1CK2A

Yeast (saccharomyces cerevisiae) ribosomal protein l30
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
104
structure length
104
Chain Sequence
APVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Local folding coupled to RNA binding in the yeast ribosomal protein L30
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 60S RIBOSOMAL PROTEIN L30
total genus 43
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 1999-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1ck2A00
1K8AH 3E1YA 1ZWZA 2KTVA 2VGNA 3RA5A 3CC7F 3I56F 1Q81H 3O85A 2I6DA 1JJ2F 1X7OA 1PXWA 3CXCF 3I55F 3LWPC 5DCVA 1W40A 2JNBA 5GANK 3CCLF 3LWVC 3CCSF 3J7AR 3WXMB 1CN7A 3G6EF 4BY9D 3CCQF 2FC3A 1NMUB 2KG4A 2CZWA 1DT9A 5GAPK 5GINC 1VQPF 2ALEA 3LFOA 5G4UC 3NMUC 2AIFA 3CC4F 3CMEF 3CCEF 3IR9A 1YJNF 3V7QA 3J80M 1RLGA 3HJWC 3OW2F 1X52A 3E20B 3PLAC 3NVKE 3N4YA 4TZZA 1T0KB 3CCRF 3G71F 3CD6F 2LBXA 1W42A 5A2QM 2KTUA 3G4SF 1YJWF 5GIPC 1YI2F 1QVGF 3CPQA 1K9MH 1M1KH 1YITF 1KD1H 4X3MA 1GZ0A 1QVFF 1M90H 2HVYD 1VQOF 1Q7YH 3J81M 2OZBA 3CC2F 2QI2A 1XBIA 1CK2A 1K73H 3JCMM 1VQMF 3NVIB 1VQ6F 2BO1A 3SIUA 3FFMA 3NK7A 3JAMM 4X3LA 1IPAA 3VMFB 1H7MA 1VQ8F 3CMAF 1YJ9F 2OHWA 3RA6A 4NUTA 1NJIH 3MCAB 1W2BF 5GIOC 5EWRA 5IT9M 3AGKA 1Q82H 2OTLF 1X7PA 3LWQC 3OBWA 2QEXF 3LWOC 1YHQF 3N4ZA 3NK6A 4BW0B 3VI6A 3ON1A 1VQ9F 3CCUF 1N8RH 3GYQA 1VQ5F 2QA4F 3CPWF 1KC8H 2LBWA 1VQ4F 1YIJF 1S72F 5EO3A 1VQNF 1W3EX 1W41A 4C4WC 1GO1A 3OBYA 1VQ7F 3V7EA 5FLXM 1RA4A 5G4VC 1E7KA 1VQKF 1GO0A 3SIVA 3CG6A 1KQSF 2WALA 1SDSA 3PAFA 3HAXD 2VGMA 1VQLF 3CCJF 5FJ4C 3LWRC 2OTJF 4LCKA 1Q86H 3CCVF 3CCMF
chains in the Genus database with same CATH superfamily
3E1YA 2KTVA 2R6R1 5KX5B 1ODEA 3V4DA 1Q81H 1PXWA 3UT5A 5DCVA 5GANK 2MQEA 5EIBC 1CN7A 3MBMA 4EI7A 3G6EF 3RYHA 3F0GA 4DXDA 1VK3A 2NMUA 1NQ3A 1PF5A 5JQGB 3M1XA 5G4UC 5LP6C 3Q8HA 1W581 1VHAA 3KJJA 2CVLA 4F6RB 5CB4B 4BVSA 4NQ3A 1X52A 3OONA 3C8LA 4TZZA 1T0KB 2R751 4U39A 2KTUA 3G4SF 1TUBA 4C8EA 1QVGF 1IV3A 4XCQA 3TD5A 2VAWA 5MN6A 1KD1H 2F9ZC 1UI9A 4I4TA 5EAZA 1VQOF 5LYJA 3S06A 5JVDB 3ZO8A 3T80A 5IJ0A 5LOVB 1XBIA 5KMGB 3FBAA 1JD1A 4BT5A 4B46A 3GHZA 1IPAA 4YJ2B 3WJRA 3C9RA 3HKEB 3DC2A 4LNUA 4BVQA 1YJ9F 4B62A 3C9UA 2P6YA 4NUTA 1COMA 1NJIH 3CYQA 4FFBB 1FFXA 1Q8RA 3AGKA 2DYYA 3C9TA 1X7PA 1FSZA 3JASA 3ON1A 3KE1A 1VQ5F 1JFFA 2VAMA 3F0DA 5EZYB 1KC8H 1YQNA 4PWTA 2KGWA 1YIJF 3RE3A 5IJ0B 1W5AA 3ERNA 5EB0A 5EZYA 5LYJB 1IV1A 4G88A 5LOVA 5FLXM 5G4VC 2PHNA 1GO0A 3VYUC 4TV8B 3JAWA 1SDSA 3PAFA 1VQLF 4C8GA 5FJ4C 4X20B 3JAWB 3LWRC 2HRYA 4LCKA 3HKDA 3N2GA 3VTIC 3VO8A 3RYCA 3E22A 5JQGA 2UYNA 1QAHA 4LNUB 5CA0A 4F6RA 2IQQA 4B45A 1JJ2F 4TUYB 4O2BB 3LWPC 5MN4A 3LWVC 3CCSF 4M8IA 3WXMB 3J7AR 4BY9D 1QU9A 3IMPA 2AIZP 2FC3A 1NMUB 1W55A 1SZQA 5GAPK 4RQOA 3U0OA 2RHOA 2ALEA 2YYEA 5J2TA 3TD4A 2AIFA 3CC4F 3CMEF 3CCEF 3IR9A 1YJNF 5FNVB 1U3PA 3J80M 1RLGA 3HJWC 3OW2F 4ZHYB 4B5CA 3S02A 3M4SA 3P4EA 2W8BC 4X1KA 2UYJA 4O4LA 3G71F 3CD6F 5HY0A 1YJWF 4YJ2A 3CPQA 1K9MH 1M1KH 3RYFA 1QVFF 2HVYD 2H6LA 2HP3A 4HNAA 1R1MA 3HKBA 3HKCB 1Q7YH 5CA0B 3RYFB 1FFXB 3VYSC 3S03A 2HQSC 2N48A 3ZP4A 4I55B 3I7TA 3CC2F 4I50A 5IJ9B 5LA6B 3JALB 3JASB 1CLIA 2ZODA 3S0HA 5ITZB 1VQMF 3JALA 4O4JB 3NVIB 1JN1A 3SIUA 5J2UA 3FFMA 3JAMM 1FNKA 2CHTA 3VMFB 1H7MA 1VQ8F 1TVKB 4O2AB 5MN5A 2OHWA 3RA6A 1RLUA 2BTUA 1OAPA 5EWRA 1Q82H 2OTLF 2G9IA 2ZVYA 3WPXA 3EORA 3S0YA 3LWOC 3JAKB 3NK6A 1GX1A 2OTMA 3GTZA 4BW0B 4X1KB 1N8RH 2Q1YA 3UT5B 3ELCA 3E22B 4ZI7A 3D01A 2LBWA 1W3EX 2L26A 3LYBA 4DRXA 1GO1A 4IHJA 1VQ7F 2H8CA 4FFBA 4O4JA 1OFUA 4ZHVA 1FNJA 3SIVA 2IAFA 3IEWA 1ONIA 2VGMA 4EB6A 5B8FA 2OTJF 4TV9B 3CCVF 1JY8A 1K8AH 1JFFB 1RQ7A 2VGNA 4G4YA 5IYZA 4O4HA 3I3FA 3RA5A 2CSLA 2HX0A 2ZF8A 1J7HA 1XRGA 3MDOA 2VAPA 4EI9A 2CWJA 3MCQA 1X7OA 3CXCF 1W40A 1H47A 3WGJA 3CCLF 4C82A 1U43A 5HP8A 4ZHWA 3C9SA 5JCOA 2BTQB 3LMEA 2Z01A 2KG4A 4G4ZA 2CZWA 3P0ZA 4G4WA 5JCOC 3D00A 3S0WA 3LFOA 3WGKA 4U3JB 2Z1EA 5C8YA 3HKEA 3V7QA 4G4XA 3VYTC 5CB4A 3E20B 5GONB 4X1IB 3JARB 3PLAC 3N4YA 3NVKE 1Z5VA 2HP0B 5IYZB 3JARA 2LBXA 4O4HB 5A2QM 3ZOPA 5GIPC 1YI2F 2HS0A 4I4TB 2VXYA 1W57A 5JH7A 4EI8A 1YITF 1TUBB 4X3MA 5HY4A 2RHJA 3MQWA 4O2AA 3V3TA 2B33A 4BT3A 2Z1TA 1W5BA 3K2XA 4RHAA 3WGMA 1QD9A 3ESJA 3WGNA 2RB9A 4X20A 3JCMM 2GVIA 5KMGA 2IG8A 4WBNB 1VQ6F 2BO1A 4TV8A 5HXZA 5LXTB 5LP6A 4X3LA 3CB2A 3LDTA 3F0EA 2EWCA 3TD3A 2RHLA 2Q1XA 4X1IA 3HKCA 3HKBB 4E6EA 4KWEA 3MCAB 5IT9M 3VOAA 3N2KA 5EB1B 5CA1B 3OBWA 2QEXF 1YGYA 4ZOLA 4EB6B 5HP7A 3VI6A 4BT2A 3CCUF 3GYQA 4ERHA 4BT4A 2QA4F 1X25A 1U3LA 1XV2A 5HY1A 2RHHA 4C8IA 3K12A 2LBTA 3OBYA 3V7EA 2I6RA 1DBFA 1RA4A 1E7KA 3F0FA 2QTPA 3HAXD 1H48A 3RYHB 3CCJF 3K14A 1KNJA 1UFYA 3D54A 3FD5A 3JAKA 2HS4A 1XHOA 4G4VA 4WBNA 1Q86H 3KIZA 5LXTA 1ZWZA 1U40A 3WPWA 3IKFA 4U3JA 5HXUA 3JATB 4YJ3A 2UYNB 3R0PA 3CC7F 2CHSA 3I56F 3O85A 2I6DA 3VCZA 3KHNA 2HRUA 3I55F 2JNBA 2ZAUA 2Z1UA 2GZLA 1T0AA 2ZOVA 3CCQF 5HWEA 1VQVA 5IJ9A 5J2TB 5JH7B 1DT9A 3F6MA 5HY2A 3QUWA 5GINC 1VQPF 5ITZA 4C81A 3NMUC 5JVDA 3K0TA 3HTNA 2V9YA 1IV2A 4IIJA 3IKEA 4BVRA 4ZHQA 3WJPA 3BYQA 2UZHA 4O4LB 2PMPA 3L7QA 4ZHQB 5EIBD 3QHDA 3CCRF 1W42A 3WGLA 5LP6B 3FPIA 2YXZA 3HKDB 2UYPA 3RYCB 3P10A 4BT7A 1GZ0A 1M90H 1SA0A 4DRXB 2Z1FA 2DT4A 4NWOB 3J81M 3JVHA 1W59A 4I55A 4ZI7B 4I50B 5LA6A 3N2KB 2OZBA 5CA1A 4BVTA 2QI2A 4ZOLB 1CK2A 3RYIA 3DDNA 2UYKA 4O4IA 4X1YA 1K73H 2HP0A 4TV9A 5BMVA 2AMTA 2CW4A 3CYPB 3NK7A 4IIJB 3KJKA 2FGYA 2H8EA 1IV4A 3FD6A 1W5EA 3CMAF 4ZK7A 1TVKA 5EYPB 1W2BF 5KX5A 5FNVA 5GIOC 1RQ2A 2HS3A 5EYPA 3LWQC 5AVMA 1YHQF 3N4ZA 1VQ9F 1SA0B 3N2GB 1KNKA 3CPWF 4R40B 1VH8A 2ZVZA 3QTYA 1VQ4F 2LCAA 4IHJB 1S72F 5EO3A 3JATA 4YJ3B 1VQNF 1W41A 4C4WC 4HNAB 3B6NA 3M84A 3VIUA 1W5FA 4TUYA 3WJQA 2GLZA 4O2BA 5GONA 1VQKF 5BMVB 1Z5WA 3CG6A 1KQSF 2WALA 5C8YB 3IEQA 4BT6A 3HWUA 3RYIB 4O4IB 4X1YB 2BTOA 3ZP7A 2K1SA 5J2UB 3VOBA 3CCMF
chains in the Genus database with same CATH topology
1K8AH 3E1YA 1ZWZA 2KTVA 2VGNA 3RA5A 5HXUA 4EI9A 3CC7F 3I56F 1Q81H 3O85A 2I6DA 1JJ2F 1X7OA 1PXWA 3CXCF 3I55F 3LWPC 5DCVA 1W40A 2JNBA 5GANK 3CCLF 3LWVC 4EI7A 3CCSF 3WXMB 3J7AR 3G6EF 4BY9D 1CN7A 3CCQF 5HWEA 2FC3A 1NMUB 2KG4A 2CZWA 1DT9A 5GAPK 5HY2A 3D00A 5GINC 1VQPF 2ALEA 3LFOA 5G4UC 3NMUC 2AIFA 3CC4F 3CMEF 3CCEF 3IR9A 4BVRA 4BVSA 1YJNF 3V7QA 4NQ3A 3J80M 1RLGA 3HJWC 3OW2F 1X52A 3E20B 3PLAC 3NVKE 3N4YA 4TZZA 1T0KB 3CCRF 3G71F 3CD6F 2LBXA 1W42A 5A2QM 2KTUA 3G4SF 5HY0A 5GIPC 1YJWF 1YI2F 1QVGF 3CPQA 4XCQA 1K9MH 4EI8A 1M1KH 1YITF 1KD1H 2F9ZC 4X3MA 1GZ0A 5HY4A 1QVFF 1M90H 2HVYD 1VQOF 3V3TA 1Q7YH 3J81M 2OZBA 3CC2F 4BVTA 2QI2A 1XBIA 1CK2A 1K73H 3JCMM 1VQMF 3NVIB 1VQ6F 2BO1A 5HXZA 3SIUA 3FFMA 3NK7A 3JAMM 4X3LA 1IPAA 3VMFB 2FGYA 1H7MA 1VQ8F 4BVQA 3CMAF 1YJ9F 2OHWA 3RA6A 4NUTA 1NJIH 3MCAB 1W2BF 5GIOC 5EWRA 5IT9M 3AGKA 1Q82H 2OTLF 1X7PA 3LWQC 3OBWA 2QEXF 3LWOC 1YHQF 3N4ZA 3NK6A 4BW0B 3VI6A 3ON1A 1VQ9F 3CCUF 1N8RH 3GYQA 1VQ5F 2QA4F 3CPWF 1KC8H 2LBWA 5HY1A 1YIJF 1VQ4F 1S72F 5EO3A 1VQNF 1W3EX 1W41A 4C4WC 1GO1A 3OBYA 1VQ7F 3V7EA 2GLZA 5FLXM 1RA4A 5G4VC 1E7KA 1VQKF 1GO0A 3SIVA 3CG6A 1KQSF 2WALA 1SDSA 3PAFA 3HAXD 2VGMA 1VQLF 3CCJF 5FJ4C 3LWRC 2OTJF 4LCKA 1Q86H 3CCVF 3CCMF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A H;  3E1Y A;  1ZWZ A;  2KTV A;  2VGN A;  3RA5 A;  3CC7 F;  3I56 F;  1Q81 H;  3O85 A;  2I6D A;  1JJ2 F;  1X7O A;  1PXW A;  3CXC F;  3I55 F;  3LWP C;  5DCV A;  1W40 A;  2JNB A;  5GAN K;  3CCL F;  3LWV C;  3CCS F;  3J7A R;  3WXM B;  1CN7 A;  3G6E F;  4BY9 D;  3CCQ F;  2FC3 A;  1NMU B;  2KG4 A;  2CZW A;  1DT9 A;  5GAP K;  5GIN C;  1VQP F;  2ALE A;  3LFO A;  5G4U C;  3NMU C;  2AIF A;  3CC4 F;  3CME F;  3CCE F;  3IR9 A;  1YJN F;  3V7Q A;  3J80 M;  1RLG A;  3HJW C;  3OW2 F;  1X52 A;  3E20 B;  3PLA C;  3NVK E;  3N4Y A;  4TZZ A;  1T0K B;  3CCR F;  3G71 F;  3CD6 F;  2LBX A;  1W42 A;  5A2Q M;  2KTU A;  3G4S F;  1YJW F;  5GIP C;  1YI2 F;  1QVG F;  3CPQ A;  1K9M H;  1M1K H;  1YIT F;  1KD1 H;  4X3M A;  1GZ0 A;  1QVF F;  1M90 H;  2HVY D;  1VQO F;  1Q7Y H;  3J81 M;  2OZB A;  3CC2 F;  2QI2 A;  1XBI A;  1CK2 A;  1K73 H;  3JCM M;  1VQM F;  3NVI B;  1VQ6 F;  2BO1 A;  3SIU A;  3FFM A;  3NK7 A;  3JAM M;  4X3L A;  1IPA A;  3VMF B;  1H7M A;  1VQ8 F;  3CMA F;  1YJ9 F;  2OHW A;  3RA6 A;  4NUT A;  1NJI H;  3MCA B;  1W2B F;  5GIO C;  5EWR A;  5IT9 M;  3AGK A;  1Q82 H;  2OTL F;  1X7P A;  3LWQ C;  3OBW A;  2QEX F;  3LWO C;  1YHQ F;  3N4Z A;  3NK6 A;  4BW0 B;  3VI6 A;  3ON1 A;  1VQ9 F;  3CCU F;  1N8R H;  3GYQ A;  1VQ5 F;  2QA4 F;  3CPW F;  1KC8 H;  2LBW A;  1VQ4 F;  1YIJ F;  1S72 F;  5EO3 A;  1VQN F;  1W3E X;  1W41 A;  4C4W C;  1GO1 A;  3OBY A;  1VQ7 F;  3V7E A;  5FLX M;  1RA4 A;  5G4V C;  1E7K A;  1VQK F;  1GO0 A;  3SIV A;  3CG6 A;  1KQS F;  2WAL A;  1SDS A;  3PAF A;  3HAX D;  2VGM A;  1VQL F;  3CCJ F;  5FJ4 C;  3LWR C;  2OTJ F;  4LCK A;  1Q86 H;  3CCV F;  3CCM F; 
#chains in the Genus database with same CATH topology
 3E1Y A;  2KTV A;  2R6R 1;  5KX5 B;  1ODE A;  3V4D A;  1Q81 H;  1PXW A;  3UT5 A;  5DCV A;  5GAN K;  2MQE A;  5EIB C;  1CN7 A;  3MBM A;  4EI7 A;  3G6E F;  3RYH A;  3F0G A;  4DXD A;  1VK3 A;  2NMU A;  1NQ3 A;  1PF5 A;  5JQG B;  3M1X A;  5G4U C;  5LP6 C;  3Q8H A;  1W58 1;  1VHA A;  3KJJ A;  2CVL A;  4F6R B;  5CB4 B;  4BVS A;  4NQ3 A;  1X52 A;  3OON A;  3C8L A;  4TZZ A;  1T0K B;  2R75 1;  4U39 A;  2KTU A;  3G4S F;  1TUB A;  4C8E A;  1QVG F;  1IV3 A;  4XCQ A;  3TD5 A;  2VAW A;  5MN6 A;  1KD1 H;  2F9Z C;  1UI9 A;  4I4T A;  5EAZ A;  1VQO F;  5LYJ A;  3S06 A;  5JVD B;  3ZO8 A;  3T80 A;  5IJ0 A;  5LOV B;  1XBI A;  5KMG B;  3FBA A;  1JD1 A;  4BT5 A;  4B46 A;  3GHZ A;  1IPA A;  4YJ2 B;  3WJR A;  3C9R A;  3HKE B;  3DC2 A;  4LNU A;  4BVQ A;  1YJ9 F;  4B62 A;  3C9U A;  2P6Y A;  4NUT A;  1COM A;  1NJI H;  3CYQ A;  4FFB B;  1FFX A;  1Q8R A;  3AGK A;  2DYY A;  3C9T A;  1X7P A;  1FSZ A;  3JAS A;  3ON1 A;  3KE1 A;  1VQ5 F;  1JFF A;  2VAM A;  3F0D A;  5EZY B;  1KC8 H;  1YQN A;  4PWT A;  2KGW A;  1YIJ F;  3RE3 A;  5IJ0 B;  1W5A A;  3ERN A;  5EB0 A;  5EZY A;  5LYJ B;  1IV1 A;  4G88 A;  5LOV A;  5FLX M;  5G4V C;  2PHN A;  1GO0 A;  3VYU C;  4TV8 B;  3JAW A;  1SDS A;  3PAF A;  1VQL F;  4C8G A;  5FJ4 C;  4X20 B;  3JAW B;  3LWR C;  2HRY A;  4LCK A;  3HKD A;  3N2G A;  3VTI C;  3VO8 A;  3RYC A;  3E22 A;  5JQG A;  2UYN A;  1QAH A;  4LNU B;  5CA0 A;  4F6R A;  2IQQ A;  4B45 A;  1JJ2 F;  4TUY B;  4O2B B;  3LWP C;  5MN4 A;  3LWV C;  3CCS F;  4M8I A;  3WXM B;  3J7A R;  4BY9 D;  1QU9 A;  3IMP A;  2AIZ P;  2FC3 A;  1NMU B;  1W55 A;  1SZQ A;  5GAP K;  4RQO A;  3U0O A;  2RHO A;  2ALE A;  2YYE A;  5J2T A;  3TD4 A;  2AIF A;  3CC4 F;  3CME F;  3CCE F;  3IR9 A;  1YJN F;  5FNV B;  1U3P A;  3J80 M;  1RLG A;  3HJW C;  3OW2 F;  4ZHY B;  4B5C A;  3S02 A;  3M4S A;  3P4E A;  2W8B C;  4X1K A;  2UYJ A;  4O4L A;  3G71 F;  3CD6 F;  5HY0 A;  1YJW F;  4YJ2 A;  3CPQ A;  1K9M H;  1M1K H;  3RYF A;  1QVF F;  2HVY D;  2H6L A;  2HP3 A;  4HNA A;  1R1M A;  3HKB A;  3HKC B;  1Q7Y H;  5CA0 B;  3RYF B;  1FFX B;  3VYS C;  3S03 A;  2HQS C;  2N48 A;  3ZP4 A;  4I55 B;  3I7T A;  3CC2 F;  4I50 A;  5IJ9 B;  5LA6 B;  3JAL B;  3JAS B;  1CLI A;  2ZOD A;  3S0H A;  5ITZ B;  1VQM F;  3JAL A;  4O4J B;  3NVI B;  1JN1 A;  3SIU A;  5J2U A;  3FFM A;  3JAM M;  1FNK A;  2CHT A;  3VMF B;  1H7M A;  1VQ8 F;  1TVK B;  4O2A B;  5MN5 A;  2OHW A;  3RA6 A;  1RLU A;  2BTU A;  1OAP A;  5EWR A;  1Q82 H;  2OTL F;  2G9I A;  2ZVY A;  3WPX A;  3EOR A;  3S0Y A;  3LWO C;  3JAK B;  3NK6 A;  1GX1 A;  2OTM A;  3GTZ A;  4BW0 B;  4X1K B;  1N8R H;  2Q1Y A;  3UT5 B;  3ELC A;  3E22 B;  4ZI7 A;  3D01 A;  2LBW A;  1W3E X;  2L26 A;  3LYB A;  4DRX A;  1GO1 A;  4IHJ A;  1VQ7 F;  2H8C A;  4FFB A;  4O4J A;  1OFU A;  4ZHV A;  1FNJ A;  3SIV A;  2IAF A;  3IEW A;  1ONI A;  2VGM A;  4EB6 A;  5B8F A;  2OTJ F;  4TV9 B;  3CCV F;  1JY8 A;  1K8A H;  1JFF B;  1RQ7 A;  2VGN A;  4G4Y A;  5IYZ A;  4O4H A;  3I3F A;  3RA5 A;  2CSL A;  2HX0 A;  2ZF8 A;  1J7H A;  1XRG A;  3MDO A;  2VAP A;  4EI9 A;  2CWJ A;  3MCQ A;  1X7O A;  3CXC F;  1W40 A;  1H47 A;  3WGJ A;  3CCL F;  4C82 A;  1U43 A;  5HP8 A;  4ZHW A;  3C9S A;  5JCO A;  2BTQ B;  3LME A;  2Z01 A;  2KG4 A;  4G4Z A;  2CZW A;  3P0Z A;  4G4W A;  5JCO C;  3D00 A;  3S0W A;  3LFO A;  3WGK A;  4U3J B;  2Z1E A;  5C8Y A;  3HKE A;  3V7Q A;  4G4X A;  3VYT C;  5CB4 A;  3E20 B;  5GON B;  4X1I B;  3JAR B;  3PLA C;  3N4Y A;  3NVK E;  1Z5V A;  2HP0 B;  5IYZ B;  3JAR A;  2LBX A;  4O4H B;  5A2Q M;  3ZOP A;  5GIP C;  1YI2 F;  2HS0 A;  4I4T B;  2VXY A;  1W57 A;  5JH7 A;  4EI8 A;  1YIT F;  1TUB B;  4X3M A;  5HY4 A;  2RHJ A;  3MQW A;  4O2A A;  3V3T A;  2B33 A;  4BT3 A;  2Z1T A;  1W5B A;  3K2X A;  4RHA A;  3WGM A;  1QD9 A;  3ESJ A;  3WGN A;  2RB9 A;  4X20 A;  3JCM M;  2GVI A;  5KMG A;  2IG8 A;  4WBN B;  1VQ6 F;  2BO1 A;  4TV8 A;  5HXZ A;  5LXT B;  5LP6 A;  4X3L A;  3CB2 A;  3LDT A;  3F0E A;  2EWC A;  3TD3 A;  2RHL A;  2Q1X A;  4X1I A;  3HKC A;  3HKB B;  4E6E A;  4KWE A;  3MCA B;  5IT9 M;  3VOA A;  3N2K A;  5EB1 B;  5CA1 B;  3OBW A;  2QEX F;  1YGY A;  4ZOL A;  4EB6 B;  5HP7 A;  3VI6 A;  4BT2 A;  3CCU F;  3GYQ A;  4ERH A;  4BT4 A;  2QA4 F;  1X25 A;  1U3L A;  1XV2 A;  5HY1 A;  2RHH A;  4C8I A;  3K12 A;  2LBT A;  3OBY A;  3V7E A;  2I6R A;  1DBF A;  1RA4 A;  1E7K A;  3F0F A;  2QTP A;  3HAX D;  1H48 A;  3RYH B;  3CCJ F;  3K14 A;  1KNJ A;  1UFY A;  3D54 A;  3FD5 A;  3JAK A;  2HS4 A;  1XHO A;  4G4V A;  4WBN A;  1Q86 H;  3KIZ A;  5LXT A;  1ZWZ A;  1U40 A;  3WPW A;  3IKF A;  4U3J A;  5HXU A;  3JAT B;  4YJ3 A;  2UYN B;  3R0P A;  3CC7 F;  2CHS A;  3I56 F;  3O85 A;  2I6D A;  3VCZ A;  3KHN A;  2HRU A;  3I55 F;  2JNB A;  2ZAU A;  2Z1U A;  2GZL A;  1T0A A;  2ZOV A;  3CCQ F;  5HWE A;  1VQV A;  5IJ9 A;  5J2T B;  5JH7 B;  1DT9 A;  3F6M A;  5HY2 A;  3QUW A;  5GIN C;  1VQP F;  5ITZ A;  4C81 A;  3NMU C;  5JVD A;  3K0T A;  3HTN A;  2V9Y A;  1IV2 A;  4IIJ A;  3IKE A;  4BVR A;  4ZHQ A;  3WJP A;  3BYQ A;  2UZH A;  4O4L B;  2PMP A;  3L7Q A;  4ZHQ B;  5EIB D;  3QHD A;  3CCR F;  1W42 A;  3WGL A;  5LP6 B;  3FPI A;  2YXZ A;  3HKD B;  2UYP A;  3RYC B;  3P10 A;  4BT7 A;  1GZ0 A;  1M90 H;  1SA0 A;  4DRX B;  2Z1F A;  2DT4 A;  4NWO B;  3J81 M;  3JVH A;  1W59 A;  4I55 A;  4ZI7 B;  4I50 B;  5LA6 A;  3N2K B;  2OZB A;  5CA1 A;  4BVT A;  2QI2 A;  4ZOL B;  1CK2 A;  3RYI A;  3DDN A;  2UYK A;  4O4I A;  4X1Y A;  1K73 H;  2HP0 A;  4TV9 A;  5BMV A;  2AMT A;  2CW4 A;  3CYP B;  3NK7 A;  4IIJ B;  3KJK A;  2FGY A;  2H8E A;  1IV4 A;  3FD6 A;  1W5E A;  3CMA F;  4ZK7 A;  1TVK A;  5EYP B;  1W2B F;  5KX5 A;  5FNV A;  5GIO C;  1RQ2 A;  2HS3 A;  5EYP A;  3LWQ C;  5AVM A;  1YHQ F;  3N4Z A;  1VQ9 F;  1SA0 B;  3N2G B;  1KNK A;  3CPW F;  4R40 B;  1VH8 A;  2ZVZ A;  3QTY A;  1VQ4 F;  2LCA A;  4IHJ B;  1S72 F;  5EO3 A;  3JAT A;  4YJ3 B;  1VQN F;  1W41 A;  4C4W C;  4HNA B;  3B6N A;  3M84 A;  3VIU A;  1W5F A;  4TUY A;  3WJQ A;  2GLZ A;  4O2B A;  5GON A;  1VQK F;  5BMV B;  1Z5W A;  3CG6 A;  1KQS F;  2WAL A;  5C8Y B;  3IEQ A;  4BT6 A;  3HWU A;  3RYI B;  4O4I B;  4X1Y B;  2BTO A;  3ZP7 A;  2K1S A;  5J2U B;  3VOB A;  3CCM F; 
#chains in the Genus database with same CATH homology
 1K8A H;  3E1Y A;  1ZWZ A;  2KTV A;  2VGN A;  3RA5 A;  5HXU A;  4EI9 A;  3CC7 F;  3I56 F;  1Q81 H;  3O85 A;  2I6D A;  1JJ2 F;  1X7O A;  1PXW A;  3CXC F;  3I55 F;  3LWP C;  5DCV A;  1W40 A;  2JNB A;  5GAN K;  3CCL F;  3LWV C;  4EI7 A;  3CCS F;  3WXM B;  3J7A R;  3G6E F;  4BY9 D;  1CN7 A;  3CCQ F;  5HWE A;  2FC3 A;  1NMU B;  2KG4 A;  2CZW A;  1DT9 A;  5GAP K;  5HY2 A;  3D00 A;  5GIN C;  1VQP F;  2ALE A;  3LFO A;  5G4U C;  3NMU C;  2AIF A;  3CC4 F;  3CME F;  3CCE F;  3IR9 A;  4BVR A;  4BVS A;  1YJN F;  3V7Q A;  4NQ3 A;  3J80 M;  1RLG A;  3HJW C;  3OW2 F;  1X52 A;  3E20 B;  3PLA C;  3NVK E;  3N4Y A;  4TZZ A;  1T0K B;  3CCR F;  3G71 F;  3CD6 F;  2LBX A;  1W42 A;  5A2Q M;  2KTU A;  3G4S F;  5HY0 A;  5GIP C;  1YJW F;  1YI2 F;  1QVG F;  3CPQ A;  4XCQ A;  1K9M H;  4EI8 A;  1M1K H;  1YIT F;  1KD1 H;  2F9Z C;  4X3M A;  1GZ0 A;  5HY4 A;  1QVF F;  1M90 H;  2HVY D;  1VQO F;  3V3T A;  1Q7Y H;  3J81 M;  2OZB A;  3CC2 F;  4BVT A;  2QI2 A;  1XBI A;  1CK2 A;  1K73 H;  3JCM M;  1VQM F;  3NVI B;  1VQ6 F;  2BO1 A;  5HXZ A;  3SIU A;  3FFM A;  3NK7 A;  3JAM M;  4X3L A;  1IPA A;  3VMF B;  2FGY A;  1H7M A;  1VQ8 F;  4BVQ A;  3CMA F;  1YJ9 F;  2OHW A;  3RA6 A;  4NUT A;  1NJI H;  3MCA B;  1W2B F;  5GIO C;  5EWR A;  5IT9 M;  3AGK A;  1Q82 H;  2OTL F;  1X7P A;  3LWQ C;  3OBW A;  2QEX F;  3LWO C;  1YHQ F;  3N4Z A;  3NK6 A;  4BW0 B;  3VI6 A;  3ON1 A;  1VQ9 F;  3CCU F;  1N8R H;  3GYQ A;  1VQ5 F;  2QA4 F;  3CPW F;  1KC8 H;  2LBW A;  5HY1 A;  1YIJ F;  1VQ4 F;  1S72 F;  5EO3 A;  1VQN F;  1W3E X;  1W41 A;  4C4W C;  1GO1 A;  3OBY A;  1VQ7 F;  3V7E A;  2GLZ A;  5FLX M;  1RA4 A;  5G4V C;  1E7K A;  1VQK F;  1GO0 A;  3SIV A;  3CG6 A;  1KQS F;  2WAL A;  1SDS A;  3PAF A;  3HAX D;  2VGM A;  1VQL F;  3CCJ F;  5FJ4 C;  3LWR C;  2OTJ F;  4LCK A;  1Q86 H;  3CCV F;  3CCM F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...