1CKAA

Structural basis for the specific interaction of lysine-containing proline-rich peptides with the n-terminal sh3 domain of c-crk
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C-CRK N-TERMINAL SH3 DOMAIN
publication title Structural basis for the specific interaction of lysine-containing proline-rich peptides with the N-terminal SH3 domain of c-Crk.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (oncogene protein/peptide)
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1995-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ckaA00
2JS2A 2BTTA 4ESRA 2KXDA 2C0TA 2FPDA 2I0NA 2RMOA 2RQWA 4GLMA 4JZ3A 2CSIA 2DL4A 2C0OA 2J05A 4A63B 4JZ4A 2EYWA 2D8HA 2HBWA 2DLPA 1YP5A 1UHCA 2EKHA 1NG2A 3M0RA 3EHRA 4JJCA 1KSWA 4LUDA 5FW9A 2HCKA 2AKKA 2DA9A 3VS4A 3M0QA 4J9HA 1QLYA 2YT6A 2DJQA 2P4RA 2MCNA 1UJ0A 2O2OA 1OPKA 1K0SA 4Z88A 1NYGA 1W70A 3I5RA 2PTKA 1TUDA 2DRKA 2EYYA 4D8DA 1SRLA 4D8KA 3EG2A 1I0CA 2LNHB 3M0TA 2EGCA 5EC7A 4M4ZA 2CT3A 2KE9A 1SPKA 3JV3A 3ZL7C 2RF0A 4RTTA 1WLPB 3EG3A 5IXFA 4CC7A 1ZUKA 2ROTA 2DL5A 3M0PA 2DL3A 2PZ1A 5IHKA 2EBPA 2CDTA 3H0HA 1OV3A 1UJYA 1T0HA 2KGTA 2FG0A 2J06A 1GBRA 2AK5A 3VRZA 1GFCA 1HD3A 1M8MA 1PRLC 5ECAA 3SHWA 1WX6A 2DE0X 1GCQA 2EPDA 1X2QA 1JO8A 3EG1A 1A0NB 4RTWA 2CH4W 2SEMA 1IO6A 2AZSA 4CC4B 1NLOC 2NWMA 1WYXA 1VA7A 1QWEA 2DL8A 4LN2A 2ABLA 2KRNA 3U23A 1E6HA 1MV3A 2BZXA 2L3PA 4RTUA 2F2VA 5HCKA 3ULRB 1UTIA 1WXTA 1MUZA 3GBQA 1XOVA 2MIOA 2V1QA 4AFZC 5I11A 5GJWB 3REBB 1T3SA 2M51A 1JXMA 1SHGA 5L23A 2V1RA 1OEBA 2LX7A 4HVUA 2RNAA 1SRMA 3KFVA 2CSQA 1ABQA 4RTVA 1KJWA 4CC2A 1KFZA 4K11A 4KRTA 4J9GA 2AZVA 3SEMA 2GTOA 2GTJA 2O31A 1W1FA 2ROLA 2CUBA 3VS5A 1BBZA 4AG2C 5IHNA 1K9AA 3CQTA 1NLPC 2LJ3A 1K0XA 2MOXA 2RQVA 1AVZC 1OOTA 1WI7A 2RN8A 2DL7A 2EGAA 1WA7A 2DYBA 2O9VA 2LQWA 3C0CA 1AEYA 5IXBA 1Y0MA 4J9CA 2DF6A 2DM1A 1JEGA 4ORZA 2NUZA 2FPFA 2KT8A 2YUPA 3H41A 2F2XA 2D0NA 2KYMA 1K4US 1HJDA 3O5ZA 4LNPA 3PVQA 2DILA 1Z9ZA 5FWBA 2O9SA 1YWPA 2YDLA 1M3BA 4J9FA 2GQIA 2LJ0A 1AZEA 2CUDA 1UUEA 4LE9A 2JM8A 2FRYA 1X69A 1H8KA 4HVVA 2LCSA 1GCPA 1X43A 1CKBA 1BK2A 2LZ6B 2JTEA 3NMZC 1ZLMA 4HCKA 3TSZA 3TVTA 2HDAA 1TUCA 2GBQA 2J7IA 1WXUA 1X2KA 2L0AA 2K7AA 2RQRA 1JQQA 1EFNA 1U06A 3UA7A 2EYZA 2EGEA 1T0JA 4LUEA 4AG1C 3A98A 1H3HA 2L3QA 3I5SA 3I9QA 4AFQC 2ECZA 2EYXA 2FRWA 4E6RA 2KNBB 1GBQA 1B3QA 4J9DA 2DRMA 4JJBA 1QWFA 1UFFA 1I07A 2B86A 3R6NA 2D8JA 1G2BA 2HSPA 2L2PA 3I35A 2DBMA 3VS7A 4RTXA 1X6GA 2JXBA 2DNUA 2YSQA 1V1CA 2BZYA 2A28A 2RQTA 2BZ8A 3H0FA 1WIEA 1G83A 2KXCA 4WCIA 1CSKA 3QWXX 2G6FX 2KYBA 1LCKA 5FWCA 2M0YA 1GFDA 4J9IA 2D1XA 3FJ5A 1M27C 2AKLA 2KBTA 4OMOA 4OMQA 4IIMA 1S1NA 1PHTA 1ABOA 3UATA 4OMMA 1E7OA 2SRCA 4HVWA 4F17A 1AWOA 1W6XA 1FMKA 5IHIA 2K79A 2YUQA 2K2MA 4J9EA 1AWJA 1WFWA 4HXJA 1ZBJA 3NPFA 3PE0A 1M30A 2ED0A 2K9GA 4Y92A 1SSHA 2ENMA 2HEQA 2RPNA 3VS1A 4AFSC 2XMFA 4J9BA 1E6GA 2H8HA 5IH2A 2DVJA 2VWFA 1X6BA 1RI9A 2KRMA 1PRMC 4JJDA 1ARKA 1ZUUA 1NM7A 4RTYA 1PKSA 4OMLA 2F2WA 1SHFA 3RNJA 1YN8A 2LJ1A 4X1VA 1QKWA 1NEGA 2ESWA 1VYTA 1J3TA 1KIKA 2O88A 2A36A 2YUOA 2GNCA 2IIMA 4F14A 2PNIA 2VKNA 1ZSGA 2KT1A 3PVLA 4QT7A 1GCQC 3VRYA 4DEXA 2C0IA 4JPBW 2EQIA 2OAWA 4Z8AA 4AFUC 1GL5A 3EHQA 1TG0A 3VS2A 1SEMA 2QDLA 2ED1A 1UG1A 4IIOA 1BB9A 2JM9A 2A37A 1UHFA 1X27A 2J6FA 2K3BA 4FSSA 1RUWA 4GBQA 1I1JA 1UE9A 5GJVB 1JXOA 3VS3A 3UF4A 2LP5A 2KEAA 1U3OA 1M3AA 1M3CA 2JW4A 2DMOA 1YWOA 1AOJA 3IQLA 5I22A 1BU1A 4RTZA 1U5SA 3VS6A 2FO0A 2X3WD 1N5ZA 3M0UA 1YCSB 3UA6A 1CKAA 1VYVA 2EVRA 1FYNA 3EGUA 4F16A 4R0KA 1T3LA 4DEYA 3RBBB 1AD5A 2FEIA 2DBKA 2X3XD 1AWWA 3M0SA 1UECA 1NYFA 1QKXA 1UDLA 2DX1A 2CT4A 2EW3A 2JS0A 2K6DA 2VVKA 1Y57A 1UGVA 1AZGB 2JMCA 2OJ2A 1B07A 2E5KA 2J6KA 2OI3A 4OMPA 3TSWA 3LH5A 1GRIA 1JU5C 2L3SA 1PKTA 1WXBA 1PWTA 3NGPA 1NEBA 3REAB 1Z9QA 2RQUA 2JT4A 4RUGA 4EIKA 1OPLA 4ZNXA 1ZX6A 1WDXA 2W10A 3EG0A 2KROA 3H0IA 3QWYA 1MV0B 1AWXA 2KRSA 2YUNA 2LQNA 1VYUA 1PNJA 2GGRA 2LMJA 3THKA 3VS0A 1H92A 4CC3A 3NHNA 1ZUYA 1YNZA 2J6OA 1RLPC 2A08A 1HSQA 2CH4A 1K76A 1K1ZA 1RLQC 2CREA 1QCFA 4Z89A 2JMAA 4OMNA 2FPEA 2W0ZA 2KR3A
chains in the Genus database with same CATH superfamily
2F69A 4JRQA 2BTTA 4ESRA 1QMCA 2CP2A 4KGVB 4JZ3A 4LD9K 1VQ4Q 2J05A 1S72T 4A63B 2ZPEB 4ELYC 2EYWA 3HPWA 2D8HA 3F70A 4RG2A 1UHCA 1K9MU 1M90U 4XU3A 2EKHA 1NG2A 2CP6A 3EHRA 5C6SA 2BKDN 4F7UE 4M7DF 2QTXA 3M57A 2YHTA 2HCKA 1BIAA 3S3OA 2VV5A 3M59A 2JJ9A 1X6OA 4BB7A 2FL7A 3P8DA 3UT1A 3CCUQ 4N4IA 2RO0A 1K0SA 4J6XA 4EMKB 5KH6A 2QASA 1NYGA 4KH0B 1VQLT 2PTKA 1TUDA 1I5OB 2ZAEA 3BFMA 4ZTJA 1M90R 2HBPA 1I0CA 3M0TA 5EC7A 1G5VA 4M4ZA 4FT4A 3ZEHA 1SPKA 2RF0A 2P84A 3EG3A 3QZ5B 3OS1A 3EFRA 2DL3A 4PJOC 4IUTA 1RAFB 3V7CA 1B34B 2D9TA 4BE2A 3C12A 1OV3A 1QCOA 4A53A 2K5IA 3EH1A 2BE7D 2FVUA 1GFCA 5CAIA 4JS4A 1U8RA 4MMLA 3M58A 5ECAA 1WX6A 4C5HA 4TVRA 5KYXB 4C92E 2CP0A 1NE8A 3FJPA 4RTWA 2SEMA 4CC4B 3CCLT 3FLGA 3KXTA 1WYXA 1M1FA 3EFSA 2DL8A 4HA8A 4LN2A 3BDUA 2MPXC 2X4XA 4M77E 3U23A 3MKDA 1E6HA 1WHGA 2WSCE 4C5IA 4PJLA 1JB0E 4OB3B 3OYCA 1MNDA 1UTIA 3P8BB 3SD4A 1M2VA 3OMCA 2QEXT 2V1RA 2LX7A 4PJOA 3KFVA 3A8LB 3VUBA 3JCMX 1ABQA 4CC2A 5LJ5d 1VQ4T 4J9GA 4AT1B 2GTOA 1YIJQ 4PNOA 3BE3A 2PQWA 2O31A 1W1FA 1Q95G 5IHNA 3WVEB 4XTYA 1NLPC 2GQVA 2MOXA 2RQVA 4NL2A 1BCOA 2DL7A 2EGAA 2DYBA 2PVOB 4ZN3A 2QDYB 3OYFA 1YJ9A 4E7JA 3PGGA 1Y0MA 2DM1A 4C5EA 5FRNA 4ORZA 1JEGA 3HSBA 2NUZA 4BD3A 2FPFA 3M4YA 1P92A 3OYKA 1SF9A 3O5ZA 4LNPA 1RADB 1G3WA 3PVQA 5FWBA 4PJOG 2O9SA 1YWPA 1G3SA 4MZPA 3PIPA 2YDLA 4FYVB 2R5MA 4QKUA 1AZEA 4B9WA 2FRYA 4M7AA 1H8KA 3NTKA 2LCSA 6AT1B 3EG9A 1I4K1 1ZBXA 1H3ZA 4PJOB 4KGZB 4PLLA 4HCKA 1RAEB 2C06A 2HDAA 1TUCA 2J7IA 1TU0B 1WXUA 2RHXA 1OYXA 2K7AA 3KUFA 1U06A 3UA7A 2EYZA 3HP9A 2OAUA 4AG1C 4RG8A 1D0ZA 2L3QA 3I5SA 1WNLA 2LT4A 4M75C 3QIIA 2P0QA 5CIUA 3FRNA 3EAEA 1RABB 1VQ5Q 3J7AF 2L2PA 1RAHB 4HCBA 4GY5A 3FIFA 4RTXA 1X6GA 1IGUA 2MK5A 3OSSC 1TTHB 1PG5B 2M0YA 1GFDA 1M27C 5D6YA 4OMOA 1YI2A 1S1NA 3UATA 1PCXA 2HKQB 2EQMA 2DK3A 4F17A 2LQKA 3G4SA 2CKKA 2DETA 4BACA 1YJWT 1WQWA 1KQ1A 3UWNA 3PE0A 1VQ7A 2K9GA 3PT9A 2QGGA 4EDUA 1YIJT 3GNGA 4J9BA 2H8HA 1N9RA 2HZYA 1BI1A 2D0QB 3MHXA 5DM7R 3BW1A 4M75A 4RTYA 4OMLA 2F2WA 1SHFA 4PFZA 1QVPA 4N4GA 1KIKA 4C0DC 4WF2A 2IIMA 4DOVA 2VKNA 2DTIA 1FX7A 3MP1A 1GCQC 5KYYA 4JPBW 2OAWA 4Z8AA 2VGMA 2XIDA 1C6VX 2JUFA 3EHQA 3QDRB 5GAMh 2XHCA 3VS2A 2D6FA 3KBGA 1VQ8A 2QDLA 1LNXA 2ED1A 4M7DE 3QZ9B 1HXDA 1UGQB 4IIOA 2OX7A 2HQHA 1R0CB 5GANd 2IVWA 2CS7A 1QCNA 2E65A 2FZCB 5GJVB 2LP5A 1U3OA 2YRVA 1M3AA 3QUIA 3DB3A 3V8JA 1M3CA 1YWOA 4R55A 3IQLA 2EQJA 4FW1A 1IHVA 4M75G 3J81E 3MEUA 3CC7T 2G3RA 2KK4A 4IURA 1VYVA 4C92F 3JCMh 5CQYA 1QVFP 3VJPA 1NJIC 2DIGA 3HRSA 3CD6A 1D3BB 3EGUA 4R0KA 5KCOA 1T3LA 1LJOA 1VQ5T 2X3XD 3I56A 1AWWA 1YCYA 4M75B 2V8KA 4M77F 2F5TX 1RAIB 2RJFA 1MNEA 2DX1A 1RI0A 2XDBA 5FROA 1UGVA 3JAME 2KVQG 1M1KU 1OULA 3TSWA 1OU9A 3LH5A 4CI0C 2JZ2A 4FW2A 3NGPA 4BY6C 3LW5E 1Y7XA 4C8QF 4MZTA 2RQUA 1OU8A 4O6JA 2DEUA 2W10A 3E9FA 3H0IA 5GAN7 4ANJA 3S3NA 1SSFA 3QWYA 3A5ZB 2E6ZA 1YHQA 3I55A 1XNIA 1QVGS 2LQNA 3HL8A 1FMWA 2GGRA 2MMPA 4JRIA 1I5LA 5GMKe 2LMJA 1H92A 3EGXB 4M78A 4QVDA 1ZUYA 1YJNA 4XQ3A 2EFIA 4AMCA 2CH4A 1K1ZA 5IAYA 1RLQC 4ELZC 2DJZA 5GAMf 1YITQ 1ZUKA 4LDYA 2KR3A 2YRDA 1Q86U 4OVAA 3BY7A 1Q82C 4A4FA 2EJGA 4PKCC 2KXDA 2C0TA 3VKIA 3JCMP 2QI2A 3JB9I 4KUDK 4IUQA 3ASKA 2E12A 3ZBDA 3CC4T 2HD0A 3CEYA 2KY9A 4JZ4A 1YBYA 5GAN3 3CD6Q 1VQ9A 2VC8A 3FB9A 1XQHA 4LDUA 2DLPA 1YP5A 1VQPT 3M0RA 5CK9A 4JJCA 4LUDA 2LTOA 2X35A 3CMAA 4Z02A 2DXBA 2AKKA 1K8AC 4J9HA 2P4RA 2MCNA 4C92D 2A3LA 2HNIA 2XD0A 4ZGJB 1VQMA 1W2BP 3A1PA 1W70A 2NUPB 1KD1C 1JJ2A 3A8GB 3GPLA 3CCJT 4D8KA 4XU2A 2EGCA 2CT3A 4M77D 5J39A 3ZL7C 1Q81U 4RTTA 1WLPB 2V26A 3E2UA 1FXXA 5IHKA 1RL2A 3H0HA 1T0HA 2FG0A 1Q7YC 3WXMB 3VRZA 1KG1A 1HD3A 2LC4A 2M1HA 1M8MA 4C5GA 2OTJT 1TH7A 4EPCA 4BI3A 2F1LA 2WACA 4RCCA 3CCVA 5CKFA 1RAGB 2YWWA 3EG1A 1NJIR 1A0NB 1WJRA 1M4ZA 2CH4W 3JCMV 1IO6A 2AZSA 1VQKA 9ATCB 1VA7A 2E70A 4BY6B 4QVCA 1M1GA 1N8RU 3JB9F 2OTLT 3CC2Q 3RMSA 3CMAQ 3JCMW 5LJ3d 4A4EA 5HCKA 1WGSA 4FYYB 3ULRB 1KHCA 1Y96A 3CMEA 1WXTA 1UGPB 1VQNQ 3L42A 3GBQA 3QYGB 2LQ8A 4AFZC 5I11A 3QSUA 5J3BA 1VQMQ 1JJ2S 1T3SA 3MPUB 3JB9J 1WHMA 3NTHA 1YITT 2RNAA 3JCMb 2DXCA 5KE3A 1SRMA 4A54A 2RM4A 4GLKA 3CPWS 3RUXA 5CR2A 5GAMj 1KFZA 1VQ6T 4K11A 1GXIE 4FU6A 3CCET 2AZVA 5M9OA 5KYXA 4HKEA 4XTXA 3VS5A 2LNVA 4AG2C 2LJ3A 4HCCA 2HQEA 1D1AA 1AVZC 1X75C 4QQ6A 3OYIA 3H9NA 4C0ZA 1AEYA 1Q82R 3X25B 4J9CA 4JS5A 1TUGB 2RK1A 4LD6A 2DXTA 1OZ2A 2D0NA 2KYMA 1K4US 2DILA 2K57A 1VQKQ 3MEWA 2QQBA 3R6OA 3C94A 4J9FA 2LJ0A 4X9CA 1UGRB 3G6EQ 1Y96B 3SWNC 1QQJA 2DTOA 4LE9A 1C0MA 2KI7A 2JM8A 3HKSA 1X69A 3OYHA 3CMEQ 1X43A 4O5VA 3NMZC 1X01A 4NS5A 2QA4A 4ZGEB 4C0GA 1KD1R 2L0AA 2DYIA 2RQRA 2AHJB 1EFNA 2E64A 1T0JA 3OS2A 3M53A 3CXCP 1K73U 2RD1A 1BIBA 1H3HA 4E7HA 2CZ0B 2QQ9A 1Y07A 2RJDA 1QP3A 4Q5WA 2FRWA 2NUTA 3OQ5A 5GMKl 5AYFA 5HKCA 1BI3A 3LX7A 5LJ5e 3X20B 2DRMA 4IUUA 1I07A 3ER0A 2B86A 5CCAA 1G2BA 2HSPA 2DNUA 4NL3A 3CCST 3CC2T 1M5Q1 1K73R 2RQTA 5GAOl 4XTWA 1O75A 1WIEA 5CKBA 5GMKi 2I2LA 1G83A 5FU7B 3OYMA 1WQ7A 1SG5A 3M56A 1VQNT 2YXYA 4XTVA 1KQSP 2D1XA 2AKLA 2KBTA 3SWNA 4C8QE 1ABOA 1XJWB 2FZGB 1JRIA 2Y4XA 1QP2A 4DQ2A 1E7OA 4C92C 4N0AC 1AWOA 3FDRA 1W6XA 2GF7A 1FMKA 3CBMA 4F7UA 3JB9H 2E41A 4M7DD 5CVIA 4HXJA 1ZBJA 5I21A 1M30A 2A0FB 1BYMA 2P4TA 2Y90A 2GFAA 3CCRA 1SSHA 2ENMA 1OX9A 4M77C 4AFSC 3X24B 5LJ5g 2HMAA 2EAYA 5LJ5f 3L1AA 1RI9A 2VXFA 1NPRA 1ZUUA 1NM7A 2DVEA 2LJ1A 2NUTB 3LYIA 2EQUA 2QAZA 3GP8A 1VYTA 3HFNA 3CCUT 2DXUA 2YUOA 5KYNA 4OGCA 4ME7A 1ZSGA 3QHSA 2KT1A 5D6WA 1PC0A 1W4SA 4QT7A 1ZHIA 3VRYA 1BCMA 3QKJA 1GL5A 4F7UG 1N9SA 2YLBA 4JLIA 4QVZA 5A0GA 3G6ET 5LL6S 1U1SA 1UG1A 1BB9A 1UHFA 1X27A 2J6FA 4FSSA 4J6YA 3HRTA 1PD1A 1VIFA 4C92A 1I1JA 1PSEA 1UE9A 2KSSA 3QO3A 4N0AA 3SWNB 1Y71A 1LOJA 2LCCA 1R0BG 2JW4A 2DZ9A 5KYWB 4J7IA 5I22A 2EQKA 4EMHA 1U5SA 3MJXA 4F7UB 1WHJA 3D7SB 3QYHB 3OYLA 1D1CA 1N5ZA 3G71A 1R77A 5DY9A 2L8DA 3EFOA 3UA6A 4M77A 2EVRA 1RACB 2XDDA 3L2UA 4F16A 4RMOA 3CCRQ 1ZSZC 4DBHA 1G3TA 4DEYA 4MDXA 1N27A 3RBBB 2EKOA 2FEIA 2DBKA 1VQOA 3M0SA 2FZKB 1UECA 1NYFA 1QKXA 3C95A 2EW3A 3VV0A 1TOVA 2XI9A 4MZMA 1AZGB 2E6NA 2E5KA 2J6KA 2OI3A 1YJ9Q 4OB2B 4C92G 2LVMA 1PKTA 1N6AA 3AT1B 3FEOA 1NEBA 2JTMA 2P0PA 2JT4A 4RUGA 1OPLA 1ZX6A 1B7TA 2FB7A 2KROA 1M1KC 2BIVA 2RJEA 2DKGA 4M77G 3VYHB 2NYSA 1MV0B 3LH0A 2ZPFB 3J80E 4IUPA 5FLXE 1VYUA 2DAQA 1PNJA 2YLCA 4C92B 2ZPGB 3EGDA 4J83A 5GAN5 3NHNA 2WSEE 2GFUA 4C8QG 1K76A 4OGEA 1D3BA 1MHNA 3OW2P 3HTRA 3OW2A 2L3RA 5GANe 2JMAA 2R57A 3EFOB 3SDZA 2FPEA 4M77B 3G1JA 4KBMB 3CCMA 4L5GA 1ZSZA 4E7IA 2FPDA 2I0NA 3OYAA 4L6V5 2DL4A 2HL5C 2C0OA 4C8QB 2HBWA 2LX9A 4IKFA 1VQOQ 2MI6A 5FW9A 2CP3A 3VS4A 3M0QA 3E19A 4MMKA 2DJQA 4M78E 1UJ0A 2O2OA 1OPKA 4JRKA 3QBYA 1U1TA 4Z88A 3OYYA 4J5YA 1UEBA 1WJSA 2DRKA 4ZTFA 1KC8C 1O9SA 3EGXA 3HRUA 4OP0A 2EYYA 1SRLA 1YI2Q 3EG2A 2KE9A 5GANg 1D0YA 2KMTA 5GANf 2KQWA 3EGDB 2PVGB 2LRQA 3M0PA 4N4HA 3G4SQ 1I8FA 1VQ7Q 1QVFA 2E3IA 2K2VA 1OZ3A 2XDPA 4QQGA 2KGTA 2MF2A 3CCQA 3OW2S 4A4KA 2J06A 4XK8E 4M7DC 1IB8A 1UGSB 4R56A 1ZSZB 3RKWA 2COZA 4M7AF 1PRLC 2QYZA 1IZ6A 1YJ9T 3QDFA 1S72A 2EPDA 1GCQA 4B9XA 1X2QA 1JO8A 2BE9B 3UPUA 4E7KA 3QXEB 1NLOC 2RHZA 2NWMA 3VUZA 1AT1B 3DKMA 3TQ7P 4DBQA 2NUPA 1MV3A 2DFUA 3OYJA 2BZXA 3MP6A 4RTUA 4DA4A 2F2VA 2EYQA 1VQ8Q 1MUZA 1VQLA 1XOVA 2V1QA 1M9SA 3S3MA 1JXMA 4E47A 4BE1A 4HT8A 4HVUA 2RH2A 2DTHA 2CSQA 5GAMd 2VXEA 4X34A 4OF1A 1V29B 3M54A 3OBYA 4BUGA 3CPFA 4M7DA 1QVFS 2RHIA 2GTJA 5C0MA 2ROLA 1BBZA 2MYSA 3CCQQ 1K9AA 3CQTA 1M8VA 2X9HA 1OOTA 3I56Q 2RN8A 2K3YA 2EJFA 2LQWA 4KGXB 2VUBA 1PSFA 3C0CA 5IXBA 5HK3A 3JCMd 2M16A 2RHYA 1TWBA 1ZA1B 2RI3A 3MEAA 5A2QE 3H41A 3M5AA 1MMNA 4FT2A 3CCLA 4FM4B 5DLOA 1K9MC 1M90C 1HJDA 4M75F 3Q1JA 1W2BA 2VYTA 1KK7A 3MO8A 1YI2T 8AT1B 4IUVA 2GQIA 1QW1A 3META 3EH2A 2K4YA 2DERA 4M7DG 4M7AD 2CUDA 1UUEA 1YHQQ 3G4ST 1IXDA 3I55Q 1NZ9A 3LGFA 1VQ7T 1GCPA 1CKBA 1BK2A 2QEXA 5LJ3e 2JTEA 1VQLQ 1NJIU 1ZLMA 2F5KA 2CGHA 4C8QD 1YJNQ 3TVTA 1KC8R 4OMFB 1X2KA 1PM3A 3LWHA 3PMTA 2EGEA 4M7DB 1VQ4A 1KQ2A 3A98A 3V7RA 3OSVA 7AT1B 4JJNK 3JCMQ 2ECZA 2EYXA 2KNBB 1GBQA 4FYWB 3OYBA 3QJYA 2L5QA 4HCZA 1VQ9Q 4V2SA 5AT1B 4J6WA 3R6NA 4BI4A 3VS7A 2DBMA 3M55A 5FU7C 3E1SA 2YSQA 1V1CA 2BZYA 3M9QA 2A28A 3H0FA 2MWOA 2XICA 1VQ8T 4WCIA 3QWXX 2K3XA 2G6FX 2O4XB 2WSFE 1EIFA 4X9DA 3FC3A 1MMGA 3HHTB 5FWCA 1W2BS 3FJ5A 4FYXB 4IIMA 4BE0A 5LJ3g 1RAAB 2XKOC 4OMMA 1NPPA 5LJ3f 2RJCA 2QG9B 4HVWA 2AIRB 4MDWA 5IHIA 2K79A 2YUQA 2K2MA 4FSXA 2K5LA 3NPFA 1WHKA 4PL6A 4KH1B 1Q82U 3GNFB 4Y92A 2HEQA 3V8LA 1D1BA 3CD6T 2EJ9A 5IH2A 1KHIA 1ACMB 2M9UA 1TSFA 4PK4A 2DVJA 2VWFA 3E9GA 3I56T 1X6BA 2KRMA 1PRMC 1ARKA 1WZOA 5GAN2 1UB4A 4XU1A 4M78F 1YN8A 1TXQA 1NEGA 1EX4A 2ESWA 1J3TA 2A36A 2GNCA 3NTIA 1K8AU 3CCVQ 2PNIA 3OBWA 4RCBA 4PJJA 3PVLA 2JOYA 4PJOE 1C1AA 2C0IA 4C0FA 2EQIA 4AFUC 1KD1U 2E4HA 1TG0A 1SEMA 3INZA 1WJQA 5LJ5h 5GMKj 4QW2A 1YHQT 2JM9A 5CKHA 3I55T 2K3BA 1K8AR 2XK0A 3VS3A 3JCMJ 2RA2A 1K9MR 2H3JA 1ZQ1A 2DMOA 1YJNT 1AOJA 2VASA 3RKYA 4YTLA 4P5NA 3VS6A 2FO0A 2X3WD 1YJWA 3CBOA 2DPPB 1Q7YU 3M0UA 3TU4K 1OI1A 2ZZDA 1YCSB 4WTOB 1CKAA 2QQSA 3JB9D 1G3YA 1VUBA 4JUVA 3CXCA 4LDXA 1YIJA 2ZPIB 4E7SA 3ZFJA 5KE2A 1AHJB 1VQ9T 2PUKB 2JN0A 5CQXA 1UDLA 2A7YA 2CT4A 1Q7YR 4L59A 3JRZA 5KYUA 2OJ2A 1B07A 4OMPA 3LWIA 3CMAT 3MCAB 4M7AE 3RIRA 1GRIA 2L3SA 2X4WA 2HSEB 4JDSA 1PWTA 3REAB 3V7SA 1PD0A 1VQMT 2M0OA 4ZNXA 1KQSA 3GLXA 4LXCA 2DD5A 2CZ7B 5KYWA 2ZPBB 1AWXA 1G8XA 1HYOA 4M78D 5LJ3j 4FCYA 4KT0E 3VS0A 2ZCFB 4CC3A 2COWA 3TREA 5KCHA 1RLPC 1WHHA 2A08A 4B6MA 3DLMA 2QQRA 4M7AC 2CREA 1QCFA 2QA4Q 3CC7A 4OMNA 5FU6C 5GAN6 3A8OB 3A8HB 2JS2A 4DOWA 1M2OA 1YJWQ 4Y28E 3CXCS 2RMOA 2RQWA 4GLMA 4C8QC 2JVVA 2CSIA 8ATCB 3CCVT 1VQ5A 5GAOr 2XG8D 5FRMA 4OB1B 1VQKT 2KDSA 5KYUB 1KSWA 2COYA 4II1A 1WHLA 3GOXA 2B8AA 2DA9A 1QLYA 2YT6A 5GAOp 4ZN1A 4J7FA 3SB2A 3OMGA 1I81A 5GAOn 3CMET 1KQSS 3I5RA 2CZ1B 4D8DA 4M75E 1R8OB 2LNHB 5HK0A 4QQDA 2V8IA 3JV3A 4BDZA 4OB0B 5IXFA 4CC7A 3OY9A 1M2VB 2DL5A 2ROTA 4ZGDB 3LLRA 3RMQA 2PZ1A 2LDMA 2X51A 5A0DA 2EBPA 2CDTA 3T9NA 2JTFA 3RDVA 1UJYA 2YRCA 2CYZB 1GBRA 1HK9A 4A4HA 4C8QA 2AK5A 5GAN8 1IREB 3S6WA 3CC7Q 1VOMA 2LCLA 3SHWA 2NLUA 4PJNA 3CC4A 5EG2A 3G7ZA 4VUBA 2DE0X 2DD4A 5GANh 1ZA2B 2E5QA 2R5AA 1VQPA 4D6WA 1EZZB 4HT9A 1QWEA 2ABLA 2KRNA 4ATOA 1OX8A 4KUIA 2L3PA 4M7AG 2RHUA 3DB4A 2IG0A 3OYDA 4DBRA 2L89A 2MIOA 4UC4A 5GJWB 3REBB 2M51A 3CCJA 2LT1A 1SHGA 5L23A 1OEBA 2ATCB 1JBMA 2QA4T 2DIQA 5CO7A 4JLGA 4RTVA 3M4GA 4M7AB 1KJWA 2CP7A 4FL6A 2PU9B 5I2SA 3G71Q 3EG9B 2K5FA 5FU6B 4LDWA 5A0LA 3H6ZA 4KRTA 5LJ5j 3SEMA 2RI5A 4PJOF 2HL3A 2CUBA 4F7UF 1K0XA 1Q86C 2DZCA 4XTUA 1TS9A 3SFMA 1WI7A 1IGQA 1WA7A 2OTJA 2O9VA 1MGQA 3WVDB 2MAMA 4JRPA 3CC4Q 2DF6A 2DO3A 3MP8A 2KT8A 2YUPA 2F2XA 1Z9ZA 4PJMA 5DLQE 1VQPQ 1M3BA 1DJ7B 2OTLA 2Z0WA 4J8OA 2IPOB 1IHWA 4XU0A 1QVGP 5GAOq 1QVGA 4NOYA 1IRXA 4KULA 1YFNA 4HVVA 2LZ6B 3GF5A 3CCRT 3JSCA 3L2VA 1YITA 5HY6A 3CCJQ 1NBEB 2E3HA 3TSZA 5IT9E 1Q81C 2GBQA 1V76A 4M78C 1D09B 5GAN4 3QJ6A 1JQQA 2QQAA 3JCMc 5GMKh 4PLIA 1VQ6A 1FWZA 4LUEA 3CCMQ 2M02A 3PIOA 3CCEA 3X26B 3I9QA 4AFQC 5GAMe 4E6RA 2CZ6B 1B3QA 4J9DA 5IN1A 4JJBA 1QWFA 1UFFA 2KAFA 1LPLA 2D8JA 1WPYA 3I35A 2JXBA 2OTJQ 3CBPA 4E7ZA 2FHDA 3H8ZA 2BZ8A 2E10A 2V8JA 2MWPA 1F1BB 2KXCA 1CSKA 4E2FB 2EIFA 2KYBA 5KYYB 1LCKA 4J9IA 3JCMe 4OMQA 5I2MA 2R58A 1PHTA 2GCXA 1N8RC 4PJOD 3C4SA 2SRCA 3TCJA 4BDYA 2OTLQ 3OYEA 1LVKA 1M1KR 5D6XA 4J9EA 2BUDA 1AWJA 1WFWA 2ZPHB 4PFPA 3G71T 3JB9G 3OA6A 3TEEA 3DLLA 2ED0A 3RKXA 1MMAA 2RPNA 3OS5A 3VS1A 2XMFA 3HFOA 1E6GA 1H641 5GAMg 5CKEA 4CRIA 1VQOT 3NFCA 4JJDA 4LDVA 2P0KA 1PKSA 3RNJA 5LJ3h 1VQ6Q 4X1VA 1QKWA 3CCEQ 3RESA 2O88A 1S72Q 4XAXB 4DBFA 3QPHA 4F14A 3OB9A 3N5BB 3ME9A 4F04B 2O4XA 4C0DB 4DEXA 3JCMg 5L8RE 1Q86R 3CCSA 3CC2A 3JCMf 1KC8U 2VGNA 3MEVA 5CKDA 3L2WA 4EMKC 3OYNA 4BI8B 4M78G 2A37A 1VQNA 3PTAA 1RUWA 4GBQA 2X4JA 1JXOA 5GANj 3UF4A 2KEAA 1JJ2P 3GIBA 2HQXA 2RB6A 3URGA 2O01E 1BU1A 4RTZA 3V8KA 4FIBA 2FYKA 3P8HA 2JNGA 2HKNA 3QG1A 2QTVA 5GMKm 2RK2A 3CPWP 3CPWA 4RKUE 3PFSA 3CCMT 3UDCA 4M78B 3BDLA 1FYNA 5D7UA 2DEQA 3L2ZA 3OYGA 2HAXA 2AT1B 1BI0A 3PNWC 1AD5A 2E1HA 2X4YA 3OS0A 5GAOm 3L2RA 2EWNA 3PMIA 3L2QA 1Q81R 1K73C 2JS0A 2K6DA 2PUOB 2VVKA 1Y57A 2JMCA 1OQKA 3CCUA 3A8MB 4XTZA 2ZGWA 1FMVA 3VYGA 1JU5C 2PVDB 2VB6A 1WXBA 4Y91A 4E7LA 1Z9QA 4EMGA 4EIKA 4A4GA 3CCLQ 2QGFB 4PFOA 4EMKA 1WDXA 3EG0A 2Y4YA 1BI2A 2QK0A 3G6EA 3CCSQ 2QXFA 1SKUB 3RR6A 2KRSA 1BKBA 2YUNA 2H3EB 3AHUA 1MMDA 3O8VA 3X28B 3THKA 1D0XA 5J26A 3LGLA 1YNZA 2RI2A 2J6OA 1B34A 2CP5A 1HSQA 3VU3C 2QEXQ 4Z89A 3CCQT 1N8RR 4M75D 2XU8A 3RERA 1XTDA 2W0ZA 1VIEA
chains in the Genus database with same CATH topology
2JS2A 2BTTA 4ESRA 2KXDA 2C0TA 2FPDA 2I0NA 2RMOA 2RQWA 4GLMA 4JZ3A 2CSIA 2DL4A 2C0OA 2J05A 4A63B 4JZ4A 2EYWA 2D8HA 2HBWA 2DLPA 1YP5A 1UHCA 2EKHA 1NG2A 3M0RA 3EHRA 4JJCA 1KSWA 4LUDA 5FW9A 2HCKA 2AKKA 2DA9A 3VS4A 3M0QA 4J9HA 1QLYA 2YT6A 2DJQA 2P4RA 2MCNA 1UJ0A 2O2OA 1OPKA 1K0SA 4Z88A 1NYGA 1W70A 3I5RA 2PTKA 1TUDA 2DRKA 2EYYA 4D8DA 1SRLA 4D8KA 3EG2A 1I0CA 2LNHB 3M0TA 2EGCA 5EC7A 4M4ZA 2CT3A 2KE9A 1SPKA 3JV3A 3ZL7C 2RF0A 4RTTA 1WLPB 3EG3A 5IXFA 4CC7A 1ZUKA 2ROTA 2DL5A 3M0PA 2DL3A 2PZ1A 5IHKA 2EBPA 2CDTA 3H0HA 1OV3A 1UJYA 1T0HA 2KGTA 2FG0A 2J06A 1GBRA 2AK5A 3VRZA 1GFCA 1HD3A 1M8MA 1PRLC 5ECAA 3SHWA 1WX6A 2DE0X 1GCQA 2EPDA 1X2QA 1JO8A 3EG1A 1A0NB 4RTWA 2CH4W 2SEMA 1IO6A 2AZSA 4CC4B 1NLOC 2NWMA 1WYXA 1VA7A 1QWEA 2DL8A 4LN2A 2ABLA 2KRNA 3U23A 1E6HA 1MV3A 2BZXA 2L3PA 4RTUA 2F2VA 5HCKA 3ULRB 1UTIA 1WXTA 1MUZA 3GBQA 1XOVA 2MIOA 2V1QA 4AFZC 5I11A 5GJWB 3REBB 1T3SA 2M51A 1JXMA 1SHGA 5L23A 2V1RA 1OEBA 2LX7A 4HVUA 2RNAA 1SRMA 3KFVA 2CSQA 1ABQA 4RTVA 1KJWA 4CC2A 1KFZA 4K11A 4KRTA 4J9GA 2AZVA 3SEMA 2GTOA 2GTJA 2O31A 1W1FA 2ROLA 2CUBA 3VS5A 1BBZA 4AG2C 5IHNA 1K9AA 3CQTA 1NLPC 2LJ3A 1K0XA 2MOXA 2RQVA 1AVZC 1OOTA 1WI7A 2RN8A 2DL7A 2EGAA 1WA7A 2DYBA 2O9VA 2LQWA 3C0CA 1AEYA 5IXBA 1Y0MA 4J9CA 2DF6A 2DM1A 1JEGA 4ORZA 2NUZA 2FPFA 2KT8A 2YUPA 3H41A 2F2XA 2D0NA 2KYMA 1K4US 1HJDA 3O5ZA 4LNPA 3PVQA 2DILA 1Z9ZA 5FWBA 2O9SA 1YWPA 2YDLA 1M3BA 4J9FA 2GQIA 2LJ0A 1AZEA 2CUDA 1UUEA 4LE9A 2JM8A 2FRYA 1X69A 1H8KA 4HVVA 2LCSA 1GCPA 1X43A 1CKBA 1BK2A 2LZ6B 2JTEA 3NMZC 1ZLMA 4HCKA 3TSZA 3TVTA 2HDAA 1TUCA 2GBQA 2J7IA 1WXUA 1X2KA 2L0AA 2K7AA 2RQRA 1JQQA 1EFNA 1U06A 3UA7A 2EYZA 2EGEA 1T0JA 4LUEA 4AG1C 3A98A 1H3HA 2L3QA 3I5SA 3I9QA 4AFQC 2ECZA 2EYXA 2FRWA 4E6RA 2KNBB 1GBQA 1B3QA 4J9DA 2DRMA 4JJBA 1QWFA 1UFFA 1I07A 2B86A 3R6NA 2D8JA 1G2BA 2HSPA 2L2PA 3I35A 2DBMA 3VS7A 4RTXA 1X6GA 2JXBA 2DNUA 2YSQA 1V1CA 2BZYA 2A28A 2RQTA 2BZ8A 3H0FA 1WIEA 1G83A 2KXCA 4WCIA 1CSKA 3QWXX 2G6FX 2KYBA 1LCKA 5FWCA 2M0YA 1GFDA 4J9IA 2D1XA 3FJ5A 1M27C 2AKLA 2KBTA 4OMOA 4OMQA 4IIMA 1S1NA 1PHTA 1ABOA 3UATA 4OMMA 1E7OA 2SRCA 4HVWA 4F17A 1AWOA 1W6XA 1FMKA 5IHIA 2K79A 2YUQA 2K2MA 4J9EA 1AWJA 1WFWA 4HXJA 1ZBJA 3NPFA 3PE0A 1M30A 2ED0A 2K9GA 4Y92A 1SSHA 2ENMA 2HEQA 2RPNA 3VS1A 4AFSC 2XMFA 4J9BA 1E6GA 2H8HA 5IH2A 2DVJA 2VWFA 1X6BA 1RI9A 2KRMA 1PRMC 4JJDA 1ARKA 1ZUUA 1NM7A 4RTYA 1PKSA 4OMLA 2F2WA 1SHFA 3RNJA 1YN8A 2LJ1A 4X1VA 1QKWA 1NEGA 2ESWA 1VYTA 1J3TA 1KIKA 2O88A 2A36A 2YUOA 2GNCA 2IIMA 4F14A 2PNIA 2VKNA 1ZSGA 2KT1A 3PVLA 4QT7A 1GCQC 3VRYA 4DEXA 2C0IA 4JPBW 2EQIA 2OAWA 4Z8AA 4AFUC 1GL5A 3EHQA 1TG0A 3VS2A 1SEMA 2QDLA 2ED1A 1UG1A 4IIOA 1BB9A 2JM9A 2A37A 1UHFA 1X27A 2J6FA 2K3BA 4FSSA 1RUWA 4GBQA 1I1JA 1UE9A 5GJVB 1JXOA 3VS3A 3UF4A 2LP5A 2KEAA 1U3OA 1M3AA 1M3CA 2JW4A 2DMOA 1YWOA 1AOJA 3IQLA 5I22A 1BU1A 4RTZA 1U5SA 3VS6A 2FO0A 2X3WD 1N5ZA 3M0UA 1YCSB 3UA6A 1CKAA 1VYVA 2EVRA 1FYNA 3EGUA 4F16A 4R0KA 1T3LA 4DEYA 3RBBB 1AD5A 2FEIA 2DBKA 2X3XD 1AWWA 3M0SA 1UECA 1NYFA 1QKXA 1UDLA 2DX1A 2CT4A 2EW3A 2JS0A 2K6DA 2VVKA 1Y57A 1UGVA 1AZGB 2JMCA 2OJ2A 1B07A 2E5KA 2J6KA 2OI3A 4OMPA 3TSWA 3LH5A 1GRIA 1JU5C 2L3SA 1PKTA 1WXBA 1PWTA 3NGPA 1NEBA 3REAB 1Z9QA 2RQUA 2JT4A 4RUGA 4EIKA 1OPLA 4ZNXA 1ZX6A 1WDXA 2W10A 3EG0A 2KROA 3H0IA 3QWYA 1MV0B 1AWXA 2KRSA 2YUNA 2LQNA 1VYUA 1PNJA 2GGRA 2LMJA 3THKA 3VS0A 1H92A 4CC3A 3NHNA 1ZUYA 1YNZA 2J6OA 1RLPC 2A08A 1HSQA 2CH4A 1K76A 1K1ZA 1RLQC 2CREA 1QCFA 4Z89A 2JMAA 4OMNA 2FPEA 2W0ZA 2KR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JS2 A;  2BTT A;  4ESR A;  2KXD A;  2C0T A;  2FPD A;  2I0N A;  2RMO A;  2RQW A;  4GLM A;  4JZ3 A;  2CSI A;  2DL4 A;  2C0O A;  2J05 A;  4A63 B;  4JZ4 A;  2EYW A;  2D8H A;  2HBW A;  2DLP A;  1YP5 A;  1UHC A;  2EKH A;  1NG2 A;  3M0R A;  3EHR A;  4JJC A;  1KSW A;  4LUD A;  5FW9 A;  2HCK A;  2AKK A;  2DA9 A;  3VS4 A;  3M0Q A;  4J9H A;  1QLY A;  2YT6 A;  2DJQ A;  2P4R A;  2MCN A;  1UJ0 A;  2O2O A;  1OPK A;  1K0S A;  4Z88 A;  1NYG A;  1W70 A;  3I5R A;  2PTK A;  1TUD A;  2DRK A;  2EYY A;  4D8D A;  1SRL A;  4D8K A;  3EG2 A;  1I0C A;  2LNH B;  3M0T A;  2EGC A;  5EC7 A;  4M4Z A;  2CT3 A;  2KE9 A;  1SPK A;  3JV3 A;  3ZL7 C;  2RF0 A;  4RTT A;  1WLP B;  3EG3 A;  5IXF A;  4CC7 A;  1ZUK A;  2ROT A;  2DL5 A;  3M0P A;  2DL3 A;  2PZ1 A;  5IHK A;  2EBP A;  2CDT A;  3H0H A;  1OV3 A;  1UJY A;  1T0H A;  2KGT A;  2FG0 A;  2J06 A;  1GBR A;  2AK5 A;  3VRZ A;  1GFC A;  1HD3 A;  1M8M A;  1PRL C;  5ECA A;  3SHW A;  1WX6 A;  2DE0 X;  1GCQ A;  2EPD A;  1X2Q A;  1JO8 A;  3EG1 A;  1A0N B;  4RTW A;  2CH4 W;  2SEM A;  1IO6 A;  2AZS A;  4CC4 B;  1NLO C;  2NWM A;  1WYX A;  1VA7 A;  1QWE A;  2DL8 A;  4LN2 A;  2ABL A;  2KRN A;  3U23 A;  1E6H A;  1MV3 A;  2BZX A;  2L3P A;  4RTU A;  2F2V A;  5HCK A;  3ULR B;  1UTI A;  1WXT A;  1MUZ A;  3GBQ A;  1XOV A;  2MIO A;  2V1Q A;  4AFZ C;  5I11 A;  5GJW B;  3REB B;  1T3S A;  2M51 A;  1JXM A;  1SHG A;  5L23 A;  2V1R A;  1OEB A;  2LX7 A;  4HVU A;  2RNA A;  1SRM A;  3KFV A;  2CSQ A;  1ABQ A;  4RTV A;  1KJW A;  4CC2 A;  1KFZ A;  4K11 A;  4KRT A;  4J9G A;  2AZV A;  3SEM A;  2GTO A;  2GTJ A;  2O31 A;  1W1F A;  2ROL A;  2CUB A;  3VS5 A;  1BBZ A;  4AG2 C;  5IHN A;  1K9A A;  3CQT A;  1NLP C;  2LJ3 A;  1K0X A;  2MOX A;  2RQV A;  1AVZ C;  1OOT A;  1WI7 A;  2RN8 A;  2DL7 A;  2EGA A;  1WA7 A;  2DYB A;  2O9V A;  2LQW A;  3C0C A;  1AEY A;  5IXB A;  1Y0M A;  4J9C A;  2DF6 A;  2DM1 A;  1JEG A;  4ORZ A;  2NUZ A;  2FPF A;  2KT8 A;  2YUP A;  3H41 A;  2F2X A;  2D0N A;  2KYM A;  1K4U S;  1HJD A;  3O5Z A;  4LNP A;  3PVQ A;  2DIL A;  1Z9Z A;  5FWB A;  2O9S A;  1YWP A;  2YDL A;  1M3B A;  4J9F A;  2GQI A;  2LJ0 A;  1AZE A;  2CUD A;  1UUE A;  4LE9 A;  2JM8 A;  2FRY A;  1X69 A;  1H8K A;  4HVV A;  2LCS A;  1GCP A;  1X43 A;  1CKB A;  1BK2 A;  2LZ6 B;  2JTE A;  3NMZ C;  1ZLM A;  4HCK A;  3TSZ A;  3TVT A;  2HDA A;  1TUC A;  2GBQ A;  2J7I A;  1WXU A;  1X2K A;  2L0A A;  2K7A A;  2RQR A;  1JQQ A;  1EFN A;  1U06 A;  3UA7 A;  2EYZ A;  2EGE A;  1T0J A;  4LUE A;  4AG1 C;  3A98 A;  1H3H A;  2L3Q A;  3I5S A;  3I9Q A;  4AFQ C;  2ECZ A;  2EYX A;  2FRW A;  4E6R A;  2KNB B;  1GBQ A;  1B3Q A;  4J9D A;  2DRM A;  4JJB A;  1QWF A;  1UFF A;  1I07 A;  2B86 A;  3R6N A;  2D8J A;  1G2B A;  2HSP A;  2L2P A;  3I35 A;  2DBM A;  3VS7 A;  4RTX A;  1X6G A;  2JXB A;  2DNU A;  2YSQ A;  1V1C A;  2BZY A;  2A28 A;  2RQT A;  2BZ8 A;  3H0F A;  1WIE A;  1G83 A;  2KXC A;  4WCI A;  1CSK A;  3QWX X;  2G6F X;  2KYB A;  1LCK A;  5FWC A;  2M0Y A;  1GFD A;  4J9I A;  2D1X A;  3FJ5 A;  1M27 C;  2AKL A;  2KBT A;  4OMO A;  4OMQ A;  4IIM A;  1S1N A;  1PHT A;  1ABO A;  3UAT A;  4OMM A;  1E7O A;  2SRC A;  4HVW A;  4F17 A;  1AWO A;  1W6X A;  1FMK A;  5IHI A;  2K79 A;  2YUQ A;  2K2M A;  4J9E A;  1AWJ A;  1WFW A;  4HXJ A;  1ZBJ A;  3NPF A;  3PE0 A;  1M30 A;  2ED0 A;  2K9G A;  4Y92 A;  1SSH A;  2ENM A;  2HEQ A;  2RPN A;  3VS1 A;  4AFS C;  2XMF A;  4J9B A;  1E6G A;  2H8H A;  5IH2 A;  2DVJ A;  2VWF A;  1X6B A;  1RI9 A;  2KRM A;  1PRM C;  4JJD A;  1ARK A;  1ZUU A;  1NM7 A;  4RTY A;  1PKS A;  4OML A;  2F2W A;  1SHF A;  3RNJ A;  1YN8 A;  2LJ1 A;  4X1V A;  1QKW A;  1NEG A;  2ESW A;  1VYT A;  1J3T A;  1KIK A;  2O88 A;  2A36 A;  2YUO A;  2GNC A;  2IIM A;  4F14 A;  2PNI A;  2VKN A;  1ZSG A;  2KT1 A;  3PVL A;  4QT7 A;  1GCQ C;  3VRY A;  4DEX A;  2C0I A;  4JPB W;  2EQI A;  2OAW A;  4Z8A A;  4AFU C;  1GL5 A;  3EHQ A;  1TG0 A;  3VS2 A;  1SEM A;  2QDL A;  2ED1 A;  1UG1 A;  4IIO A;  1BB9 A;  2JM9 A;  2A37 A;  1UHF A;  1X27 A;  2J6F A;  2K3B A;  4FSS A;  1RUW A;  4GBQ A;  1I1J A;  1UE9 A;  5GJV B;  1JXO A;  3VS3 A;  3UF4 A;  2LP5 A;  2KEA A;  1U3O A;  1M3A A;  1M3C A;  2JW4 A;  2DMO A;  1YWO A;  1AOJ A;  3IQL A;  5I22 A;  1BU1 A;  4RTZ A;  1U5S A;  3VS6 A;  2FO0 A;  2X3W D;  1N5Z A;  3M0U A;  1YCS B;  3UA6 A;  1CKA A;  1VYV A;  2EVR A;  1FYN A;  3EGU A;  4F16 A;  4R0K A;  1T3L A;  4DEY A;  3RBB B;  1AD5 A;  2FEI A;  2DBK A;  2X3X D;  1AWW A;  3M0S A;  1UEC A;  1NYF A;  1QKX A;  1UDL A;  2DX1 A;  2CT4 A;  2EW3 A;  2JS0 A;  2K6D A;  2VVK A;  1Y57 A;  1UGV A;  1AZG B;  2JMC A;  2OJ2 A;  1B07 A;  2E5K A;  2J6K A;  2OI3 A;  4OMP A;  3TSW A;  3LH5 A;  1GRI A;  1JU5 C;  2L3S A;  1PKT A;  1WXB A;  1PWT A;  3NGP A;  1NEB A;  3REA B;  1Z9Q A;  2RQU A;  2JT4 A;  4RUG A;  4EIK A;  1OPL A;  4ZNX A;  1ZX6 A;  1WDX A;  2W10 A;  3EG0 A;  2KRO A;  3H0I A;  3QWY A;  1MV0 B;  1AWX A;  2KRS A;  2YUN A;  2LQN A;  1VYU A;  1PNJ A;  2GGR A;  2LMJ A;  3THK A;  3VS0 A;  1H92 A;  4CC3 A;  3NHN A;  1ZUY A;  1YNZ A;  2J6O A;  1RLP C;  2A08 A;  1HSQ A;  2CH4 A;  1K76 A;  1K1Z A;  1RLQ C;  2CRE A;  1QCF A;  4Z89 A;  2JMA A;  4OMN A;  2FPE A;  2W0Z A;  2KR3 A; 
#chains in the Genus database with same CATH topology
 2F69 A;  4JRQ A;  2BTT A;  4ESR A;  1QMC A;  2CP2 A;  4KGV B;  4JZ3 A;  4LD9 K;  1VQ4 Q;  2J05 A;  1S72 T;  4A63 B;  2ZPE B;  4ELY C;  2EYW A;  3HPW A;  2D8H A;  3F70 A;  4RG2 A;  1UHC A;  1K9M U;  1M90 U;  4XU3 A;  2EKH A;  1NG2 A;  2CP6 A;  3EHR A;  5C6S A;  2BKD N;  4F7U E;  4M7D F;  2QTX A;  3M57 A;  2YHT A;  2HCK A;  1BIA A;  3S3O A;  2VV5 A;  3M59 A;  2JJ9 A;  1X6O A;  4BB7 A;  2FL7 A;  3P8D A;  3UT1 A;  3CCU Q;  4N4I A;  2RO0 A;  1K0S A;  4J6X A;  4EMK B;  5KH6 A;  2QAS A;  1NYG A;  4KH0 B;  1VQL T;  2PTK A;  1TUD A;  1I5O B;  2ZAE A;  3BFM A;  4ZTJ A;  1M90 R;  2HBP A;  1I0C A;  3M0T A;  5EC7 A;  1G5V A;  4M4Z A;  4FT4 A;  3ZEH A;  1SPK A;  2RF0 A;  2P84 A;  3EG3 A;  3QZ5 B;  3OS1 A;  3EFR A;  2DL3 A;  4PJO C;  4IUT A;  1RAF B;  3V7C A;  1B34 B;  2D9T A;  4BE2 A;  3C12 A;  1OV3 A;  1QCO A;  4A53 A;  2K5I A;  3EH1 A;  2BE7 D;  2FVU A;  1GFC A;  5CAI A;  4JS4 A;  1U8R A;  4MML A;  3M58 A;  5ECA A;  1WX6 A;  4C5H A;  4TVR A;  5KYX B;  4C92 E;  2CP0 A;  1NE8 A;  3FJP A;  4RTW A;  2SEM A;  4CC4 B;  3CCL T;  3FLG A;  3KXT A;  1WYX A;  1M1F A;  3EFS A;  2DL8 A;  4HA8 A;  4LN2 A;  3BDU A;  2MPX C;  2X4X A;  4M77 E;  3U23 A;  3MKD A;  1E6H A;  1WHG A;  2WSC E;  4C5I A;  4PJL A;  1JB0 E;  4OB3 B;  3OYC A;  1MND A;  1UTI A;  3P8B B;  3SD4 A;  1M2V A;  3OMC A;  2QEX T;  2V1R A;  2LX7 A;  4PJO A;  3KFV A;  3A8L B;  3VUB A;  3JCM X;  1ABQ A;  4CC2 A;  5LJ5 d;  1VQ4 T;  4J9G A;  4AT1 B;  2GTO A;  1YIJ Q;  4PNO A;  3BE3 A;  2PQW A;  2O31 A;  1W1F A;  1Q95 G;  5IHN A;  3WVE B;  4XTY A;  1NLP C;  2GQV A;  2MOX A;  2RQV A;  4NL2 A;  1BCO A;  2DL7 A;  2EGA A;  2DYB A;  2PVO B;  4ZN3 A;  2QDY B;  3OYF A;  1YJ9 A;  4E7J A;  3PGG A;  1Y0M A;  2DM1 A;  4C5E A;  5FRN A;  4ORZ A;  1JEG A;  3HSB A;  2NUZ A;  4BD3 A;  2FPF A;  3M4Y A;  1P92 A;  3OYK A;  1SF9 A;  3O5Z A;  4LNP A;  1RAD B;  1G3W A;  3PVQ A;  5FWB A;  4PJO G;  2O9S A;  1YWP A;  1G3S A;  4MZP A;  3PIP A;  2YDL A;  4FYV B;  2R5M A;  4QKU A;  1AZE A;  4B9W A;  2FRY A;  4M7A A;  1H8K A;  3NTK A;  2LCS A;  6AT1 B;  3EG9 A;  1I4K 1;  1ZBX A;  1H3Z A;  4PJO B;  4KGZ B;  4PLL A;  4HCK A;  1RAE B;  2C06 A;  2HDA A;  1TUC A;  2J7I A;  1TU0 B;  1WXU A;  2RHX A;  1OYX A;  2K7A A;  3KUF A;  1U06 A;  3UA7 A;  2EYZ A;  3HP9 A;  2OAU A;  4AG1 C;  4RG8 A;  1D0Z A;  2L3Q A;  3I5S A;  1WNL A;  2LT4 A;  4M75 C;  3QII A;  2P0Q A;  5CIU A;  3FRN A;  3EAE A;  1RAB B;  1VQ5 Q;  3J7A F;  2L2P A;  1RAH B;  4HCB A;  4GY5 A;  3FIF A;  4RTX A;  1X6G A;  1IGU A;  2MK5 A;  3OSS C;  1TTH B;  1PG5 B;  2M0Y A;  1GFD A;  1M27 C;  5D6Y A;  4OMO A;  1YI2 A;  1S1N A;  3UAT A;  1PCX A;  2HKQ B;  2EQM A;  2DK3 A;  4F17 A;  2LQK A;  3G4S A;  2CKK A;  2DET A;  4BAC A;  1YJW T;  1WQW A;  1KQ1 A;  3UWN A;  3PE0 A;  1VQ7 A;  2K9G A;  3PT9 A;  2QGG A;  4EDU A;  1YIJ T;  3GNG A;  4J9B A;  2H8H A;  1N9R A;  2HZY A;  1BI1 A;  2D0Q B;  3MHX A;  5DM7 R;  3BW1 A;  4M75 A;  4RTY A;  4OML A;  2F2W A;  1SHF A;  4PFZ A;  1QVP A;  4N4G A;  1KIK A;  4C0D C;  4WF2 A;  2IIM A;  4DOV A;  2VKN A;  2DTI A;  1FX7 A;  3MP1 A;  1GCQ C;  5KYY A;  4JPB W;  2OAW A;  4Z8A A;  2VGM A;  2XID A;  1C6V X;  2JUF A;  3EHQ A;  3QDR B;  5GAM h;  2XHC A;  3VS2 A;  2D6F A;  3KBG A;  1VQ8 A;  2QDL A;  1LNX A;  2ED1 A;  4M7D E;  3QZ9 B;  1HXD A;  1UGQ B;  4IIO A;  2OX7 A;  2HQH A;  1R0C B;  5GAN d;  2IVW A;  2CS7 A;  1QCN A;  2E65 A;  2FZC B;  5GJV B;  2LP5 A;  1U3O A;  2YRV A;  1M3A A;  3QUI A;  3DB3 A;  3V8J A;  1M3C A;  1YWO A;  4R55 A;  3IQL A;  2EQJ A;  4FW1 A;  1IHV A;  4M75 G;  3J81 E;  3MEU A;  3CC7 T;  2G3R A;  2KK4 A;  4IUR A;  1VYV A;  4C92 F;  3JCM h;  5CQY A;  1QVF P;  3VJP A;  1NJI C;  2DIG A;  3HRS A;  3CD6 A;  1D3B B;  3EGU A;  4R0K A;  5KCO A;  1T3L A;  1LJO A;  1VQ5 T;  2X3X D;  3I56 A;  1AWW A;  1YCY A;  4M75 B;  2V8K A;  4M77 F;  2F5T X;  1RAI B;  2RJF A;  1MNE A;  2DX1 A;  1RI0 A;  2XDB A;  5FRO A;  1UGV A;  3JAM E;  2KVQ G;  1M1K U;  1OUL A;  3TSW A;  1OU9 A;  3LH5 A;  4CI0 C;  2JZ2 A;  4FW2 A;  3NGP A;  4BY6 C;  3LW5 E;  1Y7X A;  4C8Q F;  4MZT A;  2RQU A;  1OU8 A;  4O6J A;  2DEU A;  2W10 A;  3E9F A;  3H0I A;  5GAN 7;  4ANJ A;  3S3N A;  1SSF A;  3QWY A;  3A5Z B;  2E6Z A;  1YHQ A;  3I55 A;  1XNI A;  1QVG S;  2LQN A;  3HL8 A;  1FMW A;  2GGR A;  2MMP A;  4JRI A;  1I5L A;  5GMK e;  2LMJ A;  1H92 A;  3EGX B;  4M78 A;  4QVD A;  1ZUY A;  1YJN A;  4XQ3 A;  2EFI A;  4AMC A;  2CH4 A;  1K1Z A;  5IAY A;  1RLQ C;  4ELZ C;  2DJZ A;  5GAM f;  1YIT Q;  1ZUK A;  4LDY A;  2KR3 A;  2YRD A;  1Q86 U;  4OVA A;  3BY7 A;  1Q82 C;  4A4F A;  2EJG A;  4PKC C;  2KXD A;  2C0T A;  3VKI A;  3JCM P;  2QI2 A;  3JB9 I;  4KUD K;  4IUQ A;  3ASK A;  2E12 A;  3ZBD A;  3CC4 T;  2HD0 A;  3CEY A;  2KY9 A;  4JZ4 A;  1YBY A;  5GAN 3;  3CD6 Q;  1VQ9 A;  2VC8 A;  3FB9 A;  1XQH A;  4LDU A;  2DLP A;  1YP5 A;  1VQP T;  3M0R A;  5CK9 A;  4JJC A;  4LUD A;  2LTO A;  2X35 A;  3CMA A;  4Z02 A;  2DXB A;  2AKK A;  1K8A C;  4J9H A;  2P4R A;  2MCN A;  4C92 D;  2A3L A;  2HNI A;  2XD0 A;  4ZGJ B;  1VQM A;  1W2B P;  3A1P A;  1W70 A;  2NUP B;  1KD1 C;  1JJ2 A;  3A8G B;  3GPL A;  3CCJ T;  4D8K A;  4XU2 A;  2EGC A;  2CT3 A;  4M77 D;  5J39 A;  3ZL7 C;  1Q81 U;  4RTT A;  1WLP B;  2V26 A;  3E2U A;  1FXX A;  5IHK A;  1RL2 A;  3H0H A;  1T0H A;  2FG0 A;  1Q7Y C;  3WXM B;  3VRZ A;  1KG1 A;  1HD3 A;  2LC4 A;  2M1H A;  1M8M A;  4C5G A;  2OTJ T;  1TH7 A;  4EPC A;  4BI3 A;  2F1L A;  2WAC A;  4RCC A;  3CCV A;  5CKF A;  1RAG B;  2YWW A;  3EG1 A;  1NJI R;  1A0N B;  1WJR A;  1M4Z A;  2CH4 W;  3JCM V;  1IO6 A;  2AZS A;  1VQK A;  9ATC B;  1VA7 A;  2E70 A;  4BY6 B;  4QVC A;  1M1G A;  1N8R U;  3JB9 F;  2OTL T;  3CC2 Q;  3RMS A;  3CMA Q;  3JCM W;  5LJ3 d;  4A4E A;  5HCK A;  1WGS A;  4FYY B;  3ULR B;  1KHC A;  1Y96 A;  3CME A;  1WXT A;  1UGP B;  1VQN Q;  3L42 A;  3GBQ A;  3QYG B;  2LQ8 A;  4AFZ C;  5I11 A;  3QSU A;  5J3B A;  1VQM Q;  1JJ2 S;  1T3S A;  3MPU B;  3JB9 J;  1WHM A;  3NTH A;  1YIT T;  2RNA A;  3JCM b;  2DXC A;  5KE3 A;  1SRM A;  4A54 A;  2RM4 A;  4GLK A;  3CPW S;  3RUX A;  5CR2 A;  5GAM j;  1KFZ A;  1VQ6 T;  4K11 A;  1GXI E;  4FU6 A;  3CCE T;  2AZV A;  5M9O A;  5KYX A;  4HKE A;  4XTX A;  3VS5 A;  2LNV A;  4AG2 C;  2LJ3 A;  4HCC A;  2HQE A;  1D1A A;  1AVZ C;  1X75 C;  4QQ6 A;  3OYI A;  3H9N A;  4C0Z A;  1AEY A;  1Q82 R;  3X25 B;  4J9C A;  4JS5 A;  1TUG B;  2RK1 A;  4LD6 A;  2DXT A;  1OZ2 A;  2D0N A;  2KYM A;  1K4U S;  2DIL A;  2K57 A;  1VQK Q;  3MEW A;  2QQB A;  3R6O A;  3C94 A;  4J9F A;  2LJ0 A;  4X9C A;  1UGR B;  3G6E Q;  1Y96 B;  3SWN C;  1QQJ A;  2DTO A;  4LE9 A;  1C0M A;  2KI7 A;  2JM8 A;  3HKS A;  1X69 A;  3OYH A;  3CME Q;  1X43 A;  4O5V A;  3NMZ C;  1X01 A;  4NS5 A;  2QA4 A;  4ZGE B;  4C0G A;  1KD1 R;  2L0A A;  2DYI A;  2RQR A;  2AHJ B;  1EFN A;  2E64 A;  1T0J A;  3OS2 A;  3M53 A;  3CXC P;  1K73 U;  2RD1 A;  1BIB A;  1H3H A;  4E7H A;  2CZ0 B;  2QQ9 A;  1Y07 A;  2RJD A;  1QP3 A;  4Q5W A;  2FRW A;  2NUT A;  3OQ5 A;  5GMK l;  5AYF A;  5HKC A;  1BI3 A;  3LX7 A;  5LJ5 e;  3X20 B;  2DRM A;  4IUU A;  1I07 A;  3ER0 A;  2B86 A;  5CCA A;  1G2B A;  2HSP A;  2DNU A;  4NL3 A;  3CCS T;  3CC2 T;  1M5Q 1;  1K73 R;  2RQT A;  5GAO l;  4XTW A;  1O75 A;  1WIE A;  5CKB A;  5GMK i;  2I2L A;  1G83 A;  5FU7 B;  3OYM A;  1WQ7 A;  1SG5 A;  3M56 A;  1VQN T;  2YXY A;  4XTV A;  1KQS P;  2D1X A;  2AKL A;  2KBT A;  3SWN A;  4C8Q E;  1ABO A;  1XJW B;  2FZG B;  1JRI A;  2Y4X A;  1QP2 A;  4DQ2 A;  1E7O A;  4C92 C;  4N0A C;  1AWO A;  3FDR A;  1W6X A;  2GF7 A;  1FMK A;  3CBM A;  4F7U A;  3JB9 H;  2E41 A;  4M7D D;  5CVI A;  4HXJ A;  1ZBJ A;  5I21 A;  1M30 A;  2A0F B;  1BYM A;  2P4T A;  2Y90 A;  2GFA A;  3CCR A;  1SSH A;  2ENM A;  1OX9 A;  4M77 C;  4AFS C;  3X24 B;  5LJ5 g;  2HMA A;  2EAY A;  5LJ5 f;  3L1A A;  1RI9 A;  2VXF A;  1NPR A;  1ZUU A;  1NM7 A;  2DVE A;  2LJ1 A;  2NUT B;  3LYI A;  2EQU A;  2QAZ A;  3GP8 A;  1VYT A;  3HFN A;  3CCU T;  2DXU A;  2YUO A;  5KYN A;  4OGC A;  4ME7 A;  1ZSG A;  3QHS A;  2KT1 A;  5D6W A;  1PC0 A;  1W4S A;  4QT7 A;  1ZHI A;  3VRY A;  1BCM A;  3QKJ A;  1GL5 A;  4F7U G;  1N9S A;  2YLB A;  4JLI A;  4QVZ A;  5A0G A;  3G6E T;  5LL6 S;  1U1S A;  1UG1 A;  1BB9 A;  1UHF A;  1X27 A;  2J6F A;  4FSS A;  4J6Y A;  3HRT A;  1PD1 A;  1VIF A;  4C92 A;  1I1J A;  1PSE A;  1UE9 A;  2KSS A;  3QO3 A;  4N0A A;  3SWN B;  1Y71 A;  1LOJ A;  2LCC A;  1R0B G;  2JW4 A;  2DZ9 A;  5KYW B;  4J7I A;  5I22 A;  2EQK A;  4EMH A;  1U5S A;  3MJX A;  4F7U B;  1WHJ A;  3D7S B;  3QYH B;  3OYL A;  1D1C A;  1N5Z A;  3G71 A;  1R77 A;  5DY9 A;  2L8D A;  3EFO A;  3UA6 A;  4M77 A;  2EVR A;  1RAC B;  2XDD A;  3L2U A;  4F16 A;  4RMO A;  3CCR Q;  1ZSZ C;  4DBH A;  1G3T A;  4DEY A;  4MDX A;  1N27 A;  3RBB B;  2EKO A;  2FEI A;  2DBK A;  1VQO A;  3M0S A;  2FZK B;  1UEC A;  1NYF A;  1QKX A;  3C95 A;  2EW3 A;  3VV0 A;  1TOV A;  2XI9 A;  4MZM A;  1AZG B;  2E6N A;  2E5K A;  2J6K A;  2OI3 A;  1YJ9 Q;  4OB2 B;  4C92 G;  2LVM A;  1PKT A;  1N6A A;  3AT1 B;  3FEO A;  1NEB A;  2JTM A;  2P0P A;  2JT4 A;  4RUG A;  1OPL A;  1ZX6 A;  1B7T A;  2FB7 A;  2KRO A;  1M1K C;  2BIV A;  2RJE A;  2DKG A;  4M77 G;  3VYH B;  2NYS A;  1MV0 B;  3LH0 A;  2ZPF B;  3J80 E;  4IUP A;  5FLX E;  1VYU A;  2DAQ A;  1PNJ A;  2YLC A;  4C92 B;  2ZPG B;  3EGD A;  4J83 A;  5GAN 5;  3NHN A;  2WSE E;  2GFU A;  4C8Q G;  1K76 A;  4OGE A;  1D3B A;  1MHN A;  3OW2 P;  3HTR A;  3OW2 A;  2L3R A;  5GAN e;  2JMA A;  2R57 A;  3EFO B;  3SDZ A;  2FPE A;  4M77 B;  3G1J A;  4KBM B;  3CCM A;  4L5G A;  1ZSZ A;  4E7I A;  2FPD A;  2I0N A;  3OYA A;  4L6V 5;  2DL4 A;  2HL5 C;  2C0O A;  4C8Q B;  2HBW A;  2LX9 A;  4IKF A;  1VQO Q;  2MI6 A;  5FW9 A;  2CP3 A;  3VS4 A;  3M0Q A;  3E19 A;  4MMK A;  2DJQ A;  4M78 E;  1UJ0 A;  2O2O A;  1OPK A;  4JRK A;  3QBY A;  1U1T A;  4Z88 A;  3OYY A;  4J5Y A;  1UEB A;  1WJS A;  2DRK A;  4ZTF A;  1KC8 C;  1O9S A;  3EGX A;  3HRU A;  4OP0 A;  2EYY A;  1SRL A;  1YI2 Q;  3EG2 A;  2KE9 A;  5GAN g;  1D0Y A;  2KMT A;  5GAN f;  2KQW A;  3EGD B;  2PVG B;  2LRQ A;  3M0P A;  4N4H A;  3G4S Q;  1I8F A;  1VQ7 Q;  1QVF A;  2E3I A;  2K2V A;  1OZ3 A;  2XDP A;  4QQG A;  2KGT A;  2MF2 A;  3CCQ A;  3OW2 S;  4A4K A;  2J06 A;  4XK8 E;  4M7D C;  1IB8 A;  1UGS B;  4R56 A;  1ZSZ B;  3RKW A;  2COZ A;  4M7A F;  1PRL C;  2QYZ A;  1IZ6 A;  1YJ9 T;  3QDF A;  1S72 A;  2EPD A;  1GCQ A;  4B9X A;  1X2Q A;  1JO8 A;  2BE9 B;  3UPU A;  4E7K A;  3QXE B;  1NLO C;  2RHZ A;  2NWM A;  3VUZ A;  1AT1 B;  3DKM A;  3TQ7 P;  4DBQ A;  2NUP A;  1MV3 A;  2DFU A;  3OYJ A;  2BZX A;  3MP6 A;  4RTU A;  4DA4 A;  2F2V A;  2EYQ A;  1VQ8 Q;  1MUZ A;  1VQL A;  1XOV A;  2V1Q A;  1M9S A;  3S3M A;  1JXM A;  4E47 A;  4BE1 A;  4HT8 A;  4HVU A;  2RH2 A;  2DTH A;  2CSQ A;  5GAM d;  2VXE A;  4X34 A;  4OF1 A;  1V29 B;  3M54 A;  3OBY A;  4BUG A;  3CPF A;  4M7D A;  1QVF S;  2RHI A;  2GTJ A;  5C0M A;  2ROL A;  1BBZ A;  2MYS A;  3CCQ Q;  1K9A A;  3CQT A;  1M8V A;  2X9H A;  1OOT A;  3I56 Q;  2RN8 A;  2K3Y A;  2EJF A;  2LQW A;  4KGX B;  2VUB A;  1PSF A;  3C0C A;  5IXB A;  5HK3 A;  3JCM d;  2M16 A;  2RHY A;  1TWB A;  1ZA1 B;  2RI3 A;  3MEA A;  5A2Q E;  3H41 A;  3M5A A;  1MMN A;  4FT2 A;  3CCL A;  4FM4 B;  5DLO A;  1K9M C;  1M90 C;  1HJD A;  4M75 F;  3Q1J A;  1W2B A;  2VYT A;  1KK7 A;  3MO8 A;  1YI2 T;  8AT1 B;  4IUV A;  2GQI A;  1QW1 A;  3MET A;  3EH2 A;  2K4Y A;  2DER A;  4M7D G;  4M7A D;  2CUD A;  1UUE A;  1YHQ Q;  3G4S T;  1IXD A;  3I55 Q;  1NZ9 A;  3LGF A;  1VQ7 T;  1GCP A;  1CKB A;  1BK2 A;  2QEX A;  5LJ3 e;  2JTE A;  1VQL Q;  1NJI U;  1ZLM A;  2F5K A;  2CGH A;  4C8Q D;  1YJN Q;  3TVT A;  1KC8 R;  4OMF B;  1X2K A;  1PM3 A;  3LWH A;  3PMT A;  2EGE A;  4M7D B;  1VQ4 A;  1KQ2 A;  3A98 A;  3V7R A;  3OSV A;  7AT1 B;  4JJN K;  3JCM Q;  2ECZ A;  2EYX A;  2KNB B;  1GBQ A;  4FYW B;  3OYB A;  3QJY A;  2L5Q A;  4HCZ A;  1VQ9 Q;  4V2S A;  5AT1 B;  4J6W A;  3R6N A;  4BI4 A;  3VS7 A;  2DBM A;  3M55 A;  5FU7 C;  3E1S A;  2YSQ A;  1V1C A;  2BZY A;  3M9Q A;  2A28 A;  3H0F A;  2MWO A;  2XIC A;  1VQ8 T;  4WCI A;  3QWX X;  2K3X A;  2G6F X;  2O4X B;  2WSF E;  1EIF A;  4X9D A;  3FC3 A;  1MMG A;  3HHT B;  5FWC A;  1W2B S;  3FJ5 A;  4FYX B;  4IIM A;  4BE0 A;  5LJ3 g;  1RAA B;  2XKO C;  4OMM A;  1NPP A;  5LJ3 f;  2RJC A;  2QG9 B;  4HVW A;  2AIR B;  4MDW A;  5IHI A;  2K79 A;  2YUQ A;  2K2M A;  4FSX A;  2K5L A;  3NPF A;  1WHK A;  4PL6 A;  4KH1 B;  1Q82 U;  3GNF B;  4Y92 A;  2HEQ A;  3V8L A;  1D1B A;  3CD6 T;  2EJ9 A;  5IH2 A;  1KHI A;  1ACM B;  2M9U A;  1TSF A;  4PK4 A;  2DVJ A;  2VWF A;  3E9G A;  3I56 T;  1X6B A;  2KRM A;  1PRM C;  1ARK A;  1WZO A;  5GAN 2;  1UB4 A;  4XU1 A;  4M78 F;  1YN8 A;  1TXQ A;  1NEG A;  1EX4 A;  2ESW A;  1J3T A;  2A36 A;  2GNC A;  3NTI A;  1K8A U;  3CCV Q;  2PNI A;  3OBW A;  4RCB A;  4PJJ A;  3PVL A;  2JOY A;  4PJO E;  1C1A A;  2C0I A;  4C0F A;  2EQI A;  4AFU C;  1KD1 U;  2E4H A;  1TG0 A;  1SEM A;  3INZ A;  1WJQ A;  5LJ5 h;  5GMK j;  4QW2 A;  1YHQ T;  2JM9 A;  5CKH A;  3I55 T;  2K3B A;  1K8A R;  2XK0 A;  3VS3 A;  3JCM J;  2RA2 A;  1K9M R;  2H3J A;  1ZQ1 A;  2DMO A;  1YJN T;  1AOJ A;  2VAS A;  3RKY A;  4YTL A;  4P5N A;  3VS6 A;  2FO0 A;  2X3W D;  1YJW A;  3CBO A;  2DPP B;  1Q7Y U;  3M0U A;  3TU4 K;  1OI1 A;  2ZZD A;  1YCS B;  4WTO B;  1CKA A;  2QQS A;  3JB9 D;  1G3Y A;  1VUB A;  4JUV A;  3CXC A;  4LDX A;  1YIJ A;  2ZPI B;  4E7S A;  3ZFJ A;  5KE2 A;  1AHJ B;  1VQ9 T;  2PUK B;  2JN0 A;  5CQX A;  1UDL A;  2A7Y A;  2CT4 A;  1Q7Y R;  4L59 A;  3JRZ A;  5KYU A;  2OJ2 A;  1B07 A;  4OMP A;  3LWI A;  3CMA T;  3MCA B;  4M7A E;  3RIR A;  1GRI A;  2L3S A;  2X4W A;  2HSE B;  4JDS A;  1PWT A;  3REA B;  3V7S A;  1PD0 A;  1VQM T;  2M0O A;  4ZNX A;  1KQS A;  3GLX A;  4LXC A;  2DD5 A;  2CZ7 B;  5KYW A;  2ZPB B;  1AWX A;  1G8X A;  1HYO A;  4M78 D;  5LJ3 j;  4FCY A;  4KT0 E;  3VS0 A;  2ZCF B;  4CC3 A;  2COW A;  3TRE A;  5KCH A;  1RLP C;  1WHH A;  2A08 A;  4B6M A;  3DLM A;  2QQR A;  4M7A C;  2CRE A;  1QCF A;  2QA4 Q;  3CC7 A;  4OMN A;  5FU6 C;  5GAN 6;  3A8O B;  3A8H B;  2JS2 A;  4DOW A;  1M2O A;  1YJW Q;  4Y28 E;  3CXC S;  2RMO A;  2RQW A;  4GLM A;  4C8Q C;  2JVV A;  2CSI A;  8ATC B;  3CCV T;  1VQ5 A;  5GAO r;  2XG8 D;  5FRM A;  4OB1 B;  1VQK T;  2KDS A;  5KYU B;  1KSW A;  2COY A;  4II1 A;  1WHL A;  3GOX A;  2B8A A;  2DA9 A;  1QLY A;  2YT6 A;  5GAO p;  4ZN1 A;  4J7F A;  3SB2 A;  3OMG A;  1I81 A;  5GAO n;  3CME T;  1KQS S;  3I5R A;  2CZ1 B;  4D8D A;  4M75 E;  1R8O B;  2LNH B;  5HK0 A;  4QQD A;  2V8I A;  3JV3 A;  4BDZ A;  4OB0 B;  5IXF A;  4CC7 A;  3OY9 A;  1M2V B;  2DL5 A;  2ROT A;  4ZGD B;  3LLR A;  3RMQ A;  2PZ1 A;  2LDM A;  2X51 A;  5A0D A;  2EBP A;  2CDT A;  3T9N A;  2JTF A;  3RDV A;  1UJY A;  2YRC A;  2CYZ B;  1GBR A;  1HK9 A;  4A4H A;  4C8Q A;  2AK5 A;  5GAN 8;  1IRE B;  3S6W A;  3CC7 Q;  1VOM A;  2LCL A;  3SHW A;  2NLU A;  4PJN A;  3CC4 A;  5EG2 A;  3G7Z A;  4VUB A;  2DE0 X;  2DD4 A;  5GAN h;  1ZA2 B;  2E5Q A;  2R5A A;  1VQP A;  4D6W A;  1EZZ B;  4HT9 A;  1QWE A;  2ABL A;  2KRN A;  4ATO A;  1OX8 A;  4KUI A;  2L3P A;  4M7A G;  2RHU A;  3DB4 A;  2IG0 A;  3OYD A;  4DBR A;  2L89 A;  2MIO A;  4UC4 A;  5GJW B;  3REB B;  2M51 A;  3CCJ A;  2LT1 A;  1SHG A;  5L23 A;  1OEB A;  2ATC B;  1JBM A;  2QA4 T;  2DIQ A;  5CO7 A;  4JLG A;  4RTV A;  3M4G A;  4M7A B;  1KJW A;  2CP7 A;  4FL6 A;  2PU9 B;  5I2S A;  3G71 Q;  3EG9 B;  2K5F A;  5FU6 B;  4LDW A;  5A0L A;  3H6Z A;  4KRT A;  5LJ5 j;  3SEM A;  2RI5 A;  4PJO F;  2HL3 A;  2CUB A;  4F7U F;  1K0X A;  1Q86 C;  2DZC A;  4XTU A;  1TS9 A;  3SFM A;  1WI7 A;  1IGQ A;  1WA7 A;  2OTJ A;  2O9V A;  1MGQ A;  3WVD B;  2MAM A;  4JRP A;  3CC4 Q;  2DF6 A;  2DO3 A;  3MP8 A;  2KT8 A;  2YUP A;  2F2X A;  1Z9Z A;  4PJM A;  5DLQ E;  1VQP Q;  1M3B A;  1DJ7 B;  2OTL A;  2Z0W A;  4J8O A;  2IPO B;  1IHW A;  4XU0 A;  1QVG P;  5GAO q;  1QVG A;  4NOY A;  1IRX A;  4KUL A;  1YFN A;  4HVV A;  2LZ6 B;  3GF5 A;  3CCR T;  3JSC A;  3L2V A;  1YIT A;  5HY6 A;  3CCJ Q;  1NBE B;  2E3H A;  3TSZ A;  5IT9 E;  1Q81 C;  2GBQ A;  1V76 A;  4M78 C;  1D09 B;  5GAN 4;  3QJ6 A;  1JQQ A;  2QQA A;  3JCM c;  5GMK h;  4PLI A;  1VQ6 A;  1FWZ A;  4LUE A;  3CCM Q;  2M02 A;  3PIO A;  3CCE A;  3X26 B;  3I9Q A;  4AFQ C;  5GAM e;  4E6R A;  2CZ6 B;  1B3Q A;  4J9D A;  5IN1 A;  4JJB A;  1QWF A;  1UFF A;  2KAF A;  1LPL A;  2D8J A;  1WPY A;  3I35 A;  2JXB A;  2OTJ Q;  3CBP A;  4E7Z A;  2FHD A;  3H8Z A;  2BZ8 A;  2E10 A;  2V8J A;  2MWP A;  1F1B B;  2KXC A;  1CSK A;  4E2F B;  2EIF A;  2KYB A;  5KYY B;  1LCK A;  4J9I A;  3JCM e;  4OMQ A;  5I2M A;  2R58 A;  1PHT A;  2GCX A;  1N8R C;  4PJO D;  3C4S A;  2SRC A;  3TCJ A;  4BDY A;  2OTL Q;  3OYE A;  1LVK A;  1M1K R;  5D6X A;  4J9E A;  2BUD A;  1AWJ A;  1WFW A;  2ZPH B;  4PFP A;  3G71 T;  3JB9 G;  3OA6 A;  3TEE A;  3DLL A;  2ED0 A;  3RKX A;  1MMA A;  2RPN A;  3OS5 A;  3VS1 A;  2XMF A;  3HFO A;  1E6G A;  1H64 1;  5GAM g;  5CKE A;  4CRI A;  1VQO T;  3NFC A;  4JJD A;  4LDV A;  2P0K A;  1PKS A;  3RNJ A;  5LJ3 h;  1VQ6 Q;  4X1V A;  1QKW A;  3CCE Q;  3RES A;  2O88 A;  1S72 Q;  4XAX B;  4DBF A;  3QPH A;  4F14 A;  3OB9 A;  3N5B B;  3ME9 A;  4F04 B;  2O4X A;  4C0D B;  4DEX A;  3JCM g;  5L8R E;  1Q86 R;  3CCS A;  3CC2 A;  3JCM f;  1KC8 U;  2VGN A;  3MEV A;  5CKD A;  3L2W A;  4EMK C;  3OYN A;  4BI8 B;  4M78 G;  2A37 A;  1VQN A;  3PTA A;  1RUW A;  4GBQ A;  2X4J A;  1JXO A;  5GAN j;  3UF4 A;  2KEA A;  1JJ2 P;  3GIB A;  2HQX A;  2RB6 A;  3URG A;  2O01 E;  1BU1 A;  4RTZ A;  3V8K A;  4FIB A;  2FYK A;  3P8H A;  2JNG A;  2HKN A;  3QG1 A;  2QTV A;  5GMK m;  2RK2 A;  3CPW P;  3CPW A;  4RKU E;  3PFS A;  3CCM T;  3UDC A;  4M78 B;  3BDL A;  1FYN A;  5D7U A;  2DEQ A;  3L2Z A;  3OYG A;  2HAX A;  2AT1 B;  1BI0 A;  3PNW C;  1AD5 A;  2E1H A;  2X4Y A;  3OS0 A;  5GAO m;  3L2R A;  2EWN A;  3PMI A;  3L2Q A;  1Q81 R;  1K73 C;  2JS0 A;  2K6D A;  2PUO B;  2VVK A;  1Y57 A;  2JMC A;  1OQK A;  3CCU A;  3A8M B;  4XTZ A;  2ZGW A;  1FMV A;  3VYG A;  1JU5 C;  2PVD B;  2VB6 A;  1WXB A;  4Y91 A;  4E7L A;  1Z9Q A;  4EMG A;  4EIK A;  4A4G A;  3CCL Q;  2QGF B;  4PFO A;  4EMK A;  1WDX A;  3EG0 A;  2Y4Y A;  1BI2 A;  2QK0 A;  3G6E A;  3CCS Q;  2QXF A;  1SKU B;  3RR6 A;  2KRS A;  1BKB A;  2YUN A;  2H3E B;  3AHU A;  1MMD A;  3O8V A;  3X28 B;  3THK A;  1D0X A;  5J26 A;  3LGL A;  1YNZ A;  2RI2 A;  2J6O A;  1B34 A;  2CP5 A;  1HSQ A;  3VU3 C;  2QEX Q;  4Z89 A;  3CCQ T;  1N8R R;  4M75 D;  2XU8 A;  3RER A;  1XTD A;  2W0Z A;  1VIE A; 
#chains in the Genus database with same CATH homology
 2JS2 A;  2BTT A;  4ESR A;  2KXD A;  2C0T A;  2FPD A;  2I0N A;  2RMO A;  2RQW A;  4GLM A;  4JZ3 A;  2CSI A;  2DL4 A;  2C0O A;  2J05 A;  4A63 B;  4JZ4 A;  2EYW A;  2D8H A;  2HBW A;  2DLP A;  1YP5 A;  1UHC A;  2EKH A;  1NG2 A;  3M0R A;  3EHR A;  4JJC A;  1KSW A;  4LUD A;  5FW9 A;  2HCK A;  2AKK A;  2DA9 A;  3VS4 A;  3M0Q A;  4J9H A;  1QLY A;  2YT6 A;  2DJQ A;  2P4R A;  2MCN A;  1UJ0 A;  2O2O A;  1OPK A;  1K0S A;  4Z88 A;  1NYG A;  1W70 A;  3I5R A;  2PTK A;  1TUD A;  2DRK A;  2EYY A;  4D8D A;  1SRL A;  4D8K A;  3EG2 A;  1I0C A;  2LNH B;  3M0T A;  2EGC A;  5EC7 A;  4M4Z A;  2CT3 A;  2KE9 A;  1SPK A;  3JV3 A;  3ZL7 C;  2RF0 A;  4RTT A;  1WLP B;  3EG3 A;  5IXF A;  4CC7 A;  1ZUK A;  2ROT A;  2DL5 A;  3M0P A;  2DL3 A;  2PZ1 A;  5IHK A;  2EBP A;  2CDT A;  3H0H A;  1OV3 A;  1UJY A;  1T0H A;  2KGT A;  2FG0 A;  2J06 A;  1GBR A;  2AK5 A;  3VRZ A;  1GFC A;  1HD3 A;  1M8M A;  1PRL C;  5ECA A;  3SHW A;  1WX6 A;  2DE0 X;  1GCQ A;  2EPD A;  1X2Q A;  1JO8 A;  3EG1 A;  1A0N B;  4RTW A;  2CH4 W;  2SEM A;  1IO6 A;  2AZS A;  4CC4 B;  1NLO C;  2NWM A;  1WYX A;  1VA7 A;  1QWE A;  2DL8 A;  4LN2 A;  2ABL A;  2KRN A;  3U23 A;  1E6H A;  1MV3 A;  2BZX A;  2L3P A;  4RTU A;  2F2V A;  5HCK A;  3ULR B;  1UTI A;  1WXT A;  1MUZ A;  3GBQ A;  1XOV A;  2MIO A;  2V1Q A;  4AFZ C;  5I11 A;  5GJW B;  3REB B;  1T3S A;  2M51 A;  1JXM A;  1SHG A;  5L23 A;  2V1R A;  1OEB A;  2LX7 A;  4HVU A;  2RNA A;  1SRM A;  3KFV A;  2CSQ A;  1ABQ A;  4RTV A;  1KJW A;  4CC2 A;  1KFZ A;  4K11 A;  4KRT A;  4J9G A;  2AZV A;  3SEM A;  2GTO A;  2GTJ A;  2O31 A;  1W1F A;  2ROL A;  2CUB A;  3VS5 A;  1BBZ A;  4AG2 C;  5IHN A;  1K9A A;  3CQT A;  1NLP C;  2LJ3 A;  1K0X A;  2MOX A;  2RQV A;  1AVZ C;  1OOT A;  1WI7 A;  2RN8 A;  2DL7 A;  2EGA A;  1WA7 A;  2DYB A;  2O9V A;  2LQW A;  3C0C A;  1AEY A;  5IXB A;  1Y0M A;  4J9C A;  2DF6 A;  2DM1 A;  1JEG A;  4ORZ A;  2NUZ A;  2FPF A;  2KT8 A;  2YUP A;  3H41 A;  2F2X A;  2D0N A;  2KYM A;  1K4U S;  1HJD A;  3O5Z A;  4LNP A;  3PVQ A;  2DIL A;  1Z9Z A;  5FWB A;  2O9S A;  1YWP A;  2YDL A;  1M3B A;  4J9F A;  2GQI A;  2LJ0 A;  1AZE A;  2CUD A;  1UUE A;  4LE9 A;  2JM8 A;  2FRY A;  1X69 A;  1H8K A;  4HVV A;  2LCS A;  1GCP A;  1X43 A;  1CKB A;  1BK2 A;  2LZ6 B;  2JTE A;  3NMZ C;  1ZLM A;  4HCK A;  3TSZ A;  3TVT A;  2HDA A;  1TUC A;  2GBQ A;  2J7I A;  1WXU A;  1X2K A;  2L0A A;  2K7A A;  2RQR A;  1JQQ A;  1EFN A;  1U06 A;  3UA7 A;  2EYZ A;  2EGE A;  1T0J A;  4LUE A;  4AG1 C;  3A98 A;  1H3H A;  2L3Q A;  3I5S A;  3I9Q A;  4AFQ C;  2ECZ A;  2EYX A;  2FRW A;  4E6R A;  2KNB B;  1GBQ A;  1B3Q A;  4J9D A;  2DRM A;  4JJB A;  1QWF A;  1UFF A;  1I07 A;  2B86 A;  3R6N A;  2D8J A;  1G2B A;  2HSP A;  2L2P A;  3I35 A;  2DBM A;  3VS7 A;  4RTX A;  1X6G A;  2JXB A;  2DNU A;  2YSQ A;  1V1C A;  2BZY A;  2A28 A;  2RQT A;  2BZ8 A;  3H0F A;  1WIE A;  1G83 A;  2KXC A;  4WCI A;  1CSK A;  3QWX X;  2G6F X;  2KYB A;  1LCK A;  5FWC A;  2M0Y A;  1GFD A;  4J9I A;  2D1X A;  3FJ5 A;  1M27 C;  2AKL A;  2KBT A;  4OMO A;  4OMQ A;  4IIM A;  1S1N A;  1PHT A;  1ABO A;  3UAT A;  4OMM A;  1E7O A;  2SRC A;  4HVW A;  4F17 A;  1AWO A;  1W6X A;  1FMK A;  5IHI A;  2K79 A;  2YUQ A;  2K2M A;  4J9E A;  1AWJ A;  1WFW A;  4HXJ A;  1ZBJ A;  3NPF A;  3PE0 A;  1M30 A;  2ED0 A;  2K9G A;  4Y92 A;  1SSH A;  2ENM A;  2HEQ A;  2RPN A;  3VS1 A;  4AFS C;  2XMF A;  4J9B A;  1E6G A;  2H8H A;  5IH2 A;  2DVJ A;  2VWF A;  1X6B A;  1RI9 A;  2KRM A;  1PRM C;  4JJD A;  1ARK A;  1ZUU A;  1NM7 A;  4RTY A;  1PKS A;  4OML A;  2F2W A;  1SHF A;  3RNJ A;  1YN8 A;  2LJ1 A;  4X1V A;  1QKW A;  1NEG A;  2ESW A;  1VYT A;  1J3T A;  1KIK A;  2O88 A;  2A36 A;  2YUO A;  2GNC A;  2IIM A;  4F14 A;  2PNI A;  2VKN A;  1ZSG A;  2KT1 A;  3PVL A;  4QT7 A;  1GCQ C;  3VRY A;  4DEX A;  2C0I A;  4JPB W;  2EQI A;  2OAW A;  4Z8A A;  4AFU C;  1GL5 A;  3EHQ A;  1TG0 A;  3VS2 A;  1SEM A;  2QDL A;  2ED1 A;  1UG1 A;  4IIO A;  1BB9 A;  2JM9 A;  2A37 A;  1UHF A;  1X27 A;  2J6F A;  2K3B A;  4FSS A;  1RUW A;  4GBQ A;  1I1J A;  1UE9 A;  5GJV B;  1JXO A;  3VS3 A;  3UF4 A;  2LP5 A;  2KEA A;  1U3O A;  1M3A A;  1M3C A;  2JW4 A;  2DMO A;  1YWO A;  1AOJ A;  3IQL A;  5I22 A;  1BU1 A;  4RTZ A;  1U5S A;  3VS6 A;  2FO0 A;  2X3W D;  1N5Z A;  3M0U A;  1YCS B;  3UA6 A;  1CKA A;  1VYV A;  2EVR A;  1FYN A;  3EGU A;  4F16 A;  4R0K A;  1T3L A;  4DEY A;  3RBB B;  1AD5 A;  2FEI A;  2DBK A;  2X3X D;  1AWW A;  3M0S A;  1UEC A;  1NYF A;  1QKX A;  1UDL A;  2DX1 A;  2CT4 A;  2EW3 A;  2JS0 A;  2K6D A;  2VVK A;  1Y57 A;  1UGV A;  1AZG B;  2JMC A;  2OJ2 A;  1B07 A;  2E5K A;  2J6K A;  2OI3 A;  4OMP A;  3TSW A;  3LH5 A;  1GRI A;  1JU5 C;  2L3S A;  1PKT A;  1WXB A;  1PWT A;  3NGP A;  1NEB A;  3REA B;  1Z9Q A;  2RQU A;  2JT4 A;  4RUG A;  4EIK A;  1OPL A;  4ZNX A;  1ZX6 A;  1WDX A;  2W10 A;  3EG0 A;  2KRO A;  3H0I A;  3QWY A;  1MV0 B;  1AWX A;  2KRS A;  2YUN A;  2LQN A;  1VYU A;  1PNJ A;  2GGR A;  2LMJ A;  3THK A;  3VS0 A;  1H92 A;  4CC3 A;  3NHN A;  1ZUY A;  1YNZ A;  2J6O A;  1RLP C;  2A08 A;  1HSQ A;  2CH4 A;  1K76 A;  1K1Z A;  1RLQ C;  2CRE A;  1QCF A;  4Z89 A;  2JMA A;  4OMN A;  2FPE A;  2W0Z A;  2KR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...