1CKAA

Structural basis for the specific interaction of lysine-containing proline-rich peptides with the n-terminal sh3 domain of c-crk
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
b'AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C-CRK N-TERMINAL SH3 DOMAIN
molecule tags Complex (oncogene protein/peptide)
source organism Mus musculus
publication title Structural basis for the specific interaction of lysine-containing proline-rich peptides with the N-terminal SH3 domain of c-Crk.
pubmed doi rcsb
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1995-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ckaA00
1B3QA 3C0CA 3JV3A 2KT1A 1PNJA 1TG0A 1ZBJA 3NPFA 5EC7A 2DRKA 2VKNA 2DLPA 2RPNA 1Y0MA 1NM7A 2YUNA 2I0NA 1A0NB 2ENMA 3PVQA 1NLOC 4OMPA 1YNZA 2LNHB 2MIOA 5IXBA 1TUDA 1YWPA 5ECAA 2V1QA 1MUZA 2DBMA 5HCKA 1CKAA 3EG2A 2JW4A 1AD5A 1KJWA 4J9FA 1X27A 1UHCA 3TVTA 4HVUA 1H92A 1PKSA 1UDLA 1SRMA 2MCNA 1E7OA 4JJDA 2LMJA 1GCPA 3TSWA 2YUQA 5IHIA 1WIEA 2D0NA 2DL5A 2ROLA 2K79A 2KXDA 4RTZA 1X69A 1K76A 4X1VA 2HDAA 2QDLA 4J9BA 2CSQA 2JM8A 1WXUA 1M3AA 2JM9A 4OMLA 1H3HA 5GJVB 3PVLA 1BBZA 4HVVA 2W0ZA 3M0TA 1X6GA 2L3SA 2V1RA 2KNBB 1ZLMA 1OV3A 4CC4B 2YDLA 2EBPA 2RQVA 1ZUKA 1U5SA 4EIKA 2DNUA 2AKKA 2ED1A 2DF6A 1JO8A 4FSSA 2GTOA 2RF0A 1SSHA 1GL5A 4LUDA 3UA6A 1Z9ZA 2JS2A 2NWMA 2KRSA 3EGUA 4A63B 1T3LA 1UECA 3IQLA 2JMCA 1HJDA 1GFDA 3VS4A 1SEMA 2BTTA 1UG1A 1FYNA 2XMFA 2M0YA 1VYTA 4OMQA 1GRIA 2EYXA 3EHQA 4J9GA 3RBBB 2JTEA 3QWYA 2EYWA 1AWJA 4Z8AA 2FPEA 2D8HA 4F16A 4KRTA 2K2MA 3NGPA 3M0QA 2K3BA 1VA7A 1PKTA 1WFWA 2L3QA 1I0CA 5GJWB 2D1XA 1X43A 1GFCA 2KYMA 4DEXA 3EG1A 1NYFA 2ESWA 2EW3A 4OMOA 2OJ2A 1AVZC 2C0TA 1M30A 2L0AA 4J9DA 2W10A 2CT4A 2G6FX 2KRMA 1QCFA 1GCQC 4DEYA 3ULRB 1SHGA 2AK5A 1WI7A 4QT7A 4Y92A 3EG0A 1WA7A 2BZ8A 3EHRA 3VS3A 1OPKA 1QWFA 1NG2A 2LQWA 2PTKA 1ZUYA 2BZXA 2RQTA 2JMAA 2K7AA 4JJBA 1UJYA 4AFUC 3I5SA 3H0IA 2KROA 3NHNA 2YUOA 2J6FA 4ORZA 4RTYA 4WCIA 2EPDA 2GGRA 3U23A 1NEGA 2VVKA 4HVWA 4JJCA 2ED0A 2YT6A 4F17A 3R6NA 3RNJA 2F2XA 2GTJA 1JU5C 2DE0X 3VS2A 1CKBA 4J9IA 4ESRA 4RTVA 2CH4A 2FRYA 2KGTA 2F2WA 4ZNXA 2D8JA 1YN8A 3A98A 1VYVA 3EG3A 2ROTA 2L3PA 4HCKA 4D8KA 3ZL7C 4RTWA 1NLPC 2KT8A 1PRLC 1G2BA 3FJ5A 2FPFA 1PWTA 1BK2A 4CC3A 1WYXA 2YSQA 1GCQA 4CC2A 1M27C 1M3CA 1ABOA 2CT3A 1OOTA 2YUPA 3I9QA 3THKA 3NMZC 1AZGB 4LE9A 2RMOA 1GBQA 2MOXA 2GBQA 1WX6A 3VS0A 4F14A 1K1ZA 2DL7A 1AZEA 1JEGA 1UJ0A 2DVJA 1CSKA 1AWXA 1JXMA 2JXBA 1G83A 2KEAA 1ZSGA 1T3SA 2KRNA 2J05A 1JQQA 5IH2A 1AEYA 2HCKA 3VS1A 2IIMA 3M0PA 1W6XA 1V1CA 4CC7A 2CUDA 1ZUUA 1X2KA 1X2QA 2DL4A 1WXBA 2FG0A 3UATA 1RI9A 2GNCA 1E6GA 3VS5A 1PRMC 2H8HA 3GBQA 1B07A 1RLPC 2A28A 1IO6A 4K11A 1H8KA 1VYUA 2HEQA 1YCSB 2JS0A 2O88A 1N5ZA 2M51A 3LH5A 3VS7A 1AOJA 2K6DA 2FO0A 4E6RA 1YP5A 4M4ZA 1UFFA 1KFZA 1E6HA 2FRWA 4Z88A 5I11A 4LUEA 1RLQC 5FWBA 2C0IA 1ZX6A 3VS6A 2X3XD 4J9CA 4HXJA 1AWWA 2RQWA 2LP5A 2RN8A 2EGEA 3CQTA 2ECZA 2E5KA 1U06A 4AFZC 2KE9A 2J7IA 5FWCA 4JPBW 2DL8A 1UGVA 2VWFA 3I5RA 1S1NA 2OI3A 1I07A 4AFQC 3VRZA 3VRYA 1MV3A 4Z89A 5L23A 1RUWA 2KYBA 2ABLA 2OAWA 2A37A 2FPDA 2GQIA 2EYZA 2O2OA 4AG2C 1EFNA 2RQUA 1YWOA 1K0XA 4AG1C 1QKWA 1BB9A 1HD3A 1WLPB 2EVRA 2EKHA 1W1FA 1T0JA 1XOVA 2EGCA 2CREA 2K9GA 1X6BA 2PZ1A 3M0UA 3REAB 5IXFA 1U3OA 2B86A 2RQRA 1MV0B 3M0RA 1KIKA 3M0SA 3REBB 1KSWA 2LJ1A 1ABQA 4GLMA 2F2VA 2KXCA 2LZ6B 1OPLA 2DBKA 3H0FA 1SPKA 1JXOA 2HBWA 3KFVA 3PE0A 3SEMA 2LCSA 1WXTA 1J3TA 1QWEA 5IHKA 2EGAA 2DJQA 5IHNA 2PNIA 2A08A 1K4US 2J6KA 3O5ZA 2O9VA 2L2PA 4RTXA 2AZSA 1UUEA 2DYBA 4RTUA 1UTIA 5I22A 2CUBA 4D8DA 1WDXA 2EYYA 2J06A 2FEIA 1GBRA 3UF4A 4OMNA 1K0SA 1FMKA 1I1JA 1HSQA 1QKXA 2A36A 4JZ4A 1Y57A 1M3BA 1SRLA 2LQNA 2JT4A 2KBTA 2LJ0A 1M8MA 1Z9QA 3H0HA 3QWXX 2NUZA 2EQIA 4GBQA 4OMMA 1AWOA 1QLYA 2CSIA 4LN2A 4IIOA 1BU1A 1PHTA 1ARKA 2BZYA 2AZVA 4IIMA 1UHFA 1SHFA 4J9HA 1NYGA 2CDTA 4AFSC 2DILA 2RNAA 2DM1A 2HSPA 4RUGA 2DRMA 2SEMA 3SHWA 2CH4W 2SRCA 3H41A 2AKLA 2KR3A 3UA7A 4LNPA 2DMOA 2P4RA 2LX7A 3TSZA 1T0HA 1K9AA 4R0KA 2DA9A 2LJ3A 1W70A 4RTTA 1TUCA 1NEBA 1OEBA 1UE9A 2C0OA 5FW9A 2O9SA 4JZ3A 4J9EA 2X3WD 3I35A 2DX1A 1LCKA 2DL3A 2J6OA 2O31A
chains in the Genus database with same CATH superfamily
2QEXA 1VQ4Q 3JV3A 2KT1A 1PNJA 3SDZA 2RHXA 1ZBJA 3QDRB 2E41A 3NPFA 4F04B 3FB9A 1BCMA 3V8JA 2DRKA 2VKNA 4QW2A 4BI4A 2RPNA 3H6ZA 1VQLA 1NM7A 2YUNA 1FXXA 4OMPA 4Z02A 2MIOA 2V1QA 4XTUA 2QQAA 2DBMA 4MZTA 4Q5WA 5HCKA 3EG2A 1PSEA 4NL2A 4JS5A 4M78F 2QQSA 1UHCA 2L5QA 1Q82C 1OYXA 4M7AE 5A0GA 4ATOA 2C06A 5I2MA 4M75B 4PJOF 3TSWA 4LDUA 2YUQA 3G71Q 1D0ZA 1QVPA 1WIEA 3L1AA 3OBYA 1X69A 2VASA 3RKYA 1KC8R 3V8LA 2HDAA 3EH1A 4J9BA 3S3OA 4BY6B 4DBQA 1YJWT 2X35A 5GJVB 2M02A 3PVLA 3I56Q 1N9RA 1Q7YC 1RACB 2L3SA 2V1RA 2RK2A 2KNBB 4N4GA 2RQVA 1Q7YR 5GANg 2AKKA 1RI0A 2ED1A 2DF6A 2NUTB 4KT0E 3META 5FLXE 3HRTA 5D6WA 2LQ8A 3UA6A 2R5MA 2NWMA 2F5KA 5CVIA 1GFDA 1SKUB 3VS4A 2E5QA 1M2OA 3KBGA 2PVDB 3ZEHA 4IUPA 5LJ3e 4PK4A 1IHWA 4XTXA 2JTEA 4Z8AA 2D8HA 4F16A 3JCMV 5GAMd 1JJ2S 1VQ7A 4QQGA 3HL8A 3I56T 2L3QA 1GFCA 4DEXA 2WACA 3HKSA 3EG1A 3QO3A 1M90U 2E4HA 3MO8A 3R6OA 5KE2A 1WHLA 2LT1A 2DTHA 2ESWA 2EW3A 3CCEQ 1MHNA 4OB0B 2C0TA 1M30A 2EQKA 2L0AA 4J9DA 1WHKA 2CT4A 2XHCA 1GCQC 2XG8D 3C94A 4Y92A 3EG0A 1WA7A 1HYOA 1OPKA 1ZSZB 2LX9A 4PJJA 4DQ2A 2PTKA 1ZUYA 5LJ5j 1UJYA 3CC7Q 3I5SA 2DERA 2KROA 5GAOl 2E65A 4KUIA 4ZGDB 4JDSA 5LJ3f 1PC0A 4PJOE 4BE1A 1BI3A 3E2UA 2DE0X 1MMDA 2KGTA 2LTOA 4ZNXA 3A98A 3EFOA 3JCMf 4D8KA 2I2LA 4RTWA 1NLPC 2KT8A 3A1PA 2ZAEA 2RK1A 4CC3A 2M0OA 2AHJB 2YUPA 3THKA 3I9QA 1AZGB 4LE9A 2RMOA 3CPWS 1QVGS 5KYNA 3CCRT 3M53A 3VS0A 1K1ZA 2DL7A 2V8KA 1UJ0A 1G3TA 5C0MA 4NS5A 4A4EA 2D9TA 4PL6A 1YITA 4FYYB 1AWXA 1Q82U 1VIFA 5GANh 3CMEQ 1QVGP 1O9SA 2CP6A 4C0DC 2KRNA 2CZ1B 2LCLA 3TREA 2A0FB 1D1AA 4HA8A 4DBFA 3JB9D 1RL2A 1OI1A 1ZUUA 1X2QA 2QYZA 1RI9A 3VS5A 1PRMC 3GBQA 4OGCA 1Y71A 1U1SA 1B07A 4A54A 5GMKm 1IO6A 1Y07A 4J83A 1WZOA 5GANf 1H8KA 3ASKA 3VS7A 4FYWB 5GMKj 2FO0A 2K5LA 1VQNQ 3TQ7P 1FWZA 3M4YA 4NL3A 2X51A 2FRWA 3GPLA 5FU6C 5I11A 3M4GA 3EG9B 3A5ZB 3VS6A 4IUQA 1AWWA 3J81E 3TCJA 3UWNA 2EGEA 1QP3A 2FVUA 3ZBDA 3FRNA 5CCAA 1U06A 3CBOA 5CO7A 2J7IA 5FWCA 5LJ5g 2LCCA 1UGVA 3I5RA 3M56A 4MMKA 1I07A 3VRYA 2HBPA 3M55A 1N6AA 3QHSA 2FPDA 5KCOA 3CCJA 1JJ2A 4JJNK 5M9OA 1N8RR 3OYYA 1DJ7B 4OGEA 3CCSA 1D09B 3HHTB 4JRKA 3GOXA 3JCMe 2EQUA 4M77F 4E7SA 2EGCA 1OZ2A 2HQXA 2K9GA 2VC8A 4HCBA 4C8QC 3HFNA 3FJPA 2Y4XA 4B9WA 4M75G 2HMAA 1W2BP 1KIKA 1RADB 3M0SA 1UGQB 1KSWA 3OYGA 1VQ4T 3HRSA 2KXCA 3GNGA 4PJOB 5AYFA 3H0FA 5FRNA 1SPKA 3CCLA 5GAMj 3AT1B 1WXTA 2E64A 2K5FA 3G4ST 3VV0A 3BE3A 2LRQA 5GANd 2QK0A 5IHNA 5KYYB 2PNIA 2QA4A 2A08A 1ZSZC 2J6KA 4XU2A 3E19A 2DD5A 2AZSA 2LVMA 2R57A 3A8OB 3EGXB 2CUBA 3O8VA 1PD1A 3RDVA 1WQWA 3JB9H 1RAAB 2LT4A 3UF4A 3OB9A 1HSQA 1M3BA 1WHMA 1RAFB 5GAN7 1Z9QA 5A0LA 2E10A 1NPPA 2WSFE 2XU8A 3GF5A 3M58A 1XQHA 1YHQT 2XDBA 4OMMA 4IIOA 2FZKB 1BU1A 1ARKA 1XNIA 5KYUA 2QAZA 2BZYA 3F70A 3GIBA 3ER0A 3NTIA 4KUDK 3OYBA 1BI1A 4XU0A 2DILA 1MNDA 4E7ZA 2DRMA 2KI7A 3SHWA 1W2BA 2CH4W 2SRCA 2AKLA 2GQVA 2CP2A 1ZBXA 4RCBA 1VQ9A 2DMOA 2K3XA 3LWHA 1M2VA 4RTTA 4M77E 5FW9A 3OYHA 4J9EA 2P0QA 2X3WD 3FLGA 4FYXB 5LJ3d 3LWIA 2J6OA 2O31A 1B3QA 1VQ4A 3J7AF 2QDYB 4EMKA 1TG0A 1KQ2A 3CXCS 3UT1A 2DKGA 4XU3A 1YCYA 5EC7A 4FM4B 4VUBA 5CR2A 1Y0MA 4LD6A 1ACMB 1OZ3A 3VUBA 1VQKQ 1A0NB 3PVQA 3DKMA 3CD6T 2LNHB 4M75D 2JOYA 1FMWA 2M16A 1YJ9A 1NPRA 3EGDB 1IZ6A 4X9CA 1AD5A 1VQ9Q 3TVTA 1H92A 2K2VA 1PKSA 2DIQA 3UDCA 2ZPFB 2V8IA 2MCNA 4GY5A 1GCPA 1R8OB 4M77G 2VYTA 2ROLA 3T9NA 1UB4A 4PKCC 4WF2A 2QDLA 2CSQA 4PJOD 1WXUA 1M3AA 2RD1A 3JAME 2X9HA 4OMLA 1I5LA 4DOVA 5LJ3g 2YRDA 4C0FA 3OMGA 1M1KR 3OYLA 4HVVA 2W0ZA 3URGA 4LDVA 4HT9A 2LC4A 1ZLMA 1OV3A 2Y90A 4CC4B 3G4SA 4M7DD 3MEVA 1ZUKA 3QBYA 3S3NA 2FZGB 4ZTJA 4M7DC 3OSVA 2ZPBB 3L2UA 4FSSA 2RF0A 4XTZA 1KQ1A 1YFNA 5GAN3 4A53A 3BDLA 1Z9ZA 3OW2P 1HXDA 1KHCA 4N0AC 5GMKh 4A63B 4GLKA 3IQLA 4MZMA 2KY9A 1VQPT 1LPLA 4JUVA 1UG1A 4CI0C 2KSSA 2M0YA 1VYTA 4OMQA 3JCMW 3EHQA 5GAMe 4EMKB 2RA2A 3V7CA 2CYZB 3QWYA 2H3EB 2EYWA 5CK9A 1H3ZA 4WTOB 3OYDA 2FPEA 4ELZC 1M90C 2DPPB 4ZGJB 5GAOp 5KYYA 3OA6A 3CCUQ 3OS5A 1WFWA 1I0CA 2D1XA 1X43A 4J6WA 3J80E 2GF7A 5I2SA 2EJ9A 4OMOA 4C5IA 2PUOB 3CCVT 2OTLQ 1LNXA 1KQSS 3SB2A 1TU0B 1VQ9T 3RIRA 2KRMA 1K9MU 2CP0A 1BI2A 1SHGA 4QT7A 1NJIC 3QYHB 1K8AU 4KBMB 4QQDA 4II1A 1YITT 2LQWA 2IVWA 3I55A 1VQNT 3I55Q 4M7DB 1AT1B 2JUFA 1I4K1 4AFUC 3H0IA 2ZPIB 1YJNT 2YLCA 1V76A 3NHNA 3DB4A 2YUOA 2J6FA 4WCIA 2OTJA 2GGRA 2MK5A 2VVKA 4HVWA 3A8MB 4JJCA 2EQMA 4M77A 4F17A 3R6NA 2F2XA 2BIVA 1JU5C 3SD4A 4RTVA 4M7DA 2CH4A 1C1AA 2FRYA 4BE0A 2L89A 2PVOB 4M77D 4J5YA 3JRZA 3EG3A 2L3PA 1F1BB 2XDDA 2CKKA 1ZA2B 1G2BA 1I5OB 2GFAA 1WQ7A 2E6ZA 3M59A 1OQKA 1Q86R 1ABOA 2D0QB 1RAEB 2E6NA 4M78D 3NMZC 5CQYA 1VQOT 1Q86C 1RAIB 4M7DG 2HZYA 4M78C 3JB9G 2MOXA 2DEUA 1XJWB 5FU6B 4RMOA 2CZ7B 4DA4A 1K73C 2KVQG 2DVJA 3MEWA 4M75E 5L8RE 4BI3A 1YJNQ 4M75A 2JXBA 2RI5A 1G3SA 3OYAA 3CPWA 2KQWA 1T3SA 1I8FA 1D1CA 2J05A 1M8VA 3JSCA 1JQQA 4X34A 2DD4A 2QI2A 3CMAA 1IB8A 3VS1A 4HT8A 3L2RA 1W6XA 3SFMA 5DM7R 1X2KA 2E3IA 2DL4A 1IRXA 2FG0A 5HK0A 5DLQE 2EJFA 2GNCA 4JRIA 3PIPA 4L59A 1BI0A 1NJIU 1BIBA 3H9NA 1WNLA 4E7IA 1VYUA 2HEQA 1IXDA 2JNGA 1YCSB 2JS0A 4BY6C 1N5ZA 3LH5A 4J7IA 2L8DA 3CCSQ 4E7LA 1KFZA 1YJ9T 2OX7A 3HPWA 3PMTA 4E2FB 4IURA 1ZX6A 1KC8U 4XAXB 2RQWA 1OU9A 3P8BB 1LVKA 4CRIA 4MZPA 1M2VB 3E9GA 1TTHB 2E5KA 3EFOB 3CXCP 1M1KU 4AFZC 2DL8A 4F7UF 3OY9A 3CMAQ 3DB3A 1D0XA 5LJ5h 1VQMA 3LH0A 3VRZA 1VQ7Q 2EQJA 4M7DF 1N8RC 3QPHA 2OTLT 2OAWA 2A37A 2FL7A 5DY9A 2O2OA 4AG2C 2LDMA 1EFNA 2FYKA 5J26A 2DXBA 4AG1C 3I55T 5FU7C 2RO0A 1HD3A 2EVRA 2O01E 2EKHA 1UGPB 4AT1B 2ATCB 4B9XA 3OYNA 2PZ1A 1MMAA 3M0UA 1Y7XA 3A8LB 1KD1R 4PJOC 2BE9B 2RQRA 1MV0B 1S72Q 4J7FA 2RI3A 3V8KA 1C0MA 2LJ1A 4M78G 4XU1A 3MHXA 4GLMA 1TH7A 2F2VA 2QEXT 1OPLA 4O6JA 2RHZA 1SF9A 2DBKA 1JXOA 3PE0A 3QXEB 2LCSA 4B6MA 2FHDA 3E9FA 2DTOA 2VUBA 2OAUA 1X75C 3CD6Q 2O9VA 3Q1JA 2KDSA 2DYBA 3NFCA 4RTUA 4FL6A 1UTIA 2QQ9A 2KK4A 1YBYA 2KAFA 2HL5C 4RKUE 5GAMg 2ZPGB 1YJ9Q 4DBRA 2IG0A 1K8AC 3KXTA 1QKXA 2A36A 3OSSC 3S3MA 3CXCA 2LQNA 1TSFA 2KBTA 3PGGA 4OB3B 1Q95G 1HK9A 1Y96B 3QUIA 2DXUA 2EQIA 1ZHIA 2HD0A 3CMAT 1TWBA 2MMPA 4M7AA 2AZVA 2DK3A 2ZPEB 1VQ8A 1WHJA 3X25B 1NYGA 2RH2A 2HSEB 4AFSC 1IGUA 2RNAA 3L2WA 2PVGB 3G7ZA 2BKDN 4RUGA 4DBHA 1OU8A 1W2BS 2YXYA 1QW1A 4C0ZA 4C8QG 2HKQB 4PJLA 4LNPA 1T0HA 2E70A 2DETA 4KGZB 4M7DE 2DA9A 1W70A 1TUCA 1NEBA 4C92D 1OEBA 2QTXA 4PJOA 2P0PA 4C92C 5GMKl 3I35A 8ATCB 5GAOn 1LCKA 2M1HA 2DL3A 1S72T 1D3BB 3A8HB 4N4HA 3L2ZA 2QEXQ 2AIRB 3EGDA 2P84A 2PUKB 4HKEA 1BIAA 1R77A 2I0NA 2ENMA 4PJOG 1EIFA 3PNWC 1YNZA 3OS1A 1TUDA 1YWPA 4QVZA 3CCVQ 3M5AA 3CC4A 1CKAA 1NJIR 1EX4A 3MCAB 1G5VA 2EFIA 4J9FA 1X27A 2DFUA 5HKCA 4HVUA 4D6WA 1QVFS 1KD1C 1UDLA 4C5GA 1SRMA 4J6XA 3OYCA 2D0NA 2K79A 3X24B 3QDFA 4X1VA 5KYXB 2JM8A 1VQ5A 3JB9I 2JM9A 1X6OA 3DLLA 5KH6A 3CCUA 3C4SA 1BBZA 2RJEA 5LJ3h 2CGHA 5FROA 3M0TA 1X6GA 3JCMJ 2DEQA 1RAHB 3G4SQ 1KQSA 3DLMA 2KMTA 2EBPA 1MGQA 1U5SA 3FEOA 2DNUA 2XKOC 3QJYA 2GTOA 1SSHA 2K4YA 1QCOA 4LUDA 2EAYA 2JS2A 4XQ3A 2KRSA 2RJDA 2Y4YA 3EGUA 1UECA 1VOMA 3MPUB 2JMCA 1VQOQ 1M1FA 1C6VX 1N8RU 3INZA 3X26B 4F7UE 2BTTA 2DXCA 2XMFA 4C5HA 4PFOA 4ELYC 4FT4A 4QKUA 1GRIA 3RUXA 3OYKA 3OYJA 3WVDB 3SWNB 1N27A 2XK0A 3RBBB 5FRMA 1PG5B 4C8QD 1AWJA 2QA4T 2H3JA 2K2MA 4OP0A 3S6WA 3NGPA 2HL3A 5AT1B 2K3BA 2XD0A 1VA7A 1PKTA 1TOVA 4AMCA 5GJWB 4C92G 4R56A 2KYMA 2QQRA 3GNFB 1VQ8T 2MWOA 3M57A 4LXCA 1XTDA 4M77C 2OJ2A 1AVZC 1D1BA 3OW2A 3JCMg 2W10A 2RI2A 2G6FX 3L42A 2DXTA 2GFUA 1YI2A 2AK5A 1WI7A 1BYMA 2CS7A 2K57A 3VS3A 1M4ZA 1QWFA 1NG2A 3C12A 3KUFA 3X20B 2CZ6B 1KHIA 2DO3A 2XDPA 2BZXA 2RQTA 2JMAA 4JJBA 2F1LA 4RTYA 4ORZA 3RESA 4A4HA 1TUGB 1NEGA 5GAN2 3MEAA 2YT6A 5IT9E 4ME7A 2GTJA 2QA4Q 1CKBA 4ESRA 4BB7A 2F2WA 3CCLQ 2D8JA 1QVGA 2NUPA 1VYVA 2ROTA 1D0YA 2VGMA 1VQ8Q 3ZL7C 1PRLC 3FJ5A 2VV5A 4IKFA 3V7RA 1BK2A 1QQJA 4BUGA 2QTVA 1OOTA 5IAYA 5GANj 1I81A 1ZQ1A 1GBQA 1WX6A 1AZEA 1JEGA 2V8JA 1BKBA 4RCCA 2X4JA 1CSKA 3G6EQ 3BY7A 2NUPB 1B34A 5CAIA 5KYUB 4FIBA 4OVAA 5HK3A 1VQ6A 3I56A 3PIOA 4PFPA 1QMCA 4OMFB 4X9DA 3HTRA 2HCKA 5CIUA 2OTLA 2IPOB 2MF2A 1V1CA 4CC7A 5GAOq 3TEEA 2CUDA 3FC3A 4JS4A 1WXBA 2COYA 3UATA 4F7UG 3JCMQ 3RKXA 4M7AF 2H8HA 3JB9J 2RHIA 5D6XA 2EKOA 4ZN1A 2A28A 4M78E 2WSCE 4K11A 1PCXA 2DTIA 2MWPA 5GANe 3MKDA 4HCZA 4XK8E 1JB0E 1AOJA 2K6DA 2CP5A 4E6RA 1YIJQ 1YP5A 4M4ZA 3EFSA 1GXIE 5GAN4 1E6HA 1M5Q1 3MP1A 3CPWP 3HP9A 2C0IA 2X3XD 2X4YA 2DVEA 4HXJA 4J9CA 5LJ5d 3G6ET 1VQ5Q 3OYIA 1P92A 2R5AA 1YHQQ 3BW1A 2ECZA 1VQ6Q 2K3YA 3NTHA 2D6FA 4JPBW 3WVEB 3JCMh 2VWFA 3OW2S 1S1NA 1Q7YU 5KCHA 1YJWA 5HY6A 4EPCA 5KYXA 1MV3A 3CCMA 3CD6A 2EIFA 5L23A 1RUWA 2KYBA 2RJFA 1B7TA 2EYZA 1QCNA 2RQUA 1YITQ 5GMKi 1K0XA 3EFRA 1QKWA 4Y28E 3LW5E 4N4IA 3SWNC 1WLPB 3JCMb 3CCRQ 1KK7A 1W1FA 4FW1A 2O4XA 1X6BA 3JCMP 3REAB 4FU6A 2L3RA 3N5BB 3M0RA 3REBB 3GP8A 3QIIA 1VQLQ 4M75F 2DJZA 2LZ6B 4XTVA 1JBMA 3SEMA 3KFVA 3VYGA 4LDXA 3TU4K 1QWEA 2QGFB 1D3BA 1J3TA 3EG9A 2EGAA 1M90R 1TS9A 3O5ZA 4BACA 2L2PA 1VQMT 3OQ5A 1YIJA 1UUEA 1VQNA 2BUDA 5I22A 4PNOA 1WDXA 1K8AR 1VQPA 2J06A 2OTJT 2FEIA 1GBRA 4OMNA 1FMKA 3HRUA 1S72A 2NYSA 1I1JA 4J6YA 2ZZDA 1Y57A 3SWNA 1JRIA 2JT4A 4KGXB 5LJ5f 2LJ0A 3QZ5B 1M8MA 1R0CB 4A4FA 1WPYA 3VJPA 1VQ6T 3H0HA 1QVFA 2NUZA 4BDZA 4M7AB 2YHTA 4GBQA 5DLOA 1PD0A 4C0GA 1KQSP 3ZFJA 4C8QB 3G1JA 3CMEA 1RABB 2JTFA 5A2QE 4FCYA 4IIMA 5GAMf 1UHFA 3CC4T 1SHFA 4J9HA 1G3WA 1WGSA 1AHJB 1PM3A 2A3LA 2HSPA 4L6V5 3CCJT 1K73U 1VQMQ 3H41A 1Q86U 3UA7A 4BI8B 1OULA 3CCST 2LX7A 3TSZA 2A7YA 1K9AA 1H641 4R0KA 1ZA1B 3QKJA 2OTJQ 4PJNA 2FB7A 1NZ9A 1VUBA 2C0OA 4C92B 4JZ3A 3JCMc 2COZA 4ZGEB 1YJNA 3P8HA 4L5GA 1WJQA 1M9SA 2VGNA 3C0CA 3JCMX 1EZZB 2YWWA 3CBMA 1QP2A 1WJSA 3OS2A 2LQKA 3ME9A 2DLPA 5KYWA 2Z0WA 3VUZA 3P8DA 7AT1B 2CP3A 3LGFA 2QASA 4FW2A 4ZTFA 1NLOC 4R55A 1Q81U 5IXBA 5ECAA 1MUZA 2BE7D 2HNIA 2JW4A 1KJWA 2VB6A 3NTKA 2NLUA 3CCMQ 1X01A 4QVCA 3CC2T 4C92E 1K9MC 4OB2B 1E7OA 4JJDA 2LMJA 4PJMA 4RG8A 5D7UA 5IHIA 2DL5A 4IUUA 2KXDA 4RTZA 3BFMA 1K76A 5CKDA 4Y91A 2LNVA 1NBEB 2F69A 1YHQA 4IUTA 4KULA 4C0DB 2XI9A 1H3HA 3X28B 4C8QE 2E3HA 2X4XA 1SSFA 1FX7A 4E47A 4N0AA 2QXFA 3VKIA 3CCLT 2YDLA 3CC4Q 5GAMh 5CKFA 4EIKA 3CPFA 4MDWA 2EYQA 5D6YA 1JO8A 3WXMB 1RAGB 1GL5A 4P5NA 5I21A 1LJOA 2MPXC 2JVVA 2DIGA 2PQWA 1T3LA 4PLIA 4JLGA 1HJDA 2O4XB 3CCMT 1SEMA 1OX8A 1U1TA 3CCQA 1FYNA 2RB6A 1Y96A 3CCQQ 3PMIA 4J8OA 1MMNA 2JTMA 3LGLA 4A4GA 2NUTA 2F5TX 2EYXA 4J9GA 4A4KA 5FU7B 3OMCA 1KD1U 1O75A 3JCMd 2RJCA 2K5IA 5GAN6 4BE2A 4KRTA 2E12A 4LDYA 3M0QA 1WHHA 5GMKe 4C92A 3RERA 4FYVB 4EMGA 4E7HA 5J39A 1NYFA 5C6SA 3MEUA 4TVRA 4UC4A 3HSBA 4LDWA 3CCRA 2G3RA 1QCFA 4OF1A 3ULRB 4DEYA 1FMVA 3EHRA 2BZ8A 4EMKC 4QQ6A 4M7AD 5CKEA 1MNEA 2HAXA 4EDUA 5GAOm 2K7AA 3G71T 4JRQA 4KGVB 1W4SA 1G8XA 1R0BG 2EPDA 3U23A 4JRPA 4E7KA 4PLLA 2ED0A 5CQXA 3RNJA 9ATCB 3VS2A 4J9IA 3LYIA 1KC8C 4M77B 2RM4A 4RG2A 3CCEA 1YN8A 4JLIA 1VQ7T 2AT1B 1QVFP 4HCKA 1BCOA 2FPFA 1PWTA 4IUVA 3RMQA 2JZ2A 4O5VA 1WYXA 2JJ9A 1GCQA 2YSQA 5GAOr 1K73R 4CC2A 1M27C 1M3CA 2GCXA 2CT3A 2MI6A 1G3YA 3QZ9B 3LLRA 3CC2Q 4MDXA 3CC2A 5CKBA 4DOWA 3M9QA 1VQPQ 1IGQA 2DYIA 2GBQA 4F14A 3LX7A 1YI2T 2RHUA 2B8AA 2FZCB 2EWNA 2HQEA 4M78B 1JXMA 1SG5A 1VQLT 1G83A 4KH1B 4OB1B 2KEAA 4FSXA 1ZSGA 1VIEA 2YRVA 3MP6A 5IH2A 1AEYA 2IIMA 3GLXA 3M0PA 2CZ0B 1N9SA 2X4WA 4M75C 3CCVA 1Q81R 4C92F 2RHYA 4XTYA 1E6GA 1RLPC 3VU3C 1B34B 5KYWB 2MAMA 4C8QF 4KH0B 1JJ2P 5GAN8 3A8GB 6AT1B 2O88A 2M51A 1IHVA 3CCQT 2QQBA 5J3BA 1UFFA 3M54A 3G71A 2HQHA 4Z88A 3CBPA 4LUEA 2PU9B 3QYGB 1RLQC 4MMLA 1YI2Q 4FT2A 5FWBA 2HKNA 5EG2A 4HCCA 4XTWA 3OYEA 3CC7T 1V29B 2ZCFB 3OBWA 2LP5A 2RN8A 3EH2A 3CQTA 3PFSA 3RKWA 2JN0A 2KE9A 2M9UA 2XIDA 4M7AG 1TXQA 3L2QA 2V26A 2DAQA 2OI3A 5KE3A 4AFQC 4QVDA 3OYMA 1VQKT 3JB9F 2QG9B 4Z89A 2ABLA 3H8ZA 4YTLA 2GQIA 3CCJQ 1VQOA 5IN1A 1NE8A 1YWOA 2XICA 3OYFA 1BB9A 2EJGA 2YLBA 4PFZA 5LL6S 3L2VA 1U8RA 3BDUA 1T0JA 1XOVA 8AT1B 2CREA 5LJ5e 3MJXA 3C95A 3RMSA 2DZCA 5IXFA 1U3OA 2CP7A 4BD3A 2B86A 1VQ5T 2COWA 3CMET 1ABQA 3G6EA 1YJWQ 2ZGWA 4F7UA 3UPUA 2HBWA 1Q81C 2DZ9A 3VYHB 1M1GA 2VXEA 5IHKA 1KG1A 4M78A 2DJQA 1OX9A 1LOJA 1K4US 3V7SA 2YRCA 1IREB 4RTXA 2P0KA 2R58A 4D8DA 3QG1A 3HFOA 1K9MR 3PTAA 1UEBA 2EYYA 3CEYA 4BDYA 4EMHA 4LD9K 1K0SA 4C8QA 4NOYA 2ZPHB 3E1SA 4JZ4A 1SRLA 3AHUA 3EAEA 1MMGA 3MP8A 5LJ3j 3QWXX 1AWOA 1QLYA 2CSIA 5A0DA 4LN2A 4E7JA 3CCUT 2MYSA 1M1KC 1PHTA 2P4TA 1ZSZA 1PSFA 1VQKA 3D7SB 3QJ6A 2E1HA 2CDTA 2DM1A 1WHGA 1UGSB 3PT9A 3CCET 4ZN3A 2SEMA 1WJRA 2KR3A 4M7AC 1UGRB 2P4RA 1YIJT 3FDRA 4ANJA 2LJ3A 3EGXA 3QSUA 2WSEE 3FIFA 5CKHA 3RR6A 2VXFA 1UE9A 2O9SA 4F7UB 2QGGA 5GAN5 2DX1A 3CC7A 1Q82R 4C5EA 3OS0A 4V2SA
chains in the Genus database with same CATH topology
1B3QA 3C0CA 3JV3A 2KT1A 1PNJA 1TG0A 1ZBJA 3NPFA 5EC7A 2DRKA 2VKNA 2DLPA 2RPNA 1Y0MA 1NM7A 2YUNA 2I0NA 1A0NB 2ENMA 3PVQA 1NLOC 4OMPA 1YNZA 2LNHB 2MIOA 5IXBA 1TUDA 1YWPA 5ECAA 2V1QA 1MUZA 2DBMA 5HCKA 1CKAA 3EG2A 2JW4A 1AD5A 1KJWA 4J9FA 1X27A 1UHCA 3TVTA 4HVUA 1H92A 1PKSA 1UDLA 1SRMA 2MCNA 1E7OA 4JJDA 2LMJA 1GCPA 3TSWA 2YUQA 5IHIA 1WIEA 2D0NA 2DL5A 2ROLA 2K79A 2KXDA 4RTZA 1X69A 1K76A 4X1VA 2HDAA 2QDLA 4J9BA 2CSQA 2JM8A 1WXUA 1M3AA 2JM9A 4OMLA 1H3HA 5GJVB 3PVLA 1BBZA 4HVVA 2W0ZA 3M0TA 1X6GA 2L3SA 2V1RA 2KNBB 1ZLMA 1OV3A 4CC4B 2YDLA 2EBPA 2RQVA 1ZUKA 1U5SA 4EIKA 2DNUA 2AKKA 2ED1A 2DF6A 1JO8A 4FSSA 2GTOA 2RF0A 1SSHA 1GL5A 4LUDA 3UA6A 1Z9ZA 2JS2A 2NWMA 2KRSA 3EGUA 4A63B 1T3LA 1UECA 3IQLA 2JMCA 1HJDA 1GFDA 3VS4A 1SEMA 2BTTA 1UG1A 1FYNA 2XMFA 2M0YA 1VYTA 4OMQA 1GRIA 2EYXA 3EHQA 4J9GA 3RBBB 2JTEA 3QWYA 2EYWA 1AWJA 4Z8AA 2FPEA 2D8HA 4F16A 4KRTA 2K2MA 3NGPA 3M0QA 2K3BA 1VA7A 1PKTA 1WFWA 2L3QA 1I0CA 5GJWB 2D1XA 1X43A 1GFCA 2KYMA 4DEXA 3EG1A 1NYFA 2ESWA 2EW3A 4OMOA 2OJ2A 1AVZC 2C0TA 1M30A 2L0AA 4J9DA 2W10A 2CT4A 2G6FX 2KRMA 1QCFA 1GCQC 4DEYA 3ULRB 1SHGA 2AK5A 1WI7A 4QT7A 4Y92A 3EG0A 1WA7A 2BZ8A 3EHRA 3VS3A 1OPKA 1QWFA 1NG2A 2LQWA 2PTKA 1ZUYA 2BZXA 2RQTA 2JMAA 2K7AA 4JJBA 1UJYA 4AFUC 3I5SA 3H0IA 2KROA 3NHNA 2YUOA 2J6FA 4ORZA 4RTYA 4WCIA 2EPDA 2GGRA 3U23A 1NEGA 2VVKA 4HVWA 4JJCA 2ED0A 2YT6A 4F17A 3R6NA 3RNJA 2F2XA 2GTJA 1JU5C 2DE0X 3VS2A 1CKBA 4J9IA 4ESRA 4RTVA 2CH4A 2FRYA 2KGTA 2F2WA 4ZNXA 2D8JA 1YN8A 3A98A 1VYVA 3EG3A 2ROTA 2L3PA 4HCKA 4D8KA 3ZL7C 4RTWA 1NLPC 2KT8A 1PRLC 1G2BA 3FJ5A 2FPFA 1PWTA 1BK2A 4CC3A 1WYXA 2YSQA 1GCQA 4CC2A 1M27C 1M3CA 1ABOA 2CT3A 1OOTA 2YUPA 3I9QA 3THKA 3NMZC 1AZGB 4LE9A 2RMOA 1GBQA 2MOXA 2GBQA 1WX6A 3VS0A 4F14A 1K1ZA 2DL7A 1AZEA 1JEGA 1UJ0A 2DVJA 1CSKA 1AWXA 1JXMA 2JXBA 1G83A 2KEAA 1ZSGA 1T3SA 2KRNA 2J05A 1JQQA 5IH2A 1AEYA 2HCKA 3VS1A 2IIMA 3M0PA 1W6XA 1V1CA 4CC7A 2CUDA 1ZUUA 1X2KA 1X2QA 2DL4A 1WXBA 2FG0A 3UATA 1RI9A 2GNCA 1E6GA 3VS5A 1PRMC 2H8HA 3GBQA 1B07A 1RLPC 2A28A 1IO6A 4K11A 1H8KA 1VYUA 2HEQA 1YCSB 2JS0A 2O88A 1N5ZA 2M51A 3LH5A 3VS7A 1AOJA 2K6DA 2FO0A 4E6RA 1YP5A 4M4ZA 1UFFA 1KFZA 1E6HA 2FRWA 4Z88A 5I11A 4LUEA 1RLQC 5FWBA 2C0IA 1ZX6A 3VS6A 2X3XD 4J9CA 4HXJA 1AWWA 2RQWA 2LP5A 2RN8A 2EGEA 3CQTA 2ECZA 2E5KA 1U06A 4AFZC 2KE9A 2J7IA 5FWCA 4JPBW 2DL8A 1UGVA 2VWFA 3I5RA 1S1NA 2OI3A 1I07A 4AFQC 3VRZA 3VRYA 1MV3A 4Z89A 5L23A 1RUWA 2KYBA 2ABLA 2OAWA 2A37A 2FPDA 2GQIA 2EYZA 2O2OA 4AG2C 1EFNA 2RQUA 1YWOA 1K0XA 4AG1C 1QKWA 1BB9A 1HD3A 1WLPB 2EVRA 2EKHA 1W1FA 1T0JA 1XOVA 2EGCA 2CREA 2K9GA 1X6BA 2PZ1A 3M0UA 3REAB 5IXFA 1U3OA 2B86A 2RQRA 1MV0B 3M0RA 1KIKA 3M0SA 3REBB 1KSWA 2LJ1A 1ABQA 4GLMA 2F2VA 2KXCA 2LZ6B 1OPLA 2DBKA 3H0FA 1SPKA 1JXOA 2HBWA 3KFVA 3PE0A 3SEMA 2LCSA 1WXTA 1J3TA 1QWEA 5IHKA 2EGAA 2DJQA 5IHNA 2PNIA 2A08A 1K4US 2J6KA 3O5ZA 2O9VA 2L2PA 4RTXA 2AZSA 1UUEA 2DYBA 4RTUA 1UTIA 5I22A 2CUBA 4D8DA 1WDXA 2EYYA 2J06A 2FEIA 1GBRA 3UF4A 4OMNA 1K0SA 1FMKA 1I1JA 1HSQA 1QKXA 2A36A 4JZ4A 1Y57A 1M3BA 1SRLA 2LQNA 2JT4A 2KBTA 2LJ0A 1M8MA 1Z9QA 3H0HA 3QWXX 2NUZA 2EQIA 4GBQA 4OMMA 1AWOA 1QLYA 2CSIA 4LN2A 4IIOA 1BU1A 1PHTA 1ARKA 2BZYA 2AZVA 4IIMA 1UHFA 1SHFA 4J9HA 1NYGA 2CDTA 4AFSC 2DILA 2RNAA 2DM1A 2HSPA 4RUGA 2DRMA 2SEMA 3SHWA 2CH4W 2SRCA 3H41A 2AKLA 2KR3A 3UA7A 4LNPA 2DMOA 2P4RA 2LX7A 3TSZA 1T0HA 1K9AA 4R0KA 2DA9A 2LJ3A 1W70A 4RTTA 1TUCA 1NEBA 1OEBA 1UE9A 2C0OA 5FW9A 2O9SA 4JZ3A 4J9EA 2X3WD 3I35A 2DX1A 1LCKA 2DL3A 2J6OA 2O31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3Q A;  3C0C A;  3JV3 A;  2KT1 A;  1PNJ A;  1TG0 A;  1ZBJ A;  3NPF A;  5EC7 A;  2DRK A;  2VKN A;  2DLP A;  2RPN A;  1Y0M A;  1NM7 A;  2YUN A;  2I0N A;  1A0N B;  2ENM A;  3PVQ A;  1NLO C;  4OMP A;  1YNZ A;  2LNH B;  2MIO A;  5IXB A;  1TUD A;  1YWP A;  5ECA A;  2V1Q A;  1MUZ A;  2DBM A;  5HCK A;  1CKA A;  3EG2 A;  2JW4 A;  1AD5 A;  1KJW A;  4J9F A;  1X27 A;  1UHC A;  3TVT A;  4HVU A;  1H92 A;  1PKS A;  1UDL A;  1SRM A;  2MCN A;  1E7O A;  4JJD A;  2LMJ A;  1GCP A;  3TSW A;  2YUQ A;  5IHI A;  1WIE A;  2D0N A;  2DL5 A;  2ROL A;  2K79 A;  2KXD A;  4RTZ A;  1X69 A;  1K76 A;  4X1V A;  2HDA A;  2QDL A;  4J9B A;  2CSQ A;  2JM8 A;  1WXU A;  1M3A A;  2JM9 A;  4OML A;  1H3H A;  5GJV B;  3PVL A;  1BBZ A;  4HVV A;  2W0Z A;  3M0T A;  1X6G A;  2L3S A;  2V1R A;  2KNB B;  1ZLM A;  1OV3 A;  4CC4 B;  2YDL A;  2EBP A;  2RQV A;  1ZUK A;  1U5S A;  4EIK A;  2DNU A;  2AKK A;  2ED1 A;  2DF6 A;  1JO8 A;  4FSS A;  2GTO A;  2RF0 A;  1SSH A;  1GL5 A;  4LUD A;  3UA6 A;  1Z9Z A;  2JS2 A;  2NWM A;  2KRS A;  3EGU A;  4A63 B;  1T3L A;  1UEC A;  3IQL A;  2JMC A;  1HJD A;  1GFD A;  3VS4 A;  1SEM A;  2BTT A;  1UG1 A;  1FYN A;  2XMF A;  2M0Y A;  1VYT A;  4OMQ A;  1GRI A;  2EYX A;  3EHQ A;  4J9G A;  3RBB B;  2JTE A;  3QWY A;  2EYW A;  1AWJ A;  4Z8A A;  2FPE A;  2D8H A;  4F16 A;  4KRT A;  2K2M A;  3NGP A;  3M0Q A;  2K3B A;  1VA7 A;  1PKT A;  1WFW A;  2L3Q A;  1I0C A;  5GJW B;  2D1X A;  1X43 A;  1GFC A;  2KYM A;  4DEX A;  3EG1 A;  1NYF A;  2ESW A;  2EW3 A;  4OMO A;  2OJ2 A;  1AVZ C;  2C0T A;  1M30 A;  2L0A A;  4J9D A;  2W10 A;  2CT4 A;  2G6F X;  2KRM A;  1QCF A;  1GCQ C;  4DEY A;  3ULR B;  1SHG A;  2AK5 A;  1WI7 A;  4QT7 A;  4Y92 A;  3EG0 A;  1WA7 A;  2BZ8 A;  3EHR A;  3VS3 A;  1OPK A;  1QWF A;  1NG2 A;  2LQW A;  2PTK A;  1ZUY A;  2BZX A;  2RQT A;  2JMA A;  2K7A A;  4JJB A;  1UJY A;  4AFU C;  3I5S A;  3H0I A;  2KRO A;  3NHN A;  2YUO A;  2J6F A;  4ORZ A;  4RTY A;  4WCI A;  2EPD A;  2GGR A;  3U23 A;  1NEG A;  2VVK A;  4HVW A;  4JJC A;  2ED0 A;  2YT6 A;  4F17 A;  3R6N A;  3RNJ A;  2F2X A;  2GTJ A;  1JU5 C;  2DE0 X;  3VS2 A;  1CKB A;  4J9I A;  4ESR A;  4RTV A;  2CH4 A;  2FRY A;  2KGT A;  2F2W A;  4ZNX A;  2D8J A;  1YN8 A;  3A98 A;  1VYV A;  3EG3 A;  2ROT A;  2L3P A;  4HCK A;  4D8K A;  3ZL7 C;  4RTW A;  1NLP C;  2KT8 A;  1PRL C;  1G2B A;  3FJ5 A;  2FPF A;  1PWT A;  1BK2 A;  4CC3 A;  1WYX A;  2YSQ A;  1GCQ A;  4CC2 A;  1M27 C;  1M3C A;  1ABO A;  2CT3 A;  1OOT A;  2YUP A;  3I9Q A;  3THK A;  3NMZ C;  1AZG B;  4LE9 A;  2RMO A;  1GBQ A;  2MOX A;  2GBQ A;  1WX6 A;  3VS0 A;  4F14 A;  1K1Z A;  2DL7 A;  1AZE A;  1JEG A;  1UJ0 A;  2DVJ A;  1CSK A;  1AWX A;  1JXM A;  2JXB A;  1G83 A;  2KEA A;  1ZSG A;  1T3S A;  2KRN A;  2J05 A;  1JQQ A;  5IH2 A;  1AEY A;  2HCK A;  3VS1 A;  2IIM A;  3M0P A;  1W6X A;  1V1C A;  4CC7 A;  2CUD A;  1ZUU A;  1X2K A;  1X2Q A;  2DL4 A;  1WXB A;  2FG0 A;  3UAT A;  1RI9 A;  2GNC A;  1E6G A;  3VS5 A;  1PRM C;  2H8H A;  3GBQ A;  1B07 A;  1RLP C;  2A28 A;  1IO6 A;  4K11 A;  1H8K A;  1VYU A;  2HEQ A;  1YCS B;  2JS0 A;  2O88 A;  1N5Z A;  2M51 A;  3LH5 A;  3VS7 A;  1AOJ A;  2K6D A;  2FO0 A;  4E6R A;  1YP5 A;  4M4Z A;  1UFF A;  1KFZ A;  1E6H A;  2FRW A;  4Z88 A;  5I11 A;  4LUE A;  1RLQ C;  5FWB A;  2C0I A;  1ZX6 A;  3VS6 A;  2X3X D;  4J9C A;  4HXJ A;  1AWW A;  2RQW A;  2LP5 A;  2RN8 A;  2EGE A;  3CQT A;  2ECZ A;  2E5K A;  1U06 A;  4AFZ C;  2KE9 A;  2J7I A;  5FWC A;  4JPB W;  2DL8 A;  1UGV A;  2VWF A;  3I5R A;  1S1N A;  2OI3 A;  1I07 A;  4AFQ C;  3VRZ A;  3VRY A;  1MV3 A;  4Z89 A;  5L23 A;  1RUW A;  2KYB A;  2ABL A;  2OAW A;  2A37 A;  2FPD A;  2GQI A;  2EYZ A;  2O2O A;  4AG2 C;  1EFN A;  2RQU A;  1YWO A;  1K0X A;  4AG1 C;  1QKW A;  1BB9 A;  1HD3 A;  1WLP B;  2EVR A;  2EKH A;  1W1F A;  1T0J A;  1XOV A;  2EGC A;  2CRE A;  2K9G A;  1X6B A;  2PZ1 A;  3M0U A;  3REA B;  5IXF A;  1U3O A;  2B86 A;  2RQR A;  1MV0 B;  3M0R A;  1KIK A;  3M0S A;  3REB B;  1KSW A;  2LJ1 A;  1ABQ A;  4GLM A;  2F2V A;  2KXC A;  2LZ6 B;  1OPL A;  2DBK A;  3H0F A;  1SPK A;  1JXO A;  2HBW A;  3KFV A;  3PE0 A;  3SEM A;  2LCS A;  1WXT A;  1J3T A;  1QWE A;  5IHK A;  2EGA A;  2DJQ A;  5IHN A;  2PNI A;  2A08 A;  1K4U S;  2J6K A;  3O5Z A;  2O9V A;  2L2P A;  4RTX A;  2AZS A;  1UUE A;  2DYB A;  4RTU A;  1UTI A;  5I22 A;  2CUB A;  4D8D A;  1WDX A;  2EYY A;  2J06 A;  2FEI A;  1GBR A;  3UF4 A;  4OMN A;  1K0S A;  1FMK A;  1I1J A;  1HSQ A;  1QKX A;  2A36 A;  4JZ4 A;  1Y57 A;  1M3B A;  1SRL A;  2LQN A;  2JT4 A;  2KBT A;  2LJ0 A;  1M8M A;  1Z9Q A;  3H0H A;  3QWX X;  2NUZ A;  2EQI A;  4GBQ A;  4OMM A;  1AWO A;  1QLY A;  2CSI A;  4LN2 A;  4IIO A;  1BU1 A;  1PHT A;  1ARK A;  2BZY A;  2AZV A;  4IIM A;  1UHF A;  1SHF A;  4J9H A;  1NYG A;  2CDT A;  4AFS C;  2DIL A;  2RNA A;  2DM1 A;  2HSP A;  4RUG A;  2DRM A;  2SEM A;  3SHW A;  2CH4 W;  2SRC A;  3H41 A;  2AKL A;  2KR3 A;  3UA7 A;  4LNP A;  2DMO A;  2P4R A;  2LX7 A;  3TSZ A;  1T0H A;  1K9A A;  4R0K A;  2DA9 A;  2LJ3 A;  1W70 A;  4RTT A;  1TUC A;  1NEB A;  1OEB A;  1UE9 A;  2C0O A;  5FW9 A;  2O9S A;  4JZ3 A;  4J9E A;  2X3W D;  3I35 A;  2DX1 A;  1LCK A;  2DL3 A;  2J6O A;  2O31 A; 
#chains in the Genus database with same CATH topology
 2QEX A;  1VQ4 Q;  3JV3 A;  2KT1 A;  1PNJ A;  3SDZ A;  2RHX A;  1ZBJ A;  3QDR B;  2E41 A;  3NPF A;  4F04 B;  3FB9 A;  1BCM A;  3V8J A;  2DRK A;  2VKN A;  4QW2 A;  4BI4 A;  2RPN A;  3H6Z A;  1VQL A;  1NM7 A;  2YUN A;  1FXX A;  4OMP A;  4Z02 A;  2MIO A;  2V1Q A;  4XTU A;  2QQA A;  2DBM A;  4MZT A;  4Q5W A;  5HCK A;  3EG2 A;  1PSE A;  4NL2 A;  4JS5 A;  4M78 F;  2QQS A;  1UHC A;  2L5Q A;  1Q82 C;  1OYX A;  4M7A E;  5A0G A;  4ATO A;  2C06 A;  5I2M A;  4M75 B;  4PJO F;  3TSW A;  4LDU A;  2YUQ A;  3G71 Q;  1D0Z A;  1QVP A;  1WIE A;  3L1A A;  3OBY A;  1X69 A;  2VAS A;  3RKY A;  1KC8 R;  3V8L A;  2HDA A;  3EH1 A;  4J9B A;  3S3O A;  4BY6 B;  4DBQ A;  1YJW T;  2X35 A;  5GJV B;  2M02 A;  3PVL A;  3I56 Q;  1N9R A;  1Q7Y C;  1RAC B;  2L3S A;  2V1R A;  2RK2 A;  2KNB B;  4N4G A;  2RQV A;  1Q7Y R;  5GAN g;  2AKK A;  1RI0 A;  2ED1 A;  2DF6 A;  2NUT B;  4KT0 E;  3MET A;  5FLX E;  3HRT A;  5D6W A;  2LQ8 A;  3UA6 A;  2R5M A;  2NWM A;  2F5K A;  5CVI A;  1GFD A;  1SKU B;  3VS4 A;  2E5Q A;  1M2O A;  3KBG A;  2PVD B;  3ZEH A;  4IUP A;  5LJ3 e;  4PK4 A;  1IHW A;  4XTX A;  2JTE A;  4Z8A A;  2D8H A;  4F16 A;  3JCM V;  5GAM d;  1JJ2 S;  1VQ7 A;  4QQG A;  3HL8 A;  3I56 T;  2L3Q A;  1GFC A;  4DEX A;  2WAC A;  3HKS A;  3EG1 A;  3QO3 A;  1M90 U;  2E4H A;  3MO8 A;  3R6O A;  5KE2 A;  1WHL A;  2LT1 A;  2DTH A;  2ESW A;  2EW3 A;  3CCE Q;  1MHN A;  4OB0 B;  2C0T A;  1M30 A;  2EQK A;  2L0A A;  4J9D A;  1WHK A;  2CT4 A;  2XHC A;  1GCQ C;  2XG8 D;  3C94 A;  4Y92 A;  3EG0 A;  1WA7 A;  1HYO A;  1OPK A;  1ZSZ B;  2LX9 A;  4PJJ A;  4DQ2 A;  2PTK A;  1ZUY A;  5LJ5 j;  1UJY A;  3CC7 Q;  3I5S A;  2DER A;  2KRO A;  5GAO l;  2E65 A;  4KUI A;  4ZGD B;  4JDS A;  5LJ3 f;  1PC0 A;  4PJO E;  4BE1 A;  1BI3 A;  3E2U A;  2DE0 X;  1MMD A;  2KGT A;  2LTO A;  4ZNX A;  3A98 A;  3EFO A;  3JCM f;  4D8K A;  2I2L A;  4RTW A;  1NLP C;  2KT8 A;  3A1P A;  2ZAE A;  2RK1 A;  4CC3 A;  2M0O A;  2AHJ B;  2YUP A;  3THK A;  3I9Q A;  1AZG B;  4LE9 A;  2RMO A;  3CPW S;  1QVG S;  5KYN A;  3CCR T;  3M53 A;  3VS0 A;  1K1Z A;  2DL7 A;  2V8K A;  1UJ0 A;  1G3T A;  5C0M A;  4NS5 A;  4A4E A;  2D9T A;  4PL6 A;  1YIT A;  4FYY B;  1AWX A;  1Q82 U;  1VIF A;  5GAN h;  3CME Q;  1QVG P;  1O9S A;  2CP6 A;  4C0D C;  2KRN A;  2CZ1 B;  2LCL A;  3TRE A;  2A0F B;  1D1A A;  4HA8 A;  4DBF A;  3JB9 D;  1RL2 A;  1OI1 A;  1ZUU A;  1X2Q A;  2QYZ A;  1RI9 A;  3VS5 A;  1PRM C;  3GBQ A;  4OGC A;  1Y71 A;  1U1S A;  1B07 A;  4A54 A;  5GMK m;  1IO6 A;  1Y07 A;  4J83 A;  1WZO A;  5GAN f;  1H8K A;  3ASK A;  3VS7 A;  4FYW B;  5GMK j;  2FO0 A;  2K5L A;  1VQN Q;  3TQ7 P;  1FWZ A;  3M4Y A;  4NL3 A;  2X51 A;  2FRW A;  3GPL A;  5FU6 C;  5I11 A;  3M4G A;  3EG9 B;  3A5Z B;  3VS6 A;  4IUQ A;  1AWW A;  3J81 E;  3TCJ A;  3UWN A;  2EGE A;  1QP3 A;  2FVU A;  3ZBD A;  3FRN A;  5CCA A;  1U06 A;  3CBO A;  5CO7 A;  2J7I A;  5FWC A;  5LJ5 g;  2LCC A;  1UGV A;  3I5R A;  3M56 A;  4MMK A;  1I07 A;  3VRY A;  2HBP A;  3M55 A;  1N6A A;  3QHS A;  2FPD A;  5KCO A;  3CCJ A;  1JJ2 A;  4JJN K;  5M9O A;  1N8R R;  3OYY A;  1DJ7 B;  4OGE A;  3CCS A;  1D09 B;  3HHT B;  4JRK A;  3GOX A;  3JCM e;  2EQU A;  4M77 F;  4E7S A;  2EGC A;  1OZ2 A;  2HQX A;  2K9G A;  2VC8 A;  4HCB A;  4C8Q C;  3HFN A;  3FJP A;  2Y4X A;  4B9W A;  4M75 G;  2HMA A;  1W2B P;  1KIK A;  1RAD B;  3M0S A;  1UGQ B;  1KSW A;  3OYG A;  1VQ4 T;  3HRS A;  2KXC A;  3GNG A;  4PJO B;  5AYF A;  3H0F A;  5FRN A;  1SPK A;  3CCL A;  5GAM j;  3AT1 B;  1WXT A;  2E64 A;  2K5F A;  3G4S T;  3VV0 A;  3BE3 A;  2LRQ A;  5GAN d;  2QK0 A;  5IHN A;  5KYY B;  2PNI A;  2QA4 A;  2A08 A;  1ZSZ C;  2J6K A;  4XU2 A;  3E19 A;  2DD5 A;  2AZS A;  2LVM A;  2R57 A;  3A8O B;  3EGX B;  2CUB A;  3O8V A;  1PD1 A;  3RDV A;  1WQW A;  3JB9 H;  1RAA B;  2LT4 A;  3UF4 A;  3OB9 A;  1HSQ A;  1M3B A;  1WHM A;  1RAF B;  5GAN 7;  1Z9Q A;  5A0L A;  2E10 A;  1NPP A;  2WSF E;  2XU8 A;  3GF5 A;  3M58 A;  1XQH A;  1YHQ T;  2XDB A;  4OMM A;  4IIO A;  2FZK B;  1BU1 A;  1ARK A;  1XNI A;  5KYU A;  2QAZ A;  2BZY A;  3F70 A;  3GIB A;  3ER0 A;  3NTI A;  4KUD K;  3OYB A;  1BI1 A;  4XU0 A;  2DIL A;  1MND A;  4E7Z A;  2DRM A;  2KI7 A;  3SHW A;  1W2B A;  2CH4 W;  2SRC A;  2AKL A;  2GQV A;  2CP2 A;  1ZBX A;  4RCB A;  1VQ9 A;  2DMO A;  2K3X A;  3LWH A;  1M2V A;  4RTT A;  4M77 E;  5FW9 A;  3OYH A;  4J9E A;  2P0Q A;  2X3W D;  3FLG A;  4FYX B;  5LJ3 d;  3LWI A;  2J6O A;  2O31 A;  1B3Q A;  1VQ4 A;  3J7A F;  2QDY B;  4EMK A;  1TG0 A;  1KQ2 A;  3CXC S;  3UT1 A;  2DKG A;  4XU3 A;  1YCY A;  5EC7 A;  4FM4 B;  4VUB A;  5CR2 A;  1Y0M A;  4LD6 A;  1ACM B;  1OZ3 A;  3VUB A;  1VQK Q;  1A0N B;  3PVQ A;  3DKM A;  3CD6 T;  2LNH B;  4M75 D;  2JOY A;  1FMW A;  2M16 A;  1YJ9 A;  1NPR A;  3EGD B;  1IZ6 A;  4X9C A;  1AD5 A;  1VQ9 Q;  3TVT A;  1H92 A;  2K2V A;  1PKS A;  2DIQ A;  3UDC A;  2ZPF B;  2V8I A;  2MCN A;  4GY5 A;  1GCP A;  1R8O B;  4M77 G;  2VYT A;  2ROL A;  3T9N A;  1UB4 A;  4PKC C;  4WF2 A;  2QDL A;  2CSQ A;  4PJO D;  1WXU A;  1M3A A;  2RD1 A;  3JAM E;  2X9H A;  4OML A;  1I5L A;  4DOV A;  5LJ3 g;  2YRD A;  4C0F A;  3OMG A;  1M1K R;  3OYL A;  4HVV A;  2W0Z A;  3URG A;  4LDV A;  4HT9 A;  2LC4 A;  1ZLM A;  1OV3 A;  2Y90 A;  4CC4 B;  3G4S A;  4M7D D;  3MEV A;  1ZUK A;  3QBY A;  3S3N A;  2FZG B;  4ZTJ A;  4M7D C;  3OSV A;  2ZPB B;  3L2U A;  4FSS A;  2RF0 A;  4XTZ A;  1KQ1 A;  1YFN A;  5GAN 3;  4A53 A;  3BDL A;  1Z9Z A;  3OW2 P;  1HXD A;  1KHC A;  4N0A C;  5GMK h;  4A63 B;  4GLK A;  3IQL A;  4MZM A;  2KY9 A;  1VQP T;  1LPL A;  4JUV A;  1UG1 A;  4CI0 C;  2KSS A;  2M0Y A;  1VYT A;  4OMQ A;  3JCM W;  3EHQ A;  5GAM e;  4EMK B;  2RA2 A;  3V7C A;  2CYZ B;  3QWY A;  2H3E B;  2EYW A;  5CK9 A;  1H3Z A;  4WTO B;  3OYD A;  2FPE A;  4ELZ C;  1M90 C;  2DPP B;  4ZGJ B;  5GAO p;  5KYY A;  3OA6 A;  3CCU Q;  3OS5 A;  1WFW A;  1I0C A;  2D1X A;  1X43 A;  4J6W A;  3J80 E;  2GF7 A;  5I2S A;  2EJ9 A;  4OMO A;  4C5I A;  2PUO B;  3CCV T;  2OTL Q;  1LNX A;  1KQS S;  3SB2 A;  1TU0 B;  1VQ9 T;  3RIR A;  2KRM A;  1K9M U;  2CP0 A;  1BI2 A;  1SHG A;  4QT7 A;  1NJI C;  3QYH B;  1K8A U;  4KBM B;  4QQD A;  4II1 A;  1YIT T;  2LQW A;  2IVW A;  3I55 A;  1VQN T;  3I55 Q;  4M7D B;  1AT1 B;  2JUF A;  1I4K 1;  4AFU C;  3H0I A;  2ZPI B;  1YJN T;  2YLC A;  1V76 A;  3NHN A;  3DB4 A;  2YUO A;  2J6F A;  4WCI A;  2OTJ A;  2GGR A;  2MK5 A;  2VVK A;  4HVW A;  3A8M B;  4JJC A;  2EQM A;  4M77 A;  4F17 A;  3R6N A;  2F2X A;  2BIV A;  1JU5 C;  3SD4 A;  4RTV A;  4M7D A;  2CH4 A;  1C1A A;  2FRY A;  4BE0 A;  2L89 A;  2PVO B;  4M77 D;  4J5Y A;  3JRZ A;  3EG3 A;  2L3P A;  1F1B B;  2XDD A;  2CKK A;  1ZA2 B;  1G2B A;  1I5O B;  2GFA A;  1WQ7 A;  2E6Z A;  3M59 A;  1OQK A;  1Q86 R;  1ABO A;  2D0Q B;  1RAE B;  2E6N A;  4M78 D;  3NMZ C;  5CQY A;  1VQO T;  1Q86 C;  1RAI B;  4M7D G;  2HZY A;  4M78 C;  3JB9 G;  2MOX A;  2DEU A;  1XJW B;  5FU6 B;  4RMO A;  2CZ7 B;  4DA4 A;  1K73 C;  2KVQ G;  2DVJ A;  3MEW A;  4M75 E;  5L8R E;  4BI3 A;  1YJN Q;  4M75 A;  2JXB A;  2RI5 A;  1G3S A;  3OYA A;  3CPW A;  2KQW A;  1T3S A;  1I8F A;  1D1C A;  2J05 A;  1M8V A;  3JSC A;  1JQQ A;  4X34 A;  2DD4 A;  2QI2 A;  3CMA A;  1IB8 A;  3VS1 A;  4HT8 A;  3L2R A;  1W6X A;  3SFM A;  5DM7 R;  1X2K A;  2E3I A;  2DL4 A;  1IRX A;  2FG0 A;  5HK0 A;  5DLQ E;  2EJF A;  2GNC A;  4JRI A;  3PIP A;  4L59 A;  1BI0 A;  1NJI U;  1BIB A;  3H9N A;  1WNL A;  4E7I A;  1VYU A;  2HEQ A;  1IXD A;  2JNG A;  1YCS B;  2JS0 A;  4BY6 C;  1N5Z A;  3LH5 A;  4J7I A;  2L8D A;  3CCS Q;  4E7L A;  1KFZ A;  1YJ9 T;  2OX7 A;  3HPW A;  3PMT A;  4E2F B;  4IUR A;  1ZX6 A;  1KC8 U;  4XAX B;  2RQW A;  1OU9 A;  3P8B B;  1LVK A;  4CRI A;  4MZP A;  1M2V B;  3E9G A;  1TTH B;  2E5K A;  3EFO B;  3CXC P;  1M1K U;  4AFZ C;  2DL8 A;  4F7U F;  3OY9 A;  3CMA Q;  3DB3 A;  1D0X A;  5LJ5 h;  1VQM A;  3LH0 A;  3VRZ A;  1VQ7 Q;  2EQJ A;  4M7D F;  1N8R C;  3QPH A;  2OTL T;  2OAW A;  2A37 A;  2FL7 A;  5DY9 A;  2O2O A;  4AG2 C;  2LDM A;  1EFN A;  2FYK A;  5J26 A;  2DXB A;  4AG1 C;  3I55 T;  5FU7 C;  2RO0 A;  1HD3 A;  2EVR A;  2O01 E;  2EKH A;  1UGP B;  4AT1 B;  2ATC B;  4B9X A;  3OYN A;  2PZ1 A;  1MMA A;  3M0U A;  1Y7X A;  3A8L B;  1KD1 R;  4PJO C;  2BE9 B;  2RQR A;  1MV0 B;  1S72 Q;  4J7F A;  2RI3 A;  3V8K A;  1C0M A;  2LJ1 A;  4M78 G;  4XU1 A;  3MHX A;  4GLM A;  1TH7 A;  2F2V A;  2QEX T;  1OPL A;  4O6J A;  2RHZ A;  1SF9 A;  2DBK A;  1JXO A;  3PE0 A;  3QXE B;  2LCS A;  4B6M A;  2FHD A;  3E9F A;  2DTO A;  2VUB A;  2OAU A;  1X75 C;  3CD6 Q;  2O9V A;  3Q1J A;  2KDS A;  2DYB A;  3NFC A;  4RTU A;  4FL6 A;  1UTI A;  2QQ9 A;  2KK4 A;  1YBY A;  2KAF A;  2HL5 C;  4RKU E;  5GAM g;  2ZPG B;  1YJ9 Q;  4DBR A;  2IG0 A;  1K8A C;  3KXT A;  1QKX A;  2A36 A;  3OSS C;  3S3M A;  3CXC A;  2LQN A;  1TSF A;  2KBT A;  3PGG A;  4OB3 B;  1Q95 G;  1HK9 A;  1Y96 B;  3QUI A;  2DXU A;  2EQI A;  1ZHI A;  2HD0 A;  3CMA T;  1TWB A;  2MMP A;  4M7A A;  2AZV A;  2DK3 A;  2ZPE B;  1VQ8 A;  1WHJ A;  3X25 B;  1NYG A;  2RH2 A;  2HSE B;  4AFS C;  1IGU A;  2RNA A;  3L2W A;  2PVG B;  3G7Z A;  2BKD N;  4RUG A;  4DBH A;  1OU8 A;  1W2B S;  2YXY A;  1QW1 A;  4C0Z A;  4C8Q G;  2HKQ B;  4PJL A;  4LNP A;  1T0H A;  2E70 A;  2DET A;  4KGZ B;  4M7D E;  2DA9 A;  1W70 A;  1TUC A;  1NEB A;  4C92 D;  1OEB A;  2QTX A;  4PJO A;  2P0P A;  4C92 C;  5GMK l;  3I35 A;  8ATC B;  5GAO n;  1LCK A;  2M1H A;  2DL3 A;  1S72 T;  1D3B B;  3A8H B;  4N4H A;  3L2Z A;  2QEX Q;  2AIR B;  3EGD A;  2P84 A;  2PUK B;  4HKE A;  1BIA A;  1R77 A;  2I0N A;  2ENM A;  4PJO G;  1EIF A;  3PNW C;  1YNZ A;  3OS1 A;  1TUD A;  1YWP A;  4QVZ A;  3CCV Q;  3M5A A;  3CC4 A;  1CKA A;  1NJI R;  1EX4 A;  3MCA B;  1G5V A;  2EFI A;  4J9F A;  1X27 A;  2DFU A;  5HKC A;  4HVU A;  4D6W A;  1QVF S;  1KD1 C;  1UDL A;  4C5G A;  1SRM A;  4J6X A;  3OYC A;  2D0N A;  2K79 A;  3X24 B;  3QDF A;  4X1V A;  5KYX B;  2JM8 A;  1VQ5 A;  3JB9 I;  2JM9 A;  1X6O A;  3DLL A;  5KH6 A;  3CCU A;  3C4S A;  1BBZ A;  2RJE A;  5LJ3 h;  2CGH A;  5FRO A;  3M0T A;  1X6G A;  3JCM J;  2DEQ A;  1RAH B;  3G4S Q;  1KQS A;  3DLM A;  2KMT A;  2EBP A;  1MGQ A;  1U5S A;  3FEO A;  2DNU A;  2XKO C;  3QJY A;  2GTO A;  1SSH A;  2K4Y A;  1QCO A;  4LUD A;  2EAY A;  2JS2 A;  4XQ3 A;  2KRS A;  2RJD A;  2Y4Y A;  3EGU A;  1UEC A;  1VOM A;  3MPU B;  2JMC A;  1VQO Q;  1M1F A;  1C6V X;  1N8R U;  3INZ A;  3X26 B;  4F7U E;  2BTT A;  2DXC A;  2XMF A;  4C5H A;  4PFO A;  4ELY C;  4FT4 A;  4QKU A;  1GRI A;  3RUX A;  3OYK A;  3OYJ A;  3WVD B;  3SWN B;  1N27 A;  2XK0 A;  3RBB B;  5FRM A;  1PG5 B;  4C8Q D;  1AWJ A;  2QA4 T;  2H3J A;  2K2M A;  4OP0 A;  3S6W A;  3NGP A;  2HL3 A;  5AT1 B;  2K3B A;  2XD0 A;  1VA7 A;  1PKT A;  1TOV A;  4AMC A;  5GJW B;  4C92 G;  4R56 A;  2KYM A;  2QQR A;  3GNF B;  1VQ8 T;  2MWO A;  3M57 A;  4LXC A;  1XTD A;  4M77 C;  2OJ2 A;  1AVZ C;  1D1B A;  3OW2 A;  3JCM g;  2W10 A;  2RI2 A;  2G6F X;  3L42 A;  2DXT A;  2GFU A;  1YI2 A;  2AK5 A;  1WI7 A;  1BYM A;  2CS7 A;  2K57 A;  3VS3 A;  1M4Z A;  1QWF A;  1NG2 A;  3C12 A;  3KUF A;  3X20 B;  2CZ6 B;  1KHI A;  2DO3 A;  2XDP A;  2BZX A;  2RQT A;  2JMA A;  4JJB A;  2F1L A;  4RTY A;  4ORZ A;  3RES A;  4A4H A;  1TUG B;  1NEG A;  5GAN 2;  3MEA A;  2YT6 A;  5IT9 E;  4ME7 A;  2GTJ A;  2QA4 Q;  1CKB A;  4ESR A;  4BB7 A;  2F2W A;  3CCL Q;  2D8J A;  1QVG A;  2NUP A;  1VYV A;  2ROT A;  1D0Y A;  2VGM A;  1VQ8 Q;  3ZL7 C;  1PRL C;  3FJ5 A;  2VV5 A;  4IKF A;  3V7R A;  1BK2 A;  1QQJ A;  4BUG A;  2QTV A;  1OOT A;  5IAY A;  5GAN j;  1I81 A;  1ZQ1 A;  1GBQ A;  1WX6 A;  1AZE A;  1JEG A;  2V8J A;  1BKB A;  4RCC A;  2X4J A;  1CSK A;  3G6E Q;  3BY7 A;  2NUP B;  1B34 A;  5CAI A;  5KYU B;  4FIB A;  4OVA A;  5HK3 A;  1VQ6 A;  3I56 A;  3PIO A;  4PFP A;  1QMC A;  4OMF B;  4X9D A;  3HTR A;  2HCK A;  5CIU A;  2OTL A;  2IPO B;  2MF2 A;  1V1C A;  4CC7 A;  5GAO q;  3TEE A;  2CUD A;  3FC3 A;  4JS4 A;  1WXB A;  2COY A;  3UAT A;  4F7U G;  3JCM Q;  3RKX A;  4M7A F;  2H8H A;  3JB9 J;  2RHI A;  5D6X A;  2EKO A;  4ZN1 A;  2A28 A;  4M78 E;  2WSC E;  4K11 A;  1PCX A;  2DTI A;  2MWP A;  5GAN e;  3MKD A;  4HCZ A;  4XK8 E;  1JB0 E;  1AOJ A;  2K6D A;  2CP5 A;  4E6R A;  1YIJ Q;  1YP5 A;  4M4Z A;  3EFS A;  1GXI E;  5GAN 4;  1E6H A;  1M5Q 1;  3MP1 A;  3CPW P;  3HP9 A;  2C0I A;  2X3X D;  2X4Y A;  2DVE A;  4HXJ A;  4J9C A;  5LJ5 d;  3G6E T;  1VQ5 Q;  3OYI A;  1P92 A;  2R5A A;  1YHQ Q;  3BW1 A;  2ECZ A;  1VQ6 Q;  2K3Y A;  3NTH A;  2D6F A;  4JPB W;  3WVE B;  3JCM h;  2VWF A;  3OW2 S;  1S1N A;  1Q7Y U;  5KCH A;  1YJW A;  5HY6 A;  4EPC A;  5KYX A;  1MV3 A;  3CCM A;  3CD6 A;  2EIF A;  5L23 A;  1RUW A;  2KYB A;  2RJF A;  1B7T A;  2EYZ A;  1QCN A;  2RQU A;  1YIT Q;  5GMK i;  1K0X A;  3EFR A;  1QKW A;  4Y28 E;  3LW5 E;  4N4I A;  3SWN C;  1WLP B;  3JCM b;  3CCR Q;  1KK7 A;  1W1F A;  4FW1 A;  2O4X A;  1X6B A;  3JCM P;  3REA B;  4FU6 A;  2L3R A;  3N5B B;  3M0R A;  3REB B;  3GP8 A;  3QII A;  1VQL Q;  4M75 F;  2DJZ A;  2LZ6 B;  4XTV A;  1JBM A;  3SEM A;  3KFV A;  3VYG A;  4LDX A;  3TU4 K;  1QWE A;  2QGF B;  1D3B A;  1J3T A;  3EG9 A;  2EGA A;  1M90 R;  1TS9 A;  3O5Z A;  4BAC A;  2L2P A;  1VQM T;  3OQ5 A;  1YIJ A;  1UUE A;  1VQN A;  2BUD A;  5I22 A;  4PNO A;  1WDX A;  1K8A R;  1VQP A;  2J06 A;  2OTJ T;  2FEI A;  1GBR A;  4OMN A;  1FMK A;  3HRU A;  1S72 A;  2NYS A;  1I1J A;  4J6Y A;  2ZZD A;  1Y57 A;  3SWN A;  1JRI A;  2JT4 A;  4KGX B;  5LJ5 f;  2LJ0 A;  3QZ5 B;  1M8M A;  1R0C B;  4A4F A;  1WPY A;  3VJP A;  1VQ6 T;  3H0H A;  1QVF A;  2NUZ A;  4BDZ A;  4M7A B;  2YHT A;  4GBQ A;  5DLO A;  1PD0 A;  4C0G A;  1KQS P;  3ZFJ A;  4C8Q B;  3G1J A;  3CME A;  1RAB B;  2JTF A;  5A2Q E;  4FCY A;  4IIM A;  5GAM f;  1UHF A;  3CC4 T;  1SHF A;  4J9H A;  1G3W A;  1WGS A;  1AHJ B;  1PM3 A;  2A3L A;  2HSP A;  4L6V 5;  3CCJ T;  1K73 U;  1VQM Q;  3H41 A;  1Q86 U;  3UA7 A;  4BI8 B;  1OUL A;  3CCS T;  2LX7 A;  3TSZ A;  2A7Y A;  1K9A A;  1H64 1;  4R0K A;  1ZA1 B;  3QKJ A;  2OTJ Q;  4PJN A;  2FB7 A;  1NZ9 A;  1VUB A;  2C0O A;  4C92 B;  4JZ3 A;  3JCM c;  2COZ A;  4ZGE B;  1YJN A;  3P8H A;  4L5G A;  1WJQ A;  1M9S A;  2VGN A;  3C0C A;  3JCM X;  1EZZ B;  2YWW A;  3CBM A;  1QP2 A;  1WJS A;  3OS2 A;  2LQK A;  3ME9 A;  2DLP A;  5KYW A;  2Z0W A;  3VUZ A;  3P8D A;  7AT1 B;  2CP3 A;  3LGF A;  2QAS A;  4FW2 A;  4ZTF A;  1NLO C;  4R55 A;  1Q81 U;  5IXB A;  5ECA A;  1MUZ A;  2BE7 D;  2HNI A;  2JW4 A;  1KJW A;  2VB6 A;  3NTK A;  2NLU A;  3CCM Q;  1X01 A;  4QVC A;  3CC2 T;  4C92 E;  1K9M C;  4OB2 B;  1E7O A;  4JJD A;  2LMJ A;  4PJM A;  4RG8 A;  5D7U A;  5IHI A;  2DL5 A;  4IUU A;  2KXD A;  4RTZ A;  3BFM A;  1K76 A;  5CKD A;  4Y91 A;  2LNV A;  1NBE B;  2F69 A;  1YHQ A;  4IUT A;  4KUL A;  4C0D B;  2XI9 A;  1H3H A;  3X28 B;  4C8Q E;  2E3H A;  2X4X A;  1SSF A;  1FX7 A;  4E47 A;  4N0A A;  2QXF A;  3VKI A;  3CCL T;  2YDL A;  3CC4 Q;  5GAM h;  5CKF A;  4EIK A;  3CPF A;  4MDW A;  2EYQ A;  5D6Y A;  1JO8 A;  3WXM B;  1RAG B;  1GL5 A;  4P5N A;  5I21 A;  1LJO A;  2MPX C;  2JVV A;  2DIG A;  2PQW A;  1T3L A;  4PLI A;  4JLG A;  1HJD A;  2O4X B;  3CCM T;  1SEM A;  1OX8 A;  1U1T A;  3CCQ A;  1FYN A;  2RB6 A;  1Y96 A;  3CCQ Q;  3PMI A;  4J8O A;  1MMN A;  2JTM A;  3LGL A;  4A4G A;  2NUT A;  2F5T X;  2EYX A;  4J9G A;  4A4K A;  5FU7 B;  3OMC A;  1KD1 U;  1O75 A;  3JCM d;  2RJC A;  2K5I A;  5GAN 6;  4BE2 A;  4KRT A;  2E12 A;  4LDY A;  3M0Q A;  1WHH A;  5GMK e;  4C92 A;  3RER A;  4FYV B;  4EMG A;  4E7H A;  5J39 A;  1NYF A;  5C6S A;  3MEU A;  4TVR A;  4UC4 A;  3HSB A;  4LDW A;  3CCR A;  2G3R A;  1QCF A;  4OF1 A;  3ULR B;  4DEY A;  1FMV A;  3EHR A;  2BZ8 A;  4EMK C;  4QQ6 A;  4M7A D;  5CKE A;  1MNE A;  2HAX A;  4EDU A;  5GAO m;  2K7A A;  3G71 T;  4JRQ A;  4KGV B;  1W4S A;  1G8X A;  1R0B G;  2EPD A;  3U23 A;  4JRP A;  4E7K A;  4PLL A;  2ED0 A;  5CQX A;  3RNJ A;  9ATC B;  3VS2 A;  4J9I A;  3LYI A;  1KC8 C;  4M77 B;  2RM4 A;  4RG2 A;  3CCE A;  1YN8 A;  4JLI A;  1VQ7 T;  2AT1 B;  1QVF P;  4HCK A;  1BCO A;  2FPF A;  1PWT A;  4IUV A;  3RMQ A;  2JZ2 A;  4O5V A;  1WYX A;  2JJ9 A;  1GCQ A;  2YSQ A;  5GAO r;  1K73 R;  4CC2 A;  1M27 C;  1M3C A;  2GCX A;  2CT3 A;  2MI6 A;  1G3Y A;  3QZ9 B;  3LLR A;  3CC2 Q;  4MDX A;  3CC2 A;  5CKB A;  4DOW A;  3M9Q A;  1VQP Q;  1IGQ A;  2DYI A;  2GBQ A;  4F14 A;  3LX7 A;  1YI2 T;  2RHU A;  2B8A A;  2FZC B;  2EWN A;  2HQE A;  4M78 B;  1JXM A;  1SG5 A;  1VQL T;  1G83 A;  4KH1 B;  4OB1 B;  2KEA A;  4FSX A;  1ZSG A;  1VIE A;  2YRV A;  3MP6 A;  5IH2 A;  1AEY A;  2IIM A;  3GLX A;  3M0P A;  2CZ0 B;  1N9S A;  2X4W A;  4M75 C;  3CCV A;  1Q81 R;  4C92 F;  2RHY A;  4XTY A;  1E6G A;  1RLP C;  3VU3 C;  1B34 B;  5KYW B;  2MAM A;  4C8Q F;  4KH0 B;  1JJ2 P;  5GAN 8;  3A8G B;  6AT1 B;  2O88 A;  2M51 A;  1IHV A;  3CCQ T;  2QQB A;  5J3B A;  1UFF A;  3M54 A;  3G71 A;  2HQH A;  4Z88 A;  3CBP A;  4LUE A;  2PU9 B;  3QYG B;  1RLQ C;  4MML A;  1YI2 Q;  4FT2 A;  5FWB A;  2HKN A;  5EG2 A;  4HCC A;  4XTW A;  3OYE A;  3CC7 T;  1V29 B;  2ZCF B;  3OBW A;  2LP5 A;  2RN8 A;  3EH2 A;  3CQT A;  3PFS A;  3RKW A;  2JN0 A;  2KE9 A;  2M9U A;  2XID A;  4M7A G;  1TXQ A;  3L2Q A;  2V26 A;  2DAQ A;  2OI3 A;  5KE3 A;  4AFQ C;  4QVD A;  3OYM A;  1VQK T;  3JB9 F;  2QG9 B;  4Z89 A;  2ABL A;  3H8Z A;  4YTL A;  2GQI A;  3CCJ Q;  1VQO A;  5IN1 A;  1NE8 A;  1YWO A;  2XIC A;  3OYF A;  1BB9 A;  2EJG A;  2YLB A;  4PFZ A;  5LL6 S;  3L2V A;  1U8R A;  3BDU A;  1T0J A;  1XOV A;  8AT1 B;  2CRE A;  5LJ5 e;  3MJX A;  3C95 A;  3RMS A;  2DZC A;  5IXF A;  1U3O A;  2CP7 A;  4BD3 A;  2B86 A;  1VQ5 T;  2COW A;  3CME T;  1ABQ A;  3G6E A;  1YJW Q;  2ZGW A;  4F7U A;  3UPU A;  2HBW A;  1Q81 C;  2DZ9 A;  3VYH B;  1M1G A;  2VXE A;  5IHK A;  1KG1 A;  4M78 A;  2DJQ A;  1OX9 A;  1LOJ A;  1K4U S;  3V7S A;  2YRC A;  1IRE B;  4RTX A;  2P0K A;  2R58 A;  4D8D A;  3QG1 A;  3HFO A;  1K9M R;  3PTA A;  1UEB A;  2EYY A;  3CEY A;  4BDY A;  4EMH A;  4LD9 K;  1K0S A;  4C8Q A;  4NOY A;  2ZPH B;  3E1S A;  4JZ4 A;  1SRL A;  3AHU A;  3EAE A;  1MMG A;  3MP8 A;  5LJ3 j;  3QWX X;  1AWO A;  1QLY A;  2CSI A;  5A0D A;  4LN2 A;  4E7J A;  3CCU T;  2MYS A;  1M1K C;  1PHT A;  2P4T A;  1ZSZ A;  1PSF A;  1VQK A;  3D7S B;  3QJ6 A;  2E1H A;  2CDT A;  2DM1 A;  1WHG A;  1UGS B;  3PT9 A;  3CCE T;  4ZN3 A;  2SEM A;  1WJR A;  2KR3 A;  4M7A C;  1UGR B;  2P4R A;  1YIJ T;  3FDR A;  4ANJ A;  2LJ3 A;  3EGX A;  3QSU A;  2WSE E;  3FIF A;  5CKH A;  3RR6 A;  2VXF A;  1UE9 A;  2O9S A;  4F7U B;  2QGG A;  5GAN 5;  2DX1 A;  3CC7 A;  1Q82 R;  4C5E A;  3OS0 A;  4V2S A; 
#chains in the Genus database with same CATH homology
 1B3Q A;  3C0C A;  3JV3 A;  2KT1 A;  1PNJ A;  1TG0 A;  1ZBJ A;  3NPF A;  5EC7 A;  2DRK A;  2VKN A;  2DLP A;  2RPN A;  1Y0M A;  1NM7 A;  2YUN A;  2I0N A;  1A0N B;  2ENM A;  3PVQ A;  1NLO C;  4OMP A;  1YNZ A;  2LNH B;  2MIO A;  5IXB A;  1TUD A;  1YWP A;  5ECA A;  2V1Q A;  1MUZ A;  2DBM A;  5HCK A;  1CKA A;  3EG2 A;  2JW4 A;  1AD5 A;  1KJW A;  4J9F A;  1X27 A;  1UHC A;  3TVT A;  4HVU A;  1H92 A;  1PKS A;  1UDL A;  1SRM A;  2MCN A;  1E7O A;  4JJD A;  2LMJ A;  1GCP A;  3TSW A;  2YUQ A;  5IHI A;  1WIE A;  2D0N A;  2DL5 A;  2ROL A;  2K79 A;  2KXD A;  4RTZ A;  1X69 A;  1K76 A;  4X1V A;  2HDA A;  2QDL A;  4J9B A;  2CSQ A;  2JM8 A;  1WXU A;  1M3A A;  2JM9 A;  4OML A;  1H3H A;  5GJV B;  3PVL A;  1BBZ A;  4HVV A;  2W0Z A;  3M0T A;  1X6G A;  2L3S A;  2V1R A;  2KNB B;  1ZLM A;  1OV3 A;  4CC4 B;  2YDL A;  2EBP A;  2RQV A;  1ZUK A;  1U5S A;  4EIK A;  2DNU A;  2AKK A;  2ED1 A;  2DF6 A;  1JO8 A;  4FSS A;  2GTO A;  2RF0 A;  1SSH A;  1GL5 A;  4LUD A;  3UA6 A;  1Z9Z A;  2JS2 A;  2NWM A;  2KRS A;  3EGU A;  4A63 B;  1T3L A;  1UEC A;  3IQL A;  2JMC A;  1HJD A;  1GFD A;  3VS4 A;  1SEM A;  2BTT A;  1UG1 A;  1FYN A;  2XMF A;  2M0Y A;  1VYT A;  4OMQ A;  1GRI A;  2EYX A;  3EHQ A;  4J9G A;  3RBB B;  2JTE A;  3QWY A;  2EYW A;  1AWJ A;  4Z8A A;  2FPE A;  2D8H A;  4F16 A;  4KRT A;  2K2M A;  3NGP A;  3M0Q A;  2K3B A;  1VA7 A;  1PKT A;  1WFW A;  2L3Q A;  1I0C A;  5GJW B;  2D1X A;  1X43 A;  1GFC A;  2KYM A;  4DEX A;  3EG1 A;  1NYF A;  2ESW A;  2EW3 A;  4OMO A;  2OJ2 A;  1AVZ C;  2C0T A;  1M30 A;  2L0A A;  4J9D A;  2W10 A;  2CT4 A;  2G6F X;  2KRM A;  1QCF A;  1GCQ C;  4DEY A;  3ULR B;  1SHG A;  2AK5 A;  1WI7 A;  4QT7 A;  4Y92 A;  3EG0 A;  1WA7 A;  2BZ8 A;  3EHR A;  3VS3 A;  1OPK A;  1QWF A;  1NG2 A;  2LQW A;  2PTK A;  1ZUY A;  2BZX A;  2RQT A;  2JMA A;  2K7A A;  4JJB A;  1UJY A;  4AFU C;  3I5S A;  3H0I A;  2KRO A;  3NHN A;  2YUO A;  2J6F A;  4ORZ A;  4RTY A;  4WCI A;  2EPD A;  2GGR A;  3U23 A;  1NEG A;  2VVK A;  4HVW A;  4JJC A;  2ED0 A;  2YT6 A;  4F17 A;  3R6N A;  3RNJ A;  2F2X A;  2GTJ A;  1JU5 C;  2DE0 X;  3VS2 A;  1CKB A;  4J9I A;  4ESR A;  4RTV A;  2CH4 A;  2FRY A;  2KGT A;  2F2W A;  4ZNX A;  2D8J A;  1YN8 A;  3A98 A;  1VYV A;  3EG3 A;  2ROT A;  2L3P A;  4HCK A;  4D8K A;  3ZL7 C;  4RTW A;  1NLP C;  2KT8 A;  1PRL C;  1G2B A;  3FJ5 A;  2FPF A;  1PWT A;  1BK2 A;  4CC3 A;  1WYX A;  2YSQ A;  1GCQ A;  4CC2 A;  1M27 C;  1M3C A;  1ABO A;  2CT3 A;  1OOT A;  2YUP A;  3I9Q A;  3THK A;  3NMZ C;  1AZG B;  4LE9 A;  2RMO A;  1GBQ A;  2MOX A;  2GBQ A;  1WX6 A;  3VS0 A;  4F14 A;  1K1Z A;  2DL7 A;  1AZE A;  1JEG A;  1UJ0 A;  2DVJ A;  1CSK A;  1AWX A;  1JXM A;  2JXB A;  1G83 A;  2KEA A;  1ZSG A;  1T3S A;  2KRN A;  2J05 A;  1JQQ A;  5IH2 A;  1AEY A;  2HCK A;  3VS1 A;  2IIM A;  3M0P A;  1W6X A;  1V1C A;  4CC7 A;  2CUD A;  1ZUU A;  1X2K A;  1X2Q A;  2DL4 A;  1WXB A;  2FG0 A;  3UAT A;  1RI9 A;  2GNC A;  1E6G A;  3VS5 A;  1PRM C;  2H8H A;  3GBQ A;  1B07 A;  1RLP C;  2A28 A;  1IO6 A;  4K11 A;  1H8K A;  1VYU A;  2HEQ A;  1YCS B;  2JS0 A;  2O88 A;  1N5Z A;  2M51 A;  3LH5 A;  3VS7 A;  1AOJ A;  2K6D A;  2FO0 A;  4E6R A;  1YP5 A;  4M4Z A;  1UFF A;  1KFZ A;  1E6H A;  2FRW A;  4Z88 A;  5I11 A;  4LUE A;  1RLQ C;  5FWB A;  2C0I A;  1ZX6 A;  3VS6 A;  2X3X D;  4J9C A;  4HXJ A;  1AWW A;  2RQW A;  2LP5 A;  2RN8 A;  2EGE A;  3CQT A;  2ECZ A;  2E5K A;  1U06 A;  4AFZ C;  2KE9 A;  2J7I A;  5FWC A;  4JPB W;  2DL8 A;  1UGV A;  2VWF A;  3I5R A;  1S1N A;  2OI3 A;  1I07 A;  4AFQ C;  3VRZ A;  3VRY A;  1MV3 A;  4Z89 A;  5L23 A;  1RUW A;  2KYB A;  2ABL A;  2OAW A;  2A37 A;  2FPD A;  2GQI A;  2EYZ A;  2O2O A;  4AG2 C;  1EFN A;  2RQU A;  1YWO A;  1K0X A;  4AG1 C;  1QKW A;  1BB9 A;  1HD3 A;  1WLP B;  2EVR A;  2EKH A;  1W1F A;  1T0J A;  1XOV A;  2EGC A;  2CRE A;  2K9G A;  1X6B A;  2PZ1 A;  3M0U A;  3REA B;  5IXF A;  1U3O A;  2B86 A;  2RQR A;  1MV0 B;  3M0R A;  1KIK A;  3M0S A;  3REB B;  1KSW A;  2LJ1 A;  1ABQ A;  4GLM A;  2F2V A;  2KXC A;  2LZ6 B;  1OPL A;  2DBK A;  3H0F A;  1SPK A;  1JXO A;  2HBW A;  3KFV A;  3PE0 A;  3SEM A;  2LCS A;  1WXT A;  1J3T A;  1QWE A;  5IHK A;  2EGA A;  2DJQ A;  5IHN A;  2PNI A;  2A08 A;  1K4U S;  2J6K A;  3O5Z A;  2O9V A;  2L2P A;  4RTX A;  2AZS A;  1UUE A;  2DYB A;  4RTU A;  1UTI A;  5I22 A;  2CUB A;  4D8D A;  1WDX A;  2EYY A;  2J06 A;  2FEI A;  1GBR A;  3UF4 A;  4OMN A;  1K0S A;  1FMK A;  1I1J A;  1HSQ A;  1QKX A;  2A36 A;  4JZ4 A;  1Y57 A;  1M3B A;  1SRL A;  2LQN A;  2JT4 A;  2KBT A;  2LJ0 A;  1M8M A;  1Z9Q A;  3H0H A;  3QWX X;  2NUZ A;  2EQI A;  4GBQ A;  4OMM A;  1AWO A;  1QLY A;  2CSI A;  4LN2 A;  4IIO A;  1BU1 A;  1PHT A;  1ARK A;  2BZY A;  2AZV A;  4IIM A;  1UHF A;  1SHF A;  4J9H A;  1NYG A;  2CDT A;  4AFS C;  2DIL A;  2RNA A;  2DM1 A;  2HSP A;  4RUG A;  2DRM A;  2SEM A;  3SHW A;  2CH4 W;  2SRC A;  3H41 A;  2AKL A;  2KR3 A;  3UA7 A;  4LNP A;  2DMO A;  2P4R A;  2LX7 A;  3TSZ A;  1T0H A;  1K9A A;  4R0K A;  2DA9 A;  2LJ3 A;  1W70 A;  4RTT A;  1TUC A;  1NEB A;  1OEB A;  1UE9 A;  2C0O A;  5FW9 A;  2O9S A;  4JZ3 A;  4J9E A;  2X3W D;  3I35 A;  2DX1 A;  1LCK A;  2DL3 A;  2J6O A;  2O31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...