1CLOH

Anti-carcinoembryonic antigen monoclonal antibody a5b7
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMNWVRQPPGKALEWLGFIGNKANGYTTEYSASVKGRFTISRDKSQSILYLQMNTLRAEDSATYYCTRDRGLRFYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords A5B7 MONOCLONAL ANTIBODY
publication title VL:VH domain rotations in engineered antibodies: crystal structures of the Fab fragments from two murine antitumor antibodies and their engineered human constructs.
pubmed doi rcsb
total genus 39
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1996-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cloH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cloH01
3P11H 2E6QA 2KPNA 4Z0BL 4Y19D 3QQ4B 1E27A 3GO1H 2ATKB 3FQTB 5IMKB 2R4RL 2DQEH 1J86A 4OD1H 1S7VB 2NR6C 1HHKA 5AZ2L 5CEXA 4NWTH 1QACA 1F4YL 3QHZH 4WFGE 5CEZD 1K8DA 4FFYL 3FAXA 4MMXC 2RHEA 4NGHH 4G8GD 4EUPH 5IBUG 4XP1H 5M7QA 1I7ZA 3CDFA 5MENE 5DUBA 3SHSA 1NGPL 3P0YH 2EXWC 5LBSL 4LHQB 5IG7A 3RA7L 1CLOH 5IVXB 4ZOBA 2QSCH 5ADPH 1K4DA 5FYKD 4G8IA 3I6GA 4HGWB 3RVWD 4XNUL 1XIWB 5E2WL 2MQCA 4NO5B 2HWZH 5EWIH 4PS4L 1J1OH 4BZ1H 5D7KE 1EUUA 1HCVA 3MREB 5FIEA 1OP5K 4H88L 5ACZA 3BX7C 4U1MA 4AL8L 4A6YL 1UJTA 1R3LA 4PJDE 1CR9H 5B3JE 1AGDB 4QOKE 2ADJA 5IEKA 3L3DA 3SDDA 1MCEA 3SE9H 4MB4A 1RUQH 5DO2D 4AM0A 1TZHB 1MFDL 4FQHB 1T04B 1F4WL 1YEHL 2Z8WC 3JSSA 1OARH 1M7IA 4W70A 1T7XA 4EXPX 1CGVA 2NYYD 4OZHF 3VXRD 3OB0K 1SVZA 1L6ZA 4POUB 5E4EC 2Y23A 3GSNL 1NAKL 4LLQA 5AYUH 5BV7B 5I73B 2HH0L 1BBJA 3WKML 2XKNB 4OQ1A 3AS0A 1JZ8A 4R3SB 3SGJA 1GZQB 1FBIL 3BO8A 3IJYB 5BO1L 1NGZB 3JWOH 3VD5A 5F1KC 3FB6B 2HKHH 3MNWA 2CJUL 2VERN 4R6UA 4Z0BH 5FA4A 1WZKA 3KHOA 5E8OB 5ICXA 1B0RA 2QQNL 4LSTL 4QHMB 1DCLA 4LFHG 2R4RH 1JJUA 3RVTC 4X8XA 1C7SA 5ITFA 4L9LB 5C0JA 1FFPB 5AZ2H 4P2QB 5EBGA 4CU6A 3W9EB 3IDNA 2O5XL 1F4YH 2UZXB 5AD0A 4FFYH 3BEWA 2Y72A 3C9NA 1NGPH 1PBYA 1ZSDB 2F53B 1ZT7B 1U8KB 5E94A 2XN9D 5LBSH 4NYLB 2BVPB 3RA7H 3LKNB 4QTHB 1QSEB 2X4TA 2Y5EA 4WFHE 2HFFB 5HGDB 2DJSA 5EU6A 3FTGB 4F37F 3FFCE 1R3KB 3IDJA 4XNUH 5E2WH 1M7DB 1JGVL 2A83B 4PS4H 5HYFA 3G9VA 1EAPA 5C92A 3IXAB 5MEND 4GXUN 3N9GL 3OR7A 3SDAC 3OGCB 3KVQA 4NM8L 4H88H 3C08L 5GGSY 3HAEH 4NNXA 1NLBL 4JFEB 4AL8H 2EDOA 4A6YH 5TDOA 5TH2B 4Y0GA 4NFCA 2VJXA 1I3RB 3ULVF 3G5ZA 2X4RB 4HK3N 4U31A 3HE7A 3EJYC 4Y1AA 5D5ME 4EVNB 1FN4B 1I1YB 3MRPB 1HDMB 3RVXD 1UH2A 5D1QB 3CMGA 5D7KD 4KI5C 1MFDH 5HBBA 4U1SA 1AKJA 1A47A 1F4WH 5FDYA 4N9GA 1YEHH 4Z7WB 1E4WH 4MB5A 4MQSB 4QOKD 5JORA 4DVBB 4PRID 6FABL 3KJ4C 1G6RB 3NPZB 2BOBB 3GSNH 1NAKH 3B9KB 2HH0H 2OR8A 3TPKA 1FYTB 3WKMH 3QUXC 3GSWA 1J7VR 2MQ0A 5KZCB 1FBIH 4XAWL 5BO1H 4OB5L 1MAKA 5DHYB 2AABL 1IL1B 5L7XL 3PF2A 2CJUH 4G6AD 1D6VL 43C9A 2EDTA 4QYOA 1EO7A 5E4IA 2BVYA 2DQUL 2QQNH 3SDDC 2CO6B 4LSTH 5D7IB 5B39G 1IM3B 4NRXA 1T22A 4X8JB 1JNLL 3H9YA 3N1QC 3SJVA 4KJQD 3DLQR 4GAJL 2D7NA 2O5XH 4PRHE 2FWOA 2N56A 4PB0L 1SQ2N 1FFOA 3OGOE 3ES6A 5EFIA 4P23D 5GZOC 4M1CC 4OZGB 2XYCA 4P46D 5I1CL 5DS8A 2F54A 5F1SA 5JXEC 4LSPL 5TDNA 4H26A 2YUXA 5IV2A 1XGQB 1Q9LA 4ORGB 3BIKB 7CGTA 1X4XA 2AV1B 4G9FA 3TO2B 1VFMA 1JGVH 1OAYL 4TTDD 4G42A 1AHWA 1DUZA 1CDGA 2DWEA 2P8PB 4HX1A 4HS8L 1RFDH 5ITBL 3N9GH 1RZJL 2YD7A 3GSQA 4JG1L 4NM8H 5E6IC 3C08H 2I07A 1NLBH 4OKVB 4WFHD 5D72L 1DFBL 2FO4A 3FFCD 2Q7YB 3T0ED 3SN6N 3SKOA 3L3KA 4GS7B 5EULV 3QJFA 4LLYA 5D1XC 1OP5H 5JHDB 1TVDA 3CMOL 3NCEB 1Q9KB 3K2UL 4PJ9C 1I1AA 4PG2C 2E7LA 3ROLA 4MWFB 5KVEL 3BDBA 4Y4KA 3PGDA 1N6VA 2VLRB 1YEFL 1K5NA 4G5ZL 6FABH 3K4AA 3KPOB 3QDGB 4FTVA 3IDUA 1P2CA 3PABA 1S7UA 3KYMB 3FJTA 3AAZB 3B2UC 4O2FB 2C26A 4XAWH 1R3JA 1I85C 4OB5H 4QHLB 2AABH 3FKUS 3U9PL 5L7XH 1JZ3A 1D6VH 2VZUA 4JR9L 3ZKND 1KIPB 2DQUH 4LHUB 3G6JE 4KRNA 4NSKA 4ZQKA 3O11B 1QSFB 3L1OL 4Y4HC 4NQSA 3RGVB 35C8L 3SCMD 1F97A 1JNLH 4PJAE 2V7HB 4OCNC 4YC2B 5J0BA 3CK0L 3T09A 4MD0B 4GAJH 3QWRD 2YRLA 3CSBA 2G5BB 2VOTA 5D7LE 1NC2D 5CD5D 4WFEE 3V5DB 5I1CH 5JDSA 4FXGA 5GRYA 1XF5B 1HHJB 4LSPH 1T2QL 4Z7UE 5DEGA 2BHUA 1F6LL 3PGCA 1EVTC 4XBPA 1Y6KR 5KG9B 1H3VA 1OAYH 4ZFFB 2BOCA 2EIZA 1BFVL 1G7LB 3KPNA 4HS8H 5ITBH 1RZJH 1O7SA 1UACL 4UV4L 4JG1H 3REVA 4LRIA 3VE0A 3H42L 3KJ6L 4DOHE 4LNRA 5D72H 1A6AB 1DFBH 3C6SB 3FQWA 5EG6C 4HKXA 3TP4A 1D5ZB 3KPRE 1X5KA 1BQHA 1YMMA 3VFVB 1K8IB 2P49B 3HZYA 4JFFA 3RY5A 3RI5F 3WIIL 2X40A 3CMOH 4R7NA 4FABL 1BVZA 3K2UH 1RJLB 2IBZX 5KVEH 3ZDZF 4QHUA 1I8IB 4CNIA 4PJXF 1YEFH 4K9EC 3VXOB 4G5ZH 3RUGF 3RWGA 3TH4T 1ZHNB 1KTLA 2NX5E 3L3HA 3G5XB 2VDOL 1F8TL 5HYJE 3EYVB 4YPGB 1T1ZA 1PZ5B 2IG2L 3X3FL 1DANT 3D0LB 3U9PH 5DJ8A 5T1LD 5EUOA 4KC3B 2ZUWA 4JR9H 4QNPF 1G7QA 4HZLB 1WGOA 1JHKL 3HE6D 1ODAA 1JK8A 1PKQA 2QBWA 4PBWD 3L1OH 4U3XA 5JTWA 1BLNB 1OGTB 2XPGB 35C8H 4ZMAT 4EN3D 1V3LA 3VA2C 3Q3GB 5IB1A 4H20L 4M02A 1Q38A 1I1AC 4ZOEA 3T0XA 3CK0H 4L8BB 1M71B 2VRAA 5E9DB 3MUZ1 1IMHC 1UB5A 3STBA 2YKLL 3MLYL 4GQPH 5F89A 2VZOA 1J8HD 1YZZA 2Z8RA 1T2QH 5I15L 4GBXB 4OZFA 5DWUL 1FDLL 1NANI 4HHAB 4ZFZB 4GW5B 5C0CB 3UTZA 5FEBA 2BMKA 3VRJA 2DLTA 2BVQB 1HSAB 3B3IA 4WFED 5F6IB 3BD4A 1BFVH 1AC0A 5ACLA 4HD9A 4MCZA 1UACH 4KQ4L 3SDCC 4UV4H 4AEEA 3ZTJH 1BWMA 3H42H 4LVHC 3KJ6H 4QHNB 3DVGB 3UZEA 2VABA 3MUGB 2WIMA 2HLFD 1QLRB 4NOBA 3PV6B 3U46B 3RTQD 4M7JL 1EJ6A 5ACMA 3WIIH 3FRUA 5CP7B 1LEGB 1QHPA 2WUCL 2CUIA 4FABH 1MCWM 5F1IB 4ZXBA 2KBGA 3D3VA 2OL3B 1O0VA 3MCLL 4XRCA 3LN5B 2NTFB 3VI3E 3KPRD 1TQBC 1U9KA 3N1PC 1NJ9B 5E00A 1R6VA 4TUJA 2EE9A 4DZBA 5E8EB 1MAJA 2VDOH 1F8TH 4I5BA 5JPNA 3H9ZA 4M7ZC 3MRNB 4L3EE 2IC2A 3EKCA 1NFIB 4G43B 4P3WA 2IG2H 3X3FH 2FGWL 3TT3L 5F1NA 5CJOL 5BRZD 4XCNA 1U93B 4R96B 4L8CA 2R29L 3FOMB 4YE4L 2RB8A 1JHKH 5HHPA 1JUFA 2QADD 3U79A 3ZDXE 4LFHD 1N59B 5EO9B 2ZOKB 4WWKD 5ALCL 5FO9B 4F7TA 4H20H 4YHIA 4JFXA 2VKXA 4X4MA 4C83B 3FB8B 4FFWD 2CR3A 4M03A 3HZKA 4FG6D 1UZ8B 3L9RB 3OJDA 4WY7L 2ICWB 4MNHB 4R26H 3PXJA 2ENYA 3QYCA 2OMBA 2YKLH 3MLYH 5E6IB 4WUKL 4OSUL 1K85A 1PLGL 2H1PL 3TEUA 5I15H 5HYIA 1CFNA 2EC8A 4E41B 1FNGB 2EDRA 5DJ6A 5DWUH 1FDLH 2ZSWB 2D4DA 3I3EA 4EUPG 3I6KA 4NO0B 2ITDB 4X83A 3WSQL 3H6JA 1JWSB 2VDRL 4PV8A 1A6ZA 3SDXE 2VH5L 4PJ9B 4Y5YA 4KQ4H 4FQJL 2LTQC 3JV5A 4MD4B 3FT3A 3QWQB 2FO1A 3V7AG 2EE2A 3LEXB 4E42B 5BJTA 3HZVA 3N1GC 3CNKA 4TUOA 4M7JH 2D3VA 5CSZA 1PEZA 3QQNA 4YFLF 2WUCH 4JJ5B 5JW5A 3M17A 3RVVD 5K33A 1G9EA 4LLDA 3MCLH 3R0NA 4F57L 4X5XB 5HHXL 1KLUB 5CP3A 4OF6A 4UB0L 2P5EE 3B4NA 3PHQA 4I48A 5EBMA 4Y4HB 1FVCB 2FIKA 5ILTL 3W39A 2YN3A 5HHOD 4DZ8B 3QQ3B 5CWSA 4N0UB 4HH9B 1BPVA 1NUDA 1KN4L 3U6RB 2FGWH 3TT3H 1ADQA 3CUPB 5CJOH 4H1LB 3KYOA 3WYRA 1N0LA 4XXCA 3PQYD 2I27N 2R29H 5SWQB 4YE4H 2C4FT 3V95A 2OJEB 3CX5J 2E9WA 4S2SA 5FM4A 2Q3ZA 3MFFA 3T1FA 1JNHA 1ZK9A 3KYKL 5FM5M 1FNAA 2KQMA 5ALCH 4L3ED 4GRWB 3EIFA 5E2VH 4Q97A 3BKJL 3QNXA 1GHFL 3GJEA 4D0CB 2R2HB 3CZFA 4WY7H 1S7TB 3GMNA 3V52L 1KXTB 1BOGB 2JF1A 4WUKH 4F7CA 4MD5B 4OSUH 1PLGH 2H1PH 3VXSA 3DVNA 4BH8B 3ARXA 4P2OD 4I0PD 4PJIB 3DVIA 3VW3L 2BERA 5LVEA 2CRIA 4ZSOA 3NCFB 3LQZA 1TENA 3DUSB 4YDJB 4TULL 4N1EA 1YMHB 2V2TA 3NN8B 9CGTA 3WSQH 5A43C 3P9LB 4NHCL 4ZAKA 1XF2B 4R4FL 2VDRH 5ANMB 5CSGA 2VH5H 4JHAL 3NABL 2WBJA 2ESVB 4KJWD 4FQJH 3OZ9L 5DVKA 4KKBD 4OJFL 4MNQB 1F4HA 4TN9A 2UZIL 4PGBB 1X3DA 2XZAL 1DUYA 4MCYA 4HC1A 1JPGA 2IAMA 4ONOA 4GT7A 3MCKB 5FO7B 4JZOA 5AAWA 5HDBE 5DD0L 4AEFA 5SX5K 5HGHA 3ARWA 1AC6A 2ZZUT 3FN9A 2YPKB 3VFOB 4F57H 5DZNA 2K7PA 3IU3B 5HHXH 5ENWB 1B90A 4UB0H 3Q48A 3IF1B 1FHGA 5ILTH 3QXAA 1N64L 3RDTD 3BYTA 1XIWA 3FO0L 2MHAA 1KN4H 4NO5A 3T4YB 5KVDL 1FPTL 5SWZA 4BQ8A 3TCXA 2P5ED 2YWZA 1BD2E 1G7HB 1U3HD 3BYYA 3GSOB 3ET9F 1CGTA 3KYKH 2OJZL 3ARTA 1AGDA 3QUZB 2M26A 4X4YA 1U8JB 3BKJH 5BS0A 1GHFH 3F7PC 1A3RL 2BSSB 2VXVL 4WDIB 5BZDA 1CWVA 4NQCB 3V52H 3P0GB 4CRPA 2Y06L 3SDCB 2D4FA 1OTTD 1T04A 4P48A 2B2XL 1F11A 5EO0B 2GHWB 3UDWA 2W0KA 3VW3H 2NY1C 4HUMB 2DL2A 5HHMB 4FRWA 3HB3D 3OWEA 1U8HA 1S7SB 3IAPA 4TULH 4RX4D 3TZVB 1JYNA 3LQAL 1J5OL 2Y36L 1FL6A 4NHCH 3OKDB 4R4FH 1YNTA 1NGZA 3N1FC 1I8KB 4JHAH 3NABH 4XNQB 5DYOB 4UOW0 2X05A 4OZHB 4IHOB 3OZ9H 3EO1B 4OD3L 1IZJA 4GW1B 3ZSTA 5J6GB 5FUZL 4LOUC 1CIUA 1IEAA 4JANB 5IWLA 1DEEA 1CXHA 4OJFH 3O81A 4OFDA 1T5WA 1BQLL 2UZIH 2XZAH 4L9LA 2VISA 1FFPA 2D9CA 3PHOA 3ZHKA 2IH1B 4P2QA 2QHLA 5JHLH 1XCQA 3FOLB 5DD0H 3W9EA 1UFUA 4MA3A 3QPQD 1QPPA 2WAHA 4XBEL 3BJ91 4MXWL 1BFOB 1V3KA 1WQVT 2IF7A 4JRXE 5SWSD 2EKSA 1CG9B 4OCMC 1WBXB 1WBYA 3DGGA 4ZDHA 5F7YC 3T8XB 1S7QB 3E8UL 1ZT7A 4NYLA 5KSAD 3QEHB 4IJ3C 1JF1A 2JCCF 1N64H 3HG1E 2M8XA 3GNML 3TJHC 3FO0H 3T3PE 1M7DA 2X89D 4NCC2 3FRPG 5KVDH 2XICA 1PYWB 5HVHC 5AYQA 1FPTH 4KH2A 3HI1B 2VIRB 4ERSL 4YHPA 2D7TL 2JLLA 1RV6X 1Y0LA 4JFEA 1LE5B 3OAZK 2OJZH 2X4RA 3RWJA 3SEPA 4X0KB 4P2RE 5I0DA 1U3YA 3QIWC 1A3RH 5C09E 2VXVH 4HULB 4XXDA 3WXWL 4HFWA 4EQ3A 5DQDL 2Y06H 4KRPC 4PRAB 3VFNB 2ZSVB 1I4FB 2LTQB 2B4CL 4UU9B 4Q6IC 5B38B 1S9VB 2B2XH 2GSGB 5F8QC 3V7AE 4RGNC 2FATL 3RNQA 3UTSE 5IVNA 3F62A 1EEYA 4LRNL 5T5NF 1FYTA 1WV7T 3LQAH 3MRLA 2Y36H 4Y8AA 5I8EB 3HFML 4M3JA 5I1LA 2EYSB 4RISH 4FQQB 1FNHA 1JPSL 2W9LA 3FO9A 1IL1A 1E6JL 1BQUA 1S5IL 4X4XB 4OD3H 4Z5RB 1XGRB 1MHHA 2P47B 5FUZH 2RQ8A 5I1DA 2HT2C 1I8LA 5D2NE 4LKCA 4GRLA 4X8JA 1BQLH 5I74B 3VRLF 3T0AA 5A2IH 1ZVHA 1FL3A 5DJCB 3U0WL 1INQB 3DETD 4B0MM 3HMXL 4QRQA 4XAKD 4XBEH 3UDWC 3CSYB 4MXWH 4XGZB 4MNGE 1OP9A 3G04B 2VQTA 3IS1X 4JFDB 4PJ7E 2XI9A 3ARBA 43CAB 4CVWA 3E8UH 5DI8B 1HSBB 2E8ZA 4ZYKB 5T1KB 4IDJL 5D93C 1D5BB 3WNOA 4PTUB 1I7UA 3GNMH 1PD6A 4P57B 3ILPA 5T3ZD 2D0HA 3TO2A 1DJSA 5F9DC 5L8KB 4JZNB 2EICA 4XC3L 4PV9A 3UTQB 4D2NA 5IWLC 2PO6D 2KZ1B 1OSZA 4ERSH 2D7TH 3PWNA 3KDMA 3H7BB 1W72L 3HG1D 4YDVB 3O4OB 4ZS7L 4V1DA 1YC8A 2IADA 3CFIC 1NANH 1X5HA 2PW2B 3HZMB 1NAML 4MZ2A 3CGTA 4NQEB 3WXWH 2HTKD 3VFWB 5DQDH 5EU3A 1Q9KA 4G6FB 4S1QL 2B4CH 1AD0B 1DP0A 1YQVL 5H2BB 2VLRA 1S8DB 4P2RD 4KKCC 5C0EB 2VLKA 4LEOB 3DI3B 5C09D 2FATH 3MRGA 4OCYL 3X14A 4LRNH 1F6AB 2GJ6E 3HFMH 4YO0B 3T0VA 4JFPA 4O2FA 4LDLB 1JPSH 4PJ5D 1HXMA 3P0VL 4XMLL 5EU4B 5FGCB 1E6JH 5LGJA 4HKBA 1S5IH 1CD9B 4S10A 1EZVY 1FNSL 2LFGA 2Z93B 2DJUA 4ENEC 4N8PA 4LHUA 1KJMB 2UY6A 3PDDA 3UTSD 1QSFA 1YJDL 3RGVA 3AY4A 4WUUA 3SKNA 2NYYC 5HYSB 3ZTJG 1HQ4A 4P4KB 2ZUQC 3H2WA 3U0WH 4Y16C 3HMXH 2G5BA 5J6HA 2Z8SA 3P40A 1VKXA 5D7JD 1DSFL 2FJHA 4IDJH 4L9DA 2E5EA 2EDLA 2YBRA 3V5HA 1T0PB 1RZ7L 3HA0A 4XC3H 4Q9RL 3QIUC 4DGVL 3B9EA 3LIZL 2DKSA 4AG4L 2G75A 3DNKA 4OLZL 5E2UL 1W72H 1QFWM 4WI7A 4WHYH 2NY1B 3C6SA 3NZHL 4ZS7H 1SJXA 1BHGA 5DJXB 4PGEB 2UWEE 4KRMB 3S35X 1K8IA 1J0KA 3H3PL 2CIIB 1BFSA 1NAMH 3RY4A 2DTSA 3TFKC 4ZODA 3ARBC 5C2BL 3RWEA 2JJSA 3EYUL 5EZIL 5LQBL 4S1QH 2FHBA 1WC7A 2X4SA 1I8IA 1QNZL 1YQVH 5LGKA 3F7YB 4OCYH 1AXTL 2D0FA 4P9HC 3G5XA 3MRIB 4RGMC 1ZGLA 3IETB 5IMMB 4XCEA 2QJDA 4U1NA 4AT6B 3P0VH 1GIGL 2K7QA 4XMLH 3RVXC 4OLXL 1RK1B 4PJXB 5KS9E 5DFTA 2DLGA 2W0FB 1HKFA 3RUGB 3WS3A 4KV5E 4HZLA 1FNSH 3TCLA 3C2SA 3MZTA 4LSSL 3OKLA 3DYPA 3GI9L 1YJDH 4IJ3B 5EA0L 1QD0A 3L3IA 2VLLB 1BLNA 1OGTA 1NEZG 4NJ9L 3PWPD 3W0WB 3UTTE 1NH6A 4CU8A 1ERNA 1S7XB 2HFEA 5E9DA 1HH6A 1KTKE 2H26A 3WKNA 2AERT 1EEQA 2PXYB 15C8L 3BQUA 1DSFH 4JO4L 5I6XC 5FOBA 4G6AC 2HMID 4KK6D 4GBXA 3C8KB 2A6DA 4DEPC 1GGTA 2D7MA 1BVLB 5K9JL 1R3HB 3BSZL 2BVQA 4HMCA 1RZ7H 4Z7QE 4KJQC 5GGUB 4Q9RH 4HUUB 4NCC1 4DGVH 3VRIA 3LIZH 2OP4L 4PJCF 4MGXA 1QLFA 4AG4H 4OLZH 1BX2A 5E2UH 4X80L 4P23C 2DAVA 2V7NA 3NZHH 4P46C 4PRDA 4RGNB 3CFDA 5HVWA 4W4OC 3PV6A 3G08B 3JWDC 3H3PH 2O26U 4GKNB 5F70A 2F8OA 5GS0L 5JPMA 1LEGA 5C2BH 3EYUH 4IRSA 5EZIH 5LQBH 4TTDC 1DQJB 4IEFB 3EUUA 1QNZH 1DQTA 4S0SD 1LP9E 3MV8B 2AXFA 4TNWF 5IGXL 3K1DA 1NJ9A 1ZHBA 1X7QA 5H8DA 1AXTH 1RURL 1P5VA 1ROWA 2MWCA 2Q3AA 3T0EC 5C0RL 4EXKA 1QSVA 2DM3A 1GIGH 1M7XA 1J9CT 1IQDA 4OLXH 5I1HL 3U7WL 4ODXA 4UV7L 4PYGA 2J6EA 1NGQL 2I9TA 1QFUL 3MRJA 4JKMA 4LSSH 4NPYB 3GI9H 4Y19B 5EA0H 5D93B 5HXMA 3WJLA 5EO9A 3NIGE 3VGAC 4NJ9H 2FX7L 3NH7L 5M94B 3NTCL 3ZHLA 4LMQE 1IKNA 1S78D 2KKQA 4H25B 4LF3B 1UZ8A 4F3FB 3SE8L 5IB2A 5T33L 1W0YT 3MYJA 4WFFE 4L8SB 4FFVD 15C8H 3RX5A 4JO4H 5IMOA 4ELMF 4G8GB 3GM0A 3ZKNC 4GKSB 5ESAB 5FM8A 1ZHKB 3BGMB 2CQVA 5GRWA 1WFOA 1PX3A 3BSZH 5K9JH 2NZIA 3BEVA 4KK9D 4X6DA 2OP4H 4HEME 4YEEA 3V6OA 5C70A 2X4PB 5E7BA 5KOMC 1UZ6F 1QPXA 2YD4A 1UM6L 2IANE 4LPXA 3U36A 2YK1L 2HYMA 3LEXA 4N68A 4NT6B 4RZCB 4WI5A 1YEEL 3O6FA 4YHNA 4ZOCA 5TGBB 5L8LB 5GS0H 3BQUC 5L0QC 3I85A 3MXVL 3BH8B 2YPLA 3AROA 3OF6A 1JHTB 1UJ3A 4YGVA 1JVKA 2ILLA 5D1ZC 2BCKA 3QO1A 5IGXH 1MRDL 1UXSA 1XH3B 2BRQA 3TYGL 1RURH 4PP2A 3RHWK 4QRRD 3VXRB 3KWWB 1YPZE 2P8LB 3QQ3A 4HLZH 5C0RH 5BOPA 5JR1L 3BGFB 3QG6B 3PWVA 4YXKL 1G7PA 5I1HH 3U7WH 4Y2DB 2Z35B 4UV7H 4H1LA 2BRRL 5SWQA 1NGQH 1TNNA 1QFUH 3ALPA 2OJEA 4ESKA 3QJHB 5CINL 3O3UN 3HS0B 5DMKB 2FX7H 3NH7H 2VLJB 1OLZA 3NTCH 4IRSC 5GIRB 5F7UA 4J3VA 5EN2B 2Z0BA 4GUPB 3QDJE 2H2PC 1UM5L 3SE8H 4R2GD 5T33H 1MRCL 4N0FB 1KIQA 1DQLL 5C2UB 4I1NB 3OX8B 4BH8A 4HIHB 4MXVE 4DGYL 1AI1L 3VXUE 5E95B 3HE6C 3K46A 2XN9B 3MBED 4YDJA 2EDNA 3NN8A 4EN3C 3VWJD 4XP4L 3LDBB 1AD9B 3GHEL 5C0AE 5ANMA 3MRQB 3DURA 2VWEE 5I1JL 2AEQL 3IKCB 4PJBA 4U6XB 3TPUB 3TYFB 1GAFL 5MENB 1YYML 1DL7L 2R1XB 1A6TB 1UM6H 2YK1H 3HC0A 1Z9OA 4MNQA 1YEEH 1X5JA 4ONFL 3GJFA 4RGMB 3GKZA 4CJ1A 4R4BB 1MH5B 2EDFA 2ED7A 3MXVH 1HN1A 3GSRB 5K9KB 1HWHB 3K8LA 4LLWA 4NDMB 5F7DB 3VFOA 3ZZ1A 4O02L 2BNQE 3IU3A 5ENWA 3RJDA 3MV9D 4M5YL 4YHYC 3UP1A 1MRDH 3FT2B 4Z77A 2Y5TB 4QOKB 4AEHL 4ODSL 5FYJU 3TYGH 4XPTL 2Y07L 1I1CA 3UYRL 5JR1H 1IT9L 2XWBA 3VFUB 1QP1A 3T4YA 4YXKH 3D25A 3QFDA 5IESL 1Y6MR 2HRLA 4RMRA 2BRRH 4M48L 4PJCA 1WFNA 4Q58C 4YWGL 4HG4K 3LVEA 2DYPA 1AGBA 3O6FC 5CINH 3LCYA 1CD8A 3UPAA 1O7VA 5SV3A 2YD8A 2EZ0C 4DEPB 1RHHB 3QUZA 1ORSB 2QKIA 1U8JA 3DO3A 3ULVL 1TCRB 5FGSA 1L7IL 3T77A 4HBQA 4LK4A 2W65A 3UAJD 2NY3D 1RJCA 1UM5H 2YD9A 4NWUL 4OZIF 1MRCH 4TVPE 1JCKA 3TT1L 1DQLH 4F2MB 1U8NA 4DGYH 1AI1H 1Z0NA 2HJLB 4LNVA 1RIHH 4X6FA 4J23A 4NN5B 5HY9A 3QDJD 1MAML 1AXSB 3BZEA 4PY8I 4XP4H 1F00I 3G5VA 4XVSL 2DRUA 3GHEH 3OKDA 4FFWC 1DANU 2EO9A 4FG6C 5I1JH 2AEQH 2ATPB 4NKMB 1GAFH 1NCUA 1YYMH 1DL7H 1I9RL 3LKSB 4GW1A 5J6GA 2ZOLA 4JANA 5GS1B 4PRBA 5I8CB 3FFCB 3RIFF 3T0EB 4PG9B 4ONFH 4JFOB 3RZCD 3C5JA 4GG6E 4MJIE 1D9KD 1EXUB 2IQAB 2YA1A 3LMJL 3BWAB 1XCTB 4PTTB 1V7NL 4O02H 1NBQA 4WI3A 1HEZA 3VD7A 4UUJA 1ZKAA 3RY6C 3OKNB 3GMOB 1M1SA 1WBXA 4JDZB 3VH8G 2J5LB 2YZ8A 4JO2L 4M5YH 2EDQA 1S7QA 3ZKSD 4ELMA 2E27L 4OV5A 4ZUUA 4AEHH 4ODSH 3D39A 3AS1A 1ZWIA 1MVUA 4XPTH 3SGDI 1B0WA 2Y07H 2VAAB 5I17A 2P8MA 3BKCL 1NUGA 4YAQB 3UYRH 1GGYA 1IT9H 2AV7B 1U95B 3V9FA 4PLNC 3P73B 5IESH 3FB7B 3UBXA 1FZKB 4M48H 3QBTB 4LBEB 4YWGH 2JCCB 4YBHA 5FUCC 2H41A 3N06B 4KDWA 5CCKL 3L3GB 3VXPB 2GEEA 1DBAL 1EMTL 3MQIA 5IB4A 3U2SB 1UENA 1UQSB 3ULVH 1B9ZA 3SCMB 3ETBF 3V7MA 1L7IH 2J12B 1ZS8A 5IVXE 3QEQA 1K3IA 5EIIB 1MCFA 1EHNA 1FGNL 4NWUH 4PRAA 3V2AR 1I4FA 2C4XA 4PP1C 3TT1H 2P5WD 4UU9A 5DK0A 2R23B 1NC2B 3WL9B 4UT9L 1RSFA 4LDOB 1KPRB 4I2XA 1I7TB 4RNRB 4OZFH 5MERB 1MAMH 3R8QA 1JTPA 4HUKB 2DL9A 4XVSH 3DX7A 3P9WB 4U1IB 3U30C 1EX0A 4BUHA 5FOJA 4KFZC 2R0WL 4OLUL 4X4XA 3LD8B 2CK2A 3LRGA 1S7RA 2DMKA 1I9RH 4NC2B 1OQOA 4Z76A 1YY9D 2X2YA 3S7GA 2X70A 4JM4L 3WBDA 4M7LL 1MF2L 3SOBL 5C08A 3QRGL 4Y8DC 1QFHA 1GGUA 4YHLL 3LMJH 1NEUA 4X9BA 5DJCA 4WHYG 1GOGA 1GGBL 1FP5A 1YEKL 3BP6B 1G7IB 1V7NH 1I3VA 1Q94B 2HAZA 3C5ZA 4M8QA 4XGZA 3G04A 5I1GL 4B50A 3BRFA 4P5KB 1JZ5A 1IJ9A 4KJWC 4JO2H 4OIBA 5DI8A 2E27H 4M4RA 2GSIB 4MJID 1NDMB 5T1KA 1KULA 3VWKD 3DIFB 5JW4N 3BKCH 4ZFOB 4KKBC 5ID1B 3BOVA 2R2CA 3LKRB 4JFHE 1E28B 3L3JB 5J13B 1IAKA 1BF8A 4PRPE 2H32B 3T2OA 1IEBA 3ARGD 3V0WL 1ADQL 4U1GC 3ZDYE 1ED3B 3TA3A 4BYHA 4MA1C 5IK3B 5CCKH 3HE6B 1U8OB 4TQEL 3IFLL 3BZFA 3B9VA 3EYOA 1DBAH 1WWBX 1EMTH 3MRDB 4PJEE 1DBBL 3QEGL 3VDCA 1Z3GL 1PVHA 1QSEE 5SV4A 3WN5B 3RDTC 1FGNH 4Z7VE 1T83C 1HH9B 1U42A 4M1GL 3DX8A 2VITB 4N5EC 3G6JB 1MEXL 3MRBA 5H2BA 4UT9H 5FM5O 1S7WA 5D6DC 1IGYA 1S8DA 4K3JL 1U3HC 2H3NA 5L2KA 1VPOL 1H3GA 1J8HB 2AQ3A 2HVKB 3FZUD 1C08B 4P99A 5MEQB 3OKOB 5TF0A 3QUYD 2COQA 3S9DB 3WLWD 4JRYD 4JG0L 1IKFL 3BI9X 1LEKB 2R0WH 4OLUH 3WD5L 4CMHC 2CKBA 1KIUA 3ARFA 3FO1A 4ZO7A 1OTTC 1KSRA 3T4AA 4O2EA 1KJMA 4Z7UB 2CIKB 4JM4H 1SJHB 4M7LH 4Z7WE 1MF2H 3KXFA 2L0DA 4K3HA 1P84K 1ZHLB 3SOBH 5CJ5A 2MCPL 3QRGH 3I50L 4XC1L 4P4KA 3HB3C 4YHLH 4HC1L 4HQQL 2P46B 3RTQB 2YXFA 2BSTB 5C3TA 1GGBH 2WW8A 5JW3L 2JTDA 1DLFL 4M93C 1HI6A 1YEKH 5EZLB 1SYSB 4RRPA 2GJJA 4OZIA 3ORJA 3PL6A 2V6HA 5I1GH 4DOHB 1KOAA 1U92B 3AXLA 1N7ML 2WINA 3F7VA 4LCCA 3H9HA 5CP3H 4XX1E 4XWOD 3KPRB 3T08A 5J11C 3TBWA 3QXUA 5JA8B 4K71C 4C56A 2OTUB 4I18B 2FEDD 3QO0A 3PP4L 5D7IE 1G7JB 3QIBD 3EGSA 1MI5D 1FCCA 3IDYC 4N0CD 4N8VB 3LPGA 5HHQB 3V0WH 1ADQH 1ONQA 3E2HC 4ISVB 4ONHA 1HXYA 5BRZB 4K8RD 5JO5B 3TVMA 4TQEH 3IFLH 2QADB 1UA6L 3Q5YA 3QXTA 2NX5B 3OXSB 4LSRL 1RUKL 5KSAC 4WWKB 4D94A 1DBBH 2AJVL 3QEGH 1Z3GH 4L4VE 3C5ZC 4PRPD 3MMEB 1ES0A 3VFTB 3VD3A 1Q9OA 1QBLL 2A1WL 2FR4B 5IMLB 4QHKI 5DD3L 1DZBA 4YIQA 1LD9B 5A40E 4M1GH 1I1FA 1MEXH 2F74B 3TBTB 3OKKB 4K3JH 3O8XA 3N0PB 3W9DA 1VPOH 2CXKA 3EDJA 1KLGB 4XVUC 4FNLL 2FH6A 3BD3A 2YWYA 4WU7B 4XTRD 4BZ2L 1J8KA 4G80B 1MCQA 2MPAL 3TA3C 4AT6A 4OQTA 1RK1A 5J89A 5IB3B 4JG0H 1WISA 1IKFH 5JHDE 3WD5H 2R1WB 3ZKQD 5TDPB 3S5LA 2Y7QB 5I2IB 3QB7C 2VLLA 2GFBA 2IJ0C 2MCPH 3I50H 4KI1A 4ODVH 4XC1H 3SPVA 4PBVC 3BH9A 4HC1H 3T65B 3RKPA 4HQQH 1A1NB 5L2JA 2O61A 4MHHI 5JW3H 1DLFH 2ZG2A 4G7YL 2GW5A 5IM7A 3KPSE 4PJGF 1P1ZA 1T7ZA 5DC0A 4PGZA 2PXYA 5IVZB 1N7MH 1U36A 1KN2L 1TVBA 1U58B 3CDGB 1PX4A 3CFEB 5ISZA 4GKZB 5JUEL 3MGOB 3PP4H 3GSXA 5HHOB 4PJHA 1AFVL 1WJ3A 5J3HD 4N90E 4HUUA 4WW2A 1MELA 4HLZG 3PQYB 1G0DA 1WCBA 5I66A 3K80A 2CUMA 5J9PA 3CH1A 1UA6H 4NQDA 1YN6B 4LSRH 1RUKH 5B39B 1P9MA 2ICEB 5ADOL 2AJVH 1ACZA 1I9EA 4L3EB 5FKAA 3PL6C 1QBLH 4MAYD 2A1WH 2D03L 5EOTB 5DD3H 4NC0B 5INCB 1E0OB 1NPUA 2PYEE 5A1AA 4PLKD 5IBTL 3B5GA 4HEPG 2PO6C 1PG7L 2HG5B 3D1MC 3MV8A 4X5LA 1JF5A 1RQ5A 4P2OB 4L4VD 4YXHL 4I0PB 3IDIA 4FNLH 1ZEAL 4IM8A 4R7DB 1CDYA 4BZ2H 4NQXB 4L4TA 2MPAH 3WIFA 3TVMC 4QRUB 5GZND 3CLEL 3RQ3A 3NPSC 1A21A 2HTKC 5CGTA 3O3AA 3TIEA 1KB5A 2VXTL 4MX7A 3HAEA 1NCAL 1U3JA 3OXRA 4PJ8A 1AE6L 1XT5A 3GGWA 2AK4A 4ELKA 5C07A 4M3KB 5ID0A 1NSNL 4X6EA 4UQ3B 3KPQA 3OJ2C 1LGVA 1FVDA 4G7YH 1H5BC 4U1GB 1XGUA 3MLSL 1JWUB 2Q76B 3W5MA 4RA0C 3MV7E 5GGRB 5I71C 2BNRD 3QSKB 4MA1B 4WNQB 4KKLD 1KN2H 2BVEA 3P4MB 4QT5B 4Y5XC 1ZT4B 4H0GA 4FS0A 4HS6B 3UMTA 2FJGB 5MHSE 1PGRB 1UT9A 2NR6D 5JUEH 1AFVH 4UDTB 1MRFL 4N0RA 3RDTB 1Z5LB 1QRND 3PGFL 1MWAB 1RK0B 2AXGA 3MLTB 2IALB 2ZPKL 4L3CB 5F3HA 1D5MB 1MCHA 5JMRA 1DEDA 1T20B 4PGJA 2P5EB 5DRWB 2VSDA 5D7JC 3HI6L 2EXWD 1U3HB 4O2CB 2FLRT 4MDJA 4M61B 3VCLA 5ADOH 2C3HA 2AS5M 4MQ7A 4HDIA 1DR9A 5FGBA 1OP3K 2D03H 1S3KL 1CE6B 2YS4A 1NFDA 3LKPA 2W92A 3WUWB 2P24B 5IBTH 1SEBA 2MKLC 1U8PB 1JHTA 4OZ4A 1PG7H 1CDIA 3L6FA 2B20A 1KACB 3WIHA 3TH2T 4NHUB 4YXHH 2VE6A 4JEGB 1ZEAH 3U7YL 4PREB 4XP6L 3JWOC 4NN7C 3ZT6A 4ALAL 5K9QI 4FQ2L 4MVBC 4HS3B 4J4PA 2PYED 2AGJL 3QG6A 4M93B 4UDUA 3AS2A 3ROOB 3CLEH 4Y2DA 5FYLE 2QQQA 1OGAA 2X1QA 4YDLC 4LCYB 1P9MC 4HUWB 3DJ9A 4U6HB 2VXTH 3ULUL 5DJZA 4DN4L 3HS0A 1F4AA 5CKAA 1NCAH 1TDQA 4DK6A 4K71B 1BGXL 1WWAX 3L5WA 1AE6H 4FQXD 3B6SA 3UCRA 2VLJA 1CLCA 3BZ4B 3SGDH 2FBOJ 2VZ1A 1NSNH 5T3XE 5EN2A 1QR4A 3E2HB 3MLSH 2FEEL 2NW2B 3OKMB 1BQHG 2JJWA 1TTUA 5SWSB 4M4PA 5IUSA 3BESR 1SY6A 5LKNA 1GC1L 1UXWB 2XKSA 3BKML 4WIQA 2NXZD 1L4IA 5KSAB 1BBDL 3TF7C 1MRFH 4M6NL 1VFBB 1YQ2A 3ARYA 3AS3A 3PGFH 3MV7D 1OD7A 3QFJE 3MRQA 2H9GA 2ZPKH 4EIZC 2Y1VA 2EYTB 3IKCA 4JPWL 4U6XA 2XY1A 1FZMA 2C1PB 2VZVA 4TSCL 1A6TA 3HI6H 5F8RC 5KSUA 3TIDB 4JZJB 4HG4J 3K4ZA 4RSVA 5JA9A 3CCHA 5CIPA 3O41A 2GKIA 2HMIC 4K7FB 3ZYJA 3DMMA 4R4BA 2F9BT 3B2VL 1S3KH 1EZVX 4CMMB 5HHNB 4MS8C 5K9KA 4RMQA 4MLSA 4NDMA 5DJ0A 2FECI 4NBYB 1BD2B 2UVEA 4I0CC 3HUJF 8CGTA 2WV3A 1CE1L 4PJDA 2R1YA 4W4NA 4P59L 3N85L 4XPAL 3HRZB 1BM3L 1TJGL 5EOQL 3FB5A 3O6KL 3EJYD 3U7YH 4XP6H 1W0WB 4ALAH 4FQ2H 3STZB 4RFEA 3PG2A 1GOHA 2AGJH 1J0HA 3IDMB 3NFNB 1CDUA 4U33A 5GJTL 3U9UB 4OZFG 4F7PB 4O4YL 3OTTA 2I9LB 2ARJA 3ULUH 1OTUD 4K23L 1K2DA 4DN4H 3O4LA 2X4UB 1A7RL 1BGXH 4C4KO 3PWLB 4Y1AE 5CHNB 3MFGB 1RHHA 5J06A 4FXKB 3MRKB 1T89C 2LQRA 1TCRA 2X09A 3OAYK 4D3CL 4Z78B 5BXFB 1A22B 4N0UE 3UBXI 2WQ8A 1VHPA 3VA6A 3DRQB 4F9PA 5K9OA 4U6YB 3JTTB 1GC1H 1AO7E 3SDDD 2Y25A 3BKMH 2HJLA 4JVUA 5IW1B 4F15B 1OW0A 1N5AA 1BBDH 4M6NH 4NO3B 3SE3C 1LE9B 1AXSA 4RMUA 2CRZA 1JPFA 4EI6B 3RWDB 1FV1A 1L9MA 1TTFA 4JPWH 4NKMA 2PO6B 4TSCH 4FFVC 2RFXB 5CJQL 5AUMA 5GS1A 3HG1B 3SJVE 4ZTOL 3LKOA 3AU1A 2IBZY 2DQFA 4PJIE 2J8UE 5IW6B 4UT7L 2VL4A 2XKUA 3B2VH 1EXUA 2IQAA 1ACYL 4O51A 3GK8L 1EBAA 3JV4A 3KPMB 3CXHK 4KK9C 4K07A 5JLZB 3BPCA 2F54E 4LSQL 4UI2A 3OKNA 3GMOA 5DJYB 3QXWA 3OKYA 1CE1H 3TM6A 2ESVE 1A4JA 4P59H 5I76A 3N85H 1OP3H 4XPAH 1BM3H 1ZA3A 1TJGH 4P2RB 4WTXA 5D5MA 5EOQH 3O6KH 2QV2A 5C09B 2VAAA 3ZYOA 4G9DA 1KIRA 2AV7A 1U95A 1LNUB 3TBVA 5GGTA 5B3NA 1A1MB 1H5BB 3KYNA 2QSTA 3FB7A 4PJ5B 5CD3B 4LLUA 1MCBA 1VGKA 5GJTH 4O4YH 2J6EL 4XB7A 4Y5XB 5C6WH 3DO7B 12E8L 1V7ML 4K23H 3BGAA 3R1GL 2JB6B 2HP4A 1A7RH 3VXPA 3UTSB 3MACL 1FAKT 2BDNL 3U2SA 3BHBB 4XZUB 3SCMA 4D3CH 3PDOB 4I3RL 3CJJA 1K4CA 1XGPB 1OTSC 3QWRA 4Y5VC 3QA3A 3GFUA 5HGBB 2R23A 4Y1AD 5D7JB 3WL9A 5GS0D 5D2NB 3KLAA 1KPRA 5HGAB 2MOVA 3HCVA 4LIQE 5CFHA 4L3AA 5J56B 1RJYB 2P7TA 1AKJD 4AJ0A 1RZJC 4PRHA 3OKEA 2XA3A 1FCGA 1MOEA 4HIIB 1A1OB 4MNGB 3EDDA 1B6UA 4PJ7B 4ZNEE 4JLRB 5MEOB 3GMRB 3QH3A 2W38A 5J1AA 1T1WB 1BQSA 3IGAB 1OAUL 5CJQH 4WI9A 4ZTOH 5IEHB 3F5WB 4P3DB 5DC9B 4UT7H 4NNYA 4X9IA 5KJRL 1OOAA 3LN4B 1ACYH 4QRTB 3GK8H 2V2XB 2Q86B 4HJJL 4YDLB 4OFVA 5FF6B 5F7KC 5BW7A 4PJFF 3IU4L 4LSQH 1H3WM 5F97E 3SJVD 2Q6WA 3D6GA 4OZHE 1JYVA 2GSIA 3WDJA 4IOFD 2FYYB 1OY3B 4B41A 4RMSA 3L3JA 2F54D 4BQBA 3E6HB 4RAHA 1WITA 5DF0A 5HI3C 1ED3A 3RL2B 3KLHC 2J6EH 5E56A 5ABDE 12E8H 1V7MH 4GG8B 3R1GH 2CUHA 1YMME 4G9FD 4Q9CA 3F58L 4D9QE 3MACH 4JFFE 5A2KH 2BDNH 2G2RB 1P84J 4KU1A 1FGVL 4KDTC 4ZPVB 3PWPB 1WEJL 3WN5A 4I3RH 3QUKB 3OJMB 1BP3B 4A6YB 1H8NA 3MRRA 1CDHA 5FAAA 4CW1A 5KSBF 4X7FC 3G6JA 2YEZB 3RNKB 4FMKA 4PRNA 1YDPB 1T6WA 4W6XB 2MTPA 3NCMA 4NKIL 3RZWA 3JV0A 3SY0B 5D2LB 4PJAA 2FL5B 4WV1C 2P42B 1KPVB 4QY8A 1T0MB 1EGJA 3QHTC 1I1AD 2A73A 4LSUL 3WHE1 3OKOA 4Y4KD 2XWJA 5D7LA 4XBGA 1U8IA 1L0YA 1RJZA 2YUWA 4P3CL 4EDXB 3UAJC 2NY3C 3JV6B 3GSNB 4FTVD 32C2A 4RIRA 1OAUH 5IJKA 5GGRY 4Z7UA 1G1YA 3ULVE 1FQ9C 4PY8J 5C0BA 1WF5A 2OS7A 2XG4A 3OSKA 5KJRH 3G9AB 2CDFA 5FO8B 4YLQT 1J1XL 4KUZL 3T2PA 4HJJH 1SYSA 3DUHA 1HHHB 2PNDA 4GW4B 3IU4H 4RWHA 3DOSA 3CD4A 3VXNA 3DRTA 1QR1B 5JQ6L 1NGYB 3EOAA 1DVFA 4Z8FL 2X10A 2D7OA 2UWEB 2APTA 4I18A 2WWMC 4G8FB 1GCFA 1DN2A 3QNYA 1G7JA 2YN5A 1RZ8B 2X41A 1B88A 2PF6A 4QWWC 1OF2B 1D9KC 4N8VA 3S34L 4BSVB 2WK2A 1LO3L 3A6CL 4ISVA 3U0TB 2XFXA 4H1LH 4WGWB 1MCJA 2VQ1A 2D9QB 5CEYA 3EHBD 1VFUA 5C9JB 5EO1A 1GSMA 2VLME 3F58H 5ICZB 2NX5A 4DVRL 4MA8L 4XH2A 3A67L 5HYJA 3LRSB 3WS6A 1FGVH 5DZOA 5BW7C 5FXCH 3P4NB 2PTTB 1WEJH 3R0MA 3ZE1F 2V9QA 5JIPA 4HIJA 5IMLA 2UYLB 1CFVL 5KS9B 3P4OB 1R5VA 1YMMD 1VADB 4NUJB 1H3PL 1IAII 4ZUVB 1J11A 4TOYL 4JFFD 3HR5B 3OKKA 4NKIH 1T4KB 3GMQB 4HJGA 5GSRA 1PQZB 3I9GL 3MRCA 4X7SL 1C8PA 4XNMB 2OLDA 4WU7A 4H5SA 4LSUH 3S96B 3QDMA 2ADIB 3H7LA 4P3CH 1NGXB 4PGDB 3MRMB 3FHAA 5IJVA 4GLRI 4JY6B 4OF3A 2FECL 4OUUA 3WFCL 2Y7QA 3MPCA 2YZ1A 5I2IA 5GHWL 5JOFB 3RP1A 5JOPE 2APXA 4OLYL 4X4ME 4P5TC 1BAFL 1D6EB 3L7EB 4KJYA 3V6ZA 4JM2F 2R4SL 2CLZB 2YD2A 3GJFH 3OB8A 1A1NA 3WLBB 2EC9U 1J1XH 4KUZH 4Z0XB 1VACB 5EORL 1IGCL 1TZIB 2W9DL 3ULVD 1MFBL 4OGZA 5FGCE 5JQ6H 4Z8FH 4XVTL 1LHZA 4F9LA 1VFAA 2AI0L 1YY9C 2HTLC 2DOCA 3CFEA 2B5IC 1U8QA 2AJSL 4IRJA 2L7UA 2QL1A 4QRRB 4X6BA 2NCMA 4NZTL 3V0AC 2OTWB 3KLDA 1UC6A 4PJGB 1BEYL 3S37L 2X42A 5HJ3A 2GK2A 4XCYB 3S34H 3V0VB 5IJKC 1QUNA 1LO3H 2OSLA 3A6CH 5F7WC 4EI5A 4U05A 2A74A 4AH2B 1SMOA 2E9IA 4LL9A 1LP9B 1D7FA 4YXLL 2I25N 3D2UA 1YN6A 4DVRH 4MA8H 1FZOA 1D5XB 3A67H 4CN1A 5IB5B 3VWKC 1E4KA 1ZE3C 1UB6A 2EDXA 1CFVH 4KXZI 3VI4F 1DVFC 3MOAL 3ALXA 2A9NL 2ADFL 3WO3B 3KPLB 3BXNA 4R2GB 5HYQA 5F9JB 3B83A 1H3PH 3ARGC 3MJGX 4TOYH 2HG5A 3VGDA 3I9GH 4P2OA 4LDEB 5F96L 4I0PA 4X7SH 4ZXBD 2FH8A 1OT2A 3D3VD 2WP3T 3MBEB 1V05A 4NQXA 1DN0A 4JFYA 3VWJB 4F7EA 1CICC 3RIAK 5HPMB 4E5XA 4HF5L 1YC7A 3DX6A 3JBG7 2WIIB 4KROD 3ARDA 3WFCH 3MUHL 1IGTB 5D9SA 4Z95L 5GHWH 2E7HA 1FLRL 1U3ZA 5E5MB 4HAGA 4FP8L 4OLYH 3WNKA 1BAFH 2GTZA 3O9WA 2R4SH 1JFQL 1MLBB 3ZE0F 4BK5A 1AGCA 4YR6A 4ZO6A 1CXEA 1P7KB 3IFPA 4X5WA 3SDXA 2YSSB 4LPVA 5EORH 2Z8VC 1IGCH 1WK0A 2W9DH 1JWUA 3QUYC 2HJKA 1FFRA 2W0PA 3ZDZE 3WLWC 1MFBH 3MLWL 1P4LA 4WNQA 3MGTB 4PJXE 4ZSOE 5JOPD 1ZT4A 3VXQA 3MV9B 4XVTH 4J3TA 3RUGE 3QCTL 2AI0H 4BH7B 4YNYB 2AJSH 3RFZC 1WTGT 4JN1L 3M45A 4X6CF 4NZTH 2XXCB 4ZO8A 1BEYH 1Z5LA 3S37H 5JMOC 2DM2A 1MWAA 1RK0A 3W0WE 1A9EB 3LSOB 5DTFA 1G9NL 4QNPE 3EZJB 1K6QL 1JI2A 1RZIB 5EUKB 3PIQA 4YXLH 5TE4L 3KHQA 4M6OL 2APBA 3VJ6B 4TSAL 4WV1B 4MQXC 3KNBA 4X99A 1YPZB 3O2DA 4XWOC 5ETUA 2IGFL 1UH3A 5C0FB 1JGDB 3KAAA 1AGFB 3CIQA 2FEDC 5LAXA 3MROB 1KXVC 3QIBC 2APWA 3MOAH 4LHUG 2A9NH 2ADFH 2NY3B 3WUWA 4F9LC 5E99L 4YZFF 4BKLB 1UCBL 1MHCB 5C0GB 1U8PA 4IRJC 1NMBL 5GQBA 4WEBL 1KBGL 5T1MA 3O45B 5F96H 3IJSB 1N5YL 4QHKJ 3OHXB 1WBZA 4DW2L 4PREA 1U8LB 4RGNE 3QDJB 3VFSB 1TLKA 4PFEA 4I9WD 3VXTB 4PUBL 3SQOL 4XPHL 4LCUB 4QXTB 4HF5H 3T0WA 2CPCA 4KUCD 4UINL 5FECB 1TMCB 5IOPB 4U6HA 2CKBL 4Z95H 3E6FB 3MLUL 3TBSB 4UOJA 1FLRH 4FP8H 4YK4C 3RWIB 4GAFB 2NY6C 1LILA 1JFQH 2NXYC 2GITB 3RZCB 4APQB 2OBGA 4XTRC 3EFFA 1TVHA 1I8MA 4HWZB 1JF6A 5I8OL 2XOTA 2NW2A 1JYWA 3MLWH 5GRXG 4LOUD 4K3EL 3QCTH 3LKQB 4JN1H 5I16B 3BPNC 4Y19E 2KDGA 4HGKC 2AXHA 4D9RE 3V79C 2HVJB 2OQJA 3VXSD 4ETYA 5E8NB 3K4DA 2BNQB 1G9NH 1Y18A 4NKDB 2APFA 4G8EB 1K6QH 2C1PA 1IC1A 3SKMB 1FNEA 5TE4H 4M6OH 5H35B 4HFUL 5CEZE 1DQDL 4QCIB 3TIDA 3RKDD 3S36X 4TSAH 4ZAKD 1WUNT 5GS2H 4U7MA 2R39A 2IGFH 5B8CA 5IBLD 2JIXD 3TJHD 3OG6B 1G7MB 4WHTB 1DQQB 3RL1B 2V5RA 1F3JA 5AEAA 3GMPB 5FYKE 5J3HC 1IGML 5E99H 1UCBH 1F3DH 5DEFA 1HHGB 1BD2A 5IHZB 1NMBH 1UVQA 4H0IA 4WEBH 1KBGH 2IAMD 3BP4A 3LQAC 4W81A 2AJZB 1U0QA 3U83A 2A0LC 1N5YH 3HRZA 4OF7A 4DW2H 4HKZB 1R24A 4M1DL 5KSVB 3ULSB 4XNYL 4MB3A 4PUBH 3SQOH 4XPHH 1ITCA 4KRPD 4M5ZL 1V8HA 2C3WA 2HWZL 4OQTL 4UINH 4YHOL 2CLVB 2Z31A 1BZ7B 3S88L 1J88A 4F7PA 4X9GA 5J7CC 2CKBH 8FABB 4WO4A 3MLUH 1EO5A 2FJFA 2AXJA 3QULA 4U1LA 5E1AA 5DQJB 5T5NG 4CVXA 5CHNA 2B5IB 2FZ3A 3NBNA 3DECA 5KW9L 5SWZD 1Q0YL 2DICA 1KJ2A 3DUUB 1BZ9B 1OSPL 1TXKA 5ESQA 1PG7W 1WIOA 3D87B 3PXHA 5I8OH 1HWGB 1XR8B 1ORQA 5GZNC 1LK3L 1HQRB 1TZGL 3DRQA 3CXHJ 3IJHB 3WNLA 5BS0D 4K3EH 5BMFL 5IW1A 1BFTA 5FA3A 4GG6B 4MJIB 1VEMA 4HCRA 4X7CC 3VWKB 1B0GB 4HT1L 3CFBB 3O3DA 1OWWA 2XT1B 3C60A 3RWDA 4IIQC 4JFQA 4O5LL 5F72S 1CT8A 3NFPA 4JRXA 2WM0A 4F58L 3MV01 3STLB 3TN0C 1T7YA 5BVJB 3ARGB 5CBAB 3VDAA 1MJ7L 3EYQD 3B43A 4ZPTB 1H15B 2V9TA 4HFUH 1DQDH 1IAIL 3EYFB 4KKLC 4ZOAA 2V5TA 3HG1A 4JN2B 4LPWA 4MHHG 4D9RD 1ZA6A 1XGTA 1T5XA 2XN9E 2B4CC 2PN5A 5DDHB 1HOCA 1H0DB 4WU5B 1J0ZA 1IGMH 4MMZC 2QEJA 1CQYA 2OXHA 3R06B 3PWUA 4JAMA 4P2RA 5E8PB 1FRGL 3VXME 3FFDB 3C5SB 1IVLA 2AJ3B 4TPRL 4M1DH 3DARA 4X6CA 1N2RB 1LNUA 1LEIB 4XNYH 3QUYB 4LP5A 4M5ZH 4OQTH 1AP2A 5CD3A 3UJTL 4YHOH 3S88H 4JRYB 1XZ0A 3L7FB 5B8CC 1KB5L 4KKCD 4V1DE 5HVGB 4JM2C 4NZJA 3S4SA 3MODL 4LPYA 4J1UB 2IH3A 5JIHA 3UTSA 4JDVA 1E6OL 4MJ5A 5KW9H 4ODUB 2EEAA 2IPUK 5FDWB 1Q0YH 1V5JA 4RDQF 3VFRA 3CDYA 1OSPH 5IFJA 4PRIE 5TF1L 3QQ9D 2V9RA 2A38A 3VG9B 3FN3A 5TQ2L 4HKJB 3TC9A 3VGEA 1LK3H 5IQ9A 5E24E 1FZJB 1TZGH 2E7BA 4JY4A 4RGOL 2CSPA 2VLKE 4ENED 5D2NA 1E4WL 2BY3A 5BMFH 3FT4A 1K9TA 1I7RB 4JFZL 1T6VN 1RJYA 2GK0A 4HT1H 4FQXC 2DWDA 2Z31C 5DRNA 5DHVA 3QIBB 2HA1A 4Y16D 4MZ3A 4D0BA 4LLMB 4O5LH 1A1OA 4F58H 3C8HA 4FFZL 5A3ID 4PJ7A 4JLRA 1MJ7H 3GMRA 5FFLA 1T1WA 1FYTD 1IAIH 4BFIA 5LXGL 2X4QB 2HLAB 3F5WA 3ILQD 4M9PA 2NXZC 4H1LG 4ZD3L 2NLJB 1TJHL 3SE4C 4PRPB 2XTJD 3MR9A 3EOBA 4QRTA 3QIUD 3TESA 2Q86A 4XI5D 3G6DL 2Q8AL 3QDHA 5FB8B 1RUPL 1X9QA 4LVNC 4Y2OA 4GRLD 3QPXL 4L8DB 3ESUF 4PY7A 4D0DB 5BVPL 4DJMA 5IHBA 5JW4Q 2B0SL 2E9JA 1LO4L 3IDGA 4PJEB 4YK4B 3TO4A 2V2WA 3WIHL 1FRGH 3TNMA 2MFNA 4JDTL 4TPRH 4HW6A 1PEWA 4Z7VB 3TFKD 4PJFB 3T0EE 2B1AL 5EU7C 2ADGB 1JZ4A 3ARBD 4NFBA 2EXYD 3UJTH 1S9YB 1T21B 1YJDC 2RJMA 2A6KA 3OL2A 4QXWA 5EUOF 3RHWF 1RFDL 2JK5B 4HIEA 1KB5H 5E6YA 3VXMD 25C8L 3MODH 4N0YL 1E6OH 2C7UB 1BIHA 1CYGA 2GJ6A 1B4RA 4R0LA 4CBPA 4X7DC 5TF1H 1GYAA 5TQ2H 1IAOA 1KT2B 3WFDL 5DZLA 4V1DD 2XQYK 4RGOH 5DA4A 3RPIB 3OAUL 5GSVB 1AGEB 1FNFA 1NBYA 1EHLL 1SY6L 1VENA 4DFHA 1U8MB 5K9QG 1OTUC 3SY0A 2AK1L 2JCCE 4JFZH 4WEUD 5IR1A 3HNVL 4NKOA 2RCSL 1G84A 2LV4A 4OFYA 2ZCLL 1I3UA 3DTXB 2XZZA 4EDXA 4FFZH 2VTFA 2VLKD 3DBXA 3MJ8A 4KXZH 2IEPA 3JV6A 3GI8L 3DXAA 4U6TA 4UILL 5KVMC 3ECBB 4GMSL 5LXGH 1FL5A 3OQ3B 2C3VA 4QXUL 3D0VB 5D6CB 3L5HA 3GB7B 4K7PX 5IIEB 4ZD3H 3ARUA 1TJHH 4QO1A 2YC1B 2P44B 3ULUD 1IGJB 4MAYB 2Q8AH 3G6DH 3X11B 1RUPH 3LQMA 4DCQB 3LH2L 3CVHA 3ZHDA 4ZUTB 3QPXH 5ERWB 4WUUD 4JQVA 4UAOC 5BVPH 5E6ZA 4DUVA 2B0SH 2R69L 5ESVB 3WCYA 1LO4H 2W1NA 1XF4B 4NBXB 2UWEA 3EO0A 4IOIB 3WIHH 4L4VB 3SGJC 4G8FA 4JDTH 1QO3A 2BC4B 3KPPB 2B1AH 3RPKA 4PR5A 4AENA 3LPWA 3MNVB 3U0TA 2FX9L 3MLPA 4IMLB 2JKXA 1LMKA 3G6AA 1JV5A 25C8H 4N0YH 5C9JA 5FK9A 4DKEL 3VRLE 1TITA 5C8JB 2ARWA 1OM3L 2MJWA 2R2BA 5DQ9A 3P4NA 1W0VA 1QYGL 2HT3C 5LJYH 4MA7L 5KS9A 2H8PB 2DI7A 3WFDH 3TO4C 1M05A 2L7JA 4ZUVA 3OAUH 4LCWE 2NZ9D 1P7QB 5D96C 3HR5A 1EHLH 3AREA 1SY6H 3GMQA 3O6LL 2BNUA 2AK1H 2LAAA 4QXGL 3VFMA 1NKOA 3B5HA 3HNVH 3UTTA 1JE6A 4DN3L 5KVFL 2RCSH 3BW9A 4LLVB 2ICES 2ZCLH 3PNWA 5CMAB 3S96A 1KJVA 2ADIA 4X98B 1KNOB 1OAZL 2FIRT 3ARVA 1QRNB 2IFFL 3KPSB 4RMWA 5DGRA 3WE6A 3GI8H 3FO2B 4AIZB 4ETQA 1ULVA 3OB0H 2CR6A 3V6FB 3I84A 4UILH 1FVEA 5A16A 3HE7C 4GMSH 2PETA 1MY7A 4R0LC 4QXUH 4ZFGL 5F71A 5GS0C 1BVKB 2DDQL 1F3DJ 1CD1B 5CIPH 3UBXG 4GRMA 1T03L 1JN6A 1J8HE 1HILB 3MJ7A 3TNNA 3WLBA 4OCXL 3E3QC 1T1YA 4JGJA 1AH1A 3LH2H 4NZDA 2J1KA 3W11D 3WHXB 3DX9B 2FCBA 4YBLC 4IS6B 2R69H 1RUML 1YY8B 2DF3A 4KUCF 4CVZB 3ME0A 1NGWB 1CD0A 4G6JL 3EW3B 2A77L 3BQUD 3WNNA 4L29A 2PYEB 4XCYA 5GGTL 1Z9MA 3O6ML 3B8YA 5GRVK 1VDGA 2FX9H 4GBXD 2JJTA 2XXMB 1FYHB 1CXLA 2XWTB 1LP9A 5D1ZD 5KN5B 3WFHA 2XTLA 4Q0XL 3H0TA 4DKEH 3DYMA 2EH8L 2ZUSA 4HV8B 5D4QA 5E4EB 1NBZA 1OM3H 3QWOB 5ICYB 2PCPB 1G6VK 2GUOA 5EC2A 5L6YL 1P6FA 4IOFC 5I9QC 1QYGH 3CPLB 4MA7H 1T0NA 4OD2B 3QI9A 4HSQA 4OI9A 4F8TA 3KPLA 3MC0A 1C12B 1I9JL 4Z9KB 5F9JA 5AZEL 5GGSA 5FCSH 5EZJA 1ZT1A 3U82B 3O6LH 5BRZE 5IT2L 1JGEB 1NAMB 3VFPA 1A4KA 4QXGH 2GY7B 1Q9WB 4DN3H 4IRSD 5KVFH 2DLHA 2NXZB 4IBLT 1AHWC 2WANA 1PDKA 4FN0A 1EFXA 1X5ZA 1OAZH 2H2PD 1HYSD 2IFFH 1A9BA 1A2YB 3MV7B 4LCWD 3P9MA 3I02B 3GMMA 2A6JB 3FONA 4FQ1L 3NIDF 2WIIA 3U4BL 1C7TA 4TNVK 3QEUA 5EZOL 1IGTA 4NJAL 4ZFGH 4LEXL 2C1OB 2DDQH 3RWCA 1T03H 5F7MC 1B2WL 3RWFB 5CJBA 2E7LC 4OCXH 1YUHB 3ALWA 4Y4KC 3MRHA 1QKZL 4LVEA 1E27B 1Z2KA 4IMKA 4R26L 4EQ2A 2IANA 2MQ3A 3SDAB 1QA9A 1R5WA 4HK0A 1RUMH 5FHBL 1HHKB 2GY5A 2F15A 3UTOA 5CEXB 1BMGA 1MLCA 4U7KA 4U1KA 3C09C 4G6JH 4JY5L 3Q0HA 5E08L 1FORL 2A77H 1K8DB 1QZ1A 3C6LA 3FQRB 5GGTH 3O6MH 1QEWA 5DUBB 3CC5A 4QRPA 3BDXA 1S5HA 4Q0XH 1WSST 1K4DB 3BE1L 1OT1A 3NIFF 4G8IB 5FUCE 3VJ6A 3I6GB 2EH8H 3MLVL 1YPZA 3ZSSA 3KJ4B 3BD5A 4WEMB 3HNSL 5L6YH 4TTGA 3QUXB 3DVFA 4OLWL 5KANI 4BQ9A 5ACZB 4H8WL 5HHOE 4JHWL 4U1MB 5C0GA 4BKLA 1I9JH 5JW4M 1MHCA 1PAMA 2HJFB 5AZEH 1EERB 2X4OB 3O6FD 1AXIB 5IT2H 3L3OA 3GUTB 2ADJB 5IEKB 2EZ0D 2OM5A 3EHBC 3PQYE 3SDDB 1BREA 2NY2D 2YPLD 4RRPG 4AM0B 1S9XA 3OF6D 1EGJL 3DV6A 3QXVA 4PJCE 4LRIC 4MXQD 3IKKA 4LCUA 4XP5L 1M7IB 4NRZB 3K7UA 4FQ1H 2NTSP 3U4BH 5IFHL 4UAOB 3FN0H 5HI4D 4OGXL 3OR6A 1KCSL 5EZOH 3VXUA 2FHCA 4NJAH 4LEXH 3SO5A 3QI9C 3BO8B 2DQIL 1B2WH 2GITA 4APQA 5E2VL 5C0AA 3S3SA 3QFJB 5EH1A 2DQCL 2C3GA 5DK2A 5FA4B 1CGXA 1QKZH 5ICXB 1B0RB 3FCTA 5BCAA 1MQ8A 5IKCB 3PJSB 5HDLA 5FHBH 5ITFB 5C0JB 3OJVC 1T3FB 3HN3A 4NQVA 2KUTA 3IDNB 4JY5H 5E08H 1FORH 3FQXA 5AD0B 3MYZA 3BEWB 2CMRL 5I1AA 1QFPA 2AQ1A 1TNMA 5D1XB 3PWJA 2BNQA 4JJHA 3HKFA 1XF3A 5F88A 4P4RA 5D96B 3BVNA 2NNAA 3EOYG 1DDHB 3BE1H 3ULVC 3MLVH 2RIKA 3IDJB 1MJJA 4DTGL 3HNSH 1G7MA 1EAPB 4OLWH 3OR7B 3S5LG 4H8WH 4JHWH 4NNXB 1X5LA 2ZP0T 4OF8A 5TDOB 4ELME 4MNQD 2BSRA 5IHZA 4Y1AB 3O2VL 4YQXL 2AJZA 1NC4A 3BIAX 4MSWA 4HKZA 5DXWA 3FL7A 3GMLB 1EGJH 3IXTA 4P2YA 4N9GB 1AR1D 1HIML 2LVEA 4XP5H 4FOMA 3LPFA 2ED9A 4PP1D 5JORB 5IFHH 3S37X 1UZ6E 2WLZA 5F44A 1AO7B 4OGXH 1KCSH 2SEBA 4U7SA 3GSWB 1MUJA 3FQNA 1X44A 5H37H 2PYFA 1WT5A 3QEQE 2DQIH 2NY5L 4ZXBC 2EEBA 4PIRF 1BZ9A 3NAAL 3F7QA 2DQCH 4CADA 2DYPD 1UCTA 4ZUSA 2VDNL 4QYOB 1RU9L 1YN7B 2QHRL 3JTSA 3QUZD 2E3VA 4S0TD 4OZGF 1T22B 4I2XE 5DJ2A 3SJVB 4KROC 4OT1L 1QQDA 5F3BA 2J8UB 4GG6A 2CLRB 1FFOB 2VZ3A 5I9QB 3ES6B 5EFIB 2XY2A 2CMRH 1ZV5A 1GRWA 4NC1C 2AJXL 5DS8B 3STLA 4KKNA 2F54B 5FHAL 4Y4FA 5BQ7B 3G5YA 4OF0A 5BVJA 3F65A 4YHML 1RZGA 5TDNB 4H26B 1Q9LB 4UNUA 5C08E 5SWSE 4JN2A 3QQ4A 4G9FB 2ATKA 1AHWB 3FQTA 4G42B 1DUZB 5IMKA 4DTGH 2DWEB 3FQUB 4S1RL 1S7VA 4C59B 3QZWB 5DDHA 5JHLL 2NMSA 3HAEG 1H3UA 2Q87A 1CXKA 2X1OA 3L3KB 1C5CL 3QJFB 4LLYB 2DBJA 3O2VH 4YQXH 3R06A 4RCAA 4UNVA 4UQ2B 3KPTA 5IVXA 1G0YR 3CFKB 1I1AB 4Y5YC 2AAVA 1HIMH 4HGWA 1NCNA 1FIGL 3PGDB 3D39D 1JBJA 3OG4B 4N5ED 3ULUF 2N7AA 5DURD 2I5YL 4FTVB 3MREA 1RVFL 2ZNWA 3PABB 4DUXA 1S7UB 3GZKA 1R3JB 5HDQL 1YEIL 3WNMA 4R4ND 4HZAA 2NY5H 3NAAH 4JPVL 4Q9BA 3QXDB 2WBKA 2VDNH 5JNYB 1RU9H 2NY0C 2QHRH 5FYJL 4ZQKB 4NSKB 1TZHA 4UNTA 4OKDA 4FQHA 4LVHB 5L2KE 4OT1H 3QEQD 4MJ2A 1FAIL 2VDLL 1C5DB 1JNNL 5INDB 2XKNA 4XXCC 2ICCA 4R3SA 1MWAL 2AJXH 1GZQA 3SO3C 4RISL 4FXGB 3IJYA 5JDSB 2KH2B 5FHAH 1F90L 1YEDB 1URLA 4OCRL 3A0OA 4YHMH 5DEGB 3EDFA 3FB6A 3PGCB 4EJ1C 5IROA 4XAKE 1TQBB 4XBPB 5E8OA 2I26N 4QHMA 3O2DL 4X7EC 2EIZB 3PP3K 4S1RH 2G9HB 4PRPA 4M7ZB 3REVB 5K93A 4JO3L 1BECA 3VE0B 4OZIE 4R97C 4LNRB 2PTVA 5T3ZE 4L8DA 4HKXB 5C08D 5HD8C 4UZGA 1C5CH 4D0DA 1BQHB 1YMMB 4WHCA 1A7BA 4JFFB 1YECL 4RMVA 3HPLB 3W2DL 1ZSDA 2F53A 1U8KA 2VSCA 2BVPA 3RKDC 3LKNA 4QTHA 1QSEA 4R7NB 4ZAKC 4U1HB 3C5ZD 2HFFA 5HGDA 2X4NB 3FTGA 3CSGA 2IPUG 2WBJC 5IBLC 1R3KA 3AB0C 1ZLSL 4QHUB 1FIGH 2A83A 4CNIB 1S9YA 5T1KD 3UJIL 2MSPA 3IXAA 3RWGB 2I5YH 4TVSa 3L3HB 3OGCA 1RVFH 4M8VA 2VN7A 1R3IL 2IAMC 4XVUD 5TH2A 1VSCA 1YEIH 2DQTL 5HDQH 1I3RA 3JUZA 4RA3A 1ITBB 2EDEA 4ZO9A 1X5XA 4HUXB 4EVNA 4CL7A 4JPVH 1FN4A 5B22A 3TA3D 1I1YA 1JZ2A 1G7QB 3MRPA 1HDMA 2CO7B 4HMEA 5FYJH 1PJ9A 1PKQB 5D1QA 4JE4B 4PLJD 4PGCB 1L0XA 3RPIA 4PJ5E 5EBWB 5GSVA 4Z7WA 1AGEA 1WIPA 1DLHB 4LPUA 3ABZA 1U8MA 1OL0A 4YX2L 3HLAB 5J1SC 1FAIH 1FC2D 4LLAA 4DVBA 1XIWC 1G6RA 2VDLH 2BOBA 2DD8L 3LOWA 3MGAA 3B9KA 1EJOL 1JNNH 1UB5B 5F89B 1M6OB 1VEOA 1Z9SA 1MWAH 1GL4B 4KI5F 1F90H 5F1OB 5L2KD 4OCRH 2AKRB 5DHYA 3DGCR 1L9NA 4OZFB 2BMKB 3VRJB 4GAYB 5D7IA 2YHGA 5CGYC 5GISL 3IAGC 3O2DH 1IM3A 2DLFL 3C87A 5TFSL 2BHYA 3ARFD 4JO3H 4MAYA 3X11A 2YPVL 1NCTA 3BJLA 3KXFD 4DCQA 2VDML 2VABB 5CLWA 5ERWA 5I18L 1KENL 4P4KD 4OZGA 5BV7C 5ISZE 1YECH 3EYQC 3WO4C 3W2DH 4IOIA 2N7BA 3PL6D 5SX5H 1XGQA 3KPPA 3SBWA 4ORGA 3BIKA 3RJQB 1ZLSH 2AV1A 3BN3B 3VGBA 5IROC 3MNVA 4Q2ZB 2P8PA 3UJIH 5E00B 4IMLA 4C56D 4TUJB 3B8SA 2EIBA 4KROB 4DZBB 3H8NA 1KC5L 1QSZA 4I5BB 4L9LC 1R3IH 4OKVA 2UUDK 2Q7YA 2XACC 2DQTH 1A0QL 3T0DA 5F1NB 4XCNB 4L8CB 2R15A 3K8MA 1KJ2L 4JKPL 3TVMD 1NBVL 2H8PA 4UBDC 5HHPB 3HNTL 5JHDA 4GJTB 3U7AA 3BAEL 3D9AL 1P7QA 4MWFA 4U6VL 4F7TB 3BT2L 4LP4A 4O58L 4JFXB 1FO0B 3U1SL 5D71L 4YX2H 4EZMA 3OJDB 2DD8H 3KPOA 3QDGA 4HCRL 1EJOH 3KLSA 3BISA 3BUTA 5JXAL 3KYMA 4LU5L 4X6DF 4HUVB 1MCDA 3IFOB 3KPSA 3AAZA 3PWPE 3O8XD 3QQ9C 4QHLA 4AIZA 1CFNB 5DJ6B 4Y7MA 2QSVA 4KZEL 1NKRA 1AIFB 2AK4E 1T2XA 1KIPA 4M6ML 4NM4L 5C07E 4LMQI 2OI9C 3O11A 1LO2L 5GISH 1BVKA 2DLFH 5DSCB 4Q7DA 4Y5YB 5D2LE 5TFSH 2V7HA 1HILA 5CJ8A 2A6IB 3FT3B 4MD0A 5E03A 2YPVH 5I8KL 2LU7A 2VDMH 3U4EB 1IM9B 5I18H 5E1HB 5A3IC 2KZWA 3HZVB 1KENH 2VQUA 3V5DA 3IRPX 3ZE2F 1YY8A 1JIBA 4TUOB 1KEGL 5FUOH 5JDJA 5CSZB 1XF5A 1HHJA 2LAGB 3M17B 1B3JA 1NGWA 3O3BB 4O9HL 5B4MD 4LLDB 4QKXB 2PXYD 3ILQC 4WVRA 4ORZC 5KG9A 5GJSL 2XTJC 4TYUA 2YMXL 2VR9A 4ZFFA 4KMTL 5DD5L 1G7LA 5E70A 3PHQB 1QBAA 4I48B 4XI5C 5ISZD 2FIKB 1I8LC 3W39B 4GRLC 4LPCA 1KC5H 1A6AA 1WWWX 4YHZL 1EO8L 1A0QH 1SYVB 4GRWF 1D5ZA 5CKGA 3UYPA 3QG7L 3VFVA 4MVBD 3HR6A 1KJ2H 4JKPH 4ZTPL 3SO3B 1NBVH 3HNTH 4S2SB 4NQDD 3MFFB 1C12A 3T1FB 1JNHB 1J05B 3BAEH 4C55A 2EXYC 1RJLA 3D9AH 3OAZH 2RAMA 4U6VH 5HGGS 3BT2H 4XPFL 4O58H 1ZVSB 3QNXB 3U1SH 5D71H 3GJEB 3VXOA 3DHJA 4MQTB 1YEJL 1ZHNA 3GMNB 4HCRH 5JXAH 4LU5H 3HC4L 3EYVA 3LS4L 4YPGA 3DVNB 1PZ5A 3D0LA 4PJBF 4ZSOB 3F8UB 1C16B 3LQZB 3SGEI 4KZEH 4L4TD 4M6MH 4NM4H 3H9SE 4KKAD 2V2TB 1LO2H 2VR5A 4ZAKB 2XPGA 2VNCA 3Q3GA 2JIXB 4L8BA 1YUHA 4L1DA 1VEPA 5E2JA 1M71A 5I8KH 4KGJA 5HVHB 4PJ8D 5DK3A 2AK4D 1KCUL 5C07D 4J6RL 3SDAA 2DLEA 3UO1L 4NQUA 1DUYB 4MCYB 1KEGH 1JPGB 2IAMB 1X4YA 4U2YA 5CZXD 5JW4R 4JZOB 4O9HH 5HGHB 2OK0L 4HHAA 4WI2A 4ZFZA 4GW5A 3QIWB 2W9EL 5C0CA 1HZHL 3DYOA 3FQRA 4MS8D 5GJSH 4IRZL 3ULUC 1HSAA 2YMXH 1KCRL 3B5TA 4KMTH 4UT6L 4NO2B 5DD5H 5C9KA 4KRPB 2LABA 3WDIA 1J1PL 3LN9A 1OHQA 3QXAB 4U49A 3RGVC 4Q6IB 3AY4C 1JYXA 3IYLW 4JGMA 1RIVL 4QHNA 2DQGL 5I75C 3J8F7 2GTWB 3DVGA 4YC2C 3MUGA 4YHZH 1EO8H 2MHAB 1Z6JT 4JREC 3QG7H 5SWZB 1QLRA 3GRWA 3QUXA 3EDEA 4ODTL 3U46A 4CAGA 4ZTPH 2ZG1A 1KF9B 2G60L 4QRRE 5CP7A 1GC1C 4I8DA 4PJGE 1F45A 5F1IA 5H37G 2UUDH 2HJFA 2OYPA 2OL3A 4YDIL 2X4OA 3LN5A 4X4YB 4LKXB 4XPFH 1NQBA 2NTFA 4Z7OF 3GUTA 5BS0B 2YA0A 3BFOA 5BZDB 1GH7A 5E5RB 1YEJH 4MJ4A 2K1MA 5E8EA 2X1PA 5DHVH 4X7TB 3EJZD 3HC4H 3MRNA 2D31B 3LS4H 1QFWI 3MLZL 1F11B 2P4AB 1NFIA 4G43A 4AYFA 4NRZA 3MXWH 1U93A 3O4LE 4R96A 3FOMA 1U8HB 1ZTXL 2YRZA 3WO4B 4J4PD 1EAJA 2NZ9C 5JXEA 1SJVA 1FL6B 4N8VG 1N59A 4Y2DD 3CXDL 1YNTB 4OAWB 4B7IA 2ZOKA 1OGAD 5FO9A 2JJSC 4JPKL 4MYWB 2IFGA 3QFJA 4C83A 3FB8A 4UIKL 4LHJB 3S35L 3L9RA 4BZYA 4P49A 2ICWA 1IEAB 4MNHA 1DEEB 3CVHL 3D85D 1EUTA 1KCUH 2VLJD 3H9SD 4J6RH 1T5WB 4BM7A 5IKCA 1JWMB 3UO1H 5E6IA 3PJSA 2VISB 3PHOB 1JI1A 1CL7I 1VESA 4NKQB 1T3FA 2BVUA 1XCQB 4B7LA 1E4JA 3CSPA 4E41A 1FNGA 1WFUA 4MA3B 2OK0H 4GAGL 2W9EH 2ZSWA 1HZHH 4ODWB 2EKSB 2VXUL 5D1XA 4NO0A 4DQOL 4IRZH 2ITDA 1KCRH 4P2CG 1WBYB 3DGGB 4UT6H 4ZDHB 1JZ6A 1JWSA 2BXYA 1EFQA 4PJ9A 1J1PH 3RX7A 4PG2A 1IC7L 1JF1B 4DGIL 3W11C 5DVMA 3BN9D 1DDHA 3LS5L 1RIVH 4MD4A 2DQGH 1A3LL 4WFGD 5ELIA 4E42A 3MV9E 4YEFA 4AIOA 5KVGL 3BMVA 4ODTH 5T5FL 4YHPB 2G60H 5F9WC 1I85A 5DFVD 4JJ5A 1Y0LB 1TETL 4FQIL 1BIIB 3V6BR 1LDPL 4YDIH 4X5XA 3RWJB 4GBXC 4KAQL 3K3QA 3DMMD 1KLUA 2K3TA 5C0ND 2OI9B 2X1WL 4XXDB 1EBPA 1KFAL 3QCUL 4KK5D 4Y4HA 4HFWB 1FVCA 1WAAF 1F42A 3VGGA 3GBML 5F6IC 3GMLA 4DZ8A 1IARB 2ZUQB 4E0RB 3L5JA 4N0UA 3MLZH 4HH9A 1OTSD 4Y16B 4BA8A 3U6RA 3CUPA 3K0WA 2BFVL 1AO7A 3SGKA 3RNQB 2X7LB 1EEYB 1ZTXH 3MRLB 4MJ6B 5I1IL 4LQFL 5I1LB 4LSVL 3LAFA 3NACL 3CXDH 2VR4A 1MCRA 3FO9B 4JPKH 1II4E 1C1EL 2DJ4A 2XTJB 4UIKH 4D0CA 3S35H 3O0RL 2R2HA 3O4LD 3QIUB 1MHHB 1YN7A 1HYSC 5F7LB 5I1DB 1S7TA 3CVHH 2DIAA 3JUYA 4PBXA 3DV4B 4LKCB 4GRLB 3UZVB 1BOGA 3ZMRA 4MD5A 4URTB 1UKTA 4KVCL 1FL3B 1UKQA 4GQ9L 4PJIA 2J8UA 1J12A 1RIHL 4QRQB 1J87A 2CLRA 4GAGH 1E4XI 3DUSA 3SQBA 1L6XA 3GBNL 1YMHA 2VXUH 2FB4L 5CGMA 4DQOH 1DBML 3ARBB 3P9LA 1S9WB 1XF2A 4JCMA 1OB1B 5BQ7A 2YRPA 1IC7H 2ESVA 3WJLC 4DGIH 2FHFA 3LS5H 1I7UB 1A3LH 1SM3L 3MRFB 3VXMB 1IKNC 3ILPB 1MCSA 5F9AC 2EIEA 3BP5B 3F7RA 5J8OA 4PV9B 4HPOL 1MFEL 3FQUA 4PGBA 5KVGH 5T5FH 1OSZB 3QZWA 3MCKA 3PWNB 1L0QA 5FO7A 3KDMB 4J7RA 1TETH 1ZMYA 4FQIH 5EIVA 5HI3D 4MLIA 5HTSA 3KLHD 1LDPH 2YPKA 4LASL 4V1DB 4KAQH 2IADB 3EZ8A 4EIGB 1KFAH 3QCUH 4UQ2A 3IF1A 2EIDA 3GBMH 3CFKA 4PRIB 5EU3B 2EEDA 3V6OC 4OLVL 2HFGL 5LG1A 2VLKB 2BFVH 1KB9K 3MRGB 5I6XB 3X14B 2XA8L 1G7HA 5I1IH 4LQFH 2DM4A 3RIAF 2P5WE 3GSOA 4JFPB 4LSVH 3NACH 2MMXA 1HXMB 5C86A 1KCVL 5LGJB 1RZKC 1MFCL 3OV6A 2NY2C 4HKBB 1C1EH 2BSSA 4WDIA 4JO1L 2EYRB 3QXDA 3O0RH 5JNYA 1UJ3C 1A6VL 4ZNEA 4NQCA 1RMFL 2AJYL 4QGYA 5BOZG 4MXQC 3UC0L 3HUJE 3SDCA 4WUUB 3SKNB 4CN4A 4OFIA 4P23B 2RR3A 5I75B 4KVCH 1HQ4B 5EO0A 4GQ9H 5HI4C 1W2KT 4P46B 4JREB 3WJJA 4PB0H 3WUWG 5J6HB 1VKXB 1C5DA 1S7SA 3GBNH 5INDA 3TZVA 2FB4H 3SGKC 1DBMH 4CDGC 4S1DC 4RFOL 2FJHB 1YEDA 4M7KL 1I8KA 3HTLX 4XNQA 5DYOA 4JB9L 1X6LA 3NCBB 4OZHA 1ZLUK 4IHOA 3EO1A 1TIUA 2YBRB 1SM3H 4PRHD 3WXVL 5C0BE 3V5HB 2WWMD 1KTDB 3JXAA 4HPOH 1MFEH 4XHJD 2G9HA 2A9ML 2IH1A 2G75B 4QWWD 2AJUL 3FOLA 1UM4L 2FDBP 1U91B 4LASH 1BFOA 1NLDL 5DVOA 3UZQA 1CG9A 3HPLA 3T8XA 6CGTA 3QEHA 3VGAB 1G9ML 4U1HA 3RWEB 1WICA 2X4NA 1FJ1B 4Y88A 1WC7B 2X4SB 4ODBD 4OLVH 1ETZB 2HFGH 4OCLC 3W82A 2OZ4A 3D48R 4OLEA 1PYWA 2RBLA 2Z9TA 3NCCB 2LU4A 1RULL 2VIRA 3HI1A 2XA8H 1ZGLB 4XCEB 1LE5A 5KANG 4LGRB 4GXVL 4U1NB 1KCVH 2IWGA 4X0KA 1MFCH 4HUXA 3WS3B 2B39A 4JO1H 1CBVL 1A6VH 3TCLB 1RMFH 2AJYH 1AR1C 3OKLB 5K59F 3CH8A 3UC0H 3VFNA 3L3IB 2ZSVA 4PGCA 3D5OF 5EBWA 5AWNL 1KYOK 4EDWL 5B38A 1S9VA 1DLHA 3QUMB 4JRYE 2HFEB 3HLAA 5JOEA 2GSGA 4P5TD 3K2MC 4TUKL 3QDME 1HH6B 3P30L 5JZ7D 1WAAA 4PJHF 2H26B 5C3LD 3BQUB 1N8ZB 5F9WB 5L0QB 1M6OA 5I8EA 4U4BA 5FOBB 1XEDA 2EYSA 4FQQA 4RFOH 4M7KH 2AKRA 4WW2F 4JB9H 2D7PA 2EDDA 2A6DB 1Q72L 4Z5RA 3QUZC 5D1ZB 1XGRA 5C0IB 3WXVH 2HTLD 4GAYA 5D7LD 3MUY1 3OPZL 5KOVC 2CD0A 3VRIB 4XCFL 3BZDA 1QLFB 2A9MH 1BX2B 2AJUH 4X4ZA 1UEYA 1UM4H 4LSDA 1INQA 3NA9L 2V7NB 1QFWL 1MI5E 2HFTA 4PRDB 4XP9L 3CSYA 2P1YA 1JPST 1NLDH