1CK7A

Gelatinase a (full-length)
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
630
structure length
619
Chain Sequence
PSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of human pro-matrix metalloproteinase-2: activation mechanism revealed.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PROTEIN (GELATINASE A)
total genus 133
structure length 619
sequence length 630
ec nomenclature ec 3.4.24.24: Gelatinase A.
pdb deposition date 1999-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
A PF00045 Hemopexin Hemopexin
A PF00413 Peptidase_M10 Matrixin
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1ck7A02
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1ck7A04
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1ck7A03
2.110.10.10 Mainly Beta 4 Propeller Hemopexin Hemopexin-like domain 1ck7A05
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1ck7A01
3O2XA 3LK8A 1C7KA 1XFUA 1BUVM 2D1NA 2HU6A 5D1SA 1A86A 2OI0A 4G0DA 3LQ0A 5CUHA 1CGLA 1USNA 4H1QA 5D3CA 1BUDA 4L19A 5I4OA 4JA1A 3LJZA 3VI1A 1A85A 3DPEA 1QHUA 2L0RA 3V6NA 1JIZA 2JIHA 1RMZA 1OS9A 1ROSA 5D1UA 4H3XA 3P24A 1XFYA 1AKLA 4FXYP 1R1IA 3KEKA 3F18A 1ITVA 1CK7A 2OZRA 1O0QA 4JP4A 1QO6A 1KUHA 1YQYA 1YP1A 3EDIA 2A8HA 1XUDA 3LUMA 3LQBA 1UTTA 1D8MA 1DTHA 1ND1A 1UEAA 2OXUA 2FV9A 3S18A 2XS4A 3V96B 1G9KA 3K7NA 1BIWA 2CLTA 1QJSA 2ERQA 3DSLA 1E8BA 4Q1LA 5LABA 1B3DA 4JPAA 3LGPA 5CXAA 2MLSA 1XFWA 3F17A 3HB2P 4I35A 3RTSA 3LILA 1BSWA 3HBVP 1JJ9A 1FLSA 3F16A 1SMPA 1Y8JA 5D7WA 2W14A 2OVXA 2MZEA 3LEAA 1QIAA 3AIGA 4FVLA 3Q2HA 1HV5A 1HXNA 1ATLA 1BQQM 1QJJA 2N8RA 3G5CA 2DDYA 3BA0A 1OO9A 4PKSA 5BOYA 2O3EA 5BOTA 1XFZA 1ZXVA 3E8RA 1GE6A 2JT5A 1OM8A 2OXWA 1BKCI 4GR0A 3F15A 2POJA 3KMCA 1IAGA 5JMYA 1CAQA 1QJIA 2MLRA 456CA 4JQGA 3EDHA 4L63A 1PWPA 4XM6A 4QKZA 1RM8A 2K2GA 3I7IA 4H82A 2WOAA 3LKAA 3OHOA 2Y6DA 3LJGA 1KUGA 4XBHA 2JSDA 1KS0A 3AYKA 2E3XA 2PJTA 3U1RA 3KEJA 1G12A 3EDGA 830CA 1OMJA 3LE9A 2YIGA 1R1JA 3O64A 2KRJA 1R1HA 3LMCA 1CXVA 3KHIA 5CZMA 3DPFA 1C8TA 4LL2A 3EDZA 1WNIA 2AIGP 2OW9A 1BM6A 1JIWP 1PWWA 3UVCA 1JAOA 2J83A 1JANA 1D7XA 4ZR5A 2RJQA 2MQSA 1J7NA 3DNGA 4AXQA 3RTTA 2ERPA 1EB6A 3OHLA 2Y6CA 3WV3A 1EUBA 2W12A 1IAAA 1OM6A 3NX7A 2DW1A 1PWQA 1IACA 3DL1A 1D5JA 2X3CA 3C7XA 1C3IA 1MMBA 2V5OA 4HMAA 4ON1A 4DPEA 2DW2A 1JH1A 1YCMA 2RJPA 4AIGA 1HY7A 4FXQA 1XFVA 1S4BP 966CA 2TCLA 5I43A 3ZUKA 1QICA 2E2DA 2JXYA 1MNCA 3TT4A 3VTGA 1HFCA 1MMQA 1Q3AA 1CQRA 1ZTQA 4WKIA 2FN2A 3KECA 4DV8A 1JAQA 1JK3A 1EAKA 3DWBA 3N2UA 1Z3JA 3EWJA 2USNA 1KUKA 1GKCA 1PDCA 1CXWA 4OEIA 4GQLA 3F1AA 2W15A 2D1OA 3B8ZA 1L6JA 2MZIA 1E88A 3OYOA 3HYGA 1GENA 3LUNA 3CKIA 1OM7A 1DMTA 2OW0A 1J7MA 2OY4A 1GKDA 1G4KA 1ZS0A 4HX3A 4DD8A 4IJOA 2OVZA 4IUWA 2V4BA 1UMTA 4R3VA 4XM7A 1FM1A 4AYKA 1SATA 4CTHA 3HY9A 1H8PA 4PKVA 2DDFA 3Q2GA 1R54A 3MA2A 4XCTA 2OW1A 4A7BA 4WZVA 5L79A 5D1TA 4L6TA 2X3AA 5D2BA 2WO8A 1CGEA 3MQLA 1B8YA 1CGFA 2X3BA 2OY2A 2Z2DA 4WKEA 4H76A 3L0TA 3N2VA 3K7LA 1D8FA 1XUCA 3AYUA 4G9LA 2CKIA 4GF1A 4A3WA 2AYKA 4YEHA 3USNA 1YOUA 4H84A 3B92A 4I03A 2EROA 1IADA 1OS2A 1GE5A 1FBLA 3KWVC 2XS3A 1BZSA 2WO9A 2FV5A 3HDBA 4PKQA 3B2ZA 3TVCA 1AYKA 1UMSA 3F19A 1KUFA 5I0LA 1K7GA 1IABA 4EFSA 3KMEA 2QPJA 1ASTA 1GE7A 1AF0A 1I1IP 1HFSA 3M7PA 1IAEA 2JNPA 3TSKA 4DF9A 1JAPA 4H49A 3TS4A 1KUIA 1G05A 5B5OA 1JKYA 1SLNA 2W13A 1KBCA 4GUYA 2J0TA 2DW0A 3HBUP 1R55A 1CIZA 4GWNA 4ILWD 1RTGA 1Y0VA 4XM8A 2OXZA 1I76A 1QIBA 4WF6A 1SRPA 1SU3A 1KAPP 4H2EA 4HSDA 4GR8A 2W0DA 3GBOA 1PWVA 1XFXA 4GWMA 1PWUA 1K7IA 2K9CA 4PKRA 2O36A 2I47A 1K7QA 2MZHA 3HDAP 1UTZA 2SRTA 3SHIA 1GO7P 1HOVA 1GXDA 3LIRA 3LJTA 4IN9A 3WV2A 1ZXCA 1HTDA 4PKTA 1ZVXA 3ZXHA 4AUOA 1MMPA 2X7MA 1SLMA 1Y93A 1G49A 3KRYA 4WK7A 2OW2A 1PEXA 1H71P 1BKCA 5I2ZA 4H30A 3ELMA 5H8XA 1XURA 1ZP5A 1GO8P 4JIJA 1O0TA 3L0VA 3WV1A 3LIKA 4GR3A 1BQOA 3P1VA 3G42A 4PKWA 3LP9A 3I7GA 4J4MA 5BPAA 3EHXA 1I73A 1MMRA 5B5PA 4PKUA 5I3MA 5I12A 4FU4A 3HY7A 1BKCE 4RT6B 2YB9A 1QUAA 3EHYA 2JT6A 3ZVSA 5L7FA
chains in the Genus database with same CATH superfamily
3O2XA 2Y2KA 3LK8A 1C7KA 2Y2IA 1XFUA 1BUVM 2D1NA 2HU6A 5D1SA 1A86A 2OI0A 4G0DA 3LQ0A 5CUHA 1E15A 1CGLA 1USNA 4H1QA 5D3CA 1BUDA 4L19A 5I4OA 4JA1A 3LJZA 3VI1A 1A85A 3KS4A 4GHLA 3DPEA 1QHUA 2L0RA 3V6NA 1JIZA 2JIHA 3DTIA 1RMZA 1OS9A 1ROSA 5D1UA 4H3XA 3P24A 1XFYA 1W1TA 1AKLA 4FXYP 1R1IA 3KEKA 3F18A 1ITVA 1CK7A 2OZRA 1O0QA 1YU4A 2Y2HA 4JP4A 1QO6A 1KUHA 1YQYA 1YP1A 3EDIA 2A8HA 1XUDA 3LUMA 3LQBA 1UTTA 1D8MA 4Z2KA 1DTHA 1H0IA 1ND1A 1UEAA 4HMCA 2OXUA 2FV9A 3S18A 1XAXA 2XS4A 3V96B 1OGGA 1G9KA 3K7NA 1BIWA 2CLTA 1GOIA 1QJSA 2Y2MA 4Z2HA 2ERQA 3DSLA 1E8BA 4NYYA 4Q1LA 5LABA 1B3DA 3L29A 4MB3A 1H0GA 2Y2OA 4JPAA 4Z2JA 5BPVA 3LGPA 5CXAA 2MLSA 1XFWA 3F17A 3HB2P 4I35A 3RTSA 3LILA 1BSWA 3HBVP 3L25A 1JJ9A 1FLSA 3F16A 1SMPA 1Y8JA 4GHAA 5D7WA 4NZ1A 2XD1A 2W14A 2OVXA 2MZEA 3LEAA 1W1PA 3DTEA 1QIAA 1E6ZA 3AIGA 4FVLA 3Q2HA 1HV5A 1HXNA 1ATLA 1BQQM 1QJJA 2N8RA 3G5CA 2DDYA 3HONA 4HMEA 3BA0A 1OO9A 4PKSA 5BOYA 2O3EA 5BOTA 1XFZA 4IBBA 1ZXVA 3WD0A 3E8RA 1GE6A 2JT5A 1OM8A 2OXWA 1BKCI 4GR0A 3F15A 4OJ6A 2POJA 3KMCA 1IAGA 4IBGA 1W1VA 5JMYA 4IBIA 1CAQA 1QJIA 2MLRA 456CA 4QNLA 4JQGA 3EDHA 4L63A 1PWPA 4XM6A 4QKZA 1RM8A 2K2GA 3I7IA 1YU3A 2WOAA 4H82A 3LKAA 3OHOA 2Y6DA 3LJGA 1KUGA 4XBHA 2JSDA 1KS0A 3AYKA 2E3XA 2PJTA 3DTKA 3U1RA 3KEJA 1G12A 3EDGA 4IBFA 830CA 1OMJA 3LE9A 2YIGA 1R1JA 3O64A 2KRJA 1R1HA 3LMCA 1CXVA 3KHIA 4IBJA 5CZMA 3DPFA 1C8TA 4LL2A 1O6IA 1WNIA 2AIGP 2OW9A 3EDZA 1BM6A 1JIWP 1PWWA 3UVCA 1JAOA 2J83A 3N3FA 1JANA 1D7XA 4ZR5A 2RJQA 2MQSA 4TX8A 1J7NA 3DNGA 4AXQA 3RTTA 2Y2PA 2ERPA 1EB6A 3OHLA 2Y6CA 3WV3A 1EUBA 2W12A 1UR8A 1IAAA 4OJPA 1OM6A 3NX7A 2DW1A 1PWQA 1IACA 4Z2LA 4NZ4A 3DL1A 1D5JA 2X3CA 3C7XA 2Y2GA 1C3IA 1MMBA 2V5OA 4HMAA 4ON1A 4DPEA 2DW2A 1JH1A 2IOUA 1YCMA 2RJPA 4AIGA 4IJFA 4NY2A 1HY7A 4FXQA 1GPFA 1XFVA 4L7AA 1S4BP 3WD3A 4HMDA 966CA 2TCLA 5I43A 3ZUKA 1QICA 2E2DA 2JXYA 1MNCA 1YUEA 3TT4A 3VTGA 1HFCA 1MMQA 4OJ5A 1Q3AA 1CQRA 1ZTQA 4WKIA 2FN2A 3KECA 1OGBA 4DV8A 1JAQA 1JK3A 1EAKA 3DWBA 2Y2JA 1Z3JA 3N2UA 3EWJA 2USNA 1KUKA 1OZ9A 2D49A 1GKCA 2BG1A 1PDCA 1CXWA 4OEIA 3WD2A 4GQLA 3F1AA 2W15A 2D1OA 3B8ZA 1L6JA 2MZIA 1E88A 3OYOA 3HYGA 1GENA 3LUNA 3CKIA 1YU0A 1OM7A 1DMTA 2OW0A 1J7MA 2OY4A 1GKDA 1G4KA 1ZS0A 4HX3A 4DD8A 4IJOA 2OVZA 4IUWA 4MB5A 2V4BA 1UMTA 4R3VA 2UWXA 4IBCA 4NZ5A 4XM7A 1FM1A 4AYKA 1SATA 4CTHA 3HY9A 3L2AA 1H8PA 4PKVA 1YU2A 3HSHA 2DDFA 3Q2GA 1R54A 3MA2A 4XCTA 1YU1A 2OW1A 4A7BA 4WZVA 5L79A 2Y2LA 5D1TA 4L6TA 2X3AA 5D2BA 2WO8A 1CGEA 3MQLA 1B8YA 1CGFA 2X3BA 2OY2A 2Z2DA 4WKEA 1XM5A 4H76A 3L0TA 3N2VA 3K7LA 1D8FA 1XUCA 3AYUA 4G9LA 2CKIA 4GF1A 4A3WA 2AYKA 2Y2QA 4YEHA 3USNA 1YOUA 4H84A 3L28A 3B92A 4I03A 2EROA 1IADA 1OS2A 4NYUA 1GE5A 4Z2IA 1FBLA 3KWVC 2XS3A 4IBEA 1BZSA 2WO9A 2FV5A 3HDBA 4PKQA 3B2ZA 3TVCA 1AYKA 1UMSA 3F19A 1E6PA 4MB4A 1KUFA 5I0LA 1K7GA 3L27A 1IABA 4EFSA 3L26A 2QPJA 3KMEA 1ASTA 4NZ3A 1GE7A 1AF0A 1I1IP 1HFSA 3M7PA 3FKEA 1IAEA 2JNPA 3TSKA 1JAPA 4DF9A 4H49A 3TS4A 4IJEA 1G05A 1KUIA 5B5OA 4OJOA 1JKYA 1SLNA 1UR9A 3KS8A 1KBCA 2W13A 4GUYA 2J0TA 2DW0A 3HBUP 1R55A 1CIZA 4GWNA 3WD4A 4ILWD 1RTGA 2XD5A 1E6RA 1ED7A 1Y0VA 4XM8A 2OXZA 1I76A 1QIBA 4WF6A 1SRPA 1SU3A 4OUIA 1KAPP 4H2EA 4HSDA 2Y2NA 4GR8A 2W0DA 3GBOA 1PWVA 1XFXA 4GWMA 1PWUA 1K7IA 2K9CA 4PKRA 2O36A 4IBKA 2I47A 3WD1A 1K7QA 2YUFA 2MZHA 3HDAP 1UTZA 2SRTA 3SHIA 1GO7P 4OJLA 1E6NA 1HOVA 1GXDA 3LIRA 3LJTA 4IN9A 2RTSA 3WV2A 2JE5A 4IBDA 1ZXCA 1AIWA 1HTDA 4PKTA 1ZVXA 3ZXHA 4AUOA 1MMPA 1W1YA 2X7MA 1SLMA 1Y93A 1G49A 3KRYA 4WK7A 2OW2A 1PEXA 1H71P 1BKCA 5I2ZA 4H30A 3ELMA 4GH9A 5H8XA 1XURA 1ZP5A 1GO8P 4JIJA 1O0TA 3L0VA 3WV1A 3LIKA 4GR3A 1BQOA 3P1VA 3G42A 4PKWA 3LP9A 3I7GA 4J4MA 5BPAA 3EHXA 1I73A 1MMRA 5B5PA 4PKUA 5I3MA 5I12A 4FU4A 4LG2A 2JCHA 3HY7A 1BKCE 4Z2GA 4RT6B 2YB9A 3WX7A 2FFFB 1QUAA 3EHYA 2JT6A 3ZVSA 5L7FA 1TVIA
chains in the Genus database with same CATH topology
3O2XA 3LK8A 1C7KA 1XFUA 1BUVM 2D1NA 2HU6A 5D1SA 1A86A 2OI0A 4G0DA 3LQ0A 5CUHA 1CGLA 1USNA 4H1QA 5D3CA 1BUDA 4L19A 5I4OA 4JA1A 3LJZA 3VI1A 1A85A 3DPEA 1QHUA 2L0RA 3V6NA 1JIZA 3DTIA 2JIHA 1RMZA 1OS9A 1ROSA 5D1UA 4H3XA 3P24A 1XFYA 1AKLA 4FXYP 1R1IA 3KEKA 3F18A 1ITVA 1CK7A 2OZRA 1O0QA 4JP4A 1QO6A 1KUHA 1YQYA 1YP1A 3EDIA 2A8HA 1XUDA 3LUMA 3LQBA 1UTTA 1D8MA 1DTHA 1ND1A 1UEAA 2OXUA 2FV9A 3S18A 2XS4A 3V96B 1G9KA 3K7NA 1BIWA 2CLTA 1QJSA 2ERQA 3DSLA 1E8BA 4Q1LA 5LABA 1B3DA 4JPAA 3LGPA 5CXAA 2MLSA 1XFWA 3F17A 3HB2P 4I35A 3RTSA 3LILA 1BSWA 3HBVP 1JJ9A 1FLSA 3F16A 1SMPA 1Y8JA 5D7WA 2W14A 2OVXA 2MZEA 3LEAA 3DTEA 1QIAA 3AIGA 4FVLA 3Q2HA 1HV5A 1HXNA 1ATLA 1BQQM 1QJJA 2N8RA 3G5CA 2DDYA 3BA0A 1OO9A 4PKSA 5BOYA 2O3EA 5BOTA 1XFZA 1ZXVA 3E8RA 1GE6A 2JT5A 1OM8A 2OXWA 1BKCI 4GR0A 3F15A 2POJA 3KMCA 1IAGA 5JMYA 1CAQA 1QJIA 2MLRA 456CA 4JQGA 3EDHA 4L63A 1PWPA 4XM6A 4QKZA 1RM8A 2K2GA 3I7IA 4H82A 2WOAA 3LKAA 3OHOA 2Y6DA 3LJGA 1KUGA 4XBHA 2JSDA 1KS0A 3AYKA 2E3XA 2PJTA 3DTKA 3U1RA 3KEJA 1G12A 3EDGA 830CA 1OMJA 3LE9A 2YIGA 1R1JA 3O64A 2KRJA 1R1HA 3LMCA 1CXVA 3KHIA 5CZMA 3DPFA 1C8TA 4LL2A 3EDZA 1WNIA 2AIGP 2OW9A 1BM6A 1JIWP 1PWWA 3UVCA 1JAOA 2J83A 1JANA 1D7XA 4ZR5A 2RJQA 2MQSA 1J7NA 3DNGA 4AXQA 3RTTA 2ERPA 1EB6A 3OHLA 2Y6CA 3WV3A 1EUBA 2W12A 1IAAA 1OM6A 3NX7A 2DW1A 1PWQA 1IACA 3DL1A 1D5JA 2X3CA 3C7XA 1C3IA 1MMBA 2V5OA 4HMAA 4ON1A 4DPEA 2DW2A 1JH1A 1YCMA 2RJPA 4AIGA 1HY7A 4FXQA 1XFVA 4L7AA 1S4BP 966CA 2TCLA 5I43A 3ZUKA 1QICA 2E2DA 2JXYA 1MNCA 3TT4A 3VTGA 1HFCA 1MMQA 1Q3AA 1CQRA 1ZTQA 4WKIA 2FN2A 3KECA 4DV8A 1JAQA 1JK3A 1EAKA 3DWBA 3N2UA 1Z3JA 3EWJA 2USNA 1KUKA 1GKCA 1PDCA 1CXWA 4OEIA 4GQLA 3F1AA 2W15A 2D1OA 3B8ZA 1L6JA 2MZIA 1E88A 3OYOA 3HYGA 1GENA 3LUNA 3CKIA 1OM7A 1DMTA 2OW0A 1J7MA 2OY4A 1GKDA 1G4KA 1ZS0A 4HX3A 4DD8A 4IJOA 2OVZA 4IUWA 2V4BA 1UMTA 4R3VA 4XM7A 1FM1A 4AYKA 1SATA 4CTHA 3HY9A 1H8PA 4PKVA 2DDFA 3Q2GA 1R54A 3MA2A 4XCTA 2OW1A 4A7BA 4WZVA 5L79A 5D1TA 4L6TA 2X3AA 5D2BA 2WO8A 1CGEA 3MQLA 1B8YA 1CGFA 2X3BA 2OY2A 2Z2DA 4WKEA 4H76A 3L0TA 3N2VA 3K7LA 1D8FA 1XUCA 3AYUA 4G9LA 2CKIA 4GF1A 4A3WA 2AYKA 4YEHA 3USNA 1YOUA 4H84A 3B92A 4I03A 2EROA 1IADA 1OS2A 1GE5A 1FBLA 3KWVC 2XS3A 1BZSA 2WO9A 2FV5A 3HDBA 4PKQA 3B2ZA 3TVCA 1AYKA 1UMSA 3F19A 1KUFA 5I0LA 1K7GA 1IABA 4EFSA 3KMEA 2QPJA 1ASTA 1GE7A 1AF0A 1I1IP 1HFSA 3M7PA 1IAEA 2JNPA 3TSKA 4DF9A 1JAPA 4H49A 3TS4A 1KUIA 1G05A 5B5OA 1JKYA 1SLNA 2W13A 1KBCA 4GUYA 2J0TA 2DW0A 3HBUP 1R55A 1CIZA 4GWNA 4ILWD 1RTGA 1Y0VA 4XM8A 2OXZA 1I76A 1QIBA 4WF6A 1SRPA 1SU3A 1KAPP 4H2EA 4HSDA 4GR8A 2W0DA 3GBOA 1PWVA 1XFXA 4GWMA 1PWUA 1K7IA 2K9CA 4PKRA 2O36A 2YUFA 2I47A 1K7QA 2MZHA 3HDAP 1UTZA 2SRTA 3SHIA 1GO7P 1HOVA 1GXDA 3LIRA 3LJTA 4IN9A 3WV2A 1ZXCA 1HTDA 4PKTA 1ZVXA 3ZXHA 4AUOA 1MMPA 2X7MA 1SLMA 1Y93A 1G49A 3KRYA 4WK7A 2OW2A 1PEXA 1H71P 1BKCA 5I2ZA 4H30A 3ELMA 5H8XA 1XURA 1ZP5A 1GO8P 4JIJA 1O0TA 3L0VA 3WV1A 3LIKA 4GR3A 1BQOA 3P1VA 3G42A 4PKWA 3LP9A 3I7GA 4J4MA 5BPAA 3EHXA 1I73A 1MMRA 5B5PA 4PKUA 5I3MA 5I12A 4FU4A 3HY7A 1BKCE 4RT6B 2YB9A 1QUAA 3EHYA 2JT6A 3ZVSA 5L7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O2X A;  3LK8 A;  1C7K A;  1XFU A;  1BUV M;  2D1N A;  2HU6 A;  5D1S A;  1A86 A;  2OI0 A;  4G0D A;  3LQ0 A;  5CUH A;  1CGL A;  1USN A;  4H1Q A;  5D3C A;  1BUD A;  4L19 A;  5I4O A;  4JA1 A;  3LJZ A;  3VI1 A;  1A85 A;  3DPE A;  1QHU A;  2L0R A;  3V6N A;  1JIZ A;  2JIH A;  1RMZ A;  1OS9 A;  1ROS A;  5D1U A;  4H3X A;  3P24 A;  1XFY A;  1AKL A;  4FXY P;  1R1I A;  3KEK A;  3F18 A;  1ITV A;  1CK7 A;  2OZR A;  1O0Q A;  4JP4 A;  1QO6 A;  1KUH A;  1YQY A;  1YP1 A;  3EDI A;  2A8H A;  1XUD A;  3LUM A;  3LQB A;  1UTT A;  1D8M A;  1DTH A;  1ND1 A;  1UEA A;  2OXU A;  2FV9 A;  3S18 A;  2XS4 A;  3V96 B;  1G9K A;  3K7N A;  1BIW A;  2CLT A;  1QJS A;  2ERQ A;  3DSL A;  1E8B A;  4Q1L A;  5LAB A;  1B3D A;  4JPA A;  3LGP A;  5CXA A;  2MLS A;  1XFW A;  3F17 A;  3HB2 P;  4I35 A;  3RTS A;  3LIL A;  1BSW A;  3HBV P;  1JJ9 A;  1FLS A;  3F16 A;  1SMP A;  1Y8J A;  5D7W A;  2W14 A;  2OVX A;  2MZE A;  3LEA A;  1QIA A;  3AIG A;  4FVL A;  3Q2H A;  1HV5 A;  1HXN A;  1ATL A;  1BQQ M;  1QJJ A;  2N8R A;  3G5C A;  2DDY A;  3BA0 A;  1OO9 A;  4PKS A;  5BOY A;  2O3E A;  5BOT A;  1XFZ A;  1ZXV A;  3E8R A;  1GE6 A;  2JT5 A;  1OM8 A;  2OXW A;  1BKC I;  4GR0 A;  3F15 A;  2POJ A;  3KMC A;  1IAG A;  5JMY A;  1CAQ A;  1QJI A;  2MLR A;  456C A;  4JQG A;  3EDH A;  4L63 A;  1PWP A;  4XM6 A;  4QKZ A;  1RM8 A;  2K2G A;  3I7I A;  4H82 A;  2WOA A;  3LKA A;  3OHO A;  2Y6D A;  3LJG A;  1KUG A;  4XBH A;  2JSD A;  1KS0 A;  3AYK A;  2E3X A;  2PJT A;  3U1R A;  3KEJ A;  1G12 A;  3EDG A;  830C A;  1OMJ A;  3LE9 A;  2YIG A;  1R1J A;  3O64 A;  2KRJ A;  1R1H A;  3LMC A;  1CXV A;  3KHI A;  5CZM A;  3DPF A;  1C8T A;  4LL2 A;  3EDZ A;  1WNI A;  2AIG P;  2OW9 A;  1BM6 A;  1JIW P;  1PWW A;  3UVC A;  1JAO A;  2J83 A;  1JAN A;  1D7X A;  4ZR5 A;  2RJQ A;  2MQS A;  1J7N A;  3DNG A;  4AXQ A;  3RTT A;  2ERP A;  1EB6 A;  3OHL A;  2Y6C A;  3WV3 A;  1EUB A;  2W12 A;  1IAA A;  1OM6 A;  3NX7 A;  2DW1 A;  1PWQ A;  1IAC A;  3DL1 A;  1D5J A;  2X3C A;  3C7X A;  1C3I A;  1MMB A;  2V5O A;  4HMA A;  4ON1 A;  4DPE A;  2DW2 A;  1JH1 A;  1YCM A;  2RJP A;  4AIG A;  1HY7 A;  4FXQ A;  1XFV A;  1S4B P;  966C A;  2TCL A;  5I43 A;  3ZUK A;  1QIC A;  2E2D A;  2JXY A;  1MNC A;  3TT4 A;  3VTG A;  1HFC A;  1MMQ A;  1Q3A A;  1CQR A;  1ZTQ A;  4WKI A;  2FN2 A;  3KEC A;  4DV8 A;  1JAQ A;  1JK3 A;  1EAK A;  3DWB A;  3N2U A;  1Z3J A;  3EWJ A;  2USN A;  1KUK A;  1GKC A;  1PDC A;  1CXW A;  4OEI A;  4GQL A;  3F1A A;  2W15 A;  2D1O A;  3B8Z A;  1L6J A;  2MZI A;  1E88 A;  3OYO A;  3HYG A;  1GEN A;  3LUN A;  3CKI A;  1OM7 A;  1DMT A;  2OW0 A;  1J7M A;  2OY4 A;  1GKD A;  1G4K A;  1ZS0 A;  4HX3 A;  4DD8 A;  4IJO A;  2OVZ A;  4IUW A;  2V4B A;  1UMT A;  4R3V A;  4XM7 A;  1FM1 A;  4AYK A;  1SAT A;  4CTH A;  3HY9 A;  1H8P A;  4PKV A;  2DDF A;  3Q2G A;  1R54 A;  3MA2 A;  4XCT A;  2OW1 A;  4A7B A;  4WZV A;  5L79 A;  5D1T A;  4L6T A;  2X3A A;  5D2B A;  2WO8 A;  1CGE A;  3MQL A;  1B8Y A;  1CGF A;  2X3B A;  2OY2 A;  2Z2D A;  4WKE A;  4H76 A;  3L0T A;  3N2V A;  3K7L A;  1D8F A;  1XUC A;  3AYU A;  4G9L A;  2CKI A;  4GF1 A;  4A3W A;  2AYK A;  4YEH A;  3USN A;  1YOU A;  4H84 A;  3B92 A;  4I03 A;  2ERO A;  1IAD A;  1OS2 A;  1GE5 A;  1FBL A;  3KWV C;  2XS3 A;  1BZS A;  2WO9 A;  2FV5 A;  3HDB A;  4PKQ A;  3B2Z A;  3TVC A;  1AYK A;  1UMS A;  3F19 A;  1KUF A;  5I0L A;  1K7G A;  1IAB A;  4EFS A;  3KME A;  2QPJ A;  1AST A;  1GE7 A;  1AF0 A;  1I1I P;  1HFS A;  3M7P A;  1IAE A;  2JNP A;  3TSK A;  4DF9 A;  1JAP A;  4H49 A;  3TS4 A;  1KUI A;  1G05 A;  5B5O A;  1JKY A;  1SLN A;  2W13 A;  1KBC A;  4GUY A;  2J0T A;  2DW0 A;  3HBU P;  1R55 A;  1CIZ A;  4GWN A;  4ILW D;  1RTG A;  1Y0V A;  4XM8 A;  2OXZ A;  1I76 A;  1QIB A;  4WF6 A;  1SRP A;  1SU3 A;  1KAP P;  4H2E A;  4HSD A;  4GR8 A;  2W0D A;  3GBO A;  1PWV A;  1XFX A;  4GWM A;  1PWU A;  1K7I A;  2K9C A;  4PKR A;  2O36 A;  2I47 A;  1K7Q A;  2MZH A;  3HDA P;  1UTZ A;  2SRT A;  3SHI A;  1GO7 P;  1HOV A;  1GXD A;  3LIR A;  3LJT A;  4IN9 A;  3WV2 A;  1ZXC A;  1HTD A;  4PKT A;  1ZVX A;  3ZXH A;  4AUO A;  1MMP A;  2X7M A;  1SLM A;  1Y93 A;  1G49 A;  3KRY A;  4WK7 A;  2OW2 A;  1PEX A;  1H71 P;  1BKC A;  5I2Z A;  4H30 A;  3ELM A;  5H8X A;  1XUR A;  1ZP5 A;  1GO8 P;  4JIJ A;  1O0T A;  3L0V A;  3WV1 A;  3LIK A;  4GR3 A;  1BQO A;  3P1V A;  3G42 A;  4PKW A;  3LP9 A;  3I7G A;  4J4M A;  5BPA A;  3EHX A;  1I73 A;  1MMR A;  5B5P A;  4PKU A;  5I3M A;  5I12 A;  4FU4 A;  3HY7 A;  1BKC E;  4RT6 B;  2YB9 A;  1QUA A;  3EHY A;  2JT6 A;  3ZVS A;  5L7F A; 
#chains in the Genus database with same CATH topology
 3O2X A;  2Y2K A;  3LK8 A;  1C7K A;  2Y2I A;  1XFU A;  1BUV M;  2D1N A;  2HU6 A;  5D1S A;  1A86 A;  2OI0 A;  4G0D A;  3LQ0 A;  5CUH A;  1E15 A;  1CGL A;  1USN A;  4H1Q A;  5D3C A;  1BUD A;  4L19 A;  5I4O A;  4JA1 A;  3LJZ A;  3VI1 A;  1A85 A;  3KS4 A;  4GHL A;  3DPE A;  1QHU A;  2L0R A;  3V6N A;  1JIZ A;  2JIH A;  3DTI A;  1RMZ A;  1OS9 A;  1ROS A;  5D1U A;  4H3X A;  3P24 A;  1XFY A;  1W1T A;  1AKL A;  4FXY P;  1R1I A;  3KEK A;  3F18 A;  1ITV A;  1CK7 A;  2OZR A;  1O0Q A;  1YU4 A;  2Y2H A;  4JP4 A;  1QO6 A;  1KUH A;  1YQY A;  1YP1 A;  3EDI A;  2A8H A;  1XUD A;  3LUM A;  3LQB A;  1UTT A;  1D8M A;  4Z2K A;  1DTH A;  1H0I A;  1ND1 A;  1UEA A;  4HMC A;  2OXU A;  2FV9 A;  3S18 A;  1XAX A;  2XS4 A;  3V96 B;  1OGG A;  1G9K A;  3K7N A;  1BIW A;  2CLT A;  1GOI A;  1QJS A;  2Y2M A;  4Z2H A;  2ERQ A;  3DSL A;  1E8B A;  4NYY A;  4Q1L A;  5LAB A;  1B3D A;  3L29 A;  4MB3 A;  1H0G A;  2Y2O A;  4JPA A;  4Z2J A;  5BPV A;  3LGP A;  5CXA A;  2MLS A;  1XFW A;  3F17 A;  3HB2 P;  4I35 A;  3RTS A;  3LIL A;  1BSW A;  3HBV P;  3L25 A;  1JJ9 A;  1FLS A;  3F16 A;  1SMP A;  1Y8J A;  4GHA A;  5D7W A;  4NZ1 A;  2XD1 A;  2W14 A;  2OVX A;  2MZE A;  3LEA A;  1W1P A;  3DTE A;  1QIA A;  1E6Z A;  3AIG A;  4FVL A;  3Q2H A;  1HV5 A;  1HXN A;  1ATL A;  1BQQ M;  1QJJ A;  2N8R A;  3G5C A;  2DDY A;  3HON A;  4HME A;  3BA0 A;  1OO9 A;  4PKS A;  5BOY A;  2O3E A;  5BOT A;  1XFZ A;  4IBB A;  1ZXV A;  3WD0 A;  3E8R A;  1GE6 A;  2JT5 A;  1OM8 A;  2OXW A;  1BKC I;  4GR0 A;  3F15 A;  4OJ6 A;  2POJ A;  3KMC A;  1IAG A;  4IBG A;  1W1V A;  5JMY A;  4IBI A;  1CAQ A;  1QJI A;  2MLR A;  456C A;  4QNL A;  4JQG A;  3EDH A;  4L63 A;  1PWP A;  4XM6 A;  4QKZ A;  1RM8 A;  2K2G A;  3I7I A;  1YU3 A;  2WOA A;  4H82 A;  3LKA A;  3OHO A;  2Y6D A;  3LJG A;  1KUG A;  4XBH A;  2JSD A;  1KS0 A;  3AYK A;  2E3X A;  2PJT A;  3DTK A;  3U1R A;  3KEJ A;  1G12 A;  3EDG A;  4IBF A;  830C A;  1OMJ A;  3LE9 A;  2YIG A;  1R1J A;  3O64 A;  2KRJ A;  1R1H A;  3LMC A;  1CXV A;  3KHI A;  4IBJ A;  5CZM A;  3DPF A;  1C8T A;  4LL2 A;  1O6I A;  1WNI A;  2AIG P;  2OW9 A;  3EDZ A;  1BM6 A;  1JIW P;  1PWW A;  3UVC A;  1JAO A;  2J83 A;  3N3F A;  1JAN A;  1D7X A;  4ZR5 A;  2RJQ A;  2MQS A;  4TX8 A;  1J7N A;  3DNG A;  4AXQ A;  3RTT A;  2Y2P A;  2ERP A;  1EB6 A;  3OHL A;  2Y6C A;  3WV3 A;  1EUB A;  2W12 A;  1UR8 A;  1IAA A;  4OJP A;  1OM6 A;  3NX7 A;  2DW1 A;  1PWQ A;  1IAC A;  4Z2L A;  4NZ4 A;  3DL1 A;  1D5J A;  2X3C A;  3C7X A;  2Y2G A;  1C3I A;  1MMB A;  2V5O A;  4HMA A;  4ON1 A;  4DPE A;  2DW2 A;  1JH1 A;  2IOU A;  1YCM A;  2RJP A;  4AIG A;  4IJF A;  4NY2 A;  1HY7 A;  4FXQ A;  1GPF A;  1XFV A;  4L7A A;  1S4B P;  3WD3 A;  4HMD A;  966C A;  2TCL A;  5I43 A;  3ZUK A;  1QIC A;  2E2D A;  2JXY A;  1MNC A;  1YUE A;  3TT4 A;  3VTG A;  1HFC A;  1MMQ A;  4OJ5 A;  1Q3A A;  1CQR A;  1ZTQ A;  4WKI A;  2FN2 A;  3KEC A;  1OGB A;  4DV8 A;  1JAQ A;  1JK3 A;  1EAK A;  3DWB A;  2Y2J A;  1Z3J A;  3N2U A;  3EWJ A;  2USN A;  1KUK A;  1OZ9 A;  2D49 A;  1GKC A;  2BG1 A;  1PDC A;  1CXW A;  4OEI A;  3WD2 A;  4GQL A;  3F1A A;  2W15 A;  2D1O A;  3B8Z A;  1L6J A;  2MZI A;  1E88 A;  3OYO A;  3HYG A;  1GEN A;  3LUN A;  3CKI A;  1YU0 A;  1OM7 A;  1DMT A;  2OW0 A;  1J7M A;  2OY4 A;  1GKD A;  1G4K A;  1ZS0 A;  4HX3 A;  4DD8 A;  4IJO A;  2OVZ A;  4IUW A;  4MB5 A;  2V4B A;  1UMT A;  4R3V A;  2UWX A;  4IBC A;  4NZ5 A;  4XM7 A;  1FM1 A;  4AYK A;  1SAT A;  4CTH A;  3HY9 A;  3L2A A;  1H8P A;  4PKV A;  1YU2 A;  3HSH A;  2DDF A;  3Q2G A;  1R54 A;  3MA2 A;  4XCT A;  1YU1 A;  2OW1 A;  4A7B A;  4WZV A;  5L79 A;  2Y2L A;  5D1T A;  4L6T A;  2X3A A;  5D2B A;  2WO8 A;  1CGE A;  3MQL A;  1B8Y A;  1CGF A;  2X3B A;  2OY2 A;  2Z2D A;  4WKE A;  1XM5 A;  4H76 A;  3L0T A;  3N2V A;  3K7L A;  1D8F A;  1XUC A;  3AYU A;  4G9L A;  2CKI A;  4GF1 A;  4A3W A;  2AYK A;  2Y2Q A;  4YEH A;  3USN A;  1YOU A;  4H84 A;  3L28 A;  3B92 A;  4I03 A;  2ERO A;  1IAD A;  1OS2 A;  4NYU A;  1GE5 A;  4Z2I A;  1FBL A;  3KWV C;  2XS3 A;  4IBE A;  1BZS A;  2WO9 A;  2FV5 A;  3HDB A;  4PKQ A;  3B2Z A;  3TVC A;  1AYK A;  1UMS A;  3F19 A;  1E6P A;  4MB4 A;  1KUF A;  5I0L A;  1K7G A;  3L27 A;  1IAB A;  4EFS A;  3L26 A;  2QPJ A;  3KME A;  1AST A;  4NZ3 A;  1GE7 A;  1AF0 A;  1I1I P;  1HFS A;  3M7P A;  3FKE A;  1IAE A;  2JNP A;  3TSK A;  1JAP A;  4DF9 A;  4H49 A;  3TS4 A;  4IJE A;  1G05 A;  1KUI A;  5B5O A;  4OJO A;  1JKY A;  1SLN A;  1UR9 A;  3KS8 A;  1KBC A;  2W13 A;  4GUY A;  2J0T A;  2DW0 A;  3HBU P;  1R55 A;  1CIZ A;  4GWN A;  3WD4 A;  4ILW D;  1RTG A;  2XD5 A;  1E6R A;  1ED7 A;  1Y0V A;  4XM8 A;  2OXZ A;  1I76 A;  1QIB A;  4WF6 A;  1SRP A;  1SU3 A;  4OUI A;  1KAP P;  4H2E A;  4HSD A;  2Y2N A;  4GR8 A;  2W0D A;  3GBO A;  1PWV A;  1XFX A;  4GWM A;  1PWU A;  1K7I A;  2K9C A;  4PKR A;  2O36 A;  4IBK A;  2I47 A;  3WD1 A;  1K7Q A;  2YUF A;  2MZH A;  3HDA P;  1UTZ A;  2SRT A;  3SHI A;  1GO7 P;  4OJL A;  1E6N A;  1HOV A;  1GXD A;  3LIR A;  3LJT A;  4IN9 A;  2RTS A;  3WV2 A;  2JE5 A;  4IBD A;  1ZXC A;  1AIW A;  1HTD A;  4PKT A;  1ZVX A;  3ZXH A;  4AUO A;  1MMP A;  1W1Y A;  2X7M A;  1SLM A;  1Y93 A;  1G49 A;  3KRY A;  4WK7 A;  2OW2 A;  1PEX A;  1H71 P;  1BKC A;  5I2Z A;  4H30 A;  3ELM A;  4GH9 A;  5H8X A;  1XUR A;  1ZP5 A;  1GO8 P;  4JIJ A;  1O0T A;  3L0V A;  3WV1 A;  3LIK A;  4GR3 A;  1BQO A;  3P1V A;  3G42 A;  4PKW A;  3LP9 A;  3I7G A;  4J4M A;  5BPA A;  3EHX A;  1I73 A;  1MMR A;  5B5P A;  4PKU A;  5I3M A;  5I12 A;  4FU4 A;  4LG2 A;  2JCH A;  3HY7 A;  1BKC E;  4Z2G A;  4RT6 B;  2YB9 A;  3WX7 A;  2FFF B;  1QUA A;  3EHY A;  2JT6 A;  3ZVS A;  5L7F A;  1TVI A; 
#chains in the Genus database with same CATH homology
 3O2X A;  3LK8 A;  1C7K A;  1XFU A;  1BUV M;  2D1N A;  2HU6 A;  5D1S A;  1A86 A;  2OI0 A;  4G0D A;  3LQ0 A;  5CUH A;  1CGL A;  1USN A;  4H1Q A;  5D3C A;  1BUD A;  4L19 A;  5I4O A;  4JA1 A;  3LJZ A;  3VI1 A;  1A85 A;  3DPE A;  1QHU A;  2L0R A;  3V6N A;  1JIZ A;  3DTI A;  2JIH A;  1RMZ A;  1OS9 A;  1ROS A;  5D1U A;  4H3X A;  3P24 A;  1XFY A;  1AKL A;  4FXY P;  1R1I A;  3KEK A;  3F18 A;  1ITV A;  1CK7 A;  2OZR A;  1O0Q A;  4JP4 A;  1QO6 A;  1KUH A;  1YQY A;  1YP1 A;  3EDI A;  2A8H A;  1XUD A;  3LUM A;  3LQB A;  1UTT A;  1D8M A;  1DTH A;  1ND1 A;  1UEA A;  2OXU A;  2FV9 A;  3S18 A;  2XS4 A;  3V96 B;  1G9K A;  3K7N A;  1BIW A;  2CLT A;  1QJS A;  2ERQ A;  3DSL A;  1E8B A;  4Q1L A;  5LAB A;  1B3D A;  4JPA A;  3LGP A;  5CXA A;  2MLS A;  1XFW A;  3F17 A;  3HB2 P;  4I35 A;  3RTS A;  3LIL A;  1BSW A;  3HBV P;  1JJ9 A;  1FLS A;  3F16 A;  1SMP A;  1Y8J A;  5D7W A;  2W14 A;  2OVX A;  2MZE A;  3LEA A;  3DTE A;  1QIA A;  3AIG A;  4FVL A;  3Q2H A;  1HV5 A;  1HXN A;  1ATL A;  1BQQ M;  1QJJ A;  2N8R A;  3G5C A;  2DDY A;  3BA0 A;  1OO9 A;  4PKS A;  5BOY A;  2O3E A;  5BOT A;  1XFZ A;  1ZXV A;  3E8R A;  1GE6 A;  2JT5 A;  1OM8 A;  2OXW A;  1BKC I;  4GR0 A;  3F15 A;  2POJ A;  3KMC A;  1IAG A;  5JMY A;  1CAQ A;  1QJI A;  2MLR A;  456C A;  4JQG A;  3EDH A;  4L63 A;  1PWP A;  4XM6 A;  4QKZ A;  1RM8 A;  2K2G A;  3I7I A;  4H82 A;  2WOA A;  3LKA A;  3OHO A;  2Y6D A;  3LJG A;  1KUG A;  4XBH A;  2JSD A;  1KS0 A;  3AYK A;  2E3X A;  2PJT A;  3DTK A;  3U1R A;  3KEJ A;  1G12 A;  3EDG A;  830C A;  1OMJ A;  3LE9 A;  2YIG A;  1R1J A;  3O64 A;  2KRJ A;  1R1H A;  3LMC A;  1CXV A;  3KHI A;  5CZM A;  3DPF A;  1C8T A;  4LL2 A;  3EDZ A;  1WNI A;  2AIG P;  2OW9 A;  1BM6 A;  1JIW P;  1PWW A;  3UVC A;  1JAO A;  2J83 A;  1JAN A;  1D7X A;  4ZR5 A;  2RJQ A;  2MQS A;  1J7N A;  3DNG A;  4AXQ A;  3RTT A;  2ERP A;  1EB6 A;  3OHL A;  2Y6C A;  3WV3 A;  1EUB A;  2W12 A;  1IAA A;  1OM6 A;  3NX7 A;  2DW1 A;  1PWQ A;  1IAC A;  3DL1 A;  1D5J A;  2X3C A;  3C7X A;  1C3I A;  1MMB A;  2V5O A;  4HMA A;  4ON1 A;  4DPE A;  2DW2 A;  1JH1 A;  1YCM A;  2RJP A;  4AIG A;  1HY7 A;  4FXQ A;  1XFV A;  4L7A A;  1S4B P;  966C A;  2TCL A;  5I43 A;  3ZUK A;  1QIC A;  2E2D A;  2JXY A;  1MNC A;  3TT4 A;  3VTG A;  1HFC A;  1MMQ A;  1Q3A A;  1CQR A;  1ZTQ A;  4WKI A;  2FN2 A;  3KEC A;  4DV8 A;  1JAQ A;  1JK3 A;  1EAK A;  3DWB A;  3N2U A;  1Z3J A;  3EWJ A;  2USN A;  1KUK A;  1GKC A;  1PDC A;  1CXW A;  4OEI A;  4GQL A;  3F1A A;  2W15 A;  2D1O A;  3B8Z A;  1L6J A;  2MZI A;  1E88 A;  3OYO A;  3HYG A;  1GEN A;  3LUN A;  3CKI A;  1OM7 A;  1DMT A;  2OW0 A;  1J7M A;  2OY4 A;  1GKD A;  1G4K A;  1ZS0 A;  4HX3 A;  4DD8 A;  4IJO A;  2OVZ A;  4IUW A;  2V4B A;  1UMT A;  4R3V A;  4XM7 A;  1FM1 A;  4AYK A;  1SAT A;  4CTH A;  3HY9 A;  1H8P A;  4PKV A;  2DDF A;  3Q2G A;  1R54 A;  3MA2 A;  4XCT A;  2OW1 A;  4A7B A;  4WZV A;  5L79 A;  5D1T A;  4L6T A;  2X3A A;  5D2B A;  2WO8 A;  1CGE A;  3MQL A;  1B8Y A;  1CGF A;  2X3B A;  2OY2 A;  2Z2D A;  4WKE A;  4H76 A;  3L0T A;  3N2V A;  3K7L A;  1D8F A;  1XUC A;  3AYU A;  4G9L A;  2CKI A;  4GF1 A;  4A3W A;  2AYK A;  4YEH A;  3USN A;  1YOU A;  4H84 A;  3B92 A;  4I03 A;  2ERO A;  1IAD A;  1OS2 A;  1GE5 A;  1FBL A;  3KWV C;  2XS3 A;  1BZS A;  2WO9 A;  2FV5 A;  3HDB A;  4PKQ A;  3B2Z A;  3TVC A;  1AYK A;  1UMS A;  3F19 A;  1KUF A;  5I0L A;  1K7G A;  1IAB A;  4EFS A;  3KME A;  2QPJ A;  1AST A;  1GE7 A;  1AF0 A;  1I1I P;  1HFS A;  3M7P A;  1IAE A;  2JNP A;  3TSK A;  4DF9 A;  1JAP A;  4H49 A;  3TS4 A;  1KUI A;  1G05 A;  5B5O A;  1JKY A;  1SLN A;  2W13 A;  1KBC A;  4GUY A;  2J0T A;  2DW0 A;  3HBU P;  1R55 A;  1CIZ A;  4GWN A;  4ILW D;  1RTG A;  1Y0V A;  4XM8 A;  2OXZ A;  1I76 A;  1QIB A;  4WF6 A;  1SRP A;  1SU3 A;  1KAP P;  4H2E A;  4HSD A;  4GR8 A;  2W0D A;  3GBO A;  1PWV A;  1XFX A;  4GWM A;  1PWU A;  1K7I A;  2K9C A;  4PKR A;  2O36 A;  2YUF A;  2I47 A;  1K7Q A;  2MZH A;  3HDA P;  1UTZ A;  2SRT A;  3SHI A;  1GO7 P;  1HOV A;  1GXD A;  3LIR A;  3LJT A;  4IN9 A;  3WV2 A;  1ZXC A;  1HTD A;  4PKT A;  1ZVX A;  3ZXH A;  4AUO A;  1MMP A;  2X7M A;  1SLM A;  1Y93 A;  1G49 A;  3KRY A;  4WK7 A;  2OW2 A;  1PEX A;  1H71 P;  1BKC A;  5I2Z A;  4H30 A;  3ELM A;  5H8X A;  1XUR A;  1ZP5 A;  1GO8 P;  4JIJ A;  1O0T A;  3L0V A;  3WV1 A;  3LIK A;  4GR3 A;  1BQO A;  3P1V A;  3G42 A;  4PKW A;  3LP9 A;  3I7G A;  4J4M A;  5BPA A;  3EHX A;  1I73 A;  1MMR A;  5B5P A;  4PKU A;  5I3M A;  5I12 A;  4FU4 A;  3HY7 A;  1BKC E;  4RT6 B;  2YB9 A;  1QUA A;  3EHY A;  2JT6 A;  3ZVS A;  5L7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...