1CK2A

Yeast (saccharomyces cerevisiae) ribosomal protein l30
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
104
structure length
104
Chain Sequence
b'APVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S RIBOSOMAL PROTEIN L30
molecule tags Ribosome
source organism Saccharomyces cerevisiae
publication title Local folding coupled to RNA binding in the yeast ribosomal protein L30
pubmed doi rcsb
total genus 43
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 1999-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1ck2A00
4C4WC 1X52A 1YI2F 3CCRF 3WXMB 1E7KA 4LCKA 1VQMF 1VQ5F 5A2QM 2QEXF 1YJWF 1KD1H 3CD6F 3CCEF 2OZBA 3LWRC 3CPQA 1PXWA 3FFMA 5DCVA 1XBIA 3RA6A 1DT9A 4BY9D 3NK7A 1M1KH 3V7EA 5G4UC 3HAXD 2OTJF 3NK6A 1W42A 3N4ZA 1QVGF 3G4SF 1VQ7F 1IPAA 1K8AH 1VQKF 2I6DA 3SIVA 1VQLF 3MCAB 1CK2A 5EWRA 3J80M 3CMAF 1YIJF 1VQOF 5G4VC 1CN7A 3CCQF 3VI6A 2QI2A 1T0KB 3G71F 2KTVA 1GZ0A 1RA4A 3N4YA 2HVYD 1W40A 3CC4F 1VQNF 2FC3A 3CPWF 2VGNA 3LWVC 3SIUA 5GINC 3CCVF 1W2BF 1QVFF 1YJNF 3CCMF 1X7PA 1KC8H 3JCMM 2AIFA 3GYQA 3CMEF 5GIOC 3E1YA 1N8RH 1VQ6F 3E20B 2OTLF 3OBWA 3I56F 1ZWZA 2OHWA 3J81M 2QA4F 3PAFA 1VQ8F 2CZWA 3CCUF 4NUTA 3NVIB 3O85A 1JJ2F 1Q7YH 2JNBA 2KTUA 3J7AR 2BO1A 3JAMM 2VGMA 1YHQF 4X3MA 1VQ4F 1VQ9F 5FJ4C 3RA5A 1Q82H 1GO0A 3G6EF 1YITF 3I55F 1M90H 3AGKA 3LWPC 1S72F 3CG6A 2KG4A 3IR9A 1KQSF 1H7MA 3LWQC 2WALA 4TZZA 3NMUC 3ON1A 1K73H 3VMFB 1GO1A 5IT9M 1K9MH 5EO3A 1YJ9F 3CXCF 3CC7F 4X3LA 1W41A 5GANK 1NJIH 3LFOA 3LWOC 2LBXA 3CCJF 3V7QA 2ALEA 3CC2F 3CCSF 1W3EX 1NMUB 1RLGA 1X7OA 1Q86H 3PLAC 1SDSA 3OBYA 5GAPK 3CCLF 5GIPC 1Q81H 3NVKE 5FLXM 1VQPF 3OW2F 4BW0B 3HJWC 2LBWA
chains in the Genus database with same CATH superfamily
3WGLA 4C4WC 5LP6A 3LMEA 3F0DA 4BVSA 4WBNB 2VAWA 5EYPA 5LYJA 3WGNA 2QEXF 5IJ0B 4IIJA 4G88A 3LWRC 1OAPA 3TD5A 1SZQA 4O4HB 2Q1YA 5DCVA 1ODEA 3RA6A 5ITZA 3IKEA 3V7EA 5G4UC 3HAXD 3KHNA 4LNUB 3E22A 3RYHA 2IG8A 3N4ZA 1IPAA 3KE1A 1VQLF 3LYBA 1YIJF 4NWOB 4TUYB 5LA6A 5G4VC 1CN7A 3CCQF 2QI2A 5IJ0A 1T0KB 2CHTA 4BT3A 1R1MA 3K14A 4O2BB 4YJ2B 3V4DA 3WGJA 3JATB 5B8FA 1W40A 3WPWA 2FGYA 4I55A 2VGNA 3HKDA 3WJRA 2BTOA 3WGKA 4EI7A 1VH8A 1QVFF 1YJNF 3JAWB 4G4ZA 3F0FA 4U3JB 4X20B 5LXTB 1TUBB 3C9TA 5KMGB 3KIZA 4C82A 5C8YA 1UI9A 3PAFA 2DT4A 1QAHA 3I3FA 5HY2A 1Q8RA 4ZHYB 2R751 3RE3A 3RYCA 2JNBA 3OONA 3GHZA 3RYIB 2GLZA 5MN5A 2UYJA 1YHQF 3RA5A 2ZF8A 1Q82H 3R0PA 4I4TB 3VYSC 4U39A 3C9SA 5LXTA 1RQ2A 4B45A 4BT4A 4TUYA 5MN4A 1S72F 4O2AB 3IMPA 4BVQA 4TZZA 4G4YA 5MN6A 2HRYA 3TD3A 1GO1A 1FFXB 4BVRA 3HKCB 3HTNA 1K9MH 1IV1A 5HP7A 5IT9M 3RYCB 3CC7F 5GANK 1NJIH 4PWTA 5HY4A 2CSLA 3S0HA 2Z1UA 3CC2F 3ZO8A 4ZI7A 3JALB 1FFXA 3FPIA 1X7OA 2CW4A 1YGYA 1GX1A 3HKEB 2HP0B 5GIPC 3B6NA 1XV2A 3HKCA 1Q81H 4X20A 1VQPF 3CYQA 4G4WA 3QTYA 3HJWC 1W55A 3KJJA 1W59A 1RLUA 4YJ2A 4LCKA 1X25A 3JALA 3KJKA 5HY1A 3V3TA 2OTMA 4EB6A 4C8GA 1ONIA 5A2QM 2RHHA 2IAFA 2VAPA 2V9YA 3T80A 3ZOPA 3FFMA 1FNKA 1XBIA 1IV2A 4BY9D 4XCQA 1IV4A 2ZODA 2IQQA 3NK6A 1W42A 2AMTA 5KMGA 1VQ7F 3G4SF 4B46A 1VQKF 3SIVA 3S0WA 4O4HA 1VHAA 2GVIA 4U3JA 3S03A 1CK2A 3CMAF 3J80M 5GONA 1CLIA 5CB4A 3FD6A 5LOVB 4TV9B 1NQ3A 5EIBD 3G71F 4I50B 1JFFB 1GZ0A 3RYIA 4ZHQB 5LP6B 5GONB 1VQNF 2FC3A 3CPWF 1T0AA 3LWVC 5GINC 1W5FA 5EZYB 3K12A 3VTIC 3CYPB 5HP8A 3EORA 3MDOA 1X7PA 1KC8H 4NQ3A 3JCMM 3MCQA 2AIFA 3GYQA 5KX5A 4IHJA 3HKBB 5J2UB 1SA0A 3OBWA 4IIJB 1ZWZA 2ZVZA 3VCZA 2QA4F 1H48A 1VQ8F 2RHOA 3ERNA 4EI8A 4C8EA 5HXZA 1XRGA 4NUTA 3N2GB 3O85A 2W8BC 1JN1A 1Q7YH 2BO1A 3I7TA 4G4VA 1QU9A 2VGMA 1VQ4F 3IKFA 5HXUA 4DXDA 1J7HA 2BTQB 3I55F 1M90H 5KX5B 2EWCA 5J2UA 3LWPC 4O4JB 3IR9A 4G4XA 1H7MA 3Q8HA 3LWQC 4I4TA 3NMUC 2RHJA 3ON1A 1COMA 1K73H 3VMFB 2AIZP 4RQOA 3WPXA 3RYFA 5EO3A 1YJ9F 3CXCF 3HKDB 4ZK7A 3F0GA 1W41A 3LWOC 2HS4A 4BVTA 3S06A 3JARA 5FNVA 2UZHA 3V7QA 3CCJF 2BTUA 4ZOLA 2R6R1 4DRXB 2H6LA 3CCSF 1FNJA 4IHJB 1SDSA 3JASB 2HS0A 5EIBC 3QUWA 3JAKA 2YYEA 3P0ZA 3ELCA 3CCLF 1KNJA 5FLXM 1QD9A 4X1YA 4LNUA 5J2TB 5IYZB 2VAMA 1U40A 2ZAUA 3TD4A 2HP0A 3QHDA 1Z5WA 3JASA 5IJ9A 3U0OA 3WXMB 1E7KA 3FD5A 1VQMF 1RQ7A 5JVDB 4DRXA 4ZHVA 5EYPB 5LYJB 4TV9A 3VOBA 4C81A 1VQ5F 2KGWA 1KD1H 3CD6F 4X1KB 3CCEF 1U3LA 2GZLA 1KNKA 1DT9A 3NK7A 2HX0A 1PF5A 3RYFB 2OTJF 3K2XA 3E22B 3RYHB 1JY8A 5EB0A 3UT5A 1K8AH 5CA0B 3N2KA 3D00A 4F6RA 3WJPA 3HKEA 2G9IA 5EWRA 1Z5VA 3C9UA 1W5EA 4ZOLB 4O4LB 3VI6A 2ZVYA 2PHNA 2ZOVA 5CB4B 3CC4F 3CB2A 4TV8B 3F6MA 4I50A 3CCVF 4ZHWA 2Z1FA 2H8EA 4C8IA 1W2BF 3CCMF 4O4JA 5GIOC 2H8CA 3E1YA 4EI9A 4FFBB 1VQ6F 2DYYA 2OTLF 3C9RA 5JQGB 2Z1TA 2OHWA 4B62A 3BYQA 2CZWA 4TV8A 5JVDA 3CCUF 3S02A 1DBFA 5EB1B 2YXZA 1JJ2F 3JAMM 3WGMA 4X3MA 1JFFA 3MBMA 3ZP4A 1GO0A 5JH7A 4WBNA 5LA6B 2Q1XA 1YITF 4FFBA 3AGKA 4O2AA 2MQEA 3CG6A 5EAZA 4X1IB 1XHOA 1KQSF 2HS3A 5EZYA 2CWJA 3VOAA 1TVKA 1OFUA 2HP3A 3M1XA 3LFOA 1YQNA 1UFYA 2LBXA 2UYPA 2ALEA 2UYNB 2VXYA 2HRUA 1NMUB 1RLGA 5LOVA 2CHSA 2UYKA 1Q86H 4O4IA 1W5AA 5GAPK 5JCOC 3N2KB 1W581 3UT5B 4BW0B 4BT2A 2RHLA 5CA1A 4B5CA 4O4IB 2LCAA 3JATA 1X52A 2N48A 5HWEA 5LP6C 1FSZA 1YI2F 3CCRF 3D01A 3M4SA 1W57A 1YJWF 3FBAA 2OZBA 3GTZA 1JD1A 2QTPA 3CPQA 1PXWA 3HWUA 2NMUA 1M1KH 1VK3A 1TVKB 1W5BA 3JVHA 1SA0B 4BT6A 2B33A 2Z1EA 1QVGF 2I6DA 3MCAB 3JAKB 4I55B 1VQOF 4YJ3B 4EB6B 2KTVA 1RA4A 4M8IA 4HNAB 3N4YA 4E6EA 3DC2A 3ESJA 2HVYD 4BT7A 5IJ9B 4BT5A 3K0TA 2RB9A 3SIUA 5CA1B 4O4LA 2LBTA 5C8YB 3IEQA 4X1IA 3VO8A 3CMEF 3IEWA 3LDTA 1U3PA 1N8RH 5BMVB 2CVLA 3E20B 3P4EA 3I56F 4X1KA 3VIUA 3J81M 4ZI7B 2UYNA 1VQVA 4ERHA 1H47A 3NVIB 4ZHQA 3N2GA 2PMPA 3JARB 5FNVB 4O2BA 2I6RA 2KTUA 3J7AR 3D54A 3F0EA 1VQ9F 5AVMA 2P6YA 3WJQA 5FJ4C 3G6EF 3L7QA 5IYZA 4YJ3A 5BMVA 2F9ZC 1TUBA 3DDNA 2KG4A 5HY0A 3JAWA 2WALA 2L26A 3VYTC 5JH7B 3S0YA 2HQSC 3M84A 4X3LA 3ZP7A 4HNAA 3C8LA 3MQWA 2Z01A 1W3EX 3HKBA 3VYUC 5JQGA 1U43A 3PLAC 5JCOA 4KWEA 3OBYA 5CA0A 4F6RB 3NVKE 3P10A 1IV3A 3OW2F 4X1YB 4R40B 2K1SA 2LBWA 5J2TA 5ITZB 4RHAA
chains in the Genus database with same CATH topology
4C4WC 1X52A 5HWEA 4BVSA 1YI2F 3CCRF 3WXMB 1E7KA 4LCKA 1VQMF 5HY1A 3V3TA 1VQ5F 5A2QM 2QEXF 1YJWF 1KD1H 3CD6F 3CCEF 2OZBA 3LWRC 3CPQA 1PXWA 3FFMA 5DCVA 1XBIA 3RA6A 1DT9A 4BY9D 4XCQA 3NK7A 1M1KH 3V7EA 5G4UC 3HAXD 2OTJF 3NK6A 1W42A 3N4ZA 1QVGF 3G4SF 1VQ7F 1IPAA 1K8AH 1VQKF 2I6DA 3SIVA 1VQLF 3D00A 3MCAB 1CK2A 5EWRA 3J80M 3CMAF 1YIJF 1VQOF 5G4VC 1CN7A 3CCQF 3VI6A 2QI2A 1T0KB 3G71F 2KTVA 1GZ0A 1RA4A 3N4YA 2HVYD 1W40A 3CC4F 2FGYA 1VQNF 2FC3A 3CPWF 2VGNA 3LWVC 3SIUA 5GINC 3CCVF 4EI7A 1W2BF 1QVFF 1YJNF 3CCMF 1X7PA 1KC8H 4NQ3A 3JCMM 2AIFA 3GYQA 3CMEF 5GIOC 4EI9A 3E1YA 1N8RH 1VQ6F 3E20B 2OTLF 3OBWA 3I56F 1ZWZA 2OHWA 3J81M 2QA4F 3PAFA 1VQ8F 2CZWA 5HY2A 4EI8A 5HXZA 3CCUF 4NUTA 3NVIB 3O85A 1JJ2F 1Q7YH 2JNBA 2KTUA 3J7AR 2BO1A 3JAMM 2GLZA 2VGMA 1YHQF 4X3MA 1VQ4F 1VQ9F 5FJ4C 3RA5A 5HXUA 1Q82H 1GO0A 3G6EF 1YITF 3I55F 1M90H 3AGKA 3LWPC 1S72F 2F9ZC 3CG6A 2KG4A 5HY0A 3IR9A 1KQSF 4BVQA 1H7MA 3LWQC 2WALA 4TZZA 3NMUC 3ON1A 1K73H 3VMFB 1GO1A 4BVRA 5IT9M 1K9MH 5EO3A 1YJ9F 3CXCF 3CC7F 4X3LA 1W41A 5GANK 1NJIH 3LFOA 3LWOC 4BVTA 5HY4A 2LBXA 3CCJF 3V7QA 2ALEA 3CC2F 3CCSF 1W3EX 1NMUB 1RLGA 1X7OA 1Q86H 3PLAC 1SDSA 3OBYA 5GAPK 3CCLF 5GIPC 1Q81H 3NVKE 5FLXM 1VQPF 3OW2F 4BW0B 3HJWC 2LBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C4W C;  1X52 A;  1YI2 F;  3CCR F;  3WXM B;  1E7K A;  4LCK A;  1VQM F;  1VQ5 F;  5A2Q M;  2QEX F;  1YJW F;  1KD1 H;  3CD6 F;  3CCE F;  2OZB A;  3LWR C;  3CPQ A;  1PXW A;  3FFM A;  5DCV A;  1XBI A;  3RA6 A;  1DT9 A;  4BY9 D;  3NK7 A;  1M1K H;  3V7E A;  5G4U C;  3HAX D;  2OTJ F;  3NK6 A;  1W42 A;  3N4Z A;  1QVG F;  3G4S F;  1VQ7 F;  1IPA A;  1K8A H;  1VQK F;  2I6D A;  3SIV A;  1VQL F;  3MCA B;  1CK2 A;  5EWR A;  3J80 M;  3CMA F;  1YIJ F;  1VQO F;  5G4V C;  1CN7 A;  3CCQ F;  3VI6 A;  2QI2 A;  1T0K B;  3G71 F;  2KTV A;  1GZ0 A;  1RA4 A;  3N4Y A;  2HVY D;  1W40 A;  3CC4 F;  1VQN F;  2FC3 A;  3CPW F;  2VGN A;  3LWV C;  3SIU A;  5GIN C;  3CCV F;  1W2B F;  1QVF F;  1YJN F;  3CCM F;  1X7P A;  1KC8 H;  3JCM M;  2AIF A;  3GYQ A;  3CME F;  5GIO C;  3E1Y A;  1N8R H;  1VQ6 F;  3E20 B;  2OTL F;  3OBW A;  3I56 F;  1ZWZ A;  2OHW A;  3J81 M;  2QA4 F;  3PAF A;  1VQ8 F;  2CZW A;  3CCU F;  4NUT A;  3NVI B;  3O85 A;  1JJ2 F;  1Q7Y H;  2JNB A;  2KTU A;  3J7A R;  2BO1 A;  3JAM M;  2VGM A;  1YHQ F;  4X3M A;  1VQ4 F;  1VQ9 F;  5FJ4 C;  3RA5 A;  1Q82 H;  1GO0 A;  3G6E F;  1YIT F;  3I55 F;  1M90 H;  3AGK A;  3LWP C;  1S72 F;  3CG6 A;  2KG4 A;  3IR9 A;  1KQS F;  1H7M A;  3LWQ C;  2WAL A;  4TZZ A;  3NMU C;  3ON1 A;  1K73 H;  3VMF B;  1GO1 A;  5IT9 M;  1K9M H;  5EO3 A;  1YJ9 F;  3CXC F;  3CC7 F;  4X3L A;  1W41 A;  5GAN K;  1NJI H;  3LFO A;  3LWO C;  2LBX A;  3CCJ F;  3V7Q A;  2ALE A;  3CC2 F;  3CCS F;  1W3E X;  1NMU B;  1RLG A;  1X7O A;  1Q86 H;  3PLA C;  1SDS A;  3OBY A;  5GAP K;  3CCL F;  5GIP C;  1Q81 H;  3NVK E;  5FLX M;  1VQP F;  3OW2 F;  4BW0 B;  3HJW C;  2LBW A; 
#chains in the Genus database with same CATH topology
 3WGL A;  4C4W C;  5LP6 A;  3LME A;  3F0D A;  4BVS A;  4WBN B;  2VAW A;  5EYP A;  5LYJ A;  3WGN A;  2QEX F;  5IJ0 B;  4IIJ A;  4G88 A;  3LWR C;  1OAP A;  3TD5 A;  1SZQ A;  4O4H B;  2Q1Y A;  5DCV A;  1ODE A;  3RA6 A;  5ITZ A;  3IKE A;  3V7E A;  5G4U C;  3HAX D;  3KHN A;  4LNU B;  3E22 A;  3RYH A;  2IG8 A;  3N4Z A;  1IPA A;  3KE1 A;  1VQL F;  3LYB A;  1YIJ F;  4NWO B;  4TUY B;  5LA6 A;  5G4V C;  1CN7 A;  3CCQ F;  2QI2 A;  5IJ0 A;  1T0K B;  2CHT A;  4BT3 A;  1R1M A;  3K14 A;  4O2B B;  4YJ2 B;  3V4D A;  3WGJ A;  3JAT B;  5B8F A;  1W40 A;  3WPW A;  2FGY A;  4I55 A;  2VGN A;  3HKD A;  3WJR A;  2BTO A;  3WGK A;  4EI7 A;  1VH8 A;  1QVF F;  1YJN F;  3JAW B;  4G4Z A;  3F0F A;  4U3J B;  4X20 B;  5LXT B;  1TUB B;  3C9T A;  5KMG B;  3KIZ A;  4C82 A;  5C8Y A;  1UI9 A;  3PAF A;  2DT4 A;  1QAH A;  3I3F A;  5HY2 A;  1Q8R A;  4ZHY B;  2R75 1;  3RE3 A;  3RYC A;  2JNB A;  3OON A;  3GHZ A;  3RYI B;  2GLZ A;  5MN5 A;  2UYJ A;  1YHQ F;  3RA5 A;  2ZF8 A;  1Q82 H;  3R0P A;  4I4T B;  3VYS C;  4U39 A;  3C9S A;  5LXT A;  1RQ2 A;  4B45 A;  4BT4 A;  4TUY A;  5MN4 A;  1S72 F;  4O2A B;  3IMP A;  4BVQ A;  4TZZ A;  4G4Y A;  5MN6 A;  2HRY A;  3TD3 A;  1GO1 A;  1FFX B;  4BVR A;  3HKC B;  3HTN A;  1K9M H;  1IV1 A;  5HP7 A;  5IT9 M;  3RYC B;  3CC7 F;  5GAN K;  1NJI H;  4PWT A;  5HY4 A;  2CSL A;  3S0H A;  2Z1U A;  3CC2 F;  3ZO8 A;  4ZI7 A;  3JAL B;  1FFX A;  3FPI A;  1X7O A;  2CW4 A;  1YGY A;  1GX1 A;  3HKE B;  2HP0 B;  5GIP C;  3B6N A;  1XV2 A;  3HKC A;  1Q81 H;  4X20 A;  1VQP F;  3CYQ A;  4G4W A;  3QTY A;  3HJW C;  1W55 A;  3KJJ A;  1W59 A;  1RLU A;  4YJ2 A;  4LCK A;  1X25 A;  3JAL A;  3KJK A;  5HY1 A;  3V3T A;  2OTM A;  4EB6 A;  4C8G A;  1ONI A;  5A2Q M;  2RHH A;  2IAF A;  2VAP A;  2V9Y A;  3T80 A;  3ZOP A;  3FFM A;  1FNK A;  1XBI A;  1IV2 A;  4BY9 D;  4XCQ A;  1IV4 A;  2ZOD A;  2IQQ A;  3NK6 A;  1W42 A;  2AMT A;  5KMG A;  1VQ7 F;  3G4S F;  4B46 A;  1VQK F;  3SIV A;  3S0W A;  4O4H A;  1VHA A;  2GVI A;  4U3J A;  3S03 A;  1CK2 A;  3CMA F;  3J80 M;  5GON A;  1CLI A;  5CB4 A;  3FD6 A;  5LOV B;  4TV9 B;  1NQ3 A;  5EIB D;  3G71 F;  4I50 B;  1JFF B;  1GZ0 A;  3RYI A;  4ZHQ B;  5LP6 B;  5GON B;  1VQN F;  2FC3 A;  3CPW F;  1T0A A;  3LWV C;  5GIN C;  1W5F A;  5EZY B;  3K12 A;  3VTI C;  3CYP B;  5HP8 A;  3EOR A;  3MDO A;  1X7P A;  1KC8 H;  4NQ3 A;  3JCM M;  3MCQ A;  2AIF A;  3GYQ A;  5KX5 A;  4IHJ A;  3HKB B;  5J2U B;  1SA0 A;  3OBW A;  4IIJ B;  1ZWZ A;  2ZVZ A;  3VCZ A;  2QA4 F;  1H48 A;  1VQ8 F;  2RHO A;  3ERN A;  4EI8 A;  4C8E A;  5HXZ A;  1XRG A;  4NUT A;  3N2G B;  3O85 A;  2W8B C;  1JN1 A;  1Q7Y H;  2BO1 A;  3I7T A;  4G4V A;  1QU9 A;  2VGM A;  1VQ4 F;  3IKF A;  5HXU A;  4DXD A;  1J7H A;  2BTQ B;  3I55 F;  1M90 H;  5KX5 B;  2EWC A;  5J2U A;  3LWP C;  4O4J B;  3IR9 A;  4G4X A;  1H7M A;  3Q8H A;  3LWQ C;  4I4T A;  3NMU C;  2RHJ A;  3ON1 A;  1COM A;  1K73 H;  3VMF B;  2AIZ P;  4RQO A;  3WPX A;  3RYF A;  5EO3 A;  1YJ9 F;  3CXC F;  3HKD B;  4ZK7 A;  3F0G A;  1W41 A;  3LWO C;  2HS4 A;  4BVT A;  3S06 A;  3JAR A;  5FNV A;  2UZH A;  3V7Q A;  3CCJ F;  2BTU A;  4ZOL A;  2R6R 1;  4DRX B;  2H6L A;  3CCS F;  1FNJ A;  4IHJ B;  1SDS A;  3JAS B;  2HS0 A;  5EIB C;  3QUW A;  3JAK A;  2YYE A;  3P0Z A;  3ELC A;  3CCL F;  1KNJ A;  5FLX M;  1QD9 A;  4X1Y A;  4LNU A;  5J2T B;  5IYZ B;  2VAM A;  1U40 A;  2ZAU A;  3TD4 A;  2HP0 A;  3QHD A;  1Z5W A;  3JAS A;  5IJ9 A;  3U0O A;  3WXM B;  1E7K A;  3FD5 A;  1VQM F;  1RQ7 A;  5JVD B;  4DRX A;  4ZHV A;  5EYP B;  5LYJ B;  4TV9 A;  3VOB A;  4C81 A;  1VQ5 F;  2KGW A;  1KD1 H;  3CD6 F;  4X1K B;  3CCE F;  1U3L A;  2GZL A;  1KNK A;  1DT9 A;  3NK7 A;  2HX0 A;  1PF5 A;  3RYF B;  2OTJ F;  3K2X A;  3E22 B;  3RYH B;  1JY8 A;  5EB0 A;  3UT5 A;  1K8A H;  5CA0 B;  3N2K A;  3D00 A;  4F6R A;  3WJP A;  3HKE A;  2G9I A;  5EWR A;  1Z5V A;  3C9U A;  1W5E A;  4ZOL B;  4O4L B;  3VI6 A;  2ZVY A;  2PHN A;  2ZOV A;  5CB4 B;  3CC4 F;  3CB2 A;  4TV8 B;  3F6M A;  4I50 A;  3CCV F;  4ZHW A;  2Z1F A;  2H8E A;  4C8I A;  1W2B F;  3CCM F;  4O4J A;  5GIO C;  2H8C A;  3E1Y A;  4EI9 A;  4FFB B;  1VQ6 F;  2DYY A;  2OTL F;  3C9R A;  5JQG B;  2Z1T A;  2OHW A;  4B62 A;  3BYQ A;  2CZW A;  4TV8 A;  5JVD A;  3CCU F;  3S02 A;  1DBF A;  5EB1 B;  2YXZ A;  1JJ2 F;  3JAM M;  3WGM A;  4X3M A;  1JFF A;  3MBM A;  3ZP4 A;  1GO0 A;  5JH7 A;  4WBN A;  5LA6 B;  2Q1X A;  1YIT F;  4FFB A;  3AGK A;  4O2A A;  2MQE A;  3CG6 A;  5EAZ A;  4X1I B;  1XHO A;  1KQS F;  2HS3 A;  5EZY A;  2CWJ A;  3VOA A;  1TVK A;  1OFU A;  2HP3 A;  3M1X A;  3LFO A;  1YQN A;  1UFY A;  2LBX A;  2UYP A;  2ALE A;  2UYN B;  2VXY A;  2HRU A;  1NMU B;  1RLG A;  5LOV A;  2CHS A;  2UYK A;  1Q86 H;  4O4I A;  1W5A A;  5GAP K;  5JCO C;  3N2K B;  1W58 1;  3UT5 B;  4BW0 B;  4BT2 A;  2RHL A;  5CA1 A;  4B5C A;  4O4I B;  2LCA A;  3JAT A;  1X52 A;  2N48 A;  5HWE A;  5LP6 C;  1FSZ A;  1YI2 F;  3CCR F;  3D01 A;  3M4S A;  1W57 A;  1YJW F;  3FBA A;  2OZB A;  3GTZ A;  1JD1 A;  2QTP A;  3CPQ A;  1PXW A;  3HWU A;  2NMU A;  1M1K H;  1VK3 A;  1TVK B;  1W5B A;  3JVH A;  1SA0 B;  4BT6 A;  2B33 A;  2Z1E A;  1QVG F;  2I6D A;  3MCA B;  3JAK B;  4I55 B;  1VQO F;  4YJ3 B;  4EB6 B;  2KTV A;  1RA4 A;  4M8I A;  4HNA B;  3N4Y A;  4E6E A;  3DC2 A;  3ESJ A;  2HVY D;  4BT7 A;  5IJ9 B;  4BT5 A;  3K0T A;  2RB9 A;  3SIU A;  5CA1 B;  4O4L A;  2LBT A;  5C8Y B;  3IEQ A;  4X1I A;  3VO8 A;  3CME F;  3IEW A;  3LDT A;  1U3P A;  1N8R H;  5BMV B;  2CVL A;  3E20 B;  3P4E A;  3I56 F;  4X1K A;  3VIU A;  3J81 M;  4ZI7 B;  2UYN A;  1VQV A;  4ERH A;  1H47 A;  3NVI B;  4ZHQ A;  3N2G A;  2PMP A;  3JAR B;  5FNV B;  4O2B A;  2I6R A;  2KTU A;  3J7A R;  3D54 A;  3F0E A;  1VQ9 F;  5AVM A;  2P6Y A;  3WJQ A;  5FJ4 C;  3G6E F;  3L7Q A;  5IYZ A;  4YJ3 A;  5BMV A;  2F9Z C;  1TUB A;  3DDN A;  2KG4 A;  5HY0 A;  3JAW A;  2WAL A;  2L26 A;  3VYT C;  5JH7 B;  3S0Y A;  2HQS C;  3M84 A;  4X3L A;  3ZP7 A;  4HNA A;  3C8L A;  3MQW A;  2Z01 A;  1W3E X;  3HKB A;  3VYU C;  5JQG A;  1U43 A;  3PLA C;  5JCO A;  4KWE A;  3OBY A;  5CA0 A;  4F6R B;  3NVK E;  3P10 A;  1IV3 A;  3OW2 F;  4X1Y B;  4R40 B;  2K1S A;  2LBW A;  5J2T A;  5ITZ B;  4RHA A; 
#chains in the Genus database with same CATH homology
 4C4W C;  1X52 A;  5HWE A;  4BVS A;  1YI2 F;  3CCR F;  3WXM B;  1E7K A;  4LCK A;  1VQM F;  5HY1 A;  3V3T A;  1VQ5 F;  5A2Q M;  2QEX F;  1YJW F;  1KD1 H;  3CD6 F;  3CCE F;  2OZB A;  3LWR C;  3CPQ A;  1PXW A;  3FFM A;  5DCV A;  1XBI A;  3RA6 A;  1DT9 A;  4BY9 D;  4XCQ A;  3NK7 A;  1M1K H;  3V7E A;  5G4U C;  3HAX D;  2OTJ F;  3NK6 A;  1W42 A;  3N4Z A;  1QVG F;  3G4S F;  1VQ7 F;  1IPA A;  1K8A H;  1VQK F;  2I6D A;  3SIV A;  1VQL F;  3D00 A;  3MCA B;  1CK2 A;  5EWR A;  3J80 M;  3CMA F;  1YIJ F;  1VQO F;  5G4V C;  1CN7 A;  3CCQ F;  3VI6 A;  2QI2 A;  1T0K B;  3G71 F;  2KTV A;  1GZ0 A;  1RA4 A;  3N4Y A;  2HVY D;  1W40 A;  3CC4 F;  2FGY A;  1VQN F;  2FC3 A;  3CPW F;  2VGN A;  3LWV C;  3SIU A;  5GIN C;  3CCV F;  4EI7 A;  1W2B F;  1QVF F;  1YJN F;  3CCM F;  1X7P A;  1KC8 H;  4NQ3 A;  3JCM M;  2AIF A;  3GYQ A;  3CME F;  5GIO C;  4EI9 A;  3E1Y A;  1N8R H;  1VQ6 F;  3E20 B;  2OTL F;  3OBW A;  3I56 F;  1ZWZ A;  2OHW A;  3J81 M;  2QA4 F;  3PAF A;  1VQ8 F;  2CZW A;  5HY2 A;  4EI8 A;  5HXZ A;  3CCU F;  4NUT A;  3NVI B;  3O85 A;  1JJ2 F;  1Q7Y H;  2JNB A;  2KTU A;  3J7A R;  2BO1 A;  3JAM M;  2GLZ A;  2VGM A;  1YHQ F;  4X3M A;  1VQ4 F;  1VQ9 F;  5FJ4 C;  3RA5 A;  5HXU A;  1Q82 H;  1GO0 A;  3G6E F;  1YIT F;  3I55 F;  1M90 H;  3AGK A;  3LWP C;  1S72 F;  2F9Z C;  3CG6 A;  2KG4 A;  5HY0 A;  3IR9 A;  1KQS F;  4BVQ A;  1H7M A;  3LWQ C;  2WAL A;  4TZZ A;  3NMU C;  3ON1 A;  1K73 H;  3VMF B;  1GO1 A;  4BVR A;  5IT9 M;  1K9M H;  5EO3 A;  1YJ9 F;  3CXC F;  3CC7 F;  4X3L A;  1W41 A;  5GAN K;  1NJI H;  3LFO A;  3LWO C;  4BVT A;  5HY4 A;  2LBX A;  3CCJ F;  3V7Q A;  2ALE A;  3CC2 F;  3CCS F;  1W3E X;  1NMU B;  1RLG A;  1X7O A;  1Q86 H;  3PLA C;  1SDS A;  3OBY A;  5GAP K;  3CCL F;  5GIP C;  1Q81 H;  3NVK E;  5FLX M;  1VQP F;  3OW2 F;  4BW0 B;  3HJW C;  2LBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...