1CK2A

Yeast (saccharomyces cerevisiae) ribosomal protein l30
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
104
structure length
104
Chain Sequence
APVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S RIBOSOMAL PROTEIN L30
publication title Local folding coupled to RNA binding in the yeast ribosomal protein L30
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 43
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 1999-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1ck2A00
4BY9D 3CCLF 1CK2A 1DT9A 1W41A 1YJWF 2BO1A 2QEXF 1W3EX 3CMEF 1IPAA 1VQ6F 3J81M 3CC7F 1VQ4F 4TZZA 1X7PA 1VQ5F 1VQLF 3CPWF 3OBYA 1T0KB 1YJNF 1RA4A 3I56F 2FC3A 3OBWA 1RLGA 1JJ2F 1GO0A 1YI2F 3NK7A 1K73H 2LBXA 3PAFA 3CD6F 5GAPK 2ALEA 5GANK 1S72F 1KD1H 2KTUA 3VI6A 3CCUF 1XBIA 3CXCF 3FFMA 1CN7A 4X3LA 5G4VC 3O85A 2CZWA 2QA4F 5GINC 2OZBA 5EO3A 3G4SF 3CCRF 1VQ7F 3GYQA 1VQMF 3WXMB 3V7QA 1Q7YH 1QVGF 1NJIH 5IT9M 3LWVC 3RA5A 3CCEF 3IR9A 3OW2F 1VQKF 3NMUC 3LWPC 3CCQF 1M1KH 3SIUA 2QI2A 3N4ZA 1E7KA 4C4WC 3G6EF 1X52A 2WALA 1X7OA 5FLXM 1KQSF 3CCJF 3J7AR 1YITF 3HJWC 2JNBA 3CCMF 3LFOA 2OTJF 3CMAF 1VQNF 5DCVA 2AIFA 3N4YA 1W42A 1KC8H 4LCKA 1VQOF 1H7MA 1YHQF 5G4UC 2KTVA 1SDSA 3VMFB 2VGNA 1GO1A 3LWOC 1PXWA 1Q86H 3NVKE 4NUTA 3JCMM 1K9MH 3LWQC 1K8AH 1Q82H 5FJ4C 3SIVA 3V7EA 3JAMM 3I55F 5A2QM 3MCAB 3LWRC 2I6DA 3E1YA 3J80M 3CG6A 1YIJF 3G71F 1VQ8F 3CCVF 3CC2F 1ZWZA 3CC4F 2HVYD 3ON1A 2VGMA 4X3MA 4BW0B 1W40A 1GZ0A 3CCSF 3PLAC 1VQ9F 2OHWA 3CPQA 1Q81H 2LBWA 5GIOC 1VQPF 1YJ9F 1QVFF 2KG4A 1W2BF 3AGKA 3RA6A 3NVIB 3E20B 2OTLF 1NMUB 3NK6A 3HAXD 5EWRA 5GIPC 1N8RH 1M90H
chains in the Genus database with same CATH superfamily
2PMPA 1DT9A 3JARA 5IJ9A 1YJWF 3HKCB 1FFXB 5C8YA 5GONB 1VQ5F 3WPWA 5JCOC 2VXYA 1XRGA 1T0KB 2VAPA 3N2GA 2FC3A 1RLGA 1W5AA 1YI2F 4WBNA 5HXZA 3PAFA 4X1YB 3S03A 3FBAA 2W8BC 3M1XA 3S06A 2P6YA 4I55B 4YJ2B 4X3LA 1U40A 3GTZA 4O4LB 2CZWA 2OZBA 1FNKA 5LA6A 5EO3A 3HWUA 1QD9A 4G4ZA 1VQMF 1Q7YH 1QVGF 1NJIH 5LYJB 1DBFA 4EI8A 4LNUA 4F6RA 5JVDA 3LWVC 4EB6A 3CCEF 3IR9A 4YJ3A 4M8IA 1E7KA 3RYHB 3K12A 3G6EF 5BMVA 4BT2A 3M84A 1ONIA 2HP3A 5FLXM 1TUBB 5LP6C 3CCJF 1COMA 4O4IB 4U3JA 1YITF 3S0WA 5IYZB 4BT6A 1VQNF 2Z1UA 2GZLA 3N4YA 1Z5WA 2KTVA 2HS0A 3VMFB 5HP7A 3HKBA 4NUTA 3KHNA 3JCMM 5HXUA 1K8AH 1W5BA 3BYQA 1Q82H 2GVIA 3QUWA 1JD1A 2RHJA 4ZOLB 3V7EA 5LP6B 3IEQA 3F0GA 3LWRC 5IJ0A 3D00A 3ZOPA 3F0FA 1KNJA 3G71F 2R6R1 3LDTA 5CB4A 3S0HA 1W5FA 5EIBC 4BW0B 4BVRA 5J2TA 1W40A 4X1KB 5CA0B 3KJJA 4BVQA 3PLAC 4XCQA 3JATB 2ZF8A 1Q81H 2RHLA 4ZI7A 3GHZA 2LBWA 1VQPF 4DXDA 4NQ3A 3F0EA 2DT4A 3ZP7A 3AGKA 3EORA 4IHJB 1SZQA 3MDOA 3E20B 2HP0A 3HAXD 2DYYA 3Q8HA 4ZHQB 3K0TA 4BY9D 1CK2A 4G4YA 3RYFB 1SA0A 1W41A 3CMEF 3J81M 4B62A 3WPXA 5MN4A 1X7PA 3JAWB 1KNKA 3CPWF 5LOVB 3OBYA 2H8EA 2OTMA 3VO8A 3P0ZA 3I56F 2HS3A 1CLIA 3IEWA 3JARB 4O4JA 5IJ9B 1GO0A 1GX1A 2UYKA 3CD6F 4BT3A 5GANK 3KIZA 5C8YB 1S72F 3V3TA 3RYCA 3CCUF 3VI6A 1ODEA 1XBIA 2GLZA 3CXCF 2UYNA 1YQNA 2ZOVA 3OONA 3FFMA 3N2GB 5CA1A 5EZYA 1T0AA 1U3PA 2KGWA 2HS4A 2QA4F 3G4SF 3CCRF 5FNVA 3WGNA 1W5EA 3CB2A 4I50B 3HTNA 3WXMB 4B5CA 1VQVA 3D01A 2CSLA 3C9RA 1FNJA 1J7HA 3WGLA 3OW2F 1QAHA 3WGJA 4BVSA 4DRXA 2Q1YA 3VYTC 3CCQF 3C9UA 3F0DA 1OFUA 5LA6B 1X7OA 3MQWA 3N2KA 3V4DA 5LXTA 1KQSF 5EYPA 4R40B 3J7AR 4E6EA 3CMAF 2AIZP 2HQSC 3ESJA 4LNUB 4F6RB 5JVDB 1KC8H 4LCKA 2HRUA 4G4WA 4EB6B 4RHAA 1NQ3A 1H7MA 2VAMA 1YHQF 2B33A 5HWEA 5HY2A 1PXWA 5ITZA 3NVKE 2N48A 2Z01A 1JN1A 2RHHA 3KE1A 3LWQC 5BMVB 3P10A 2H6LA 4TV9A 3WJPA 5FJ4C 3ZP4A 2VAWA 4U3JB 4C81A 5HP8A 2ZVZA 3L7QA 3J80M 2Z1TA 3CG6A 4O4HA 4B46A 4O2AA 3CC2F 4ZK7A 3HKBB 3RYIA 4X3MA 1JFFA 5B8FA 3CYPB 1GZ0A 3CCSF 2ZAUA 2HRYA 1VQ9F 2OHWA 3CPQA 1U43A 1W59A 3HKDA 5GIOC 5IJ0B 1RQ7A 4EI9A 1YJ9F 1QVFF 2KG4A 4O2BA 2CVLA 3RA6A 2HX0A 5CB4B 3NVIB 3DC2A 5JH7A 1IV4A 1U3LA 1TVKA 5GIPC 1N8RH 1QU9A 4G88A 3VOAA 3TD5A 3CCLF 1YGYA 4ZI7B 2QEXF 1W3EX 5KMGB 1VQ6F 4FFBA 1VQ4F 1FSZA 1Z5VA 3R0PA 4TZZA 3F6MA 2H8CA 3RYHA 3QHDA 3I7TA 1VQLF 2HP0B 3FD6A 1RQ2A 1YJNF 1RA4A 4HNAA 3LYBA 4KWEA 2BTOA 1SA0B 3NK7A 4NWOB 1OAPA 5GAPK 1W581 1KD1H 3B6NA 5KX5A 4U39A 2LBTA 2IQQA 4C8EA 4X20B 1PF5A 2L26A 4ERHA 1CN7A 2AMTA 2EWCA 4O4JB 5JQGA 3O85A 3UT5A 4BVTA 3D54A 5J2UA 1VQ7F 4I4TA 4RQOA 3RYCB 3U0OA 3JASA 4IIJA 2UYNB 4X1KA 2RB9A 5IT9M 3K2XA 3RA5A 3NMUC 5CA1B 5EZYB 3LWPC 1W57A 1W55A 3SIUA 2CWJA 2QI2A 2UZHA 5HY1A 5EIBD 4C4WC 2WALA 1VK3A 1UFYA 5FNVB 4G4VA 3ZO8A 3HJWC 2JNBA 1VHAA 5DCVA 2AIFA 4X1IA 1W42A 4WBNB 2MQEA 3HKEA 2Z1FA 5G4UC 2Q1XA 1SDSA 1GO1A 4DRXB 5EAZA 4TUYA 1Q86H 3JAKA 3IMPA 1K9MH 3IKFA 3DDNA 3N2KB 4TV8A 3JALA 5EYPB 3SIVA 3C9TA 3JAMM 5A2QM 3MCAB 3S0YA 2I6DA 3E1YA 1XV2A 1YIJF 1VQ8F 5ITZB 3E22A 3CC4F 2Z1EA 3ON1A 2BTUA 2VGMA 4TV9B 4C82A 2RHOA 2IAFA 3WJQA 3JVHA 3WJRA 3HKCA 4YJ3B 1FFXA 4O4HB 3K14A 4O2AB 1W2BF 4ZHYB 5GONA 3RYIB 1NMUB 4ZHVA 1JFFB 2K1SA 5EWRA 4I50A 4ZHWA 5MN5A 1R1MA 2BO1A 3HKDB 2ZODA 4X1YA 1IPAA 5EB0A 3CC7F 2R751 4O2BB 3M4SA 3IKEA 5AVMA 3TD4A 4BT5A 3S02A 5JH7B 1TVKB 5HY0A 3VIUA 1IV2A 5JCOA 4I55A 4YJ2A 3OBWA 5HY4A 2LCAA 1JJ2F 3TD3A 1K73H 2LBXA 4O4LA 4FFBB 3RE3A 2ALEA 2ZVYA 3ELCA 3ERNA 3QTYA 2KTUA 5J2TB 5LYJA 3T80A 2CHSA 4HNAB 3VYUC 1X25A 1JY8A 1XHOA 5G4VC 5GINC 4PWTA 3C8LA 1TUBA 3GYQA 4O4IA 5KX5B 3V7QA 5IYZA 3CYQA 2BTQB 3VTIC 3FPIA 1VQKF 3MCQA 1M1KH 5JQGB 3KJKA 3MBMA 3N4ZA 3UT5B 4BT4A 2NMUA 5J2UB 1X52A 2FGYA 2UYJA 4I4TB 3P4EA 3VCZA 4ZOLA 2I6RA 3JASB 4C8GA 3CCMF 3LFOA 1IV3A 2OTJF 1H48A 5LP6A 4IIJB 2V9YA 4B45A 1VQOF 1UI9A 2VGNA 3LWOC 5KMGA 1IV1A 2UYPA 3I3FA 2IG8A 1H47A 3WGKA 5EB1B 3LMEA 5CA0A 1VH8A 3I55F 3JATA 2YXZA 4X1IB 2YYEA 3HKEB 3WGMA 3CCVF 1ZWZA 4IHJA 4TUYB 3JAKB 2HVYD 2F9ZC 1RLUA 4TV8B 3JALB 3VOBA 4C8IA 4EI7A 4ZHQA 1Q8RA 4G4XA 2QTPA 2G9IA 3FD5A 4X20A 3RYFA 2CHTA 2PHNA 3C9SA 4BT7A 2CW4A 3E22B 3JAWA 2OTLF 5LXTB 3NK6A 5MN6A 5LOVA 3VYSC 1M90H
chains in the Genus database with same CATH topology
4BY9D 3CCLF 1CK2A 1DT9A 1W41A 1YJWF 2BO1A 2QEXF 1W3EX 3CMEF 1IPAA 1VQ6F 3J81M 3CC7F 1VQ4F 4TZZA 1X7PA 1VQ5F 1VQLF 3CPWF 3OBYA 5HY0A 1T0KB 1YJNF 1RA4A 3I56F 2FC3A 3OBWA 1RLGA 5HY4A 1JJ2F 1GO0A 1YI2F 3NK7A 5HXZA 1K73H 2LBXA 3PAFA 3CD6F 5GAPK 2ALEA 5GANK 1S72F 3V3TA 1KD1H 2KTUA 3VI6A 3CCUF 1XBIA 2GLZA 3CXCF 3FFMA 1CN7A 4X3LA 5G4VC 3O85A 2CZWA 2QA4F 5GINC 4BVTA 2OZBA 5EO3A 3G4SF 3CCRF 1VQ7F 3GYQA 1VQMF 3WXMB 3V7QA 1Q7YH 1QVGF 1NJIH 4EI8A 5IT9M 3LWVC 3RA5A 3CCEF 3IR9A 3OW2F 1VQKF 3NMUC 3LWPC 3CCQF 4BVSA 1M1KH 3SIUA 2QI2A 5HY1A 3N4ZA 1E7KA 4C4WC 3G6EF 1X52A 2WALA 1X7OA 2FGYA 5FLXM 1KQSF 3CCJF 3J7AR 1YITF 3HJWC 2JNBA 3CCMF 3LFOA 2OTJF 3CMAF 1VQNF 5DCVA 2AIFA 3N4YA 1W42A 1KC8H 4LCKA 1VQOF 1H7MA 1YHQF 5G4UC 2KTVA 1SDSA 3VMFB 2VGNA 1GO1A 5HWEA 5HY2A 1PXWA 3LWOC 1Q86H 3NVKE 4NUTA 5HXUA 3JCMM 1K9MH 3LWQC 1K8AH 1Q82H 5FJ4C 3SIVA 3V7EA 3JAMM 3I55F 5A2QM 3MCAB 3LWRC 2I6DA 3E1YA 3J80M 3CG6A 3D00A 3G71F 1YIJF 1VQ8F 3CCVF 3CC2F 1ZWZA 3CC4F 2HVYD 2F9ZC 3ON1A 2VGMA 4X3MA 4BW0B 4BVRA 1W40A 4EI7A 1GZ0A 3CCSF 4BVQA 3PLAC 4XCQA 1VQ9F 2OHWA 3CPQA 1Q81H 2LBWA 5GIOC 1VQPF 4EI9A 4NQ3A 1YJ9F 1QVFF 2KG4A 1W2BF 3AGKA 3RA6A 3NVIB 3E20B 2OTLF 1NMUB 3NK6A 3HAXD 5EWRA 5GIPC 1N8RH 1M90H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY9 D;  3CCL F;  1CK2 A;  1DT9 A;  1W41 A;  1YJW F;  2BO1 A;  2QEX F;  1W3E X;  3CME F;  1IPA A;  1VQ6 F;  3J81 M;  3CC7 F;  1VQ4 F;  4TZZ A;  1X7P A;  1VQ5 F;  1VQL F;  3CPW F;  3OBY A;  1T0K B;  1YJN F;  1RA4 A;  3I56 F;  2FC3 A;  3OBW A;  1RLG A;  1JJ2 F;  1GO0 A;  1YI2 F;  3NK7 A;  1K73 H;  2LBX A;  3PAF A;  3CD6 F;  5GAP K;  2ALE A;  5GAN K;  1S72 F;  1KD1 H;  2KTU A;  3VI6 A;  3CCU F;  1XBI A;  3CXC F;  3FFM A;  1CN7 A;  4X3L A;  5G4V C;  3O85 A;  2CZW A;  2QA4 F;  5GIN C;  2OZB A;  5EO3 A;  3G4S F;  3CCR F;  1VQ7 F;  3GYQ A;  1VQM F;  3WXM B;  3V7Q A;  1Q7Y H;  1QVG F;  1NJI H;  5IT9 M;  3LWV C;  3RA5 A;  3CCE F;  3IR9 A;  3OW2 F;  1VQK F;  3NMU C;  3LWP C;  3CCQ F;  1M1K H;  3SIU A;  2QI2 A;  3N4Z A;  1E7K A;  4C4W C;  3G6E F;  1X52 A;  2WAL A;  1X7O A;  5FLX M;  1KQS F;  3CCJ F;  3J7A R;  1YIT F;  3HJW C;  2JNB A;  3CCM F;  3LFO A;  2OTJ F;  3CMA F;  1VQN F;  5DCV A;  2AIF A;  3N4Y A;  1W42 A;  1KC8 H;  4LCK A;  1VQO F;  1H7M A;  1YHQ F;  5G4U C;  2KTV A;  1SDS A;  3VMF B;  2VGN A;  1GO1 A;  3LWO C;  1PXW A;  1Q86 H;  3NVK E;  4NUT A;  3JCM M;  1K9M H;  3LWQ C;  1K8A H;  1Q82 H;  5FJ4 C;  3SIV A;  3V7E A;  3JAM M;  3I55 F;  5A2Q M;  3MCA B;  3LWR C;  2I6D A;  3E1Y A;  3J80 M;  3CG6 A;  1YIJ F;  3G71 F;  1VQ8 F;  3CCV F;  3CC2 F;  1ZWZ A;  3CC4 F;  2HVY D;  3ON1 A;  2VGM A;  4X3M A;  4BW0 B;  1W40 A;  1GZ0 A;  3CCS F;  3PLA C;  1VQ9 F;  2OHW A;  3CPQ A;  1Q81 H;  2LBW A;  5GIO C;  1VQP F;  1YJ9 F;  1QVF F;  2KG4 A;  1W2B F;  3AGK A;  3RA6 A;  3NVI B;  3E20 B;  2OTL F;  1NMU B;  3NK6 A;  3HAX D;  5EWR A;  5GIP C;  1N8R H;  1M90 H; 
#chains in the Genus database with same CATH topology
 2PMP A;  1DT9 A;  3JAR A;  5IJ9 A;  1YJW F;  3HKC B;  1FFX B;  5C8Y A;  5GON B;  1VQ5 F;  3WPW A;  5JCO C;  2VXY A;  1XRG A;  1T0K B;  2VAP A;  3N2G A;  2FC3 A;  1RLG A;  1W5A A;  1YI2 F;  4WBN A;  5HXZ A;  3PAF A;  4X1Y B;  3S03 A;  3FBA A;  2W8B C;  3M1X A;  3S06 A;  2P6Y A;  4I55 B;  4YJ2 B;  4X3L A;  1U40 A;  3GTZ A;  4O4L B;  2CZW A;  2OZB A;  1FNK A;  5LA6 A;  5EO3 A;  3HWU A;  1QD9 A;  4G4Z A;  1VQM F;  1Q7Y H;  1QVG F;  1NJI H;  5LYJ B;  1DBF A;  4EI8 A;  4LNU A;  4F6R A;  5JVD A;  3LWV C;  4EB6 A;  3CCE F;  3IR9 A;  4YJ3 A;  4M8I A;  1E7K A;  3RYH B;  3K12 A;  3G6E F;  5BMV A;  4BT2 A;  3M84 A;  1ONI A;  2HP3 A;  5FLX M;  1TUB B;  5LP6 C;  3CCJ F;  1COM A;  4O4I B;  4U3J A;  1YIT F;  3S0W A;  5IYZ B;  4BT6 A;  1VQN F;  2Z1U A;  2GZL A;  3N4Y A;  1Z5W A;  2KTV A;  2HS0 A;  3VMF B;  5HP7 A;  3HKB A;  4NUT A;  3KHN A;  3JCM M;  5HXU A;  1K8A H;  1W5B A;  3BYQ A;  1Q82 H;  2GVI A;  3QUW A;  1JD1 A;  2RHJ A;  4ZOL B;  3V7E A;  5LP6 B;  3IEQ A;  3F0G A;  3LWR C;  5IJ0 A;  3D00 A;  3ZOP A;  3F0F A;  1KNJ A;  3G71 F;  2R6R 1;  3LDT A;  5CB4 A;  3S0H A;  1W5F A;  5EIB C;  4BW0 B;  4BVR A;  5J2T A;  1W40 A;  4X1K B;  5CA0 B;  3KJJ A;  4BVQ A;  3PLA C;  4XCQ A;  3JAT B;  2ZF8 A;  1Q81 H;  2RHL A;  4ZI7 A;  3GHZ A;  2LBW A;  1VQP F;  4DXD A;  4NQ3 A;  3F0E A;  2DT4 A;  3ZP7 A;  3AGK A;  3EOR A;  4IHJ B;  1SZQ A;  3MDO A;  3E20 B;  2HP0 A;  3HAX D;  2DYY A;  3Q8H A;  4ZHQ B;  3K0T A;  4BY9 D;  1CK2 A;  4G4Y A;  3RYF B;  1SA0 A;  1W41 A;  3CME F;  3J81 M;  4B62 A;  3WPX A;  5MN4 A;  1X7P A;  3JAW B;  1KNK A;  3CPW F;  5LOV B;  3OBY A;  2H8E A;  2OTM A;  3VO8 A;  3P0Z A;  3I56 F;  2HS3 A;  1CLI A;  3IEW A;  3JAR B;  4O4J A;  5IJ9 B;  1GO0 A;  1GX1 A;  2UYK A;  3CD6 F;  4BT3 A;  5GAN K;  3KIZ A;  5C8Y B;  1S72 F;  3V3T A;  3RYC A;  3CCU F;  3VI6 A;  1ODE A;  1XBI A;  2GLZ A;  3CXC F;  2UYN A;  1YQN A;  2ZOV A;  3OON A;  3FFM A;  3N2G B;  5CA1 A;  5EZY A;  1T0A A;  1U3P A;  2KGW A;  2HS4 A;  2QA4 F;  3G4S F;  3CCR F;  5FNV A;  3WGN A;  1W5E A;  3CB2 A;  4I50 B;  3HTN A;  3WXM B;  4B5C A;  1VQV A;  3D01 A;  2CSL A;  3C9R A;  1FNJ A;  1J7H A;  3WGL A;  3OW2 F;  1QAH A;  3WGJ A;  4BVS A;  4DRX A;  2Q1Y A;  3VYT C;  3CCQ F;  3C9U A;  3F0D A;  1OFU A;  5LA6 B;  1X7O A;  3MQW A;  3N2K A;  3V4D A;  5LXT A;  1KQS F;  5EYP A;  4R40 B;  3J7A R;  4E6E A;  3CMA F;  2AIZ P;  2HQS C;  3ESJ A;  4LNU B;  4F6R B;  5JVD B;  1KC8 H;  4LCK A;  2HRU A;  4G4W A;  4EB6 B;  4RHA A;  1NQ3 A;  1H7M A;  2VAM A;  1YHQ F;  2B33 A;  5HWE A;  5HY2 A;  1PXW A;  5ITZ A;  3NVK E;  2N48 A;  2Z01 A;  1JN1 A;  2RHH A;  3KE1 A;  3LWQ C;  5BMV B;  3P10 A;  2H6L A;  4TV9 A;  3WJP A;  5FJ4 C;  3ZP4 A;  2VAW A;  4U3J B;  4C81 A;  5HP8 A;  2ZVZ A;  3L7Q A;  3J80 M;  2Z1T A;  3CG6 A;  4O4H A;  4B46 A;  4O2A A;  3CC2 F;  4ZK7 A;  3HKB B;  3RYI A;  4X3M A;  1JFF A;  5B8F A;  3CYP B;  1GZ0 A;  3CCS F;  2ZAU A;  2HRY A;  1VQ9 F;  2OHW A;  3CPQ A;  1U43 A;  1W59 A;  3HKD A;  5GIO C;  5IJ0 B;  1RQ7 A;  4EI9 A;  1YJ9 F;  1QVF F;  2KG4 A;  4O2B A;  2CVL A;  3RA6 A;  2HX0 A;  5CB4 B;  3NVI B;  3DC2 A;  5JH7 A;  1IV4 A;  1U3L A;  1TVK A;  5GIP C;  1N8R H;  1QU9 A;  4G88 A;  3VOA A;  3TD5 A;  3CCL F;  1YGY A;  4ZI7 B;  2QEX F;  1W3E X;  5KMG B;  1VQ6 F;  4FFB A;  1VQ4 F;  1FSZ A;  1Z5V A;  3R0P A;  4TZZ A;  3F6M A;  2H8C A;  3RYH A;  3QHD A;  3I7T A;  1VQL F;  2HP0 B;  3FD6 A;  1RQ2 A;  1YJN F;  1RA4 A;  4HNA A;  3LYB A;  4KWE A;  2BTO A;  1SA0 B;  3NK7 A;  4NWO B;  1OAP A;  5GAP K;  1W58 1;  1KD1 H;  3B6N A;  5KX5 A;  4U39 A;  2LBT A;  2IQQ A;  4C8E A;  4X20 B;  1PF5 A;  2L26 A;  4ERH A;  1CN7 A;  2AMT A;  2EWC A;  4O4J B;  5JQG A;  3O85 A;  3UT5 A;  4BVT A;  3D54 A;  5J2U A;  1VQ7 F;  4I4T A;  4RQO A;  3RYC B;  3U0O A;  3JAS A;  4IIJ A;  2UYN B;  4X1K A;  2RB9 A;  5IT9 M;  3K2X A;  3RA5 A;  3NMU C;  5CA1 B;  5EZY B;  3LWP C;  1W57 A;  1W55 A;  3SIU A;  2CWJ A;  2QI2 A;  2UZH A;  5HY1 A;  5EIB D;  4C4W C;  2WAL A;  1VK3 A;  1UFY A;  5FNV B;  4G4V A;  3ZO8 A;  3HJW C;  2JNB A;  1VHA A;  5DCV A;  2AIF A;  4X1I A;  1W42 A;  4WBN B;  2MQE A;  3HKE A;  2Z1F A;  5G4U C;  2Q1X A;  1SDS A;  1GO1 A;  4DRX B;  5EAZ A;  4TUY A;  1Q86 H;  3JAK A;  3IMP A;  1K9M H;  3IKF A;  3DDN A;  3N2K B;  4TV8 A;  3JAL A;  5EYP B;  3SIV A;  3C9T A;  3JAM M;  5A2Q M;  3MCA B;  3S0Y A;  2I6D A;  3E1Y A;  1XV2 A;  1YIJ F;  1VQ8 F;  5ITZ B;  3E22 A;  3CC4 F;  2Z1E A;  3ON1 A;  2BTU A;  2VGM A;  4TV9 B;  4C82 A;  2RHO A;  2IAF A;  3WJQ A;  3JVH A;  3WJR A;  3HKC A;  4YJ3 B;  1FFX A;  4O4H B;  3K14 A;  4O2A B;  1W2B F;  4ZHY B;  5GON A;  3RYI B;  1NMU B;  4ZHV A;  1JFF B;  2K1S A;  5EWR A;  4I50 A;  4ZHW A;  5MN5 A;  1R1M A;  2BO1 A;  3HKD B;  2ZOD A;  4X1Y A;  1IPA A;  5EB0 A;  3CC7 F;  2R75 1;  4O2B B;  3M4S A;  3IKE A;  5AVM A;  3TD4 A;  4BT5 A;  3S02 A;  5JH7 B;  1TVK B;  5HY0 A;  3VIU A;  1IV2 A;  5JCO A;  4I55 A;  4YJ2 A;  3OBW A;  5HY4 A;  2LCA A;  1JJ2 F;  3TD3 A;  1K73 H;  2LBX A;  4O4L A;  4FFB B;  3RE3 A;  2ALE A;  2ZVY A;  3ELC A;  3ERN A;  3QTY A;  2KTU A;  5J2T B;  5LYJ A;  3T80 A;  2CHS A;  4HNA B;  3VYU C;  1X25 A;  1JY8 A;  1XHO A;  5G4V C;  5GIN C;  4PWT A;  3C8L A;  1TUB A;  3GYQ A;  4O4I A;  5KX5 B;  3V7Q A;  5IYZ A;  3CYQ A;  2BTQ B;  3VTI C;  3FPI A;  1VQK F;  3MCQ A;  1M1K H;  5JQG B;  3KJK A;  3MBM A;  3N4Z A;  3UT5 B;  4BT4 A;  2NMU A;  5J2U B;  1X52 A;  2FGY A;  2UYJ A;  4I4T B;  3P4E A;  3VCZ A;  4ZOL A;  2I6R A;  3JAS B;  4C8G A;  3CCM F;  3LFO A;  1IV3 A;  2OTJ F;  1H48 A;  5LP6 A;  4IIJ B;  2V9Y A;  4B45 A;  1VQO F;  1UI9 A;  2VGN A;  3LWO C;  5KMG A;  1IV1 A;  2UYP A;  3I3F A;  2IG8 A;  1H47 A;  3WGK A;  5EB1 B;  3LME A;  5CA0 A;  1VH8 A;  3I55 F;  3JAT A;  2YXZ A;  4X1I B;  2YYE A;  3HKE B;  3WGM A;  3CCV F;  1ZWZ A;  4IHJ A;  4TUY B;  3JAK B;  2HVY D;  2F9Z C;  1RLU A;  4TV8 B;  3JAL B;  3VOB A;  4C8I A;  4EI7 A;  4ZHQ A;  1Q8R A;  4G4X A;  2QTP A;  2G9I A;  3FD5 A;  4X20 A;  3RYF A;  2CHT A;  2PHN A;  3C9S A;  4BT7 A;  2CW4 A;  3E22 B;  3JAW A;  2OTL F;  5LXT B;  3NK6 A;  5MN6 A;  5LOV A;  3VYS C;  1M90 H; 
#chains in the Genus database with same CATH homology
 4BY9 D;  3CCL F;  1CK2 A;  1DT9 A;  1W41 A;  1YJW F;  2BO1 A;  2QEX F;  1W3E X;  3CME F;  1IPA A;  1VQ6 F;  3J81 M;  3CC7 F;  1VQ4 F;  4TZZ A;  1X7P A;  1VQ5 F;  1VQL F;  3CPW F;  3OBY A;  5HY0 A;  1T0K B;  1YJN F;  1RA4 A;  3I56 F;  2FC3 A;  3OBW A;  1RLG A;  5HY4 A;  1JJ2 F;  1GO0 A;  1YI2 F;  3NK7 A;  5HXZ A;  1K73 H;  2LBX A;  3PAF A;  3CD6 F;  5GAP K;  2ALE A;  5GAN K;  1S72 F;  3V3T A;  1KD1 H;  2KTU A;  3VI6 A;  3CCU F;  1XBI A;  2GLZ A;  3CXC F;  3FFM A;  1CN7 A;  4X3L A;  5G4V C;  3O85 A;  2CZW A;  2QA4 F;  5GIN C;  4BVT A;  2OZB A;  5EO3 A;  3G4S F;  3CCR F;  1VQ7 F;  3GYQ A;  1VQM F;  3WXM B;  3V7Q A;  1Q7Y H;  1QVG F;  1NJI H;  4EI8 A;  5IT9 M;  3LWV C;  3RA5 A;  3CCE F;  3IR9 A;  3OW2 F;  1VQK F;  3NMU C;  3LWP C;  3CCQ F;  4BVS A;  1M1K H;  3SIU A;  2QI2 A;  5HY1 A;  3N4Z A;  1E7K A;  4C4W C;  3G6E F;  1X52 A;  2WAL A;  1X7O A;  2FGY A;  5FLX M;  1KQS F;  3CCJ F;  3J7A R;  1YIT F;  3HJW C;  2JNB A;  3CCM F;  3LFO A;  2OTJ F;  3CMA F;  1VQN F;  5DCV A;  2AIF A;  3N4Y A;  1W42 A;  1KC8 H;  4LCK A;  1VQO F;  1H7M A;  1YHQ F;  5G4U C;  2KTV A;  1SDS A;  3VMF B;  2VGN A;  1GO1 A;  5HWE A;  5HY2 A;  1PXW A;  3LWO C;  1Q86 H;  3NVK E;  4NUT A;  5HXU A;  3JCM M;  1K9M H;  3LWQ C;  1K8A H;  1Q82 H;  5FJ4 C;  3SIV A;  3V7E A;  3JAM M;  3I55 F;  5A2Q M;  3MCA B;  3LWR C;  2I6D A;  3E1Y A;  3J80 M;  3CG6 A;  3D00 A;  3G71 F;  1YIJ F;  1VQ8 F;  3CCV F;  3CC2 F;  1ZWZ A;  3CC4 F;  2HVY D;  2F9Z C;  3ON1 A;  2VGM A;  4X3M A;  4BW0 B;  4BVR A;  1W40 A;  4EI7 A;  1GZ0 A;  3CCS F;  4BVQ A;  3PLA C;  4XCQ A;  1VQ9 F;  2OHW A;  3CPQ A;  1Q81 H;  2LBW A;  5GIO C;  1VQP F;  4EI9 A;  4NQ3 A;  1YJ9 F;  1QVF F;  2KG4 A;  1W2B F;  3AGK A;  3RA6 A;  3NVI B;  3E20 B;  2OTL F;  1NMU B;  3NK6 A;  3HAX D;  5EWR A;  5GIP C;  1N8R H;  1M90 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...