1VH8 A;  1W5F A;  2QI2 A;  3MCA B;  3HKE B;  4O4H A;  2H8E A;  1VQO F;  3HKC A;  1QVF F;  1Q82 H;  5GAN K;  3N4Y A;  4FFB A;  1K9M H;  3MBM A;  3WGN A;  5CA1 B;  3JAT B;  5CB4 A;  5JQG A;  3JAS B;  3VMF B;  1FNJ A;  3FD5 A;  3L7Q A;  2WAL A;  4KWE A;  4DXD A;  5KX5 B;  1W2B F;  4C81 A;  2OZB A;  4X3M A;  4BT7 A;  3NMU C;  3CXC F;  3IR9 A;  3G6E F;  4EI9 A;  3RYH B;  1IV2 A;  1X7O A;  2BTU A;  2LBT A;  3LWP C;  3I7T A;  3JAL B;  5LOV B;  3WJP A;  2HRU A;  1GO1 A;  4EB6 A;  3VIU A;  3VTI C;  5FLX M;  4X20 B;  4I50 B;  5J2T B;  1YJW F;  1VK3 A;  4G4X A;  5KMG B;  3OW2 F;  3WPX A;  4ZOL B;  3CCE F;  2H8C A;  4O4L A;  4BT6 A;  2RHL A;  3G4S F;  3CCJ F;  4U3J B;  4C8E A;  1GO0 A;  2UYP A;  4YJ3 A;  1GX1 A;  3RYF A;  4R40 B;  1IV1 A;  4EB6 B;  1KQS F;  3HJW C;  5FNV A;  3VO8 A;  5A2Q M;  4O2A A;  2HP3 A;  3C9T A;  3DC2 A;  3HKB A;  1YJN F;  5JVD A;  1TVK A;  5HY0 A;  1DBF A;  2CVL A;  3RYI B;  2AMT A;  3JAM M;  2Z1E A;  3WGK A;  4U3J A;  3HAX D;  1KD1 H;  3C9U A;  1Z5V A;  3CG6 A;  3U0O A;  2IG8 A;  3CMA F;  3WGJ A;  3K2X A;  3S0Y A;  3HKD B;  4ZHQ A;  3WXM B;  1RLU A;  4ZHY B;  3ON1 A;  3MQW A;  4X20 A;  3TD4 A;  3QUW A;  1QVG F;  1COM A;  5JQG B;  1XV2 A;  3NK6 A;  2KG4 A;  3JAR A;  4C8I A;  2YXZ A;  3OBW A;  3CC4 F;  3J7A R;  3J81 M;  5EIB C;  1NQ3 A;  5LXT B;  1XBI A;  4DRX A;  3KJJ A;  3FPI A;  5IYZ B;  1X7P A;  1GZ0 A;  1QU9 A;  2CHS A;  1R1M A;  5MN5 A;  1W5A A;  3RA5 A;  3RYF B;  1H47 A;  3P10 A;  4O2B A;  4X1Y B;  3VCZ A;  3V7Q A;  5C8Y A;  2JNB A;  1FFX A;  4IHJ A;  4O4J A;  3SIV A;  2F9Z C;  5CB4 B;  3V4D A;  3HTN A;  3IEQ A;  3F0E A;  5IYZ A;  3ERN A;  1NJI H;  5HWE A;  4YJ2 A;  2UYN A;  1H7M A;  5KMG A;  1FNK A;  5EIB D;  5J2T A;  3K12 A;  3KE1 A;  3P0Z A;  3ELC A;  1Z5W A;  3E22 A;  2OTM A;  5J2U A;  1IV4 A;  2HS3 A;  2RHJ A;  2OHW A;  1VQN F;  3CYP B;  1VQ4 F;  3S06 A;  1IPA A;  4IIJ A;  1W41 A;  4X3L A;  2ZF8 A;  5FNV B;  1SDS A;  5JH7 B;  1QAH A;  3WJQ A;  3CC2 F;  4G4V A;  3I55 F;  3PLA C;  2G9I A;  1KNJ A;  5LYJ B;  2VGN A;  2KGW A;  2V9Y A;  1RA4 A;  5GIO C;  4NUT A;  5EZY B;  3CC7 F;  3IMP A;  4RQO A;  3WGL A;  2N48 A;  3NK7 A;  1T0A A;  3I3F A;  3P4E A;  1YIJ F;  3JAW A;  1Q7Y H;  4O4L B;  1Q86 H;  1S72 F;  2CZW A;  4LNU A;  3F0G A;  3ZP4 A;  4C82 A;  3OBY A;  3CCR F;  1E7K A;  3GYQ A;  3ZO8 A;  1JFF B;  1W5E A;  1VHA A;  3QHD A;  4M8I A;  2RHH A;  3T80 A;  3M4S A;  3V3T A;  4PWT A;  3UT5 A;  1W42 A;  1SA0 B;  1VQ6 F;  5HXU A;  4LCK A;  2FGY A;  5C8Y B;  3LYB A;  5G4U C;  2PMP A;  2VAM A;  2ZAU A;  4TV9 A;  1W5B A;  3RE3 A;  3CYQ A;  2HVY D;  4EI7 A;  3CME F;  1JFF A;  2NMU A;  5EYP A;  2UYN B;  4YJ2 B;  3ZP7 A;  1VQM F;  1X25 A;  3SIU A;  4BT3 A;  1DT9 A;  1OFU A;  2R75 1;  3N2K A;  3CCM F;  2HP0 B;  3WJR A;  3HKD A;  3BYQ A;  4BW0 B;  5MN4 A;  5EB1 B;  3N2G A;  1W3E X;  3S02 A;  4XCQ A;  5JH7 A;  1ZWZ A;  3KIZ A;  2VGM A;  2Z1U A;  2Q1Y A;  2Z1T A;  5HP8 A;  5EYP B;  4NWO B;  5ITZ B;  3IEW A;  2LBX A;  2IQQ A;  4I55 B;  3LWQ C;  4X1K A;  3EOR A;  4BVS A;  4O4J B;  1VQ7 F;  1VQ9 F;  4TUY A;  2CHT A;  1KC8 H;  4BVR A;  1JY8 A;  1NMU B;  3N2G B;  3LWO C;  3AGK A;  3RYH A;  2CW4 A;  5G4V C;  3CCL F;  1K8A H;  2OTL F;  2HQS C;  1J7H A;  2R6R 1;  3N4Z A;  1JD1 A;  4FFB B;  3TD3 A;  2DYY A;  5IJ9 B;  3QTY A;  2P6Y A;  4B46 A;  5LP6 B;  1CK2 A;  1Q8R A;  3JAS A;  5CA0 B;  4BT4 A;  1PF5 A;  4U39 A;  5GIP C;  3RA6 A;  4NQ3 A;  5EO3 A;  3JAT A;  3JAK B;  3IKF A;  5GON A;  2KTV A;  2GLZ A;  2MQE A;  5EZY A;  3VOA A;  5LP6 C;  1FSZ A;  3VYU C;  2VXY A;  4X1I B;  3VYT C;  2VAP A;  3PAF A;  2BTO A;  5EAZ A;  3CB2 A;  2I6D A;  1YIT F;  3K0T A;  4O4I A;  1QD9 A;  3C8L A;  1UI9 A;  4O2A B;  3CPW F;  1U40 A;  5LOV A;  3WGM A;  1ONI A;  2BTQ B;  3JAK A;  5GAP K;  1UFY A;  2H6L A;  4X1K B;  4X1Y A;  2ALE A;  1SA0 A;  1YQN A;  2DT4 A;  3RYI A;  5ITZ A;  3FD6 A;  2KTU A;  4I50 A;  1U3L A;  5LA6 A;  1KNK A;  3KHN A;  4ZK7 A;  4BT5 A;  3DDN A;  3CCS F;  1YHQ F;  3D00 A;  4O2B B;  4YJ3 B;  3O85 A;  4O4I B;  5HXZ A;  4TV8 B;  2ZOD A;  5HY1 A;  1VQK F;  3F0D A;  1W59 A;  2UYK A;  3LFO A;  1SZQ A;  3HKB B;  2OTJ F;  3HKE A;  4O4H B;  5LA6 B;  4G4W A;  2FC3 A;  4I55 A;  2BO1 A;  3OON A;  5GON B;  1JN1 A;  3JAR B;  5EWR A;  3S03 A;  1M90 H;  3I56 F;  2LBW A;  5HY4 A;  4DRX B;  1YGY A;  4ZHV A;  5B8F A;  2Z1F A;  1M1K H;  3FBA A;  3B6N A;  3JCM M;  3HKC B;  1VQ5 F;  2HX0 A;  1W40 A;  2HRY A;  5BMV A; 
#chains in the Genus database with same CATH homology
 4BW0 B;  5IT9 M;  1CN7 A;  1W3E X;  3WXM B;  3ON1 A;  4XCQ A;  1ZWZ A;  2VGM A;  4BVQ A;  3E20 B;  5FJ4 C;  1QVG F;  3NVI B;  3NK6 A;  3LWQ C;  2LBX A;  4BVT A;  2KG4 A;  3FFM A;  4BVS A;  3CCQ F;  3OBW A;  4TZZ A;  1VQ7 F;  3CC4 F;  3J7A R;  3J81 M;  1VQ9 F;  1XBI A;  1KC8 H;  4BVR A;  1NMU B;  1RLG A;  3G71 F;  3LWO C;  3AGK A;  1X7P A;  1GZ0 A;  1PXW A;  3RA5 A;  5G4V C;  5DCV A;  2QI2 A;  3CCL F;  3MCA B;  1K8A H;  2OTL F;  3CPQ A;  3N4Z A;  1VQO F;  1QVF F;  3V7Q A;  1Q82 H;  5GAN K;  3N4Y A;  2JNB A;  1K9M H;  1CK2 A;  3SIV A;  2AIF A;  1VQL F;  2F9Z C;  4C4W C;  3LWR C;  5GIP C;  3E1Y A;  3RA6 A;  4NQ3 A;  5EO3 A;  3LWV C;  3CMA F;  3VMF B;  2KTV A;  1NJI H;  1X52 A;  2GLZ A;  5HWE A;  1K73 H;  2WAL A;  1H7M A;  1W2B F;  2OZB A;  3NMU C;  4X3M A;  3CXC F;  3IR9 A;  1Q81 H;  1N8R H;  3G6E F;  3PAF A;  4EI9 A;  2I6D A;  1YIT F;  1X7O A;  3J80 M;  3LWP C;  2OHW A;  1VQN F;  1VQ4 F;  3CPW F;  1IPA A;  1YJ9 F;  1W41 A;  4X3L A;  1SDS A;  1GO1 A;  5GAP K;  3CC2 F;  3I55 F;  2ALE A;  3PLA C;  3V7E A;  5FLX M;  2KTU A;  2VGN A;  5GIO C;  1RA4 A;  1YJW F;  4NUT A;  3CC7 F;  3OW2 F;  1YIJ F;  3NK7 A;  3CCE F;  1Q7Y H;  1Q86 H;  1S72 F;  2CZW A;  3G4S F;  3CCR F;  3CCS F;  1VQ8 F;  3OBY A;  1E7K A;  3GYQ A;  3CCJ F;  1YHQ F;  3D00 A;  1JJ2 F;  1GO0 A;  1T0K B;  3O85 A;  2QEX F;  1YI2 F;  5HXZ A;  1KQS F;  5HY1 A;  3V3T A;  1VQK F;  3HJW C;  1W42 A;  1VQ6 F;  5HXU A;  5A2Q M;  4LCK A;  2FGY A;  3LFO A;  5G4U C;  2OTJ F;  4EI8 A;  1YJN F;  2FC3 A;  5HY0 A;  2BO1 A;  3CCU F;  3CCV F;  2HVY D;  5EWR A;  1VQP F;  1M90 H;  3NVK E;  3JAM M;  3I56 F;  2LBW A;  4EI7 A;  3CME F;  3CD6 F;  5HY2 A;  3HAX D;  5HY4 A;  3VI6 A;  1KD1 H;  1VQM F;  4BY9 D;  5GIN C;  3CG6 A;  1M1K H;  3JCM M;  2QA4 F;  3SIU A;  1DT9 A;  1VQ5 F;  3CCM F;  1W40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...