1CKAA

Structural basis for the specific interaction of lysine-containing proline-rich peptides with the n-terminal sh3 domain of c-crk
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C-CRK N-TERMINAL SH3 DOMAIN
publication title Structural basis for the specific interaction of lysine-containing proline-rich peptides with the N-terminal SH3 domain of c-Crk.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (oncogene protein/peptide)
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1995-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ckaA00
1NEGA 2FO0A 1WXTA 2LCSA 2KT1A 2HEQA 2D8JA 1VYTA 1X27A 1YN8A 2O9VA 3ZL7C 2D1XA 3O5ZA 2MCNA 2LNHB 4WCIA 4CC4B 1U3OA 2KE9A 1YWPA 1JEGA 2YUPA 2KROA 4A63B 2SRCA 1CSKA 4IIOA 4OMPA 2CDTA 1YWOA 2AK5A 2RQTA 4QT7A 2K79A 2CH4W 2RPNA 4ESRA 2EPDA 1K0SA 2KRNA 2EYZA 3VS0A 1GCPA 1QWEA 1ZBJA 2DJQA 1BBZA 2JMAA 1PWTA 1WFWA 1OV3A 1G2BA 3I5SA 1AWJA 2GNCA 1H3HA 4RTZA 1RLPC 4Y92A 2RQVA 2EYXA 2KT8A 1U06A 1GBQA 4DEYA 1X43A 1ZX6A 2LMJA 2L2PA 4LE9A 4F14A 1W1FA 2DL8A 2GQIA 5IHKA 1SSHA 2DILA 2K6DA 3KFVA 2A37A 2L3SA 1ABQA 2V1QA 2EKHA 1AVZC 1OPKA 1M8MA 2EGEA 4J9GA 3GBQA 2M51A 4K11A 1JXMA 1UUEA 3UA7A 5IXBA 2K3BA 2CT4A 1ZUUA 3H0FA 1ZLMA 2DX1A 2SEMA 4E6RA 3UF4A 2ROLA 1KFZA 1NLPC 2JM9A 2K2MA 3M0UA 2DL5A 1IO6A 3I35A 4J9FA 1UE9A 1UJ0A 4HXJA 5IXFA 2DL4A 4F17A 2K9GA 1PNJA 1K0XA 2O9SA 2O2OA 2O88A 2PZ1A 4RUGA 3VS6A 2EGAA 2KEAA 2DBMA 1E6HA 2EVRA 2IIMA 1HSQA 2A28A 5FWCA 2KYBA 4KRTA 4LUDA 3U23A 2FRWA 3EG3A 2D0NA 1X69A 2DMOA 2LJ1A 2LJ3A 4AG1C 1UHCA 1QLYA 1YP5A 3VS7A 2ECZA 4RTVA 3THKA 4D8KA 1M30A 4EIKA 4JJDA 1NG2A 2DVJA 2CUDA 2AKKA 5EC7A 4JZ3A 2OI3A 3VS2A 1YCSB 3RNJA 1AEYA 1N5ZA 1JU5C 1WA7A 2FPEA 3FJ5A 2J6FA 4HVWA 5I22A 2JXBA 2PTKA 4DEXA 5IHNA 4JJBA 1UG1A 1EFNA 2PNIA 2BTTA 4OMMA 3EHRA 4GBQA 1Z9QA 1PRLC 4LUEA 1Z9ZA 4OMLA 5IH2A 3TSWA 2ED1A 5GJVB 1KSWA 1GCQA 2DL3A 1MUZA 2YSQA 1OEBA 5GJWB 4JPBW 2GBQA 2J6OA 5L23A 1JQQA 2RNAA 4LN2A 1PHTA 1UGVA 1H92A 1WXBA 3REBB 2ROTA 2J6KA 1G83A 2KGTA 1T0HA 2KNBB 3EG1A 1VYVA 1U5SA 1TG0A 1H8KA 2LX7A 2J06A 2XMFA 2LP5A 1HD3A 1T3SA 5HCKA 2OAWA 2RQUA 1NEBA 2VWFA 1SPKA 4AFZC 2NUZA 2W0ZA 2I0NA 2X3XD 2MOXA 3UATA 2CREA 1UTIA 1SHGA 2W10A 2YDLA 1V1CA 2V1RA 2RMOA 2EGCA 2GTOA 1RI9A 3PVLA 2J05A 4J9IA 2EYYA 1TUCA 4AFSC 2K7AA 1AZEA 2CSQA 2EYWA 2HDAA 4J9BA 1ZSGA 1QKXA 3NPFA 4GLMA 3UA6A 1QKWA 2NWMA 2YUNA 1E6GA 2EQIA 2DNUA 4AFQC 2F2XA 1OPLA 1KIKA 1M3AA 4HVVA 2FPFA 1X2QA 2KXDA 1AWWA 1Y0MA 1K9AA 2FPDA 1X6BA 2KXCA 2MIOA 1AWXA 2KR3A 1FMKA 2C0TA 2DRMA 1GRIA 2YUOA 2QDLA 2CSIA 3I5RA 2HCKA 3VRYA 4Z89A 4RTXA 3PVQA 1GFCA 1UJYA 3EG0A 1RUWA 2F2VA 2H8HA 2CH4A 4CC3A 3JV3A 1PKTA 3I9QA 4RTYA 1W70A 4M4ZA 2BZ8A 2JS2A 1WLPB 5FWBA 2DLPA 1LCKA 1VA7A 2ESWA 4J9DA 2DM1A 2KRMA 1I1JA 2D8HA 3TVTA 3H0IA 4RTWA 2ABLA 4R0KA 1UECA 2JM8A 1CKBA 2F2WA 3M0SA 4D8DA 2HBWA 1BU1A 2LZ6B 5IHIA 1AOJA 1TUDA 2DL7A 1UHFA 4F16A 2LQNA 2CT3A 2DE0X 2RF0A 2JS0A 1ZUKA 1UDLA 1J3TA 3R6NA 2AZSA 2L3PA 2YT6A 4OMQA 3TSZA 1JO8A 1WI7A 1ZUYA 1Y57A 4HCKA 2FRYA 4CC2A 1MV3A 1BK2A 2AZVA 2RQWA 3M0TA 2DBKA 2JTEA 2AKLA 1SRMA 2JMCA 1K1ZA 3IQLA 2C0IA 1NYFA 1SHFA 2BZXA 4OMNA 1KJWA 1NYGA 2E5KA 1M3CA 4JZ4A 2DA9A 2A08A 2G6FX 2YUQA 2A36A 1M27C 2EBPA 4CC7A 4RTUA 3NMZC 1RLQC 1T0JA 1SRLA 3M0RA 1WIEA 1UFFA 2VKNA 1HJDA 2M0YA 4OMOA 4Z8AA 2DRKA 3NGPA 4IIMA 2FEIA 1M3BA 1S1NA 1WDXA 3CQTA 1FYNA 1AWOA 2KRSA 1A0NB 1GBRA 3RBBB 1AZGB 1K4US 2J7IA 2ENMA 1GFDA 3VRZA 2HSPA 1X6GA 1XOVA 1OOTA 2BZYA 3VS1A 4FSSA 2L3QA 2P4RA 1VYUA 2JW4A 2ED0A 3PE0A 1ARKA 3ULRB 1GCQC 2EW3A 4JJCA 1QCFA 3REAB 2FG0A 2OJ2A 1B07A 1WYXA 2KYMA 4ORZA 1WX6A 2O31A 2CUBA 2LJ0A 3EG2A 3QWYA 4Z88A 3SEMA 3EHQA 1CKAA 4AFUC 1I07A 3VS4A 1B3QA 4X1VA 4AG2C 3LH5A 1I0CA 3H0HA 4J9HA 2B86A 1MV0B 1JXOA 4J9CA 1SEMA 1ABOA 2GGRA 3SHWA 2L0AA 2DYBA 2GTJA 5I11A 1YNZA 2JT4A 3NHNA 1GL5A 2C0OA 2X3WD 2KBTA 3M0QA 3VS3A 2RN8A 1W6XA 3QWXX 4ZNXA 4LNPA 4HVUA 2VVKA 1NLOC 3VS5A 1WXUA 1K76A 4RTTA 2RQRA 5FW9A 5ECAA 1PRMC 1E7OA 2DF6A 1NM7A 2LQWA 1QWFA 3EGUA 1PKSA 3M0PA 3H41A 3A98A 1T3LA 1X2KA 4J9EA 3C0CA 1BB9A 1AD5A
chains in the Genus database with same CATH superfamily
2F1LA 4N4GA 3A5ZB 3CCVA 3ZBDA 1VYTA 1YN8A 3ZL7C 2D1XA 2HQXA 3ZEHA 4CC4B 3G6EQ 4OMFB 2YUPA 2KROA 1CSKA 4N4IA 1HXDA 1UGPB 2RPNA 5CQYA 2E4HA 3CD6A 2EWNA 2E6ZA 3OYKA 1GCPA 4F04B 1QP3A 4DBHA 2O4XA 3VKIA 1G3WA 2DJQA 1BBZA 3CCJA 3M4YA 3FJPA 2GCXA 3MJXA 1WFWA 3MO8A 1MHNA 4Y92A 3CCEQ 5I21A 2EYXA 2KT8A 4O6JA 4ELYC 4DEYA 3CCLT 1X43A 2HMAA 4J6XA 1ZX6A 2FVUA 3OYFA 2EJ9A 1VQ6A 1YJWQ 2JJ9A 4HCZA 1W1FA 5LJ3j 1YFNA 2RI5A 5IHKA 1WQWA 2HNIA 4PL6A 4QQGA 3PNWC 3VYGA 5LJ3g 4M78B 3CBMA 2OTLA 1VQ5T 4K11A 3MEWA 5IXBA 3PMTA 2CT4A 3H0FA 2SEMA 2ZAEA 1K8AU 2RH2A 5KE3A 4FYVB 2DL5A 1UE9A 3LW5E 3FDRA 3MCAB 3GIBA 1PNJA 1YITQ 4FYWB 2O2OA 4MDWA 3G4SQ 2PZ1A 3VS6A 2KEAA 4N0AA 3OQ5A 1W2BP 4E7JA 1VQ4T 4PKCC 4X34A 1NJIU 4OB1B 1E6HA 1I5LA 4C0GA 5FWCA 4LUDA 1TWBA 4IUUA 2FRWA 4M78A 5DLQE 1VQ8Q 1VQKQ 2RI2A 3OMCA 4AG1C 4E7ZA 1VQMT 4RTVA 3OYMA 4FW2A 4QQDA 3THKA 1G5VA 2AKKA 2RHXA 3QYHB 4FSXA 3VS2A 3I55Q 1PSEA 1AEYA 5FROA 3CPWA 2K2VA 4HVWA 5I22A 1P92A 5LL6S 2LNVA 2YXYA 1KG1A 2C06A 2VYTA 1HK9A 4XU3A 3OS1A 1D09B 3TSWA 2XICA 1GCQA 5LJ5d 2DL3A 4LDYA 4C0ZA 1QCOA 1MUZA 3EGXA 1OEBA 4JPBW 3TCJA 4P5NA 4LN2A 5LJ5e 3REBB 2E65A 3M55A 1BI3A 4N4HA 4C0DC 1H8KA 5GAOl 3CC2T 2LX7A 2CGHA 2XMFA 4NOYA 2GFAA 4M7AF 4FW1A 3E19A 3OYNA 2RQUA 1WNLA 4ZN3A 1ZSZA 3I56Q 1PCXA 2Y4YA 4PFPA 1WHLA 2W10A 1V1CA 2DPPB 3GNGA 1X01A 2P4TA 3UT1A 4LD9K 4ZN1A 3EFSA 2K3YA 4WF2A 3PVLA 1RI9A 1Q81C 3CPWP 2EYYA 2K7AA 2HDAA 1ZSGA 3NPFA 2XI9A 1E6GA 2EQIA 2F2XA 1UGRB 2JOYA 2CP7A 4M78D 5GAN3 1KIKA 4HVVA 1X2QA 2KXDA 4NL2A 1KC8U 4OVAA 1VQPT 1X6BA 3VJPA 2LTOA 1F1BB 1PSFA 2C0TA 2YRVA 2DTOA 4M75E 4Z89A 1OU8A 1XTDA 2JUFA 3NFCA 1Q82C 1M8VA 1TU0B 1GFCA 1H3ZA 3PMIA 5IAYA 4CC3A 3JV3A 1OZ2A 3CCVQ 3I9QA 1W70A 4M4ZA 1C6VX 2JS2A 1WLPB 2FHDA 1LCKA 3X25B 2QEXA 3UPUA 2DM1A 5CQXA 1I1JA 4PJOA 3JB9F 2MF2A 2RHIA 1I81A 2YRDA 5CKDA 1NZ9A 1UECA 4X9DA 2JM8A 3V7CA 3M0SA 3CD6Q 2E64A 1AOJA 4BDYA 3FB9A 1TUDA 3RMQA 5FRNA 4BI8B 2JTMA 1UHFA 4M75F 2LQNA 5CR2A 3OBYA 2RF0A 3CCJQ 3CC4T 2JS0A 1ZUKA 4BDZA 3INZA 1VQ7T 3H9NA 2R58A 2RHUA 4HA8A 1WI7A 4DBFA 1ZUYA 1Y57A 2OTJA 4F7UB 3EGDB 1BK2A 1VQ9T 2DBKA 3JCMc 4LDUA 2AKLA 2JMCA 1V29B 1VQ6Q 2LVMA 4KGVB 1U1SA 3JCMd 2H3EB 5LJ5h 1K73C 1Q95G 1KJWA 2E5KA 4XU0A 3CMET 1UGSB 2A08A 2G6FX 3EG9B 2A36A 2H3JA 2EBPA 2OTLQ 3JCMe 4QKUA 1YHQT 1M1KU 1SRLA 2KDSA 2DEQA 5KYXA 2M0YA 4OMOA 1QVFP 2LCCA 1S1NA 1KHCA 2F5TX 1GBRA 1MMGA 2X4WA 2EAYA 3RBBB 1QP2A 4J7FA 2RJFA 2J7IA 3E9GA 3OW2P 1WQ7A 3GP8A 4ELZC 3VS1A 1EX4A 3CCST 1Y07A 1VYUA 1QQJA 2ZPBB 2ED0A 3PE0A 3X28B 3ULRB 2EW3A 2DO3A 2FG0A 2OJ2A 2KYMA 1KHIA 4C0DB 3O8VA 4LDVA 3EG2A 4JJNK 5KYNA 3OS0A 1CKAA 4AFUC 5IT9E 3VS4A 4B6MA 1D3BB 5KCHA 4M75C 1AHJB 4X1VA 4AG2C 3LH5A 2NUPB 3NTKA 4J9HA 2D0QB 4PJOD 4J9CA 1ABOA 1RI0A 2JVVA 3A8OB 4ZGJB 1YJ9Q 2DYBA 3G7ZA 3NHNA 2X4JA 3RUXA 3M0QA 1OZ3A 1TH7A 1W6XA 4LDXA 3QWXX 4JDSA 3MP6A 2NLUA 2BIVA 3PGGA 1PG5B 3G6ET 2EQMA 2F69A 2HSEB 4RTTA 2RQRA 2E10A 4XAXB 3NTIA 3DB3A 5ECAA 2DF6A 1ZBXA 1W2BS 4FU6A 1PKSA 3M0PA 3H41A 3OYBA 1R0BG 2VASA 3A98A 2DXTA 4J9EA 5KYWB 2VUBA 2ZPGB 4VUBA 4ATOA 2LCSA 4N0AC 2KT1A 2HEQA 5LJ3d 2VV5A 2D8JA 3CCET 4OGCA 4M7DF 2LC4A 2R5MA 3O5ZA 2LNHB 1U3OA 5LJ3e 2QDYB 1JEGA 2EIFA 1YJWT 1IZ6A 2KAFA 5FRMA 3HFNA 1YWOA 2A7YA 4QT7A 2HKQB 4C92F 2IG0A 3VS0A 3JB9H 3FC3A 5KYUA 3JCMh 2D6FA 4PFZA 4PJOE 1YI2A 5KYWA 2LX9A 1AWJA 2GNCA 1H3HA 4RTZA 2QTXA 4FL6A 4MZTA 4C8QG 3JB9G 1JJ2A 3CPFA 4JRQA 1GBQA 2LMJA 2V8IA 1YITT 4LE9A 1BCMA 3G4ST 2MYSA 2GQIA 1YJNA 2K6DA 2RK1A 3KFVA 2V1QA 1ABQA 2QASA 2EKHA 2LCLA 3RDVA 3G71A 1M8MA 3CMAA 2PU9B 1VQ8T 2KMTA 2M51A 3JCMg 1VQKT 4M7AA 1UUEA 4XTVA 2K3BA 4IUTA 2DX1A 2QG9B 1KK7A 3URGA 2QEXQ 2K5FA 1KFZA 4MZPA 1UJ0A 1QVGA 5EG2A 3I55T 2G3RA 4F17A 1LNXA 3MP1A 1ZSZC 3SD4A 3OMGA 2EGAA 4FM4B 4WTOB 2DBMA 1HSQA 3A8MB 3GOXA 3EG3A 2FB7A 2LJ3A 1JBMA 4KULA 1UHCA 2VC8A 3VS7A 5DY9A 2OTJQ 2E41A 3OSSC 3PT9A 3CCQA 5L8RE 4EMKC 4EIKA 4BI3A 3OYAA 4L5GA 2CP5A 3WXMB 2O4XB 4PLLA 5EC7A 3L1AA 2OI3A 3QDFA 1YCSB 2CKKA 4M75B 1N5ZA 2DD4A 1JU5C 2JXBA 2PTKA 1OI1A 2X9HA 2QAZA 5IHNA 4JJBA 3QG1A 4L59A 1EFNA 4OMMA 3EHRA 1PRLC 4LUEA 3I56T 1BIAA 5GJVB 1KSWA 2R57A 4IUVA 2XKOC 1D0YA 5GAN7 1RAHB 1UGQB 1RAAB 1MNDA 1KQSA 2GBQA 5LJ3h 2RNAA 4AMCA 1PHTA 1H92A 2CZ1B 1OX9A 2KGTA 2KNBB 1VYVA 1TG0A 3OS2A 4M75A 3EFOA 4PJOC 2OX7A 2J06A 2LP5A 1HD3A 2PUKB 3TREA 2VGMA 5HCKA 4M7AD 1EZZB 1AT1B 2I0NA 3FEOA 1FMWA 1BYMA 3UATA 2Y4XA 5KH6A 2FZGB 2GTOA 2WSCE 1YIJA 4QVZA 3JCMQ 1AZEA 1TUCA 3F70A 4MZMA 2EYWA 2XDBA 3CCVT 1QVFS 3VYHB 3C95A 4AFQC 2DNUA 2HAXA 1M3AA 4M7DG 2MWOA 1AWWA 4BE1A 5GANd 2FPDA 3OW2S 4MDXA 5I2MA 3HP9A 2MIOA 3S3NA 1S72A 1AWXA 2KR3A 5GAMf 3QIIA 2YUOA 5GANe 3LX7A 4M77G 1WZOA 3CD6T 3UDCA 4C92G 2DERA 3OYGA 5CK9A 2DK3A 3EG0A 3CCJT 2F2VA 2CH4A 1FXXA 3EGXB 2QQAA 1PKTA 1G3YA 4A4HA 4RTYA 2BZ8A 4HT9A 2DXUA 2L3RA 2MAMA 4II1A 2HQHA 1VA7A 2HL3A 1WHGA 3KUFA 4PJNA 2KRMA 3QJYA 4LD6A 1VQ6T 3EAEA 2D8HA 2ZPEB 3H0IA 3L2ZA 1YJ9A 4M7AE 3SDZA 1RADB 1VQOA 1N6AA 1OYXA 2L89A 5KYYA 2VXFA 2OTLT 2P84A 1ZSZB 3S3OA 4F16A 1VQNA 4M75D 2DE0X 1BI0A 1YI2Q 1Q81R 2EJGA 2AIRB 4FT4A 1D0ZA 4HCKA 4PFOA 5GMKj 5I2SA 3GLXA 4Y28E 1EIFA 2C0IA 4ZGEB 2RO0A 1SHFA 4IUPA 2DEUA 4XTYA 1YJNQ 4EMKB 4XQ3A 4JLIA 4BY6C 1N9SA 4GY5A 2XD0A 4JZ4A 2BKDN 3G71Q 4RTUA 3CMAQ 1NBEB 3NMZC 1T0JA 2XDPA 1WIEA 1Q82R 2CP6A 2DRKA 4M7DA 1M3BA 2DXBA 3QJ6A 5AYFA 2COWA 1M90C 1FYNA 5HY6A 1A0NB 2QQSA 1AZGB 1K4US 4DOWA 2ENMA 3HL8A 4PK4A 5KCOA 3PIPA 1WPYA 1X6GA 2BZYA 1K9MC 3OB9A 2L8DA 2EKOA 2DVEA 1PD1A 4EMKA 2BE9B 1ARKA 4C8QE 4PJMA 1B07A 1WYXA 4PJOB 5J3BA 3QO3A 3H6ZA 3SEMA 3MP8A 2LQ8A 5KE2A 3CCQQ 3OYLA 2DTIA 1ZA2B 3J80E 2HKNA 4C5EA 1M2VA 4PJLA 3L2WA 3BDUA 2B86A 5GANh 1SEMA 2GGRA 3SHWA 2EQJA 1IGUA 2XU8A 3CXCS 1Q86C 5I11A 3META 3N5BB 2VXEA 2C0OA 4KT0E 2KBTA 3D7SB 1K73R 4LDWA 2NYSA 4FIBA 2RN8A 3CCUA 4C8QF 2M9UA 2VVKA 1NLOC 3VS5A 4M7AC 2DJZA 1BI1A 3LGFA 5GANj 5FW9A 1NM7A 5GANg 3EGUA 4A53A 5KYXB 2RD1A 3NTHA 1XJWB 4JRIA 1D1BA 3CCMA 3UWNA 5FU6C 1AD5A 1NEGA 2FO0A 1WXTA 3A1PA 3KBGA 1RAEB 1VQ4Q 1NPPA 1X27A 2CZ0B 2O9VA 1TOVA 3C12A 4WCIA 1Y7XA 2SRCA 5GAN2 1OQKA 4OMPA 2CDTA 4L6V5 1C0MA 2JTFA 1TUGB 1B34A 2AK5A 2CZ6B 2FYKA 2QA4A 4XTZA 3LH0A 2X35A 2EPDA 3RIRA 1YIJQ 4NS5A 5D6WA 1K0SA 4E7KA 5GAMd 3LYIA 4B9WA 2FZCB 4TVRA 2YHTA 3HHTB 4JRPA 4C5GA 5GAMe 4XTWA 3I5SA 2YRCA 2QEXT 1X75C 3HKSA 3ME9A 5GMKi 1S72Q 1G3TA 1K8AC 1WHJA 2LT4A 3QUIA 4FCYA 4C8QC 2A37A 1PC0A 4BY6B 5J26A 5GAOn 1WJQA 2RI3A 2EGEA 1NJIC 4JLGA 3JCMV 3ZFJA 3L2QA 1RAGB 1ZUUA 5CKFA 1IGQA 4E6RA 2OTJT 3AT1B 5FLXE 1VQLA 2GF7A 2ROLA 1XNIA 3JCMb 4M78F 1TSFA 3CBPA 1I5OB 2DTHA 2JM9A 3BFMA 3M0UA 3I35A 4J9FA 2QI2A 4KGZB 1VQOQ 2DKGA 2O9SA 1K0XA 4M7DE 2ZZDA 4RUGA 3RKWA 1GXIE 3RR6A 2KK4A 2DZCA 2KI7A 1VQNQ 2A28A 3SB2A 2KYBA 4R56A 3U23A 4FYYB 1N9RA 1M1FA 2D0NA 1X69A 4M77E 1IXDA 2DIQA 2LJ1A 4C92E 1N27A 1YP5A 1TTHB 3S3MA 5D6XA 4D8KA 6AT1B 1BIBA 2QK0A 3JSCA 3OYJA 2QXFA 5KYUB 2LRQA 3M57A 3OY9A 3E9FA 2GQVA 3FJ5A 2J6FA 1G8XA 3OYEA 5A2QE 1ACMB 4A4KA 4A54A 1UG1A 3RESA 4GBQA 3DLMA 1Z9QA 1Z9ZA 4OMLA 2ED1A 2K4YA 3EH1A 1G3SA 2YSQA 4M77F 4HCBA 5GJWB 2J6OA 1VUBA 3CCRA 1JQQA 4RMOA 3JCMW 1WXBA 5CCAA 4M7AB 2ROTA 2WSFE 4OF1A 1G83A 3JCMP 1M2OA 1WHKA 2LQKA 5A0DA 4RCBA 3V8LA 4OB0B 4X9CA 4J6WA 3OA6A 5FU6B 1NEBA 5GAMh 1SPKA 4DBRA 2X3XD 4PNOA 1KC8C 3CC4Q 3X26B 2K57A 2CREA 2QQBA 1SHGA 1I8FA 2V1RA 3M53A 3M4GA 3HFOA 4PJJA 4EMGA 2CZ7B 2R5AA 4C5IA 4AFSC 3TQ7P 1PD0A 2CSQA 4J9BA 3RMSA 3UA6A 2YUNA 1LOJA 3CC7A 3CMEQ 1OPLA 5GAMj 3CCUQ 1RAIB 4LXCA 3VU3C 5LJ5f 2FPFA 4J6YA 5GAMg 1Y0MA 1K9AA 2L5QA 3CPWS 3DB4A 4BB7A 4HT8A 1FMKA 2DRMA 1GRIA 3R6OA 2QQRA 4M7DC 2COYA 5D7UA 4RTXA 1Q81U 3PVQA 5GAN6 3CCMQ 1RUWA 2JNGA 4M77C 3QYGB 1YI2T 4C8QB 3CCSQ 4BE0A 3PIOA 4C92C 5GMKe 2DAQA 1M1GA 3JAME 4JS4A 1JJ2P 2ESWA 4J9DA 4QVDA 3OBWA 4IKFA 3EFOB 1BKBA 1LJOA 1YJNT 4BD3A 4RTWA 1QVPA 3CCLA 2QGGA 4R0KA 4A4EA 5GAOr 1LVKA 1R0CB 1CKBA 2F2WA 2QA4Q 4D8DA 1Q82U 1BU1A 2LZ6B 3G71T 5IHIA 5GAN5 3CMAT 2DL7A 2LT1A 3HRTA 4MMLA 2CT3A 1M1KC 3QSUA 1VQ5A 1UDLA 1J3TA 3R6NA 4C8QA 2AZSA 2L3PA 2YT6A 2E70A 3M58A 3TSZA 1XQHA 4M78G 4OP0A 3VUZA 4IUQA 1TS9A 2FRYA 3QDRB 1MV3A 2AZVA 2RQWA 2HBPA 1QVGP 2JTEA 1NYFA 3BDLA 2NUTA 2BZXA 3A8LB 1Q7YR 3PFSA 5IN1A 3BY7A 2DA9A 4F7UF 3SWNA 3QPHA 1BI2A 4CC7A 1W2BA 3MEVA 3V7SA 1VQ4A 2RJDA 1KD1R 5AT1B 3V7RA 2QTVA 2HL5C 2BUDA 8ATCB 4Z8AA 1TXQA 1VQLQ 2P0KA 4Q5WA 1C1AA 3CCQT 1WDXA 2EJFA 1AWOA 3HTRA 3X20B 1VQMA 1GFDA 3VRZA 2HSPA 3L42A 5C6SA 1OOTA 3PTAA 3L2UA 1K73U 4FSSA 2E3IA 2P4RA 1RAFB 4FYXB 1I4K1 3A8GB 4OGEA 1RABB 1D1AA 2X4XA 4ORZA 2LJ0A 1JRIA 1Q7YC 3EHQA 1VOMA 1I07A 1B3QA 1KQSP 5KYYB 3JCMf 4E7HA 1KD1C 1I0CA 1RL2A 1SKUB 5A0LA 2E5QA 3DKMA 5C0MA 1KQ2A 1YNZA 2VGNA 1GL5A 2X3WD 3CC2A 3VS3A 4ANJA 1IHWA 3OYCA 2PVOB 4D6WA 5GMKh 1NE8A 4LNPA 2ZCFB 4GLKA 4C8QD 3JB9D 4EMHA 3EH2A 3LWIA 1WXUA 1MGQA 1K76A 3CCRQ 2A3LA 2JN0A 1M90R 1YIJT 2AT1B 2LQWA 1QWFA 3OYIA 4M7DB 3GF5A 4DOVA 1T3LA 3ER0A 1X2KA 1K9MR 1BB9A 3M54A 2QYZA 3V8KA 2M1HA 4M77B 2LDMA 5DM7R 3LGLA 2MWPA 1S72T 4C92B 3G1JA 2MCNA 5J39A 2E1HA 1VQPA 2KE9A 1YWPA 4A63B 2EQKA 1N8RR 2PVGB 3M5AA 4IIOA 4PLIA 3M59A 1BCOA 2F5KA 3V8JA 1WJSA 2RQTA 4PJOG 2K79A 2CH4W 1R8OB 2DYIA 4ESRA 2KRNA 1IREB 2EYZA 2XIDA 1QWEA 4ME7A 1ZBJA 3CC7Q 2WSEE 2DIGA 2JMAA 1PWTA 1Q86R 1OV3A 1G2BA 1M2VB 4KGXB 3JCMX 3WVDB 3DLLA 1RLPC 4JRKA 3HRUA 2RQVA 2QQ9A 1D1CA 4M77A 4OB2B 1U06A 3GPLA 2ZPHB 1YJ9T 2MI6A 4J5YA 4C92A 1IRXA 2L2PA 3OSVA 3TU4K 1VQOT 4F14A 1OULA 2DL8A 2MMPA 1SSHA 2DILA 5GAOm 4Y91A 2EFIA 1VQNT 2L3SA 1AVZC 1OPKA 4O5VA 1O75A 4QQ6A 4J9GA 4RKUE 1N8RC 3GBQA 5LJ3f 3J7AF 1JXMA 3UA7A 2KQWA 2V8KA 5HK0A 1UEBA 2PQWA 3VUBA 1ZLMA 3CC4A 3WVEB 3UF4A 5CKHA 2FZKB 1VQ7A 3FLGA 2M0OA 4E2FB 1NLPC 3X24B 2K2MA 1IO6A 1ZQ1A 4HXJA 5IXFA 4XK8E 1VQ9A 2DL4A 4BE2A 3CCLQ 9ATCB 2K9GA 4E7SA 4JUVA 2M02A 2DETA 1FX7A 2DD5A 4F7UG 2RB6A 2O88A 2EQUA 3QHSA 1WGSA 2X4YA 1WJRA 3JB9I 2EVRA 2IIMA 3CMEA 4KRTA 3HRSA 2RHZA 1VQ5Q 1YHQA 3QZ9B 2DMOA 2V26A 1U1TA 1QLYA 4DA4A 5FU7C 1YCYA 1B34B 2ATCB 2ECZA 3CBOA 5CAIA 1QVFA 1M9SA 2EYQA 3MKDA 3HPWA 1M30A 1ZA1B 3BW1A 2HZYA 4JJDA 1NG2A 2DVJA 5GMKl 2CUDA 1FMVA 5A0GA 4JZ3A 3OW2A 2ZPFB 3RNJA 7AT1B 2RJCA 1WA7A 2FPEA 1K8AR 1WHHA 2A0FB 4BACA 3OYHA 2CP0A 4DEXA 5M9OA 3CCSA 4V2SA 2PNIA 2BTTA 3L2RA 1JJ2S 4M7DD 5D6YA 3T9NA 3FRNA 3Q1JA 5GMKm 2RJEA 2HQEA 5IH2A 2KSSA 1NJIR 1QW1A 2E6NA 3OS5A 3JCMJ 1VQMQ 4RCCA 4A4GA 2YLBA 3CEYA 4M77D 2PVDB 5L23A 4KH0B 1UGVA 4C92D 2J6KA 2WACA 3C94A 4NL3A 2V8JA 4EDUA 2E3HA 1T0HA 4M78E 3EG1A 1U5SA 2DZ9A 4XU1A 2CYZB 1U8RA 2AHJB 4CI0C 5HK3A 4BI4A 4XTUA 3CCUT 1T3SA 4J83A 3P8HA 2IPOB 2RM4A 4KUIA 2OAWA 4OB3B 3QKJA 3QZ5B 2VWFA 4XU2A 3E2UA 1HYOA 3RKXA 2XG8D 4AFZC 2NUZA 2W0ZA 5GAN8 1QVGS 2MOXA 1LPLA 5CO7A 1UTIA 1Y96B 2YDLA 3G6EA 2XDDA 3JRZA 3ASKA 2GFUA 4J8OA 4YTLA 2RMOA 2XHCA 2EGCA 4F7UA 3EGDA 2J05A 4J9IA 5LJ5j 2ZPIB 3CCMT 1Y71A 3P8DA 3QXEB 5LJ5g 2YWWA 2P0PA 1MMAA 1QKXA 4GLMA 3VV0A 4QVCA 1QKWA 2NWMA 3CC2Q 3SWNC 1OU9A 3EG9A 4JS5A 5CVIA 3SFMA 1YBYA 1SSFA 1W4SA 2PUOB 3CCEA 2KXCA 3RKYA 1QCNA 2QDLA 2CSIA 5CKBA 3I5RA 1JB0E 2HCKA 2QA4T 3VRYA 1Y96A 1YJWA 5GAOp 2HD0A 2ZGWA 4HCCA 1V76A 3EFRA 1UJYA 2O01E 3HSBA 2H8HA 1IB8A 1R77A 1QMCA 4UC4A 3OYDA 3S6WA 1KQSS 5FWBA 4M7AG 3QBYA 1M4ZA 2DLPA 3OYYA 3M56A 1Q7YU 2RK2A 1VQPQ 4DQ2A 3RERA 4HKEA 1OX8A 3TVTA 2XK0A 1PM3A 2ABLA 2RHYA 4R55A 1KC8R 3C4SA 4IURA 4E7IA 1KD1U 3M9QA 4B9XA 1YITA 2HBWA 3G4SA 1D3BA 4KH1B 2E12A 2NUPA 4A4FA 2Z0WA 3CXCA 5GANf 1VQLT 4AT1B 5HKCA 1VQ8A 1VQKA 4RG2A 4OMQA 2FL7A 2VB6A 1JO8A 4ZTFA 1H641 3E1SA 2BE7D 4CC2A 4MMKA 2CP2A 3M0TA 1ZHIA 1SRMA 5FU7B 1K1ZA 3IQLA 1VIEA 4M78C 3I55A 4OMNA 1NYGA 1M3CA 2YUQA 1M27C 1B7TA 2I2LA 3H8ZA 1RLQC 2K3XA 3M0RA 1UFFA 2K5IA 2VKNA 1HJDA 2M16A 4J7IA 3BE3A 3NGPA 4IIMA 1MMNA 1SG5A 2FEIA 1VQ7Q 3CQTA 3L2VA 2KRSA 3LLRA 2KVQG 4C5HA 1RACB 1UB4A 1NPRA 1VQ9Q 1O9SA 1M5Q1 1XOVA 4C0FA 2L3QA 4XTXA 1SF9A 2JZ2A 3MEAA 2JW4A 2CS7A 5GAOq 3GNFB 2X51A 3TEEA 1VIFA 1GCQC 3MPUB 2K5LA 4JJCA 3KXTA 1QCFA 3REAB 3JB9J 5GAN4 1WX6A 2DFUA 2CUBA 2O31A 4M75G 1YHQQ 2DXCA 2P0QA 3QWYA 3CXCP 1IHVA 4Z88A 4KUDK 1M90U 4DBQA 4FT2A 3I56A 1M1KR 5DLOA 2MPXC 3A8HB 3MEUA 3CCRT 2Y90A 4KBMB 4E47A 4PJOF 2OAUA 3H0HA 1K9MU 1MV0B 1X6OA 1JXOA 2CP3A 4Z02A 2L0AA 2D9TA 3AHUA 2GTJA 3MHXA 2JT4A 5CIUA 2QGFB 4CRIA 1MNEA 4ZGDB 2B8AA 4QW2A 1MMDA 1N8RU 2YLCA 4ZNXA 2MK5A 2NUTB 4F7UE 4HVUA 3FIFA 3SWNB 5CKEA 4RG8A 2IVWA 1PRMC 1E7OA 4E7LA 4ZTJA 1WHMA 8AT1B 3P8BB 1DJ7B 4BUGA 3J81E 3LWHA 1Q86U 2RA2A 4EPCA 3CC7T 3C0CA 1KQ1A 1FWZA 1D0XA 2COZA 2KY9A
chains in the Genus database with same CATH topology
1NEGA 2FO0A 1WXTA 2LCSA 2KT1A 2HEQA 2D8JA 1VYTA 1X27A 1YN8A 2O9VA 3ZL7C 2D1XA 3O5ZA 2MCNA 2LNHB 4WCIA 4CC4B 1U3OA 2KE9A 1YWPA 1JEGA 2YUPA 2KROA 4A63B 2SRCA 1CSKA 4IIOA 4OMPA 2CDTA 1YWOA 2AK5A 2RQTA 4QT7A 2K79A 2CH4W 2RPNA 4ESRA 2EPDA 1K0SA 2KRNA 2EYZA 3VS0A 1GCPA 1QWEA 1ZBJA 2DJQA 1BBZA 2JMAA 1PWTA 1WFWA 1OV3A 1G2BA 3I5SA 1AWJA 2GNCA 1H3HA 4RTZA 1RLPC 4Y92A 2RQVA 2EYXA 2KT8A 1U06A 1GBQA 4DEYA 1X43A 1ZX6A 2LMJA 2L2PA 4LE9A 4F14A 1W1FA 2DL8A 2GQIA 5IHKA 1SSHA 2DILA 2K6DA 3KFVA 2A37A 2L3SA 1ABQA 2V1QA 2EKHA 1AVZC 1OPKA 1M8MA 2EGEA 4J9GA 3GBQA 2M51A 4K11A 1JXMA 1UUEA 3UA7A 5IXBA 2K3BA 2CT4A 1ZUUA 3H0FA 1ZLMA 2DX1A 2SEMA 4E6RA 3UF4A 2ROLA 1KFZA 1NLPC 2JM9A 2K2MA 3M0UA 2DL5A 1IO6A 3I35A 4J9FA 1UE9A 1UJ0A 4HXJA 5IXFA 2DL4A 4F17A 2K9GA 1PNJA 1K0XA 2O9SA 2O2OA 2O88A 2PZ1A 4RUGA 3VS6A 2EGAA 2KEAA 2DBMA 1E6HA 2EVRA 2IIMA 1HSQA 2A28A 5FWCA 2KYBA 4KRTA 4LUDA 3U23A 2FRWA 3EG3A 2D0NA 1X69A 2DMOA 2LJ1A 2LJ3A 4AG1C 1UHCA 1QLYA 1YP5A 3VS7A 2ECZA 4RTVA 3THKA 4D8KA 1M30A 4EIKA 4JJDA 1NG2A 2DVJA 2CUDA 2AKKA 5EC7A 4JZ3A 2OI3A 3VS2A 1YCSB 3RNJA 1AEYA 1N5ZA 1JU5C 1WA7A 2FPEA 3FJ5A 2J6FA 4HVWA 5I22A 2JXBA 2PTKA 4DEXA 5IHNA 4JJBA 1UG1A 1EFNA 2PNIA 2BTTA 4OMMA 3EHRA 4GBQA 1Z9QA 1PRLC 4LUEA 1Z9ZA 4OMLA 5IH2A 3TSWA 2ED1A 5GJVB 1KSWA 1GCQA 2DL3A 1MUZA 2YSQA 1OEBA 5GJWB 4JPBW 2GBQA 2J6OA 5L23A 1JQQA 2RNAA 4LN2A 1PHTA 1UGVA 1H92A 1WXBA 3REBB 2ROTA 2J6KA 1G83A 2KGTA 1T0HA 2KNBB 3EG1A 1VYVA 1U5SA 1TG0A 1H8KA 2LX7A 2J06A 2XMFA 2LP5A 1HD3A 1T3SA 5HCKA 2OAWA 2RQUA 1NEBA 2VWFA 1SPKA 4AFZC 2NUZA 2W0ZA 2I0NA 2X3XD 2MOXA 3UATA 2CREA 1UTIA 1SHGA 2W10A 2YDLA 1V1CA 2V1RA 2RMOA 2EGCA 2GTOA 1RI9A 3PVLA 2J05A 4J9IA 2EYYA 1TUCA 4AFSC 2K7AA 1AZEA 2CSQA 2EYWA 2HDAA 4J9BA 1ZSGA 1QKXA 3NPFA 4GLMA 3UA6A 1QKWA 2NWMA 2YUNA 1E6GA 2EQIA 2DNUA 4AFQC 2F2XA 1OPLA 1KIKA 1M3AA 4HVVA 2FPFA 1X2QA 2KXDA 1AWWA 1Y0MA 1K9AA 2FPDA 1X6BA 2KXCA 2MIOA 1AWXA 2KR3A 1FMKA 2C0TA 2DRMA 1GRIA 2YUOA 2QDLA 2CSIA 3I5RA 2HCKA 3VRYA 4Z89A 4RTXA 3PVQA 1GFCA 1UJYA 3EG0A 1RUWA 2F2VA 2H8HA 2CH4A 4CC3A 3JV3A 1PKTA 3I9QA 4RTYA 1W70A 4M4ZA 2BZ8A 2JS2A 1WLPB 5FWBA 2DLPA 1LCKA 1VA7A 2ESWA 4J9DA 2DM1A 2KRMA 1I1JA 2D8HA 3TVTA 3H0IA 4RTWA 2ABLA 4R0KA 1UECA 2JM8A 1CKBA 2F2WA 3M0SA 4D8DA 2HBWA 1BU1A 2LZ6B 5IHIA 1AOJA 1TUDA 2DL7A 1UHFA 4F16A 2LQNA 2CT3A 2DE0X 2RF0A 2JS0A 1ZUKA 1UDLA 1J3TA 3R6NA 2AZSA 2L3PA 2YT6A 4OMQA 3TSZA 1JO8A 1WI7A 1ZUYA 1Y57A 4HCKA 2FRYA 4CC2A 1MV3A 1BK2A 2AZVA 2RQWA 3M0TA 2DBKA 2JTEA 2AKLA 1SRMA 2JMCA 1K1ZA 3IQLA 2C0IA 1NYFA 1SHFA 2BZXA 4OMNA 1KJWA 1NYGA 2E5KA 1M3CA 4JZ4A 2DA9A 2A08A 2G6FX 2YUQA 2A36A 1M27C 2EBPA 4CC7A 4RTUA 3NMZC 1RLQC 1T0JA 1SRLA 3M0RA 1WIEA 1UFFA 2VKNA 1HJDA 2M0YA 4OMOA 4Z8AA 2DRKA 3NGPA 4IIMA 2FEIA 1M3BA 1S1NA 1WDXA 3CQTA 1FYNA 1AWOA 2KRSA 1A0NB 1GBRA 3RBBB 1AZGB 1K4US 2J7IA 2ENMA 1GFDA 3VRZA 2HSPA 1X6GA 1XOVA 1OOTA 2BZYA 3VS1A 4FSSA 2L3QA 2P4RA 1VYUA 2JW4A 2ED0A 3PE0A 1ARKA 3ULRB 1GCQC 2EW3A 4JJCA 1QCFA 3REAB 2FG0A 2OJ2A 1B07A 1WYXA 2KYMA 4ORZA 1WX6A 2O31A 2CUBA 2LJ0A 3EG2A 3QWYA 4Z88A 3SEMA 3EHQA 1CKAA 4AFUC 1I07A 3VS4A 1B3QA 4X1VA 4AG2C 3LH5A 1I0CA 3H0HA 4J9HA 2B86A 1MV0B 1JXOA 4J9CA 1SEMA 1ABOA 2GGRA 3SHWA 2L0AA 2DYBA 2GTJA 5I11A 1YNZA 2JT4A 3NHNA 1GL5A 2C0OA 2X3WD 2KBTA 3M0QA 3VS3A 2RN8A 1W6XA 3QWXX 4ZNXA 4LNPA 4HVUA 2VVKA 1NLOC 3VS5A 1WXUA 1K76A 4RTTA 2RQRA 5FW9A 5ECAA 1PRMC 1E7OA 2DF6A 1NM7A 2LQWA 1QWFA 3EGUA 1PKSA 3M0PA 3H41A 3A98A 1T3LA 1X2KA 4J9EA 3C0CA 1BB9A 1AD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEG A;  2FO0 A;  1WXT A;  2LCS A;  2KT1 A;  2HEQ A;  2D8J A;  1VYT A;  1X27 A;  1YN8 A;  2O9V A;  3ZL7 C;  2D1X A;  3O5Z A;  2MCN A;  2LNH B;  4WCI A;  4CC4 B;  1U3O A;  2KE9 A;  1YWP A;  1JEG A;  2YUP A;  2KRO A;  4A63 B;  2SRC A;  1CSK A;  4IIO A;  4OMP A;  2CDT A;  1YWO A;  2AK5 A;  2RQT A;  4QT7 A;  2K79 A;  2CH4 W;  2RPN A;  4ESR A;  2EPD A;  1K0S A;  2KRN A;  2EYZ A;  3VS0 A;  1GCP A;  1QWE A;  1ZBJ A;  2DJQ A;  1BBZ A;  2JMA A;  1PWT A;  1WFW A;  1OV3 A;  1G2B A;  3I5S A;  1AWJ A;  2GNC A;  1H3H A;  4RTZ A;  1RLP C;  4Y92 A;  2RQV A;  2EYX A;  2KT8 A;  1U06 A;  1GBQ A;  4DEY A;  1X43 A;  1ZX6 A;  2LMJ A;  2L2P A;  4LE9 A;  4F14 A;  1W1F A;  2DL8 A;  2GQI A;  5IHK A;  1SSH A;  2DIL A;  2K6D A;  3KFV A;  2A37 A;  2L3S A;  1ABQ A;  2V1Q A;  2EKH A;  1AVZ C;  1OPK A;  1M8M A;  2EGE A;  4J9G A;  3GBQ A;  2M51 A;  4K11 A;  1JXM A;  1UUE A;  3UA7 A;  5IXB A;  2K3B A;  2CT4 A;  1ZUU A;  3H0F A;  1ZLM A;  2DX1 A;  2SEM A;  4E6R A;  3UF4 A;  2ROL A;  1KFZ A;  1NLP C;  2JM9 A;  2K2M A;  3M0U A;  2DL5 A;  1IO6 A;  3I35 A;  4J9F A;  1UE9 A;  1UJ0 A;  4HXJ A;  5IXF A;  2DL4 A;  4F17 A;  2K9G A;  1PNJ A;  1K0X A;  2O9S A;  2O2O A;  2O88 A;  2PZ1 A;  4RUG A;  3VS6 A;  2EGA A;  2KEA A;  2DBM A;  1E6H A;  2EVR A;  2IIM A;  1HSQ A;  2A28 A;  5FWC A;  2KYB A;  4KRT A;  4LUD A;  3U23 A;  2FRW A;  3EG3 A;  2D0N A;  1X69 A;  2DMO A;  2LJ1 A;  2LJ3 A;  4AG1 C;  1UHC A;  1QLY A;  1YP5 A;  3VS7 A;  2ECZ A;  4RTV A;  3THK A;  4D8K A;  1M30 A;  4EIK A;  4JJD A;  1NG2 A;  2DVJ A;  2CUD A;  2AKK A;  5EC7 A;  4JZ3 A;  2OI3 A;  3VS2 A;  1YCS B;  3RNJ A;  1AEY A;  1N5Z A;  1JU5 C;  1WA7 A;  2FPE A;  3FJ5 A;  2J6F A;  4HVW A;  5I22 A;  2JXB A;  2PTK A;  4DEX A;  5IHN A;  4JJB A;  1UG1 A;  1EFN A;  2PNI A;  2BTT A;  4OMM A;  3EHR A;  4GBQ A;  1Z9Q A;  1PRL C;  4LUE A;  1Z9Z A;  4OML A;  5IH2 A;  3TSW A;  2ED1 A;  5GJV B;  1KSW A;  1GCQ A;  2DL3 A;  1MUZ A;  2YSQ A;  1OEB A;  5GJW B;  4JPB W;  2GBQ A;  2J6O A;  5L23 A;  1JQQ A;  2RNA A;  4LN2 A;  1PHT A;  1UGV A;  1H92 A;  1WXB A;  3REB B;  2ROT A;  2J6K A;  1G83 A;  2KGT A;  1T0H A;  2KNB B;  3EG1 A;  1VYV A;  1U5S A;  1TG0 A;  1H8K A;  2LX7 A;  2J06 A;  2XMF A;  2LP5 A;  1HD3 A;  1T3S A;  5HCK A;  2OAW A;  2RQU A;  1NEB A;  2VWF A;  1SPK A;  4AFZ C;  2NUZ A;  2W0Z A;  2I0N A;  2X3X D;  2MOX A;  3UAT A;  2CRE A;  1UTI A;  1SHG A;  2W10 A;  2YDL A;  1V1C A;  2V1R A;  2RMO A;  2EGC A;  2GTO A;  1RI9 A;  3PVL A;  2J05 A;  4J9I A;  2EYY A;  1TUC A;  4AFS C;  2K7A A;  1AZE A;  2CSQ A;  2EYW A;  2HDA A;  4J9B A;  1ZSG A;  1QKX A;  3NPF A;  4GLM A;  3UA6 A;  1QKW A;  2NWM A;  2YUN A;  1E6G A;  2EQI A;  2DNU A;  4AFQ C;  2F2X A;  1OPL A;  1KIK A;  1M3A A;  4HVV A;  2FPF A;  1X2Q A;  2KXD A;  1AWW A;  1Y0M A;  1K9A A;  2FPD A;  1X6B A;  2KXC A;  2MIO A;  1AWX A;  2KR3 A;  1FMK A;  2C0T A;  2DRM A;  1GRI A;  2YUO A;  2QDL A;  2CSI A;  3I5R A;  2HCK A;  3VRY A;  4Z89 A;  4RTX A;  3PVQ A;  1GFC A;  1UJY A;  3EG0 A;  1RUW A;  2F2V A;  2H8H A;  2CH4 A;  4CC3 A;  3JV3 A;  1PKT A;  3I9Q A;  4RTY A;  1W70 A;  4M4Z A;  2BZ8 A;  2JS2 A;  1WLP B;  5FWB A;  2DLP A;  1LCK A;  1VA7 A;  2ESW A;  4J9D A;  2DM1 A;  2KRM A;  1I1J A;  2D8H A;  3TVT A;  3H0I A;  4RTW A;  2ABL A;  4R0K A;  1UEC A;  2JM8 A;  1CKB A;  2F2W A;  3M0S A;  4D8D A;  2HBW A;  1BU1 A;  2LZ6 B;  5IHI A;  1AOJ A;  1TUD A;  2DL7 A;  1UHF A;  4F16 A;  2LQN A;  2CT3 A;  2DE0 X;  2RF0 A;  2JS0 A;  1ZUK A;  1UDL A;  1J3T A;  3R6N A;  2AZS A;  2L3P A;  2YT6 A;  4OMQ A;  3TSZ A;  1JO8 A;  1WI7 A;  1ZUY A;  1Y57 A;  4HCK A;  2FRY A;  4CC2 A;  1MV3 A;  1BK2 A;  2AZV A;  2RQW A;  3M0T A;  2DBK A;  2JTE A;  2AKL A;  1SRM A;  2JMC A;  1K1Z A;  3IQL A;  2C0I A;  1NYF A;  1SHF A;  2BZX A;  4OMN A;  1KJW A;  1NYG A;  2E5K A;  1M3C A;  4JZ4 A;  2DA9 A;  2A08 A;  2G6F X;  2YUQ A;  2A36 A;  1M27 C;  2EBP A;  4CC7 A;  4RTU A;  3NMZ C;  1RLQ C;  1T0J A;  1SRL A;  3M0R A;  1WIE A;  1UFF A;  2VKN A;  1HJD A;  2M0Y A;  4OMO A;  4Z8A A;  2DRK A;  3NGP A;  4IIM A;  2FEI A;  1M3B A;  1S1N A;  1WDX A;  3CQT A;  1FYN A;  1AWO A;  2KRS A;  1A0N B;  1GBR A;  3RBB B;  1AZG B;  1K4U S;  2J7I A;  2ENM A;  1GFD A;  3VRZ A;  2HSP A;  1X6G A;  1XOV A;  1OOT A;  2BZY A;  3VS1 A;  4FSS A;  2L3Q A;  2P4R A;  1VYU A;  2JW4 A;  2ED0 A;  3PE0 A;  1ARK A;  3ULR B;  1GCQ C;  2EW3 A;  4JJC A;  1QCF A;  3REA B;  2FG0 A;  2OJ2 A;  1B07 A;  1WYX A;  2KYM A;  4ORZ A;  1WX6 A;  2O31 A;  2CUB A;  2LJ0 A;  3EG2 A;  3QWY A;  4Z88 A;  3SEM A;  3EHQ A;  1CKA A;  4AFU C;  1I07 A;  3VS4 A;  1B3Q A;  4X1V A;  4AG2 C;  3LH5 A;  1I0C A;  3H0H A;  4J9H A;  2B86 A;  1MV0 B;  1JXO A;  4J9C A;  1SEM A;  1ABO A;  2GGR A;  3SHW A;  2L0A A;  2DYB A;  2GTJ A;  5I11 A;  1YNZ A;  2JT4 A;  3NHN A;  1GL5 A;  2C0O A;  2X3W D;  2KBT A;  3M0Q A;  3VS3 A;  2RN8 A;  1W6X A;  3QWX X;  4ZNX A;  4LNP A;  4HVU A;  2VVK A;  1NLO C;  3VS5 A;  1WXU A;  1K76 A;  4RTT A;  2RQR A;  5FW9 A;  5ECA A;  1PRM C;  1E7O A;  2DF6 A;  1NM7 A;  2LQW A;  1QWF A;  3EGU A;  1PKS A;  3M0P A;  3H41 A;  3A98 A;  1T3L A;  1X2K A;  4J9E A;  3C0C A;  1BB9 A;  1AD5 A; 
#chains in the Genus database with same CATH topology
 2F1L A;  4N4G A;  3A5Z B;  3CCV A;  3ZBD A;  1VYT A;  1YN8 A;  3ZL7 C;  2D1X A;  2HQX A;  3ZEH A;  4CC4 B;  3G6E Q;  4OMF B;  2YUP A;  2KRO A;  1CSK A;  4N4I A;  1HXD A;  1UGP B;  2RPN A;  5CQY A;  2E4H A;  3CD6 A;  2EWN A;  2E6Z A;  3OYK A;  1GCP A;  4F04 B;  1QP3 A;  4DBH A;  2O4X A;  3VKI A;  1G3W A;  2DJQ A;  1BBZ A;  3CCJ A;  3M4Y A;  3FJP A;  2GCX A;  3MJX A;  1WFW A;  3MO8 A;  1MHN A;  4Y92 A;  3CCE Q;  5I21 A;  2EYX A;  2KT8 A;  4O6J A;  4ELY C;  4DEY A;  3CCL T;  1X43 A;  2HMA A;  4J6X A;  1ZX6 A;  2FVU A;  3OYF A;  2EJ9 A;  1VQ6 A;  1YJW Q;  2JJ9 A;  4HCZ A;  1W1F A;  5LJ3 j;  1YFN A;  2RI5 A;  5IHK A;  1WQW A;  2HNI A;  4PL6 A;  4QQG A;  3PNW C;  3VYG A;  5LJ3 g;  4M78 B;  3CBM A;  2OTL A;  1VQ5 T;  4K11 A;  3MEW A;  5IXB A;  3PMT A;  2CT4 A;  3H0F A;  2SEM A;  2ZAE A;  1K8A U;  2RH2 A;  5KE3 A;  4FYV B;  2DL5 A;  1UE9 A;  3LW5 E;  3FDR A;  3MCA B;  3GIB A;  1PNJ A;  1YIT Q;  4FYW B;  2O2O A;  4MDW A;  3G4S Q;  2PZ1 A;  3VS6 A;  2KEA A;  4N0A A;  3OQ5 A;  1W2B P;  4E7J A;  1VQ4 T;  4PKC C;  4X34 A;  1NJI U;  4OB1 B;  1E6H A;  1I5L A;  4C0G A;  5FWC A;  4LUD A;  1TWB A;  4IUU A;  2FRW A;  4M78 A;  5DLQ E;  1VQ8 Q;  1VQK Q;  2RI2 A;  3OMC A;  4AG1 C;  4E7Z A;  1VQM T;  4RTV A;  3OYM A;  4FW2 A;  4QQD A;  3THK A;  1G5V A;  2AKK A;  2RHX A;  3QYH B;  4FSX A;  3VS2 A;  3I55 Q;  1PSE A;  1AEY A;  5FRO A;  3CPW A;  2K2V A;  4HVW A;  5I22 A;  1P92 A;  5LL6 S;  2LNV A;  2YXY A;  1KG1 A;  2C06 A;  2VYT A;  1HK9 A;  4XU3 A;  3OS1 A;  1D09 B;  3TSW A;  2XIC A;  1GCQ A;  5LJ5 d;  2DL3 A;  4LDY A;  4C0Z A;  1QCO A;  1MUZ A;  3EGX A;  1OEB A;  4JPB W;  3TCJ A;  4P5N A;  4LN2 A;  5LJ5 e;  3REB B;  2E65 A;  3M55 A;  1BI3 A;  4N4H A;  4C0D C;  1H8K A;  5GAO l;  3CC2 T;  2LX7 A;  2CGH A;  2XMF A;  4NOY A;  2GFA A;  4M7A F;  4FW1 A;  3E19 A;  3OYN A;  2RQU A;  1WNL A;  4ZN3 A;  1ZSZ A;  3I56 Q;  1PCX A;  2Y4Y A;  4PFP A;  1WHL A;  2W10 A;  1V1C A;  2DPP B;  3GNG A;  1X01 A;  2P4T A;  3UT1 A;  4LD9 K;  4ZN1 A;  3EFS A;  2K3Y A;  4WF2 A;  3PVL A;  1RI9 A;  1Q81 C;  3CPW P;  2EYY A;  2K7A A;  2HDA A;  1ZSG A;  3NPF A;  2XI9 A;  1E6G A;  2EQI A;  2F2X A;  1UGR B;  2JOY A;  2CP7 A;  4M78 D;  5GAN 3;  1KIK A;  4HVV A;  1X2Q A;  2KXD A;  4NL2 A;  1KC8 U;  4OVA A;  1VQP T;  1X6B A;  3VJP A;  2LTO A;  1F1B B;  1PSF A;  2C0T A;  2YRV A;  2DTO A;  4M75 E;  4Z89 A;  1OU8 A;  1XTD A;  2JUF A;  3NFC A;  1Q82 C;  1M8V A;  1TU0 B;  1GFC A;  1H3Z A;  3PMI A;  5IAY A;  4CC3 A;  3JV3 A;  1OZ2 A;  3CCV Q;  3I9Q A;  1W70 A;  4M4Z A;  1C6V X;  2JS2 A;  1WLP B;  2FHD A;  1LCK A;  3X25 B;  2QEX A;  3UPU A;  2DM1 A;  5CQX A;  1I1J A;  4PJO A;  3JB9 F;  2MF2 A;  2RHI A;  1I81 A;  2YRD A;  5CKD A;  1NZ9 A;  1UEC A;  4X9D A;  2JM8 A;  3V7C A;  3M0S A;  3CD6 Q;  2E64 A;  1AOJ A;  4BDY A;  3FB9 A;  1TUD A;  3RMQ A;  5FRN A;  4BI8 B;  2JTM A;  1UHF A;  4M75 F;  2LQN A;  5CR2 A;  3OBY A;  2RF0 A;  3CCJ Q;  3CC4 T;  2JS0 A;  1ZUK A;  4BDZ A;  3INZ A;  1VQ7 T;  3H9N A;  2R58 A;  2RHU A;  4HA8 A;  1WI7 A;  4DBF A;  1ZUY A;  1Y57 A;  2OTJ A;  4F7U B;  3EGD B;  1BK2 A;  1VQ9 T;  2DBK A;  3JCM c;  4LDU A;  2AKL A;  2JMC A;  1V29 B;  1VQ6 Q;  2LVM A;  4KGV B;  1U1S A;  3JCM d;  2H3E B;  5LJ5 h;  1K73 C;  1Q95 G;  1KJW A;  2E5K A;  4XU0 A;  3CME T;  1UGS B;  2A08 A;  2G6F X;  3EG9 B;  2A36 A;  2H3J A;  2EBP A;  2OTL Q;  3JCM e;  4QKU A;  1YHQ T;  1M1K U;  1SRL A;  2KDS A;  2DEQ A;  5KYX A;  2M0Y A;  4OMO A;  1QVF P;  2LCC A;  1S1N A;  1KHC A;  2F5T X;  1GBR A;  1MMG A;  2X4W A;  2EAY A;  3RBB B;  1QP2 A;  4J7F A;  2RJF A;  2J7I A;  3E9G A;  3OW2 P;  1WQ7 A;  3GP8 A;  4ELZ C;  3VS1 A;  1EX4 A;  3CCS T;  1Y07 A;  1VYU A;  1QQJ A;  2ZPB B;  2ED0 A;  3PE0 A;  3X28 B;  3ULR B;  2EW3 A;  2DO3 A;  2FG0 A;  2OJ2 A;  2KYM A;  1KHI A;  4C0D B;  3O8V A;  4LDV A;  3EG2 A;  4JJN K;  5KYN A;  3OS0 A;  1CKA A;  4AFU C;  5IT9 E;  3VS4 A;  4B6M A;  1D3B B;  5KCH A;  4M75 C;  1AHJ B;  4X1V A;  4AG2 C;  3LH5 A;  2NUP B;  3NTK A;  4J9H A;  2D0Q B;  4PJO D;  4J9C A;  1ABO A;  1RI0 A;  2JVV A;  3A8O B;  4ZGJ B;  1YJ9 Q;  2DYB A;  3G7Z A;  3NHN A;  2X4J A;  3RUX A;  3M0Q A;  1OZ3 A;  1TH7 A;  1W6X A;  4LDX A;  3QWX X;  4JDS A;  3MP6 A;  2NLU A;  2BIV A;  3PGG A;  1PG5 B;  3G6E T;  2EQM A;  2F69 A;  2HSE B;  4RTT A;  2RQR A;  2E10 A;  4XAX B;  3NTI A;  3DB3 A;  5ECA A;  2DF6 A;  1ZBX A;  1W2B S;  4FU6 A;  1PKS A;  3M0P A;  3H41 A;  3OYB A;  1R0B G;  2VAS A;  3A98 A;  2DXT A;  4J9E A;  5KYW B;  2VUB A;  2ZPG B;  4VUB A;  4ATO A;  2LCS A;  4N0A C;  2KT1 A;  2HEQ A;  5LJ3 d;  2VV5 A;  2D8J A;  3CCE T;  4OGC A;  4M7D F;  2LC4 A;  2R5M A;  3O5Z A;  2LNH B;  1U3O A;  5LJ3 e;  2QDY B;  1JEG A;  2EIF A;  1YJW T;  1IZ6 A;  2KAF A;  5FRM A;  3HFN A;  1YWO A;  2A7Y A;  4QT7 A;  2HKQ B;  4C92 F;  2IG0 A;  3VS0 A;  3JB9 H;  3FC3 A;  5KYU A;  3JCM h;  2D6F A;  4PFZ A;  4PJO E;  1YI2 A;  5KYW A;  2LX9 A;  1AWJ A;  2GNC A;  1H3H A;  4RTZ A;  2QTX A;  4FL6 A;  4MZT A;  4C8Q G;  3JB9 G;  1JJ2 A;  3CPF A;  4JRQ A;  1GBQ A;  2LMJ A;  2V8I A;  1YIT T;  4LE9 A;  1BCM A;  3G4S T;  2MYS A;  2GQI A;  1YJN A;  2K6D A;  2RK1 A;  3KFV A;  2V1Q A;  1ABQ A;  2QAS A;  2EKH A;  2LCL A;  3RDV A;  3G71 A;  1M8M A;  3CMA A;  2PU9 B;  1VQ8 T;  2KMT A;  2M51 A;  3JCM g;  1VQK T;  4M7A A;  1UUE A;  4XTV A;  2K3B A;  4IUT A;  2DX1 A;  2QG9 B;  1KK7 A;  3URG A;  2QEX Q;  2K5F A;  1KFZ A;  4MZP A;  1UJ0 A;  1QVG A;  5EG2 A;  3I55 T;  2G3R A;  4F17 A;  1LNX A;  3MP1 A;  1ZSZ C;  3SD4 A;  3OMG A;  2EGA A;  4FM4 B;  4WTO B;  2DBM A;  1HSQ A;  3A8M B;  3GOX A;  3EG3 A;  2FB7 A;  2LJ3 A;  1JBM A;  4KUL A;  1UHC A;  2VC8 A;  3VS7 A;  5DY9 A;  2OTJ Q;  2E41 A;  3OSS C;  3PT9 A;  3CCQ A;  5L8R E;  4EMK C;  4EIK A;  4BI3 A;  3OYA A;  4L5G A;  2CP5 A;  3WXM B;  2O4X B;  4PLL A;  5EC7 A;  3L1A A;  2OI3 A;  3QDF A;  1YCS B;  2CKK A;  4M75 B;  1N5Z A;  2DD4 A;  1JU5 C;  2JXB A;  2PTK A;  1OI1 A;  2X9H A;  2QAZ A;  5IHN A;  4JJB A;  3QG1 A;  4L59 A;  1EFN A;  4OMM A;  3EHR A;  1PRL C;  4LUE A;  3I56 T;  1BIA A;  5GJV B;  1KSW A;  2R57 A;  4IUV A;  2XKO C;  1D0Y A;  5GAN 7;  1RAH B;  1UGQ B;  1RAA B;  1MND A;  1KQS A;  2GBQ A;  5LJ3 h;  2RNA A;  4AMC A;  1PHT A;  1H92 A;  2CZ1 B;  1OX9 A;  2KGT A;  2KNB B;  1VYV A;  1TG0 A;  3OS2 A;  4M75 A;  3EFO A;  4PJO C;  2OX7 A;  2J06 A;  2LP5 A;  1HD3 A;  2PUK B;  3TRE A;  2VGM A;  5HCK A;  4M7A D;  1EZZ B;  1AT1 B;  2I0N A;  3FEO A;  1FMW A;  1BYM A;  3UAT A;  2Y4X A;  5KH6 A;  2FZG B;  2GTO A;  2WSC E;  1YIJ A;  4QVZ A;  3JCM Q;  1AZE A;  1TUC A;  3F70 A;  4MZM A;  2EYW A;  2XDB A;  3CCV T;  1QVF S;  3VYH B;  3C95 A;  4AFQ C;  2DNU A;  2HAX A;  1M3A A;  4M7D G;  2MWO A;  1AWW A;  4BE1 A;  5GAN d;  2FPD A;  3OW2 S;  4MDX A;  5I2M A;  3HP9 A;  2MIO A;  3S3N A;  1S72 A;  1AWX A;  2KR3 A;  5GAM f;  3QII A;  2YUO A;  5GAN e;  3LX7 A;  4M77 G;  1WZO A;  3CD6 T;  3UDC A;  4C92 G;  2DER A;  3OYG A;  5CK9 A;  2DK3 A;  3EG0 A;  3CCJ T;  2F2V A;  2CH4 A;  1FXX A;  3EGX B;  2QQA A;  1PKT A;  1G3Y A;  4A4H A;  4RTY A;  2BZ8 A;  4HT9 A;  2DXU A;  2L3R A;  2MAM A;  4II1 A;  2HQH A;  1VA7 A;  2HL3 A;  1WHG A;  3KUF A;  4PJN A;  2KRM A;  3QJY A;  4LD6 A;  1VQ6 T;  3EAE A;  2D8H A;  2ZPE B;  3H0I A;  3L2Z A;  1YJ9 A;  4M7A E;  3SDZ A;  1RAD B;  1VQO A;  1N6A A;  1OYX A;  2L89 A;  5KYY A;  2VXF A;  2OTL T;  2P84 A;  1ZSZ B;  3S3O A;  4F16 A;  1VQN A;  4M75 D;  2DE0 X;  1BI0 A;  1YI2 Q;  1Q81 R;  2EJG A;  2AIR B;  4FT4 A;  1D0Z A;  4HCK A;  4PFO A;  5GMK j;  5I2S A;  3GLX A;  4Y28 E;  1EIF A;  2C0I A;  4ZGE B;  2RO0 A;  1SHF A;  4IUP A;  2DEU A;  4XTY A;  1YJN Q;  4EMK B;  4XQ3 A;  4JLI A;  4BY6 C;  1N9S A;  4GY5 A;  2XD0 A;  4JZ4 A;  2BKD N;  3G71 Q;  4RTU A;  3CMA Q;  1NBE B;  3NMZ C;  1T0J A;  2XDP A;  1WIE A;  1Q82 R;  2CP6 A;  2DRK A;  4M7D A;  1M3B A;  2DXB A;  3QJ6 A;  5AYF A;  2COW A;  1M90 C;  1FYN A;  5HY6 A;  1A0N B;  2QQS A;  1AZG B;  1K4U S;  4DOW A;  2ENM A;  3HL8 A;  4PK4 A;  5KCO A;  3PIP A;  1WPY A;  1X6G A;  2BZY A;  1K9M C;  3OB9 A;  2L8D A;  2EKO A;  2DVE A;  1PD1 A;  4EMK A;  2BE9 B;  1ARK A;  4C8Q E;  4PJM A;  1B07 A;  1WYX A;  4PJO B;  5J3B A;  3QO3 A;  3H6Z A;  3SEM A;  3MP8 A;  2LQ8 A;  5KE2 A;  3CCQ Q;  3OYL A;  2DTI A;  1ZA2 B;  3J80 E;  2HKN A;  4C5E A;  1M2V A;  4PJL A;  3L2W A;  3BDU A;  2B86 A;  5GAN h;  1SEM A;  2GGR A;  3SHW A;  2EQJ A;  1IGU A;  2XU8 A;  3CXC S;  1Q86 C;  5I11 A;  3MET A;  3N5B B;  2VXE A;  2C0O A;  4KT0 E;  2KBT A;  3D7S B;  1K73 R;  4LDW A;  2NYS A;  4FIB A;  2RN8 A;  3CCU A;  4C8Q F;  2M9U A;  2VVK A;  1NLO C;  3VS5 A;  4M7A C;  2DJZ A;  1BI1 A;  3LGF A;  5GAN j;  5FW9 A;  1NM7 A;  5GAN g;  3EGU A;  4A53 A;  5KYX B;  2RD1 A;  3NTH A;  1XJW B;  4JRI A;  1D1B A;  3CCM A;  3UWN A;  5FU6 C;  1AD5 A;  1NEG A;  2FO0 A;  1WXT A;  3A1P A;  3KBG A;  1RAE B;  1VQ4 Q;  1NPP A;  1X27 A;  2CZ0 B;  2O9V A;  1TOV A;  3C12 A;  4WCI A;  1Y7X A;  2SRC A;  5GAN 2;  1OQK A;  4OMP A;  2CDT A;  4L6V 5;  1C0M A;  2JTF A;  1TUG B;  1B34 A;  2AK5 A;  2CZ6 B;  2FYK A;  2QA4 A;  4XTZ A;  3LH0 A;  2X35 A;  2EPD A;  3RIR A;  1YIJ Q;  4NS5 A;  5D6W A;  1K0S A;  4E7K A;  5GAM d;  3LYI A;  4B9W A;  2FZC B;  4TVR A;  2YHT A;  3HHT B;  4JRP A;  4C5G A;  5GAM e;  4XTW A;  3I5S A;  2YRC A;  2QEX T;  1X75 C;  3HKS A;  3ME9 A;  5GMK i;  1S72 Q;  1G3T A;  1K8A C;  1WHJ A;  2LT4 A;  3QUI A;  4FCY A;  4C8Q C;  2A37 A;  1PC0 A;  4BY6 B;  5J26 A;  5GAO n;  1WJQ A;  2RI3 A;  2EGE A;  1NJI C;  4JLG A;  3JCM V;  3ZFJ A;  3L2Q A;  1RAG B;  1ZUU A;  5CKF A;  1IGQ A;  4E6R A;  2OTJ T;  3AT1 B;  5FLX E;  1VQL A;  2GF7 A;  2ROL A;  1XNI A;  3JCM b;  4M78 F;  1TSF A;  3CBP A;  1I5O B;  2DTH A;  2JM9 A;  3BFM A;  3M0U A;  3I35 A;  4J9F A;  2QI2 A;  4KGZ B;  1VQO Q;  2DKG A;  2O9S A;  1K0X A;  4M7D E;  2ZZD A;  4RUG A;  3RKW A;  1GXI E;  3RR6 A;  2KK4 A;  2DZC A;  2KI7 A;  1VQN Q;  2A28 A;  3SB2 A;  2KYB A;  4R56 A;  3U23 A;  4FYY B;  1N9R A;  1M1F A;  2D0N A;  1X69 A;  4M77 E;  1IXD A;  2DIQ A;  2LJ1 A;  4C92 E;  1N27 A;  1YP5 A;  1TTH B;  3S3M A;  5D6X A;  4D8K A;  6AT1 B;  1BIB A;  2QK0 A;  3JSC A;  3OYJ A;  2QXF A;  5KYU B;  2LRQ A;  3M57 A;  3OY9 A;  3E9F A;  2GQV A;  3FJ5 A;  2J6F A;  1G8X A;  3OYE A;  5A2Q E;  1ACM B;  4A4K A;  4A54 A;  1UG1 A;  3RES A;  4GBQ A;  3DLM A;  1Z9Q A;  1Z9Z A;  4OML A;  2ED1 A;  2K4Y A;  3EH1 A;  1G3S A;  2YSQ A;  4M77 F;  4HCB A;  5GJW B;  2J6O A;  1VUB A;  3CCR A;  1JQQ A;  4RMO A;  3JCM W;  1WXB A;  5CCA A;  4M7A B;  2ROT A;  2WSF E;  4OF1 A;  1G83 A;  3JCM P;  1M2O A;  1WHK A;  2LQK A;  5A0D A;  4RCB A;  3V8L A;  4OB0 B;  4X9C A;  4J6W A;  3OA6 A;  5FU6 B;  1NEB A;  5GAM h;  1SPK A;  4DBR A;  2X3X D;  4PNO A;  1KC8 C;  3CC4 Q;  3X26 B;  2K57 A;  2CRE A;  2QQB A;  1SHG A;  1I8F A;  2V1R A;  3M53 A;  3M4G A;  3HFO A;  4PJJ A;  4EMG A;  2CZ7 B;  2R5A A;  4C5I A;  4AFS C;  3TQ7 P;  1PD0 A;  2CSQ A;  4J9B A;  3RMS A;  3UA6 A;  2YUN A;  1LOJ A;  3CC7 A;  3CME Q;  1OPL A;  5GAM j;  3CCU Q;  1RAI B;  4LXC A;  3VU3 C;  5LJ5 f;  2FPF A;  4J6Y A;  5GAM g;  1Y0M A;  1K9A A;  2L5Q A;  3CPW S;  3DB4 A;  4BB7 A;  4HT8 A;  1FMK A;  2DRM A;  1GRI A;  3R6O A;  2QQR A;  4M7D C;  2COY A;  5D7U A;  4RTX A;  1Q81 U;  3PVQ A;  5GAN 6;  3CCM Q;  1RUW A;  2JNG A;  4M77 C;  3QYG B;  1YI2 T;  4C8Q B;  3CCS Q;  4BE0 A;  3PIO A;  4C92 C;  5GMK e;  2DAQ A;  1M1G A;  3JAM E;  4JS4 A;  1JJ2 P;  2ESW A;  4J9D A;  4QVD A;  3OBW A;  4IKF A;  3EFO B;  1BKB A;  1LJO A;  1YJN T;  4BD3 A;  4RTW A;  1QVP A;  3CCL A;  2QGG A;  4R0K A;  4A4E A;  5GAO r;  1LVK A;  1R0C B;  1CKB A;  2F2W A;  2QA4 Q;  4D8D A;  1Q82 U;  1BU1 A;  2LZ6 B;  3G71 T;  5IHI A;  5GAN 5;  3CMA T;  2DL7 A;  2LT1 A;  3HRT A;  4MML A;  2CT3 A;  1M1K C;  3QSU A;  1VQ5 A;  1UDL A;  1J3T A;  3R6N A;  4C8Q A;  2AZS A;  2L3P A;  2YT6 A;  2E70 A;  3M58 A;  3TSZ A;  1XQH A;  4M78 G;  4OP0 A;  3VUZ A;  4IUQ A;  1TS9 A;  2FRY A;  3QDR B;  1MV3 A;  2AZV A;  2RQW A;  2HBP A;  1QVG P;  2JTE A;  1NYF A;  3BDL A;  2NUT A;  2BZX A;  3A8L B;  1Q7Y R;  3PFS A;  5IN1 A;  3BY7 A;  2DA9 A;  4F7U F;  3SWN A;  3QPH A;  1BI2 A;  4CC7 A;  1W2B A;  3MEV A;  3V7S A;  1VQ4 A;  2RJD A;  1KD1 R;  5AT1 B;  3V7R A;  2QTV A;  2HL5 C;  2BUD A;  8ATC B;  4Z8A A;  1TXQ A;  1VQL Q;  2P0K A;  4Q5W A;  1C1A A;  3CCQ T;  1WDX A;  2EJF A;  1AWO A;  3HTR A;  3X20 B;  1VQM A;  1GFD A;  3VRZ A;  2HSP A;  3L42 A;  5C6S A;  1OOT A;  3PTA A;  3L2U A;  1K73 U;  4FSS A;  2E3I A;  2P4R A;  1RAF B;  4FYX B;  1I4K 1;  3A8G B;  4OGE A;  1RAB B;  1D1A A;  2X4X A;  4ORZ A;  2LJ0 A;  1JRI A;  1Q7Y C;  3EHQ A;  1VOM A;  1I07 A;  1B3Q A;  1KQS P;  5KYY B;  3JCM f;  4E7H A;  1KD1 C;  1I0C A;  1RL2 A;  1SKU B;  5A0L A;  2E5Q A;  3DKM A;  5C0M A;  1KQ2 A;  1YNZ A;  2VGN A;  1GL5 A;  2X3W D;  3CC2 A;  3VS3 A;  4ANJ A;  1IHW A;  3OYC A;  2PVO B;  4D6W A;  5GMK h;  1NE8 A;  4LNP A;  2ZCF B;  4GLK A;  4C8Q D;  3JB9 D;  4EMH A;  3EH2 A;  3LWI A;  1WXU A;  1MGQ A;  1K76 A;  3CCR Q;  2A3L A;  2JN0 A;  1M90 R;  1YIJ T;  2AT1 B;  2LQW A;  1QWF A;  3OYI A;  4M7D B;  3GF5 A;  4DOV A;  1T3L A;  3ER0 A;  1X2K A;  1K9M R;  1BB9 A;  3M54 A;  2QYZ A;  3V8K A;  2M1H A;  4M77 B;  2LDM A;  5DM7 R;  3LGL A;  2MWP A;  1S72 T;  4C92 B;  3G1J A;  2MCN A;  5J39 A;  2E1H A;  1VQP A;  2KE9 A;  1YWP A;  4A63 B;  2EQK A;  1N8R R;  2PVG B;  3M5A A;  4IIO A;  4PLI A;  3M59 A;  1BCO A;  2F5K A;  3V8J A;  1WJS A;  2RQT A;  4PJO G;  2K79 A;  2CH4 W;  1R8O B;  2DYI A;  4ESR A;  2KRN A;  1IRE B;  2EYZ A;  2XID A;  1QWE A;  4ME7 A;  1ZBJ A;  3CC7 Q;  2WSE E;  2DIG A;  2JMA A;  1PWT A;  1Q86 R;  1OV3 A;  1G2B A;  1M2V B;  4KGX B;  3JCM X;  3WVD B;  3DLL A;  1RLP C;  4JRK A;  3HRU A;  2RQV A;  2QQ9 A;  1D1C A;  4M77 A;  4OB2 B;  1U06 A;  3GPL A;  2ZPH B;  1YJ9 T;  2MI6 A;  4J5Y A;  4C92 A;  1IRX A;  2L2P A;  3OSV A;  3TU4 K;  1VQO T;  4F14 A;  1OUL A;  2DL8 A;  2MMP A;  1SSH A;  2DIL A;  5GAO m;  4Y91 A;  2EFI A;  1VQN T;  2L3S A;  1AVZ C;  1OPK A;  4O5V A;  1O75 A;  4QQ6 A;  4J9G A;  4RKU E;  1N8R C;  3GBQ A;  5LJ3 f;  3J7A F;  1JXM A;  3UA7 A;  2KQW A;  2V8K A;  5HK0 A;  1UEB A;  2PQW A;  3VUB A;  1ZLM A;  3CC4 A;  3WVE B;  3UF4 A;  5CKH A;  2FZK B;  1VQ7 A;  3FLG A;  2M0O A;  4E2F B;  1NLP C;  3X24 B;  2K2M A;  1IO6 A;  1ZQ1 A;  4HXJ A;  5IXF A;  4XK8 E;  1VQ9 A;  2DL4 A;  4BE2 A;  3CCL Q;  9ATC B;  2K9G A;  4E7S A;  4JUV A;  2M02 A;  2DET A;  1FX7 A;  2DD5 A;  4F7U G;  2RB6 A;  2O88 A;  2EQU A;  3QHS A;  1WGS A;  2X4Y A;  1WJR A;  3JB9 I;  2EVR A;  2IIM A;  3CME A;  4KRT A;  3HRS A;  2RHZ A;  1VQ5 Q;  1YHQ A;  3QZ9 B;  2DMO A;  2V26 A;  1U1T A;  1QLY A;  4DA4 A;  5FU7 C;  1YCY A;  1B34 B;  2ATC B;  2ECZ A;  3CBO A;  5CAI A;  1QVF A;  1M9S A;  2EYQ A;  3MKD A;  3HPW A;  1M30 A;  1ZA1 B;  3BW1 A;  2HZY A;  4JJD A;  1NG2 A;  2DVJ A;  5GMK l;  2CUD A;  1FMV A;  5A0G A;  4JZ3 A;  3OW2 A;  2ZPF B;  3RNJ A;  7AT1 B;  2RJC A;  1WA7 A;  2FPE A;  1K8A R;  1WHH A;  2A0F B;  4BAC A;  3OYH A;  2CP0 A;  4DEX A;  5M9O A;  3CCS A;  4V2S A;  2PNI A;  2BTT A;  3L2R A;  1JJ2 S;  4M7D D;  5D6Y A;  3T9N A;  3FRN A;  3Q1J A;  5GMK m;  2RJE A;  2HQE A;  5IH2 A;  2KSS A;  1NJI R;  1QW1 A;  2E6N A;  3OS5 A;  3JCM J;  1VQM Q;  4RCC A;  4A4G A;  2YLB A;  3CEY A;  4M77 D;  2PVD B;  5L23 A;  4KH0 B;  1UGV A;  4C92 D;  2J6K A;  2WAC A;  3C94 A;  4NL3 A;  2V8J A;  4EDU A;  2E3H A;  1T0H A;  4M78 E;  3EG1 A;  1U5S A;  2DZ9 A;  4XU1 A;  2CYZ B;  1U8R A;  2AHJ B;  4CI0 C;  5HK3 A;  4BI4 A;  4XTU A;  3CCU T;  1T3S A;  4J83 A;  3P8H A;  2IPO B;  2RM4 A;  4KUI A;  2OAW A;  4OB3 B;  3QKJ A;  3QZ5 B;  2VWF A;  4XU2 A;  3E2U A;  1HYO A;  3RKX A;  2XG8 D;  4AFZ C;  2NUZ A;  2W0Z A;  5GAN 8;  1QVG S;  2MOX A;  1LPL A;  5CO7 A;  1UTI A;  1Y96 B;  2YDL A;  3G6E A;  2XDD A;  3JRZ A;  3ASK A;  2GFU A;  4J8O A;  4YTL A;  2RMO A;  2XHC A;  2EGC A;  4F7U A;  3EGD A;  2J05 A;  4J9I A;  5LJ5 j;  2ZPI B;  3CCM T;  1Y71 A;  3P8D A;  3QXE B;  5LJ5 g;  2YWW A;  2P0P A;  1MMA A;  1QKX A;  4GLM A;  3VV0 A;  4QVC A;  1QKW A;  2NWM A;  3CC2 Q;  3SWN C;  1OU9 A;  3EG9 A;  4JS5 A;  5CVI A;  3SFM A;  1YBY A;  1SSF A;  1W4S A;  2PUO B;  3CCE A;  2KXC A;  3RKY A;  1QCN A;  2QDL A;  2CSI A;  5CKB A;  3I5R A;  1JB0 E;  2HCK A;  2QA4 T;  3VRY A;  1Y96 A;  1YJW A;  5GAO p;  2HD0 A;  2ZGW A;  4HCC A;  1V76 A;  3EFR A;  1UJY A;  2O01 E;  3HSB A;  2H8H A;  1IB8 A;  1R77 A;  1QMC A;  4UC4 A;  3OYD A;  3S6W A;  1KQS S;  5FWB A;  4M7A G;  3QBY A;  1M4Z A;  2DLP A;  3OYY A;  3M56 A;  1Q7Y U;  2RK2 A;  1VQP Q;  4DQ2 A;  3RER A;  4HKE A;  1OX8 A;  3TVT A;  2XK0 A;  1PM3 A;  2ABL A;  2RHY A;  4R55 A;  1KC8 R;  3C4S A;  4IUR A;  4E7I A;  1KD1 U;  3M9Q A;  4B9X A;  1YIT A;  2HBW A;  3G4S A;  1D3B A;  4KH1 B;  2E12 A;  2NUP A;  4A4F A;  2Z0W A;  3CXC A;  5GAN f;  1VQL T;  4AT1 B;  5HKC A;  1VQ8 A;  1VQK A;  4RG2 A;  4OMQ A;  2FL7 A;  2VB6 A;  1JO8 A;  4ZTF A;  1H64 1;  3E1S A;  2BE7 D;  4CC2 A;  4MMK A;  2CP2 A;  3M0T A;  1ZHI A;  1SRM A;  5FU7 B;  1K1Z A;  3IQL A;  1VIE A;  4M78 C;  3I55 A;  4OMN A;  1NYG A;  1M3C A;  2YUQ A;  1M27 C;  1B7T A;  2I2L A;  3H8Z A;  1RLQ C;  2K3X A;  3M0R A;  1UFF A;  2K5I A;  2VKN A;  1HJD A;  2M16 A;  4J7I A;  3BE3 A;  3NGP A;  4IIM A;  1MMN A;  1SG5 A;  2FEI A;  1VQ7 Q;  3CQT A;  3L2V A;  2KRS A;  3LLR A;  2KVQ G;  4C5H A;  1RAC B;  1UB4 A;  1NPR A;  1VQ9 Q;  1O9S A;  1M5Q 1;  1XOV A;  4C0F A;  2L3Q A;  4XTX A;  1SF9 A;  2JZ2 A;  3MEA A;  2JW4 A;  2CS7 A;  5GAO q;  3GNF B;  2X51 A;  3TEE A;  1VIF A;  1GCQ C;  3MPU B;  2K5L A;  4JJC A;  3KXT A;  1QCF A;  3REA B;  3JB9 J;  5GAN 4;  1WX6 A;  2DFU A;  2CUB A;  2O31 A;  4M75 G;  1YHQ Q;  2DXC A;  2P0Q A;  3QWY A;  3CXC P;  1IHV A;  4Z88 A;  4KUD K;  1M90 U;  4DBQ A;  4FT2 A;  3I56 A;  1M1K R;  5DLO A;  2MPX C;  3A8H B;  3MEU A;  3CCR T;  2Y90 A;  4KBM B;  4E47 A;  4PJO F;  2OAU A;  3H0H A;  1K9M U;  1MV0 B;  1X6O A;  1JXO A;  2CP3 A;  4Z02 A;  2L0A A;  2D9T A;  3AHU A;  2GTJ A;  3MHX A;  2JT4 A;  5CIU A;  2QGF B;  4CRI A;  1MNE A;  4ZGD B;  2B8A A;  4QW2 A;  1MMD A;  1N8R U;  2YLC A;  4ZNX A;  2MK5 A;  2NUT B;  4F7U E;  4HVU A;  3FIF A;  3SWN B;  5CKE A;  4RG8 A;  2IVW A;  1PRM C;  1E7O A;  4E7L A;  4ZTJ A;  1WHM A;  8AT1 B;  3P8B B;  1DJ7 B;  4BUG A;  3J81 E;  3LWH A;  1Q86 U;  2RA2 A;  4EPC A;  3CC7 T;  3C0C A;  1KQ1 A;  1FWZ A;  1D0X A;  2COZ A;  2KY9 A; 
#chains in the Genus database with same CATH homology
 1NEG A;  2FO0 A;  1WXT A;  2LCS A;  2KT1 A;  2HEQ A;  2D8J A;  1VYT A;  1X27 A;  1YN8 A;  2O9V A;  3ZL7 C;  2D1X A;  3O5Z A;  2MCN A;  2LNH B;  4WCI A;  4CC4 B;  1U3O A;  2KE9 A;  1YWP A;  1JEG A;  2YUP A;  2KRO A;  4A63 B;  2SRC A;  1CSK A;  4IIO A;  4OMP A;  2CDT A;  1YWO A;  2AK5 A;  2RQT A;  4QT7 A;  2K79 A;  2CH4 W;  2RPN A;  4ESR A;  2EPD A;  1K0S A;  2KRN A;  2EYZ A;  3VS0 A;  1GCP A;  1QWE A;  1ZBJ A;  2DJQ A;  1BBZ A;  2JMA A;  1PWT A;  1WFW A;  1OV3 A;  1G2B A;  3I5S A;  1AWJ A;  2GNC A;  1H3H A;  4RTZ A;  1RLP C;  4Y92 A;  2RQV A;  2EYX A;  2KT8 A;  1U06 A;  1GBQ A;  4DEY A;  1X43 A;  1ZX6 A;  2LMJ A;  2L2P A;  4LE9 A;  4F14 A;  1W1F A;  2DL8 A;  2GQI A;  5IHK A;  1SSH A;  2DIL A;  2K6D A;  3KFV A;  2A37 A;  2L3S A;  1ABQ A;  2V1Q A;  2EKH A;  1AVZ C;  1OPK A;  1M8M A;  2EGE A;  4J9G A;  3GBQ A;  2M51 A;  4K11 A;  1JXM A;  1UUE A;  3UA7 A;  5IXB A;  2K3B A;  2CT4 A;  1ZUU A;  3H0F A;  1ZLM A;  2DX1 A;  2SEM A;  4E6R A;  3UF4 A;  2ROL A;  1KFZ A;  1NLP C;  2JM9 A;  2K2M A;  3M0U A;  2DL5 A;  1IO6 A;  3I35 A;  4J9F A;  1UE9 A;  1UJ0 A;  4HXJ A;  5IXF A;  2DL4 A;  4F17 A;  2K9G A;  1PNJ A;  1K0X A;  2O9S A;  2O2O A;  2O88 A;  2PZ1 A;  4RUG A;  3VS6 A;  2EGA A;  2KEA A;  2DBM A;  1E6H A;  2EVR A;  2IIM A;  1HSQ A;  2A28 A;  5FWC A;  2KYB A;  4KRT A;  4LUD A;  3U23 A;  2FRW A;  3EG3 A;  2D0N A;  1X69 A;  2DMO A;  2LJ1 A;  2LJ3 A;  4AG1 C;  1UHC A;  1QLY A;  1YP5 A;  3VS7 A;  2ECZ A;  4RTV A;  3THK A;  4D8K A;  1M30 A;  4EIK A;  4JJD A;  1NG2 A;  2DVJ A;  2CUD A;  2AKK A;  5EC7 A;  4JZ3 A;  2OI3 A;  3VS2 A;  1YCS B;  3RNJ A;  1AEY A;  1N5Z A;  1JU5 C;  1WA7 A;  2FPE A;  3FJ5 A;  2J6F A;  4HVW A;  5I22 A;  2JXB A;  2PTK A;  4DEX A;  5IHN A;  4JJB A;  1UG1 A;  1EFN A;  2PNI A;  2BTT A;  4OMM A;  3EHR A;  4GBQ A;  1Z9Q A;  1PRL C;  4LUE A;  1Z9Z A;  4OML A;  5IH2 A;  3TSW A;  2ED1 A;  5GJV B;  1KSW A;  1GCQ A;  2DL3 A;  1MUZ A;  2YSQ A;  1OEB A;  5GJW B;  4JPB W;  2GBQ A;  2J6O A;  5L23 A;  1JQQ A;  2RNA A;  4LN2 A;  1PHT A;  1UGV A;  1H92 A;  1WXB A;  3REB B;  2ROT A;  2J6K A;  1G83 A;  2KGT A;  1T0H A;  2KNB B;  3EG1 A;  1VYV A;  1U5S A;  1TG0 A;  1H8K A;  2LX7 A;  2J06 A;  2XMF A;  2LP5 A;  1HD3 A;  1T3S A;  5HCK A;  2OAW A;  2RQU A;  1NEB A;  2VWF A;  1SPK A;  4AFZ C;  2NUZ A;  2W0Z A;  2I0N A;  2X3X D;  2MOX A;  3UAT A;  2CRE A;  1UTI A;  1SHG A;  2W10 A;  2YDL A;  1V1C A;  2V1R A;  2RMO A;  2EGC A;  2GTO A;  1RI9 A;  3PVL A;  2J05 A;  4J9I A;  2EYY A;  1TUC A;  4AFS C;  2K7A A;  1AZE A;  2CSQ A;  2EYW A;  2HDA A;  4J9B A;  1ZSG A;  1QKX A;  3NPF A;  4GLM A;  3UA6 A;  1QKW A;  2NWM A;  2YUN A;  1E6G A;  2EQI A;  2DNU A;  4AFQ C;  2F2X A;  1OPL A;  1KIK A;  1M3A A;  4HVV A;  2FPF A;  1X2Q A;  2KXD A;  1AWW A;  1Y0M A;  1K9A A;  2FPD A;  1X6B A;  2KXC A;  2MIO A;  1AWX A;  2KR3 A;  1FMK A;  2C0T A;  2DRM A;  1GRI A;  2YUO A;  2QDL A;  2CSI A;  3I5R A;  2HCK A;  3VRY A;  4Z89 A;  4RTX A;  3PVQ A;  1GFC A;  1UJY A;  3EG0 A;  1RUW A;  2F2V A;  2H8H A;  2CH4 A;  4CC3 A;  3JV3 A;  1PKT A;  3I9Q A;  4RTY A;  1W70 A;  4M4Z A;  2BZ8 A;  2JS2 A;  1WLP B;  5FWB A;  2DLP A;  1LCK A;  1VA7 A;  2ESW A;  4J9D A;  2DM1 A;  2KRM A;  1I1J A;  2D8H A;  3TVT A;  3H0I A;  4RTW A;  2ABL A;  4R0K A;  1UEC A;  2JM8 A;  1CKB A;  2F2W A;  3M0S A;  4D8D A;  2HBW A;  1BU1 A;  2LZ6 B;  5IHI A;  1AOJ A;  1TUD A;  2DL7 A;  1UHF A;  4F16 A;  2LQN A;  2CT3 A;  2DE0 X;  2RF0 A;  2JS0 A;  1ZUK A;  1UDL A;  1J3T A;  3R6N A;  2AZS A;  2L3P A;  2YT6 A;  4OMQ A;  3TSZ A;  1JO8 A;  1WI7 A;  1ZUY A;  1Y57 A;  4HCK A;  2FRY A;  4CC2 A;  1MV3 A;  1BK2 A;  2AZV A;  2RQW A;  3M0T A;  2DBK A;  2JTE A;  2AKL A;  1SRM A;  2JMC A;  1K1Z A;  3IQL A;  2C0I A;  1NYF A;  1SHF A;  2BZX A;  4OMN A;  1KJW A;  1NYG A;  2E5K A;  1M3C A;  4JZ4 A;  2DA9 A;  2A08 A;  2G6F X;  2YUQ A;  2A36 A;  1M27 C;  2EBP A;  4CC7 A;  4RTU A;  3NMZ C;  1RLQ C;  1T0J A;  1SRL A;  3M0R A;  1WIE A;  1UFF A;  2VKN A;  1HJD A;  2M0Y A;  4OMO A;  4Z8A A;  2DRK A;  3NGP A;  4IIM A;  2FEI A;  1M3B A;  1S1N A;  1WDX A;  3CQT A;  1FYN A;  1AWO A;  2KRS A;  1A0N B;  1GBR A;  3RBB B;  1AZG B;  1K4U S;  2J7I A;  2ENM A;  1GFD A;  3VRZ A;  2HSP A;  1X6G A;  1XOV A;  1OOT A;  2BZY A;  3VS1 A;  4FSS A;  2L3Q A;  2P4R A;  1VYU A;  2JW4 A;  2ED0 A;  3PE0 A;  1ARK A;  3ULR B;  1GCQ C;  2EW3 A;  4JJC A;  1QCF A;  3REA B;  2FG0 A;  2OJ2 A;  1B07 A;  1WYX A;  2KYM A;  4ORZ A;  1WX6 A;  2O31 A;  2CUB A;  2LJ0 A;  3EG2 A;  3QWY A;  4Z88 A;  3SEM A;  3EHQ A;  1CKA A;  4AFU C;  1I07 A;  3VS4 A;  1B3Q A;  4X1V A;  4AG2 C;  3LH5 A;  1I0C A;  3H0H A;  4J9H A;  2B86 A;  1MV0 B;  1JXO A;  4J9C A;  1SEM A;  1ABO A;  2GGR A;  3SHW A;  2L0A A;  2DYB A;  2GTJ A;  5I11 A;  1YNZ A;  2JT4 A;  3NHN A;  1GL5 A;  2C0O A;  2X3W D;  2KBT A;  3M0Q A;  3VS3 A;  2RN8 A;  1W6X A;  3QWX X;  4ZNX A;  4LNP A;  4HVU A;  2VVK A;  1NLO C;  3VS5 A;  1WXU A;  1K76 A;  4RTT A;  2RQR A;  5FW9 A;  5ECA A;  1PRM C;  1E7O A;  2DF6 A;  1NM7 A;  2LQW A;  1QWF A;  3EGU A;  1PKS A;  3M0P A;  3H41 A;  3A98 A;  1T3L A;  1X2K A;  4J9E A;  3C0C A;  1BB9 A;  1AD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...