1CK2A

Yeast (saccharomyces cerevisiae) ribosomal protein l30
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
104
structure length
104
Chain Sequence
APVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S RIBOSOMAL PROTEIN L30
publication title Local folding coupled to RNA binding in the yeast ribosomal protein L30
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 43
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 1999-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1ck2A00
3JAMM 3JCMM 3IR9A 2AIFA 3G4SF 1GZ0A 3LWRC 1QVFF 1RLGA 2KTVA 1YJWF 3CPWF 5GINC 3CXCF 1YJ9F 3SIVA 1JJ2F 1ZWZA 2JNBA 5GIPC 3RA5A 5FLXM 3CCLF 2VGMA 3O85A 5GAPK 1YI2F 1VQOF 1K73H 5A2QM 2HVYD 3N4YA 3RA6A 3CCJF 3G71F 1VQKF 3WXMB 1YITF 2CZWA 3NVKE 1H7MA 3N4ZA 1M1KH 4LCKA 2ALEA 2KG4A 3CMAF 1KC8H 3CD6F 5G4UC 2BO1A 3NK7A 1CN7A 5EO3A 3J7AR 3HJWC 1W40A 1Q86H 3CCRF 1X7PA 2OTJF 1VQ7F 5G4VC 1E7KA 3HAXD 1YJNF 1NJIH 3OBWA 3V7QA 2QI2A 4TZZA 1Q7YH 1VQNF 3MCAB 3VMFB 1RA4A 2LBWA 5IT9M 1XBIA 1S72F 2QA4F 3CC2F 2I6DA 3CC7F 1CK2A 3VI6A 3LWVC 1QVGF 1X7OA 1K9MH 3CPQA 3NMUC 4NUTA 1VQ8F 3FFMA 3CCSF 3SIUA 1VQMF 3I55F 3AGKA 1KQSF 3CC4F 3PLAC 1VQ4F 5EWRA 1PXWA 4X3LA 1VQ6F 1VQ5F 2KTUA 3CCUF 3V7EA 3ON1A 3OW2F 3E1YA 2LBXA 1VQ9F 3CCMF 1M90H 1NMUB 1GO1A 1X52A 3LWPC 3CCVF 1Q81H 1W2BF 2OHWA 2WALA 1IPAA 1T0KB 3CCQF 3PAFA 2OZBA 3LWOC 2FC3A 3G6EF 3J80M 1W3EX 1GO0A 3I56F 3J81M 4BW0B 1KD1H 3NK6A 3OBYA 1SDSA 5DCVA 1YIJF 4C4WC 5GANK 2VGNA 4BY9D 3CCEF 2OTLF 3NVIB 3E20B 1VQLF 1N8RH 1YHQF 3GYQA 2QEXF 3LFOA 1W41A 1Q82H 1DT9A 3LWQC 4X3MA 3CG6A 1VQPF 5GIOC 1W42A 3CMEF 5FJ4C 1K8AH
chains in the Genus database with same CATH superfamily
3RYCA 4I50A 2HQSC 3IR9A 3G4SF 1GZ0A 2Z01A 5LP6C 3LWRC 1RLGA 5ITZA 2H6LA 2KTVA 3VOBA 3U0OA 1OAPA 1FSZA 2RHLA 1JJ2F 5LOVA 4O4JA 2DYYA 1W5AA 3K2XA 3RYFA 2VGMA 4ZHYB 1ODEA 1YI2F 4PWTA 5A2QM 4R40B 1VQKF 1YITF 2CZWA 4E6EA 3NVKE 3N4ZA 1M1KH 4BVSA 2UYPA 3P0ZA 3ZOPA 4G4ZA 3MCQA 3WPWA 4EI8A 4I55A 1SA0A 4EI9A 4RHAA 4O4LB 1Q86H 4EI7A 5KMGB 3CCRF 2GLZA 4BVQA 5EB0A 2R6R1 5HY4A 2Z1TA 3OBWA 5AVMA 4X1IB 1Q7YH 5EIBD 1RA4A 3D01A 3D00A 2LBWA 3VTIC 5HY0A 4G88A 2ZVYA 3CC7F 3OONA 2Z1FA 2BTQB 3VI6A 2AMTA 3I3FA 3FFMA 3CCSF 3I55F 3JAWA 3WJPA 5IYZA 3F0FA 3PLAC 4BT2A 3V4DA 1VQ4F 1U3PA 4IHJA 3S03A 5LYJB 1IV1A 1JD1A 4X3LA 2BTOA 4TUYA 3N2KB 2PHNA 1W55A 3V3TA 1XRGA 3HKEA 1M90H 3M84A 1IV3A 1X52A 3FBAA 1Q81H 3JALA 3CCQF 5J2UA 1CLIA 4O4IA 3VYUC 4U39A 4ZI7A 2Z1UA 3TD4A 3N2GB 3WJRA 1JY8A 4ZK7A 4KWEA 1W581 2HRYA 1YIJF 1KNJA 5LXTB 4F6RA 3K0TA 5JVDA 3CCEF 3CYQA 3E20B 1VQLF 2N48A 4O2BA 3RYHB 2HS4A 3GYQA 5CB4A 2QEXF 3R0PA 1Z5WA 4O4HB 4EB6B 3CMEF 3DC2A 1JFFB 1K8AH 3JAMM 5EIBC 3JCMM 3S0WA 4NWOB 4LNUB 5CA0B 1H47A 5HP7A 1DBFA 1W57A 5JQGB 4TV8A 2CSLA 5GINC 1YJWF 3SIVA 4BT3A 1T0AA 2JNBA 4B5CA 5GIPC 4B62A 4X20B 3JASB 4FFBB 4I4TB 3JATB 4X1YB 3Q8HA 2ZF8A 3O85A 1GX1A 4YJ3B 1R1MA 5EB1B 4ERHA 5GAPK 1K73H 3RA6A 3LDTA 3G71F 3S02A 4YJ2B 1H7MA 3RE3A 4ZOLB 5JH7B 3IEWA 2KG4A 1W5EA 3I7TA 5G4UC 3VYTC 1CN7A 3WPXA 4O4LA 5HXZA 4BVRA 5KMGA 4G4YA 4M8IA 2Q1YA 2HS0A 5FNVA 5GONB 2OTJF 1E7KA 3HAXD 3ZO8A 1RQ7A 1NJIH 4X1IA 3V7QA 4C82A 3HKDB 5LA6B 3C9UA 3VMFB 2HRUA 3C9RA 1NQ3A 5IT9M 5EAZA 1XBIA 3IEQA 1S72F 3FD5A 3CC2F 2I6DA 3S0HA 1X7OA 3CPQA 3B6NA 5BMVB 1VQMF 3CC4F 2H8EA 5EZYB 1VQVA 1W5BA 5LYJA 5HY1A 2VXYA 1VQ5F 2NMUA 2KTUA 3KIZA 2IAFA 3E22B 3E1YA 3HKBA 2CWJA 4G4XA 3CCMF 3ZP4A 3RYIB 4BT6A 2FGYA 3LWPC 2UYNB 2OHWA 5KX5B 2WALA 3ERNA 5JCOC 1W3EX 3N2GA 1QU9A 4IIJB 4DRXB 1KD1H 3OBYA 1TVKB 2VAPA 2HX0A 1QAHA 3VCZA 2VGNA 5LP6A 5GANK 3NVIB 2KGWA 3MQWA 3RYHA 1N8RH 3EORA 5IJ0B 3BYQA 4C81A 3LWQC 1X25A 1VQPF 4EB6A 5GIOC 4ZHWA 2OZBA 5J2TB 3HKCA 3UT5B 1TUBB 2AIFA 4LNUA 5CA0A 2UYJA 3HWUA 5JQGA 4BT5A 4ZHQB 2HS3A 2UZHA 1YJ9F 5MN5A 4X20A 3JASA 3P10A 4FFBA 3F0DA 3JATA 4I4TA 4X1YA 3GTZA 1SZQA 3M1XA 3KE1A 2CVLA 3CCJF 3WGNA 3T80A 2G9IA 4YJ2A 3WXMB 4ZOLA 3IMPA 5JH7A 4LCKA 2W8BC 2ALEA 3CMAF 1KC8H 2BO1A 3S06A 3JARB 2LBTA 1KNKA 5IJ9B 2HP0B 1U43A 2QTPA 5GONA 4DXDA 4G4VA 2EWCA 2VAWA 5G4VC 1FNKA 4HNAB 3HKDA 3KHNA 5JCOA 3F0EA 5LA6A 4TZZA 1VQNF 3MCAB 2Q1XA 3ESJA 3L7QA 5CA1B 2BTUA 3VOAA 4BT7A 4X1KB 4TV9B 2YXZA 3QUWA 4U3JB 3JALB 1Z5VA 1QVGF 5J2UB 3NMUC 3MBMA 5BMVA 1IV4A 4BVTA 3AGKA 5EZYA 1KQSF 1J7HA 3MDOA 2H8CA 5EYPB 1U40A 3VYSC 1VK3A 2R751 3QHDA 5EWRA 4WBNB 3E22A 3CCUF 3V7EA 2LBXA 1UI9A 1QD9A 2CHTA 3RYIA 2CW4A 1GO1A 2UYNA 5C8YB 5KX5A 3P4EA 4ZHVA 4O2AB 3LWOC 2FC3A 4TV8B 3HTNA 1GO0A 2ZOVA 1XHOA 1OFUA 3JAKB 5HXUA 2RB9A 4IIJA 4DRXA 4B45A 3CB2A 1TVKA 1FNJA 3LMEA 3NK6A 1SDSA 1RQ2A 4C8EA 4C8IA 2ZAUA 4C4WC 2L26A 5DCVA 4BY9D 2OTLF 1PF5A 4C8GA 3N2KA 1YHQF 5IJ0A 3S0YA 1YGYA 3LFOA 3TD5A 1Q82H 1DT9A 3CG6A 1ONIA 1FFXB 5HP8A 2IQQA 5J2TA 3UT5A 1TUBA 1UFYA 3RYCB 4I50B 2OTMA 3DDNA 1QVFF 3WJQA 2YYEA 4RQOA 4ZHQA 5ITZB 3CPWF 5FJ4C 3CXCF 5FNVB 3WGJA 1ZWZA 3RA5A 5LOVB 4B46A 5FLXM 5LXTA 4O4JB 3KJJA 3CCLF 2K1SA 3JVHA 3RYFB 3K12A 1VQOF 3C8LA 2RHJA 3N4YA 3WGMA 2HVYD 2ZVZA 4O4HA 1JFFA 2AIZP 3ZP7A 4NQ3A 3CD6F 3JARA 2GZLA 3QTYA 3NK7A 5IJ9A 3VO8A 2V9YA 3IKEA 2HP0A 4I55B 3C9SA 5EO3A 1SA0B 3F6MA 2DT4A 2UYKA 3J7AR 3HJWC 1W40A 1X7PA 3IKFA 1VQ7F 1YJNF 3C9TA 1COMA 4HNAA 2RHHA 1RLUA 1Q8RA 2QI2A 3KJKA 3TD3A 5CA1A 2LCAA 4YJ3A 1XV2A 5HWEA 2IG8A 3HKBB 3ELCA 3M4SA 4X1KA 4TV9A 3GHZA 2HP3A 4U3JA 3WGKA 2QA4F 3FPIA 1VHAA 3K14A 1CK2A 3LWVC 2MQEA 3WGLA 5MN6A 1K9MH 4NUTA 1VQ8F 3CYPB 3SIUA 5EYPA 3JAWB 5IYZB 1YQNA 5LP6B 2PMPA 4IHJB 4WBNA 1PXWA 1VQ6F 1IV2A 1JN1A 5B8FA 2F9ZC 3F0GA 4TUYB 4XCQA 3ON1A 3OW2F 2GVIA 2B33A 2RHOA 1VQ9F 5C8YA 1NMUB 3HKEB 3LYBA 1W5FA 2P6YA 3CCVF 3VIUA 3HKCB 1W2BF 5MN4A 3D54A 1IPAA 1T0KB 3PAFA 4O2AA 3G6EF 1H48A 3J80M 3JAKA 4O4IB 2VAMA 4G4WA 4ZI7B 3I56F 3J81M 4BW0B 2I6RA 2CHSA 2Z1EA 3FD6A 1VH8A 5HY2A 4F6RB 5JVDB 1W59A 2ZODA 4O2BB 5CB4B 1W41A 4X3MA 1FFXA 1U3LA 1W42A 4BT4A
chains in the Genus database with same CATH topology
3JAMM 3JCMM 3IR9A 2AIFA 3G4SF 1GZ0A 3LWRC 1QVFF 1RLGA 2KTVA 1YJWF 3CPWF 5GINC 3CXCF 1YJ9F 3SIVA 1JJ2F 1ZWZA 2JNBA 5GIPC 3RA5A 5FLXM 3CCLF 2VGMA 3O85A 5GAPK 1YI2F 1VQOF 1K73H 5A2QM 2HVYD 3N4YA 3RA6A 3CCJF 3G71F 1VQKF 3WXMB 1YITF 2CZWA 3NVKE 1H7MA 3N4ZA 1M1KH 4BVSA 4LCKA 2ALEA 2KG4A 3CMAF 4NQ3A 1KC8H 3CD6F 5G4UC 2BO1A 4EI8A 3NK7A 1CN7A 5EO3A 4EI9A 5HXZA 4BVRA 3HJWC 1W40A 3J7AR 1Q86H 4EI7A 3CCRF 1X7PA 2OTJF 2GLZA 1VQ7F 5G4VC 4BVQA 1E7KA 3HAXD 1YJNF 5HY4A 1NJIH 3OBWA 3V7QA 2QI2A 4TZZA 1Q7YH 1VQNF 3MCAB 3VMFB 1RA4A 5HWEA 3D00A 2LBWA 5IT9M 5HY0A 1XBIA 1S72F 2QA4F 3CC2F 2I6DA 3CC7F 1CK2A 3VI6A 3LWVC 1QVGF 1X7OA 1K9MH 3CPQA 3NMUC 4NUTA 1VQ8F 3FFMA 3CCSF 3SIUA 4BVTA 1VQMF 3I55F 3AGKA 1KQSF 3CC4F 3PLAC 1VQ4F 5EWRA 5HY1A 1PXWA 4X3LA 1VQ6F 1VQ5F 2F9ZC 2KTUA 3CCUF 3V7EA 4XCQA 3ON1A 3OW2F 3E1YA 2LBXA 1VQ9F 3CCMF 3V3TA 1M90H 1NMUB 1GO1A 2FGYA 1X52A 3LWPC 3CCVF 1Q81H 1W2BF 2OHWA 2WALA 1IPAA 1T0KB 3CCQF 3PAFA 2OZBA 3LWOC 2FC3A 3G6EF 3J80M 1W3EX 1GO0A 3I56F 5HXUA 3J81M 4BW0B 1KD1H 3NK6A 3OBYA 1SDSA 5DCVA 1YIJF 4C4WC 5GANK 2VGNA 4BY9D 5HY2A 3CCEF 2OTLF 3NVIB 3E20B 1VQLF 1N8RH 1YHQF 3GYQA 2QEXF 3LFOA 1W41A 1Q82H 1DT9A 3LWQC 4X3MA 3CG6A 1VQPF 5GIOC 1W42A 3CMEF 5FJ4C 1K8AH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM M;  3JCM M;  3IR9 A;  2AIF A;  3G4S F;  1GZ0 A;  3LWR C;  1QVF F;  1RLG A;  2KTV A;  1YJW F;  3CPW F;  5GIN C;  3CXC F;  1YJ9 F;  3SIV A;  1JJ2 F;  1ZWZ A;  2JNB A;  5GIP C;  3RA5 A;  5FLX M;  3CCL F;  2VGM A;  3O85 A;  5GAP K;  1YI2 F;  1VQO F;  1K73 H;  5A2Q M;  2HVY D;  3N4Y A;  3RA6 A;  3CCJ F;  3G71 F;  1VQK F;  3WXM B;  1YIT F;  2CZW A;  3NVK E;  1H7M A;  3N4Z A;  1M1K H;  4LCK A;  2ALE A;  2KG4 A;  3CMA F;  1KC8 H;  3CD6 F;  5G4U C;  2BO1 A;  3NK7 A;  1CN7 A;  5EO3 A;  3J7A R;  3HJW C;  1W40 A;  1Q86 H;  3CCR F;  1X7P A;  2OTJ F;  1VQ7 F;  5G4V C;  1E7K A;  3HAX D;  1YJN F;  1NJI H;  3OBW A;  3V7Q A;  2QI2 A;  4TZZ A;  1Q7Y H;  1VQN F;  3MCA B;  3VMF B;  1RA4 A;  2LBW A;  5IT9 M;  1XBI A;  1S72 F;  2QA4 F;  3CC2 F;  2I6D A;  3CC7 F;  1CK2 A;  3VI6 A;  3LWV C;  1QVG F;  1X7O A;  1K9M H;  3CPQ A;  3NMU C;  4NUT A;  1VQ8 F;  3FFM A;  3CCS F;  3SIU A;  1VQM F;  3I55 F;  3AGK A;  1KQS F;  3CC4 F;  3PLA C;  1VQ4 F;  5EWR A;  1PXW A;  4X3L A;  1VQ6 F;  1VQ5 F;  2KTU A;  3CCU F;  3V7E A;  3ON1 A;  3OW2 F;  3E1Y A;  2LBX A;  1VQ9 F;  3CCM F;  1M90 H;  1NMU B;  1GO1 A;  1X52 A;  3LWP C;  3CCV F;  1Q81 H;  1W2B F;  2OHW A;  2WAL A;  1IPA A;  1T0K B;  3CCQ F;  3PAF A;  2OZB A;  3LWO C;  2FC3 A;  3G6E F;  3J80 M;  1W3E X;  1GO0 A;  3I56 F;  3J81 M;  4BW0 B;  1KD1 H;  3NK6 A;  3OBY A;  1SDS A;  5DCV A;  1YIJ F;  4C4W C;  5GAN K;  2VGN A;  4BY9 D;  3CCE F;  2OTL F;  3NVI B;  3E20 B;  1VQL F;  1N8R H;  1YHQ F;  3GYQ A;  2QEX F;  3LFO A;  1W41 A;  1Q82 H;  1DT9 A;  3LWQ C;  4X3M A;  3CG6 A;  1VQP F;  5GIO C;  1W42 A;  3CME F;  5FJ4 C;  1K8A H; 
#chains in the Genus database with same CATH topology
 3RYC A;  4I50 A;  2HQS C;  3IR9 A;  3G4S F;  1GZ0 A;  2Z01 A;  5LP6 C;  3LWR C;  1RLG A;  5ITZ A;  2H6L A;  2KTV A;  3VOB A;  3U0O A;  1OAP A;  1FSZ A;  2RHL A;  1JJ2 F;  5LOV A;  4O4J A;  2DYY A;  1W5A A;  3K2X A;  3RYF A;  2VGM A;  4ZHY B;  1ODE A;  1YI2 F;  4PWT A;  5A2Q M;  4R40 B;  1VQK F;  1YIT F;  2CZW A;  4E6E A;  3NVK E;  3N4Z A;  1M1K H;  4BVS A;  2UYP A;  3P0Z A;  3ZOP A;  4G4Z A;  3MCQ A;  3WPW A;  4EI8 A;  4I55 A;  1SA0 A;  4EI9 A;  4RHA A;  4O4L B;  1Q86 H;  4EI7 A;  5KMG B;  3CCR F;  2GLZ A;  4BVQ A;  5EB0 A;  2R6R 1;  5HY4 A;  2Z1T A;  3OBW A;  5AVM A;  4X1I B;  1Q7Y H;  5EIB D;  1RA4 A;  3D01 A;  3D00 A;  2LBW A;  3VTI C;  5HY0 A;  4G88 A;  2ZVY A;  3CC7 F;  3OON A;  2Z1F A;  2BTQ B;  3VI6 A;  2AMT A;  3I3F A;  3FFM A;  3CCS F;  3I55 F;  3JAW A;  3WJP A;  5IYZ A;  3F0F A;  3PLA C;  4BT2 A;  3V4D A;  1VQ4 F;  1U3P A;  4IHJ A;  3S03 A;  5LYJ B;  1IV1 A;  1JD1 A;  4X3L A;  2BTO A;  4TUY A;  3N2K B;  2PHN A;  1W55 A;  3V3T A;  1XRG A;  3HKE A;  1M90 H;  3M84 A;  1IV3 A;  1X52 A;  3FBA A;  1Q81 H;  3JAL A;  3CCQ F;  5J2U A;  1CLI A;  4O4I A;  3VYU C;  4U39 A;  4ZI7 A;  2Z1U A;  3TD4 A;  3N2G B;  3WJR A;  1JY8 A;  4ZK7 A;  4KWE A;  1W58 1;  2HRY A;  1YIJ F;  1KNJ A;  5LXT B;  4F6R A;  3K0T A;  5JVD A;  3CCE F;  3CYQ A;  3E20 B;  1VQL F;  2N48 A;  4O2B A;  3RYH B;  2HS4 A;  3GYQ A;  5CB4 A;  2QEX F;  3R0P A;  1Z5W A;  4O4H B;  4EB6 B;  3CME F;  3DC2 A;  1JFF B;  1K8A H;  3JAM M;  5EIB C;  3JCM M;  3S0W A;  4NWO B;  4LNU B;  5CA0 B;  1H47 A;  5HP7 A;  1DBF A;  1W57 A;  5JQG B;  4TV8 A;  2CSL A;  5GIN C;  1YJW F;  3SIV A;  4BT3 A;  1T0A A;  2JNB A;  4B5C A;  5GIP C;  4B62 A;  4X20 B;  3JAS B;  4FFB B;  4I4T B;  3JAT B;  4X1Y B;  3Q8H A;  2ZF8 A;  3O85 A;  1GX1 A;  4YJ3 B;  1R1M A;  5EB1 B;  4ERH A;  5GAP K;  1K73 H;  3RA6 A;  3LDT A;  3G71 F;  3S02 A;  4YJ2 B;  1H7M A;  3RE3 A;  4ZOL B;  5JH7 B;  3IEW A;  2KG4 A;  1W5E A;  3I7T A;  5G4U C;  3VYT C;  1CN7 A;  3WPX A;  4O4L A;  5HXZ A;  4BVR A;  5KMG A;  4G4Y A;  4M8I A;  2Q1Y A;  2HS0 A;  5FNV A;  5GON B;  2OTJ F;  1E7K A;  3HAX D;  3ZO8 A;  1RQ7 A;  1NJI H;  4X1I A;  3V7Q A;  4C82 A;  3HKD B;  5LA6 B;  3C9U A;  3VMF B;  2HRU A;  3C9R A;  1NQ3 A;  5IT9 M;  5EAZ A;  1XBI A;  3IEQ A;  1S72 F;  3FD5 A;  3CC2 F;  2I6D A;  3S0H A;  1X7O A;  3CPQ A;  3B6N A;  5BMV B;  1VQM F;  3CC4 F;  2H8E A;  5EZY B;  1VQV A;  1W5B A;  5LYJ A;  5HY1 A;  2VXY A;  1VQ5 F;  2NMU A;  2KTU A;  3KIZ A;  2IAF A;  3E22 B;  3E1Y A;  3HKB A;  2CWJ A;  4G4X A;  3CCM F;  3ZP4 A;  3RYI B;  4BT6 A;  2FGY A;  3LWP C;  2UYN B;  2OHW A;  5KX5 B;  2WAL A;  3ERN A;  5JCO C;  1W3E X;  3N2G A;  1QU9 A;  4IIJ B;  4DRX B;  1KD1 H;  3OBY A;  1TVK B;  2VAP A;  2HX0 A;  1QAH A;  3VCZ A;  2VGN A;  5LP6 A;  5GAN K;  3NVI B;  2KGW A;  3MQW A;  3RYH A;  1N8R H;  3EOR A;  5IJ0 B;  3BYQ A;  4C81 A;  3LWQ C;  1X25 A;  1VQP F;  4EB6 A;  5GIO C;  4ZHW A;  2OZB A;  5J2T B;  3HKC A;  3UT5 B;  1TUB B;  2AIF A;  4LNU A;  5CA0 A;  2UYJ A;  3HWU A;  5JQG A;  4BT5 A;  4ZHQ B;  2HS3 A;  2UZH A;  1YJ9 F;  5MN5 A;  4X20 A;  3JAS A;  3P10 A;  4FFB A;  3F0D A;  3JAT A;  4I4T A;  4X1Y A;  3GTZ A;  1SZQ A;  3M1X A;  3KE1 A;  2CVL A;  3CCJ F;  3WGN A;  3T80 A;  2G9I A;  4YJ2 A;  3WXM B;  4ZOL A;  3IMP A;  5JH7 A;  4LCK A;  2W8B C;  2ALE A;  3CMA F;  1KC8 H;  2BO1 A;  3S06 A;  3JAR B;  2LBT A;  1KNK A;  5IJ9 B;  2HP0 B;  1U43 A;  2QTP A;  5GON A;  4DXD A;  4G4V A;  2EWC A;  2VAW A;  5G4V C;  1FNK A;  4HNA B;  3HKD A;  3KHN A;  5JCO A;  3F0E A;  5LA6 A;  4TZZ A;  1VQN F;  3MCA B;  2Q1X A;  3ESJ A;  3L7Q A;  5CA1 B;  2BTU A;  3VOA A;  4BT7 A;  4X1K B;  4TV9 B;  2YXZ A;  3QUW A;  4U3J B;  3JAL B;  1Z5V A;  1QVG F;  5J2U B;  3NMU C;  3MBM A;  5BMV A;  1IV4 A;  4BVT A;  3AGK A;  5EZY A;  1KQS F;  1J7H A;  3MDO A;  2H8C A;  5EYP B;  1U40 A;  3VYS C;  1VK3 A;  2R75 1;  3QHD A;  5EWR A;  4WBN B;  3E22 A;  3CCU F;  3V7E A;  2LBX A;  1UI9 A;  1QD9 A;  2CHT A;  3RYI A;  2CW4 A;  1GO1 A;  2UYN A;  5C8Y B;  5KX5 A;  3P4E A;  4ZHV A;  4O2A B;  3LWO C;  2FC3 A;  4TV8 B;  3HTN A;  1GO0 A;  2ZOV A;  1XHO A;  1OFU A;  3JAK B;  5HXU A;  2RB9 A;  4IIJ A;  4DRX A;  4B45 A;  3CB2 A;  1TVK A;  1FNJ A;  3LME A;  3NK6 A;  1SDS A;  1RQ2 A;  4C8E A;  4C8I A;  2ZAU A;  4C4W C;  2L26 A;  5DCV A;  4BY9 D;  2OTL F;  1PF5 A;  4C8G A;  3N2K A;  1YHQ F;  5IJ0 A;  3S0Y A;  1YGY A;  3LFO A;  3TD5 A;  1Q82 H;  1DT9 A;  3CG6 A;  1ONI A;  1FFX B;  5HP8 A;  2IQQ A;  5J2T A;  3UT5 A;  1TUB A;  1UFY A;  3RYC B;  4I50 B;  2OTM A;  3DDN A;  1QVF F;  3WJQ A;  2YYE A;  4RQO A;  4ZHQ A;  5ITZ B;  3CPW F;  5FJ4 C;  3CXC F;  5FNV B;  3WGJ A;  1ZWZ A;  3RA5 A;  5LOV B;  4B46 A;  5FLX M;  5LXT A;  4O4J B;  3KJJ A;  3CCL F;  2K1S A;  3JVH A;  3RYF B;  3K12 A;  1VQO F;  3C8L A;  2RHJ A;  3N4Y A;  3WGM A;  2HVY D;  2ZVZ A;  4O4H A;  1JFF A;  2AIZ P;  3ZP7 A;  4NQ3 A;  3CD6 F;  3JAR A;  2GZL A;  3QTY A;  3NK7 A;  5IJ9 A;  3VO8 A;  2V9Y A;  3IKE A;  2HP0 A;  4I55 B;  3C9S A;  5EO3 A;  1SA0 B;  3F6M A;  2DT4 A;  2UYK A;  3J7A R;  3HJW C;  1W40 A;  1X7P A;  3IKF A;  1VQ7 F;  1YJN F;  3C9T A;  1COM A;  4HNA A;  2RHH A;  1RLU A;  1Q8R A;  2QI2 A;  3KJK A;  3TD3 A;  5CA1 A;  2LCA A;  4YJ3 A;  1XV2 A;  5HWE A;  2IG8 A;  3HKB B;  3ELC A;  3M4S A;  4X1K A;  4TV9 A;  3GHZ A;  2HP3 A;  4U3J A;  3WGK A;  2QA4 F;  3FPI A;  1VHA A;  3K14 A;  1CK2 A;  3LWV C;  2MQE A;  3WGL A;  5MN6 A;  1K9M H;  4NUT A;  1VQ8 F;  3CYP B;  3SIU A;  5EYP A;  3JAW B;  5IYZ B;  1YQN A;  5LP6 B;  2PMP A;  4IHJ B;  4WBN A;  1PXW A;  1VQ6 F;  1IV2 A;  1JN1 A;  5B8F A;  2F9Z C;  3F0G A;  4TUY B;  4XCQ A;  3ON1 A;  3OW2 F;  2GVI A;  2B33 A;  2RHO A;  1VQ9 F;  5C8Y A;  1NMU B;  3HKE B;  3LYB A;  1W5F A;  2P6Y A;  3CCV F;  3VIU A;  3HKC B;  1W2B F;  5MN4 A;  3D54 A;  1IPA A;  1T0K B;  3PAF A;  4O2A A;  3G6E F;  1H48 A;  3J80 M;  3JAK A;  4O4I B;  2VAM A;  4G4W A;  4ZI7 B;  3I56 F;  3J81 M;  4BW0 B;  2I6R A;  2CHS A;  2Z1E A;  3FD6 A;  1VH8 A;  5HY2 A;  4F6R B;  5JVD B;  1W59 A;  2ZOD A;  4O2B B;  5CB4 B;  1W41 A;  4X3M A;  1FFX A;  1U3L A;  1W42 A;  4BT4 A; 
#chains in the Genus database with same CATH homology
 3JAM M;  3JCM M;  3IR9 A;  2AIF A;  3G4S F;  1GZ0 A;  3LWR C;  1QVF F;  1RLG A;  2KTV A;  1YJW F;  3CPW F;  5GIN C;  3CXC F;  1YJ9 F;  3SIV A;  1JJ2 F;  1ZWZ A;  2JNB A;  5GIP C;  3RA5 A;  5FLX M;  3CCL F;  2VGM A;  3O85 A;  5GAP K;  1YI2 F;  1VQO F;  1K73 H;  5A2Q M;  2HVY D;  3N4Y A;  3RA6 A;  3CCJ F;  3G71 F;  1VQK F;  3WXM B;  1YIT F;  2CZW A;  3NVK E;  1H7M A;  3N4Z A;  1M1K H;  4BVS A;  4LCK A;  2ALE A;  2KG4 A;  3CMA F;  4NQ3 A;  1KC8 H;  3CD6 F;  5G4U C;  2BO1 A;  4EI8 A;  3NK7 A;  1CN7 A;  5EO3 A;  4EI9 A;  5HXZ A;  4BVR A;  3HJW C;  1W40 A;  3J7A R;  1Q86 H;  4EI7 A;  3CCR F;  1X7P A;  2OTJ F;  2GLZ A;  1VQ7 F;  5G4V C;  4BVQ A;  1E7K A;  3HAX D;  1YJN F;  5HY4 A;  1NJI H;  3OBW A;  3V7Q A;  2QI2 A;  4TZZ A;  1Q7Y H;  1VQN F;  3MCA B;  3VMF B;  1RA4 A;  5HWE A;  3D00 A;  2LBW A;  5IT9 M;  5HY0 A;  1XBI A;  1S72 F;  2QA4 F;  3CC2 F;  2I6D A;  3CC7 F;  1CK2 A;  3VI6 A;  3LWV C;  1QVG F;  1X7O A;  1K9M H;  3CPQ A;  3NMU C;  4NUT A;  1VQ8 F;  3FFM A;  3CCS F;  3SIU A;  4BVT A;  1VQM F;  3I55 F;  3AGK A;  1KQS F;  3CC4 F;  3PLA C;  1VQ4 F;  5EWR A;  5HY1 A;  1PXW A;  4X3L A;  1VQ6 F;  1VQ5 F;  2F9Z C;  2KTU A;  3CCU F;  3V7E A;  4XCQ A;  3ON1 A;  3OW2 F;  3E1Y A;  2LBX A;  1VQ9 F;  3CCM F;  3V3T A;  1M90 H;  1NMU B;  1GO1 A;  2FGY A;  1X52 A;  3LWP C;  3CCV F;  1Q81 H;  1W2B F;  2OHW A;  2WAL A;  1IPA A;  1T0K B;  3CCQ F;  3PAF A;  2OZB A;  3LWO C;  2FC3 A;  3G6E F;  3J80 M;  1W3E X;  1GO0 A;  3I56 F;  5HXU A;  3J81 M;  4BW0 B;  1KD1 H;  3NK6 A;  3OBY A;  1SDS A;  5DCV A;  1YIJ F;  4C4W C;  5GAN K;  2VGN A;  4BY9 D;  5HY2 A;  3CCE F;  2OTL F;  3NVI B;  3E20 B;  1VQL F;  1N8R H;  1YHQ F;  3GYQ A;  2QEX F;  3LFO A;  1W41 A;  1Q82 H;  1DT9 A;  3LWQ C;  4X3M A;  3CG6 A;  1VQP F;  5GIO C;  1W42 A;  3CME F;  5FJ4 C;  1K8A H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...