1CLOL

Anti-carcinoembryonic antigen monoclonal antibody a5b7
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
213
Chain Sequence
b'QTVLSQSPAILSASPGEKVTMTCRASSSVTYIHWYQQKPGSSPKSWIYATSNLASGVPARFSGSGSGTSYSLTISRVEAEDAATYYCQHWSSKPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A5B7 MONOCLONAL ANTIBODY
molecule tags Immunoglobulin
publication title VL:VH domain rotations in engineered antibodies: crystal structures of the Fab fragments from two murine antitumor antibodies and their engineered human constructs.
pubmed doi rcsb
total genus 50
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 1996-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cloL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cloL01
1PJ9A 3G5XB 2FB4L 4YBLC 1JF1B 1JGLL 2CLZA 4NWUL 1BPVA 1R5IA 4MJ6B 3VG0L 1ZANL 4J4PD 5TQ2L 1DQJA 4NKIH 3ES6A 3VXNB 3PABA 4KROD 4JM4L 4PRIB 3KXFD 4PG2C 2YPLB 1PX4A 2CKBA 2ITCB 3NOIA 3LDBC 5KS9E 1UM5H 4S10A 5KVDH 4ODVH 3GO1H 5D70L 4R8WL 5T33H 1UQSB 4OCXH 3I9GH 1YNKH 4G3YH 4U3HA 4WI5A 2HH0L 5HHOD 2FEDD 1SEBB 5E5MB 3MV7B 5GGUB 4ZTPH 1ZLVK 4JE4B 3CLFL 2NY4B 4QRQA 3LY6A 2DTMH 1UXWA 4L9LB 4K7PL 2VC2H 4P5TB 4G6FD 1N7MH 4L4VD 3O3DB 4I0CC 3OKLA 4C83A 2BK8A 1JNLL 1RULL 3BH8A 4P2RE 5FO9B 1BD2A 1D5BA 4Z0XA 4XX1E 4O2CA 1MCNA 1QRNB 2ADFL 1JE6A 4HLZG 5SWZE 5CD3A 5DRZB 4NO5A 5EU6E 3C8KA 3X3FL 3U46A 2JB5L 4FABH 4LQ1A 3ZKSD 1IFHH 5EU6A 4DVBB 1D9KD 3FB7A 2PTTB 2DLFH 3MTRA 1ACYL 1UXWB 2UVFA 1VFAA 3BKJL 3O41A 1U58B 3P9LA 5DHVB 5ERWB 1M71B 2O61B 1NCUA 1AD9B 1T1YA 2FX9H 3SCMA 3ZT6A 2OR9H 4P59H 15C8L 4MS8C 5L0QB 1EFQA 2IWGA 3HZYB 1EK3A 5D1ZA 5HHQA 2DDQL 4KKNA 2AJXL 1A1MA 1DBAH 3I2CL 5FGBA 5K59F 1LO3H 2DTSA 2DQIH 4IIQC 3D39B 3F12A 4EKXA 4PB0L 1X6LA 3HNTH 1H3XA 3N1QC 4FQLH 2JTDA 5L2KB 3PDOB 1YNLL 2OI9B 1H0DB 2W1NA 4MJIA 4CRPA 4DZ8B 4JO4H 4JFOA 2IF7A 5CKAA 2RQ8A 3FRPG 1A3LH 2VDQL 3PDDA 2FB4H 2V2WB 5ENWB 3QFJB 1B2WH 4XVTH 1K4CB 1J5OL 1A1MB 1KT2A 1GZPA 2F54D 3ESUF 3T77A 3GNMH 2JIXD 4L9DA 1F97A 4UTBL 1TETL 2R29L 2G75B 2LABA 4MJ5B 3ZKMC 1ZK9A 4N5ED 4RQQA 3SDXF 3MUJA 1I7RA 1S7UB 4LCYB 4LCUB 4QHUB 2D9QB 4DK6A 2DQFA 3C6LD 1BVKA 4WFED 5KSVA 4OM1H 3GSNB 3RL1A 1GGCL 2WNGA 1XGPA 3CJJA 5LQBL 4OZ4A 2E9JA 3DGGB 1AGCB 1JNHA 3RGVD 1UM6H 4E41A 5DJXA 1OP5H 1EO7A 3U30C 3G6AA 3IF1B 3ARUA 5GISL 5C08A 1A9EB 4FOMA 2R1XB 2AKRB 2CIKB 2PO6B 4G9FD 2RCSH 4KJPC 5C0IB 1FORH 2P5EA 1CGXA 4PRHA 1G7JB 4CU8A 5SWSB 3HNSL 1QSVA 5I1IL 4WEMB 5E6ID 1FNHA 5EU5A 5AAMA 4QXUH 3MMEA 1PY9A 5DMGD 2R0ZH 4LRNL 4PRIA 4XPBL 1AR2A 4NGHL 2HRLA 3FOLA 4WCYH 1YPZF 2XN9D 4K9EL 4WFFE 2YMXH 2NY1C 4H0HB 3OJDA 2JCCF 1GGIH 1K8IA 4LAJH 4PRBA 3ZDZE 3STBA 2JCCB 1I8MA 4U0RC 2HMIC 2XWJA 1I7UB 2EKSA 5INDA 1V8HA 2WBKA 3FZUD 5BZWB 5JHDB 5A2KH 5I66B 2BC4A 4M7LT 4XMPH 2HRPH 4R90L 2HFEB 4D3CL 4HUVA 5IW1B 3FRUB 4LGPB 3QBTB 1RJLB 4JM2A 4L1DA 2ED8A 4Y89A 1JZ2A 4OD1L 4TNVK 5ESQA 3VXRA 1CWVA 3T2NL 4Q9CA 3OHXB 1IQWL 4PTUA 5C3TA 4NRXB 2EECA 3RI5F 2FZ3B 5FHAH 4CW1B 5KZCD 4S1SH 2Q1EA 3SGDI 5A3ID 1FL5B 3PABB 3WD5H 1EJOL 3FRPA 3MACH 3PWPA 4HKBA 5BRZD 1R3JB 5IBLC 2HG5A 3QDJA 1P9MC 2XPGB 2EH7L 1S7XA 5HJ3B 2IADB 3O6FC 3ZE0E 4TUKH 4DCQA 2GK2A 3CDFA 3ARBA 5TGBA 5EUKB 4PTUB 1ODAA 4IRSD 1KB9J 5ID1B 5D1QD 4PJXA 4X8XA 3VXMA 1EGJH 3JV6B 1F3DJ 1MSPA 5I76B 1B4RA 2QEJA 3QDGD 3DO7A 4PJBA 1ZA3B 1IZJA 3F6IA 3FMGL 1F3JA 2AJSH 1T2QH 1RIVL 1FV1A 1HH9B 1MJUL 1JPSH 3HAEB 4Q0XL 4K9EC 3C5ZD 1U8QB 3MJ8B 3DETC 4H1LA 1O0VA 4M7ZB 4L4VB 4XVSL 4UIMA 5C86A 5ID1A 4NO0B 1JN6B 1T1XB 1NCAH 2A6KA 2H8PB 3O6ML 4E42B 3RZCA 2DMKA 1NFKA 1NCDL 4UINH 1FNEA 1FNSL 3IETA 3MRMB 4TN9A 4MNQE 1H3PL 1HYSC 1LEKB 1T20B 4ONHB 5JQHC 3RPIB 5DEZA 3TH4T 3UTZB 4EUPB 4YHKH 5HHME 4LHUB 4MA7H 2E7LC 4Q9RH 4WV1C 2Q20A 3E6HA 5HYJA 3IFPA 2ATPA 3MCLL 3SDCD 1GVIA 1J10A 1K9TA 1BEYH 4OD1H 3CFEB 43C9A 4Y4HA 2OXHA 3QUKB 2XA8L 3SE8L 5HI3D 5M7QA 4JQXC 1I8KA 2DQIL 3THML 5J56B 1G0YR 1MLCA 5KSUA 2XZZA 1DE4B 1KJ2B 3KDMB 5HYFA 1VGEH 2P4AB 1INQA 2UY6A 3WE6B 4N90D 3JSSA 3OKOB 4ODTL 3JUYA 1G84A 2XTJB 3N9GL 1UKQA 3IKCA 4JZJC 4LCIH 1ND0B 2B20A 2X4UB 4TUKL 4GW4A 1FFPB 2DLEA 4O00A 1X4YA 1LP9F 4K23L 5DD3L 3LS4H 1G9NH 3I6KA 5A40E 2MPAL 2R4SH 3BP6A 4NWTH 1YEIH 2I27N 4MA8L 2XNAB 2QSTA 1T0MB 4U1NB 3ULVF 5D7IB 4XP1H 3OB0K 3OKOA 4G8GB 4RGOL 1KXVC 5DVLA 4DQOL 1PYWA 3E2HC 2R56L 4JN2A 5D7LB 5DJCB 1JGLH 3EO1B 4OUUB 4OV5B 1K85A 4M6NL 5IGXH 1G7QB 3LH2L 1IAII 4OIBA 3AY4C 1A9EA 5DEGB 5FM5O 2AVGA 4XVSH 1LVEA 1IM9A 3KXFB 3H9SD 3U7YL 4IBLT 3JVGA 3QR2A 5DO2C 2BVUA 3OG4B 1B4JL 2KPNA 5D7SH 2CLVA 1MHCA 2OJZL 1SY6H 4N9OB 1YEEL 3QIWB 4WU7A 3C2AH 5K9KA 1TJIL 3ZSTA 4UDUA 4RX4A 5IB3A 2BVOA 5CLTA 5JPMB 1K4CA 5F9AC 1BFSA 1UGNA 2Y06L 3FQWB 1MUJB 1EJ6A 1A6TB 2ZKHL 5HPMA 1WICA 5E99H 3OKMB 5EBWA 3L1OL 1SJHB 3SGEI 2EEDA 3LV3A 2OM5A 1NEZA 5CJ8A 5J11B 1L7TL 1UG9A 2YUVA 5HHNB 1HXMA 2A77L 3CMOH 3MBEC 1EGJA 2D2OA 1MHEA 4IDLA 4JFFE 3QISA 5DRNB 1OP3K 3O3AA 1LP9A 3D25B 2OLDA 2UZIH 4YDJB 1G9NC 3FQWA 3FFCD 3VCLA 3QEQB 2NY7H 4LU5L 5IR1B 1QR4A 5JHLL 3U0TA 4O51B 4WFFD 4ODHL 5D5MA 2VNCA 2HFFB 2YA2A 4G6KH 1G0DA 3GSRB 1TFHA 1U3HC 4U1GB 3I3BA 3WS3A 5SWZB 4PV9B 3W0WE 3GJFH 5LVEA 2WP3O 4FXKB 3HA0A 5ACMA 2X1PA 4YDJA 2P5EB 2YD3A 3CK0L 3QDJB 1E28B 1MIML 4X7SL 2AXJA 2BNRD 4X9GA 4XP1L 1MCFA 5DVOA 1F3DH 1F4YL 4WRLA 3X3GH 4D0CA 4NZRH 1NCCH 4BQCA 2EEBA 2XYCA 1J0JA 4MX7B 3EJYD 4TUOB 4Z95H 3H9YA 1LO5A 1KXQE 5F7EH 1NC4D 1JBJA 4LLDA 4YXLH 4FRWA 5DD6A 1EJOH 3D9AL 2AXFA 2AS5M 4MQSB 4PJIA 1B6DA 4UNVA 4JRXA 4MXWL 4RIRA 3S36X 2AXHA 3D3VD 3GNML 5EOCH 1J18A 1SQ2N 1ZA3A 1H8OA 3VI3E 1AFVL 1XF2A 1MCHA 3PWVA 3JUZA 5IB1B 1YEEH 4LF3A 2W38A 1EGJL 5DC9B 5J11C 5D7KE 2YXMA 2MSPA 4EOWL 3GSXB 5IVNA 1AH1A 2AEIT 3G6JB 3ILPB 5JIPA 3EZ8A 1PAMA 1LO4H 1MCEA 3ZE0F 3PWPE 5JW3L 2PCPA 1J1PL 2FATH 1PQZA 1AKJB 1HH6B 5F89A 1RZKH 2ZG2A 1NDMA 4G80B 4PRNA 4P9HC 1JZ5A 3W5NA 3OXSA 1CGWA 5ECJE 3NN8A 4XPHL 3MLUL 3R4DA 4ODWA 1YYLH 1QO3B 3BQUA 4GAYA 3WJJA 4Y19D 4OZGF 1GGYA 3W9DB 1JCKA 1IZKA 4BH8B 4M1DH 4MA3B 2Z92A 2X4PB 4FG6D 2J8OA 4N0UB 4WUUE 2COQA 3PGCB 2IH3B 5I15H 4DTGL 1NCBL 3ARRA 4ZOEA 3C6SA 3V2AR 5E4EC 3A6CH 3OTTA 4I1NB 4LHUD 2ZUYA 1PG7X 3WFDH 3GMPA 4NBXB 4Y1AA 1EXUB 2Y25A 1JTOA 1XGPB 1RURH 3PXHA 3I02A 4L3EA 3UO1H 5FOBB 2HT2C 3GMNA 3F7RA 3VD4A 4XXDB 3SDDC 5A2FA 2KQNA 3UJTL 1WFUA 1AXTL 4LEXH 5IKCA 4UUJB 3VI4E 1R0AL 1UWGL 2DQUH 1KG0A 4L8CA 5ADPH 2X1XR 3HC0A 1F4WH 4LNRB 3ZKND 4ZFOL 3SDCB 4D3CH 3UJIH 2DWDB 3SDAA 1QFUH 4PP2A 1T0MA 3LPGA 3HC4H 2NW3B 3R1GH 4MDJB 5E8PB 2LU3A 2A1WH 1PZ5A 2H1PL 5LGJA 4JCLA 3VU2A 1NBQA 1TZIB 1MI5D 5FYJU 4BUGA 3BIKA 1MRFL 2EYRB 4JY6B 4TULL 5TE7L 3AREA 1EAPB 3VDCA 3U2SB 5ICXA 2GTWA 3OKEA 1NDGB 5BO1L 5GGVL 2DLGA 4YHOL 2EC9T 2DQEL 1C1EL 4DKEL 5BRZB 4K3JH 1RHFA 4UT6H 3BX7C 2ATPB 3H42L 4JZNB 2J8UF 3DYPA 2N56A 1KNOB 3PDGA 3QUKA 5EZIH 3WDIA 4W6YB 1I1CA 2DAVA 3MRQA 1JGEA 1HHHA 1R5VB 4XNQB 4JAMB 2FD6L 4LLMA 5HHMB 2WM0A 4JG0L 3TPUB 1BBDL 1P7HL 4NSKA 3MA9L 1U9KA 2B4CL 4YR6A 4PJ7E 3TNNA 1B4JH 2Q6WA 4LCWE 1OGTA 4KI1A 1TIUA 5T1MA 2LU4A 1I8IB 2K7QA 1IARB 5E8NA 3NCJL 3LEVH 4U2YA 3QUYC 5CEXA 1ZTXL 5E00B 2IMMA 5CHNB 5EU7E 2C3GA 5BV7H 3GMQB 2FJHA 1S7SA 4XH2B 2AJUH 5JORB 3L1OH 3Q2CA 3VXSB 3RVVD 2CDFB 5GRJH 1N0XL 1JIBA 5IB2B 4L8DA 3L9RB 1Q0XL 5ACZA 3DRQB 3TJEH 1WFNA 2F53E 4H25A 4O58L 3BPCA 2CRYA 2YBRA 1S5IL 5IVXF 1MRDL 4ZD3L 4L8SA 1MAJA 5JIKA 4LSQH 2ARJB 4L4JA 1E6JL 4BQ8A 1UB5A 1NJ9A 3PGFH 5JLZB 5D5ME 5KVMC 1DQML 3HLAB 4GAFB 1Q38A 2Z8VC 3GGWB 3FB5B 4M93C 4L8BA 4PRPD 4FQCL 4PY8I 2NR6C 5DFVD 2WMPA 5C0CD 1ADQL 3SKJL 2VDNL 2Q8AL 4JFYA 4ZPVA 4YDKL 4L29B 1EEQA 2P5WA 4MHHI 1CGSL 3IGAB 4X7TB 5CILH 2VIRB 1F6LL 1HHKB 4KRNA 4MDIA 1P7QD 5GJTH 4IJ3B 1JZ6A 5ESVA 2DM4A 2K7PA 3U4EA 2AGJL 4ODTH 4X4MA 5GS0D 1PFCA 2O5XL 1OAKH 3MJ9A 5HY9A 1C1EH 4DKEH 2VQ1B 1ZVSB 1I85A 4NC2B 1FZKA 3EYQC 5CSGA 2DQFB 4JY4B 1FE8L 4K55A 3FHAA 2FJGB 4JFYB 5A16B 3DBXA 5F9OH 4ELMA 3T0EE 2QADC 4PR5A 2EZ0C 3JTTB 1FH5L 3SBWA 4EI5C 3RQ3A 1ZANH 1KIQA 1XF4B 5FXCH 4K23H 4KUCF 3LN5A 1KENL 4NN6B 5D7KD 3D0LB 5I19H 1LDPH 1QFPA 1XGYL 1AXSA 1KEMH 5CGYD 2IPUG 3U4EB 5I2IA 4OQTH 1OAXL 5GS2H 3DMMC 3EO0B 1J8HB 2VOTA 1EZVX 5K93A 1RFDL 3VXUA 4XP5H 4JY4A 4RGNE 4GAJH 1KBGL 5ISZE 3WXWH 3TP4A 3ARDC 3T2PA 3WJJC 2O5YH 2J4WL 4LPCA 3QSKB 1U91A 3V5HA 3QUXD 1WSST 5T3ZH 2A73A 3LN5B 5DJ2B 2NY3C 2YD8A 4Z7NF 4ZSOB 2HVKB 2BSTB 5JNYB 1CZ8L 5EU3A 1RJZA 4HGMA 4NZTH 4R4FH 5C7XH 5F8RC 3KLHC 1AO7E 4EVNA 4V1DE 2WLZA 3QNXB 2EDRA 1GHFL 3G6JF 4JFZH 2A6IA 2DQHH 4U1IA 4H20H 1MAMH 3NABH 4LCWB 5C09A 1U8OB 4MCYA 1IM3A 4HH9B 4M61A 1YQVL 1ZMYA 4Y5VA 2BCKB 5DQDL 4AT6A 2YD5A 3RWGB 3BFOA 3PWNA 4N1HB 1Q9WB 1JPTH 5I1KH 4BFEA 2NNAB 2C4FU 1GGBH 3PP4H 3EO1A 1JGEB 3MRQB 4M6OH 1BGXH 4OGXL 4UUJA 4ELMF 3WLWC 4GKZA 3V8OA 2XWTB 3SO3C 4RAVB 2D7TH 3KXFA 2VAAB 3W39B 1KUMA 4N0CD 4JHAH 4KC3B 3IDNA 5CZKA 1CLYH 1FVEB 2VLME 2GY5A 1OAKL 2ZJSL 5BW7A 4LP4A 1Z9SA 5D6CA 2IAMA 3VRLF 1CU4H 4I77H 4PGDB 5TH2B 2YPVH 2OK0L 3HCVA 2XRAH 4PJFA 1CT8A 1BOGB 3HZKA 3MGOA 3OKMA 5EBWB 2IG2H 3LKRB 3T3PE 4C4KO 3LS5L 4NQVB 1QPPA 1WBZA 2YN3A 4UTBH 4ZAKB 2W0PA 3RWFA 2CJUH 2O5ZH 5GJSH 1RFDH 2XZCH 32C2B 3T1FB 4XPFH 7FABL 1UXSB 4RDQF 3MRBB 1W8OA 1CDJA 2O61A 1EZVY 4UB0H 4U3CA 3RX7A 3K2MC 5IMMA 1GZQB 1FVCB 3MR9B 3D87B 3BD4A 4V2CB 1PDKA 3MLWL 3RIAK 4F3FA 4R4BA 5FKPB 1CE6B 3VG9B 3JWDL 1H3WM 4FNLL 5EZIL 1U8JA 4I18A 1Q9OB 4XNZB 3CPLB 2Z8SA 2VDMH 5C0JA 2ZUWA 4PBVC 3RX8A 3Q0HA 1CGVA 3WJLA 3ILQC 4MJIB 1LMKA 5JW5B 5CJXC 2GT9B 5T33L 4K71C 4LVEA 2V2WA 4OCWH 4EQ3A 4GG8B 3IRZA 5DWUL 3VFMA 4F3FB 1ZTXH 1JRHL 3NTCH 4D0DB 5DD5L 1FGNH 4Z8FH 1U3HD 1Q9OA 1UKTA 5BRZE 5A2JH 1YN7A 3FB6B 3NIFF 1OTSD 1U36A 1BD2B 5JXEC 1JZ8A 5BZDB 4QNPE 4JB9L 5JPNB 1KB9K 3CFEA 5T1LB 4ZO6A 1MPAH 3LDBB 4IDJL 4ZS7H 1CBVL 4RFOL 5FO7B 4C56D 2B39A 4GS7B 1I9IL 3AB0B 4WUUB 4HS6B 4I77L 3EOYG 4EN3C 2VXSH 1GOFA 1VFAB 5MP6H 3PJSA 1FFRA 1F6AA 3BE1H 2GFBA 2R2CA 3DURB 3BIBX 1YEFL 1AI1L 2DM7A 4L9LC 1P7KA 3R06A 2ITCA 4M7LL 2RR3A 3TC9A 1FFOB 2E7LA 3RZWA 1G7LA 4QNPF 4BKLA 4WV1A 3U36A 4JFDA 2LAAA 3O9WA 3MXWH 3UJTH 4WU5B 5J6HB 4S1SL 3PL6D 5E2TH 2IQAA 7FABH 3ULUC 1P7QB 3UTPD 3CSGA 1FP5A 4XBEH 3STLB 4F7TA 4DKDC 1KB5L 2MHAA 5DK2B 4BQ6A 1NEUA 3AREC 2Y5TA 3DMMA 3J8F7 3MRKB 5D6DA 1A7QL 4LNVA 2VMFA 1DBBL 1ZHNA 4HPOH 5GGTL 3IT8D 2IH3A 3BO8B 4HC1A 4URTB 4I3SH 4R6UA 5IB5A 5IHZA 5C6PB 1MRFH 3GKWH 2AQ2A 5FUOL 1K8IB 3T0VA 1B0RB 1H15A 4IIQB 1KEML 2DQEH 3WNOA 3MLTB 1JGDA 4JDTH 4NZUH 4NBZB 1I1RA 3PWJB 4QGYA 5ALBL 4TOYL 1NFDE 5EU3B 3ZDXF 5FEBA 5ID0B 2XG5A 4O5LH 2BY0A 5JTWA 5HDBE 4R2GB 3F7QA 1ZT7A 1MIEL 4NRZA 2WBJB 4X7TA 2J8UB 2PW1A 1X5KA 4NKMB 4BSWB 1WBXB 1J8HD 4HKZA 3M1BB 2R69L 4CN6A 1P6FA 5C0BE 3VWJC 3RTQD 5EUOE 3B9VA 1BBJA 2RB8A 2ICES 4LSVH 1BQSA 1WZ1L 3MRIB 4X6DF 3T3ME 1MJJA 2DLIA 1GYAA 3NCJH 1MHEB 4QHKJ 5I74C 3S34L 1UJ3B 1LO2L 2GYSA 2R9HD 5DHVH 4R3SA 4OV6F 2VABB 1G7JA 1GCFA 3LN4A 3VRLE 3BE1L 2PW1B 5BRZA 4XAKD 4R4BB 4DJMA 5E5UB 1RV6X 1AXSB 2JCCA 4JFFB 2JELL 3N1FC 3UZVB 3EOAA 3GSQB 1QLFB 1IC7L 3C5ZB 3C2SA 4XBPA 4YHIB 1PW3A 1G6RA 4K9EH 5EO9B 4Y4FC 5E2TL 3REVB 2VZ1A 1T7XA 1IEAB 1QSEA 3ROLA 4XHJC 4YLQT 3NFSH 1MF2L 4H8WL 1I9EA 3LN4B 2D03H 5F21B 3HFMH 1B88A 4CUCA 5CBEA 3HG1B 1CK0L 1WBZB 4LCCA 1BQHG 3LB6D 2XRAL 4KY1H 1ES0B 4P5KA 1T80A 5I0DA 3C5ZA 4YK4B 4XGZB 3HZMA 5IMLB 4FTVD 4PGCB 4FXGA 5J9PB 1F58H 2O5XH 5ACZB 4K8RL 3V5DB 1YMMB 4MS8D 1MFBL 1BJ1H 5AEAA 4DQOH 2NCMA 3C6LC 2NY4C 3RBGA 2W91A 2X4OB 2MQ0A 4I4WB 1DQDH 4GRMB 3LH2H 1ES0A 4P5KB 4Z7UE 3ARYA 3RWJB 3BAEH 1VFUA 1KN4H 3OJVC 1A4KA 4WW1B 1J0ZA 2J5LC 2DD8H 5E9DB 3W5MA 1PZUB 1FPTH 3BMWA 4ZUSA 1LEGB 3CC5B 4OJFL 1G7IA 3QCVH 5E8EA 3GB7B 1IEBA 3K8KA 4NQUA 5J12C 5F7MC 5GRXG 4GO6B 4X0KB 3C2AL 3LKNA 5JO5B 5HYSA 4WDIA 5CKGA 3D39A 3F12B 3QXDA 5EC1A 1C12B 2CIIB 4MMZC 1DL7H 1OGAE 4MZ3A 3WO4B 4FQXA 4MQXC 2CUHA 3LPWA 1U3JA 2AJSL 1UC6A 4PJ8A 1P1ZB 4N0UA 3WNKA 2OL3B 4U1JA 1T83C 2WLYA 4JANA 1UZ8A 2AEQH 4X6DE 5DWUH 1WITA 3MCKB 4EN3A 4LQFL 5ENWA 2HFGL 4L4VA 4MCZA 5ANMB 4CW1A 4PJAA 1KIRA 3SO5A 4N9GB 1EXUA 1GZPB 5D7IE 4L4TD 3P11H 2IBZY 3VGHA 4JB9H 2UZIL 3WLBA 3AB0C 2YD4A 3GMNB 2X4NA 5LJYH 5C6WH 2X4QB 3DV6B 4RZCB 4Y4HC 4WHCA 5JR1H 2DWEA 2FL5A 1D5XB 5DGRA 4ONHA 4Z76B 4UV4L 4JKKA 3TYFB 3VFOB 4ODHH 4QOKE 1Z5LA 1CICD 3HC0B 3MCG1 3SJVE 3GJEB 3A67H 4PP2B 3QHFH 4P9HH 5AZEL 3MREA 3AXLB 4IMLA 3MGTA 2QHRL 4HAGA 4M5YH 1E4XI 4G9DA 1R3IL 3H9SA 4OB5L 2EKJA 1OTUC 4R96B 4PJBB 4OCYL 1MREH 1K4DB 4X9IA 2WAHA 1UH2A 1SEQL 1E4KC 3SE8H 5H35A 4U1LB 4DOHB 4HG4J 1FG9C 5GZOC 1RUPH 1T21B 3PHQB 1OLZA 3GSOB 1HDMB 5F7EL 4RGNB 1BIIB 2XN9E 3JWOC 4LFHG 4ONGH 4HWZB 4Z7OF 3TF7C 3P9WB 3T65B 1YPZB 4MXVE 1XH3B 3SGKC 4JKPH 2AK4B 4LDLB 2KBGA 3VWKC 3FFCB 5ITBH 5L2KA 3PWNB 1N5AB 5AG8A 3C9NA 2ZCKH 3V8CA 4NZJA 3QCUL 5EFIB 5HGAB 4YBLB 1V7MH 3PQYA 1ZSDB 2JIXA 5KANG 4KPHH 3VXTB 4PJ5D 5JOEA 4MAUL 3IVKB 3BUTA 4UB0L 5CBEB 2GFBB 4PRDB 4H5SB 1I8LC 1FVEA 4O5LL 1HHIA 1M7IB 3DI2B 1FL3A 3CVHB 3HUJE 4W68A 4UDUB 1N59B 3GI8L 4XH2A 5FM5M 4PGBA 4JREC 1FVDB 1SM3H 4MNQD 4YBQC 4MD0B 2CGRH 3R8QA 1E0OB 4PG2A 1WWBX 5C0EA 3WL9B 5C08D 5FUCC 5EB9A 3RVWD 5ESQB 3VXRB 4WIQA 5DMJB 1LO5B 1SYSA 3DXAD 2MCPH 1YY8A 4NRXA 2O26U 5C2BH 4PJXE 3MBEA 2N7AA 4Y5YB 5MERA 1FL3B 5JHDE 3TN0A 3MRBA 3K4ZA 3MV9E 1NC4A 4LSTH 5CJQH 2XZAH 1UADC 1JTPA 4G7YH 1AGDB 2BFVH 3BDBA 5C0DB 3LKOA 2P7TB 1F8TH 4JFXA 3MMEB 3T2QA 2P24B 1O7SA 1RHHB 4I48B 1ZAGA 3TBWA 3MLZL 3PV7A 3IDGA 3VXMB 1BZQK 4JPIA 1RJCA 5F7WC 3QUYD 1MRCL 2R2EA 3O6FB 1AI1H 2K1MA 4RFNB 2F8XC 5TGBB 1T03H 2OI9C 4LASL 2MWCA 4PD4J 3WIIL 2H1PH 2EYSB 2A2QT 2BC4B 3QUZB 4QKXB 1YUHA 4K71B 5E2UH 1SJVA 2AK4E 3QXWA 3EFFB 4D9RD 2FIRT 5I8CB 1CLZL 1GXEA 1LO0L 4PJEA 1F02I 3WKNA 4MAUH 3QI9A 3VH8A 4HJGA 5IEKA 4WWKB 4HFWA 4KTYA 4WFHD 4HBCL 2WW8A 2GCYB 4R7DB 4X5WB 3ZDXE 5GSVA 4NFCA 3RL2A 1HSBA 1YJDL 4PJHF 2DMBA 3QDJD 4OLUH 4YWGH 1HXMB 1N4XL 3S98A 3I3DA 1KJVA 2DYPA 3KGRA 3MRLA 4F80A 1ZLVH 5D2NB 1CFTB 1CTNA 1S7TA 3V95A 3L3OA 3MLRL 3ALPA 2KH2B 4NO5B 3CZFA 2W0LA 3LRGA 3BP7B 3WO4C 1U8PA 1SBBA 5FDYA 5DJYB 2FSEA 4QRTB 3A0OA 3EDEA 2I60H 2PTTA 1NKRA 4QT5A 4UI2A 3P4NA 3AAZB 3SDAB 1UENA 2DI8A 1HHGB 3WFEL 3TZVA 5I9QB 4N9GA 1KJ2A 3K74B 3KDMA 1P6AB 5DMIL 1UEYA 2YA1A 5FYLE 4HUXB 4EI5D 2P8PB 1AD9A 2H32H 4I2XB 4S1DD 1W8NA 1T89A 5JOPD 5I1CL 4XMLL 4N0YL 5I1HL 1RZKL 2H2PC 3TJEL 4XWOD 5HD8C 1OF2B 3MGAA 4CU7A 2AV1B 1TJHL 5DJ8A 1OAQH 5HHVL 1MLCB 2QQNL 5AD0B 1PBYA 3MLUH 4HCRL 1LO2H 4NQDD 4PRHE 1MELA 1IGIL 2GAZB 1CXKA 2R0KL 4XX1G 3IDNB 1ORQA 1GIGL 5A1AA 2D0FA 3ZYZA 5DUMH 4E42A 2EYTB 4M8QB 5D6CB 1IAOA 2FX9L 2DI7A 4IRZH 5DYOB 1T5WB 1PVHA 1FG2A 3DX8B 1CL7H 1HIML 1CR9H 4Z7WA 3VWKA 4IHOB 3RGHA 5C9JB 3FL7A 5IVOA 3IAQA 1L6XA 1B9ZA 4F7CA 1MNUH 1QLEH 5EZJA 3HFML 3MLVL 2F58H 5HYJB 5E7BA 4D9QD 4DVRH 4OAWB 3SHSA 3HC3L 1NGZB 2NY4D 3QQNA 4DAGL 1RJYB 3INUH 1VPOH 1A3LL 2VDQH 5SWSD 1QNZH 1DUZB 4YUEL 2Z0BA 1ONQA 1AR1D 3HB3D 4X5LA 2ESVD 1OQXA 4JM2C 4M8VA 3DRTA 1MJ7H 1RZGA 3BDYL 1Z3GH 1NUGA 4N0FB 1G1CA 3WYRA 1FAIL 1ED3B 1QR1B 4DZBB 5HI4D 4OFVA 1M7IA 4X99B 4GW4B 3TT3L 5EUOB 2NZIA 3W0WD 4QF1A 2VDKH 4HGKC 1DQDL 4YGVA 3QPXH 3QJHB 3TV3H 1NSNL 3ZYIA 2AEPH 5BV7C 5F3BA 2R0WH 4WI9A 4D2NA 2HFTA 1R5IB 4MJ6A 4Y4FB 4U6XA 1U8KB 5IVXE 1BVZA 5F9JA 4JO1L 3MBEB 2ZUSA 5AZ2L 1HHHB 1IM9D 1R5VA 1J7VR 3S4SA 3TN0B 2R2BB 5F1OB 1QBML 3HZMB 3KYNB 2D7NA 1EMTH 4R26H 1PEWA 4K3EL 1ZHLA 1GC1H 4KAQH 3BDXA 2FJGA 3V4UH 2DBLH 4LGRB 3HR5A 1HHJA 5D4QA 3NCYS 5SWZA 4N8VA 3BXNB 3N85L 2NZ9C 3GJFK 3N1GC 1JF6A 5L9DH 1F6AB 1S7SB 2R4RH 1KYOJ 5KJRH 4WVRA 3U0PA 4S1DC 5JLZA 2AJUL 4D9LH 3KYOA 5MEND 3MNVA 4ZO8A 5T1KA 4JHAL 1CFVL 4FQ1L 1G6RL 4AH2A 4P99A 5F70A 3GB7A 1CGTA 4GLRH 2WUCL 1JI1A 1SBSH 2OR8A 5HHNA 1CXEA 2CDGB 1RY7B 4OCRH 4EIGB 4HGWA 3RIFF 1IQDB 2ARWA 1M05B 1ZLWH 3MV9A 3O4LE 2VLLA 5IG7B 1OLLA 3LKPA 3NZHL 1DTUA 1UWXH 1UZ8B 2PYEA 1RUQL 5L88L 4QTHA 4IEFB 3O6FD 3C87A 1KV3A 3O9WC 5AYQA 1ZLSH 4ONFL 4LVOB 3AS3A 2D7OA 2JKXA 3QDHA 4YFLI 3W9EA 2ATKA 2QQLH 4M8QA 1TPXB 2BVQA 2AK4D 3ECBB 1A6WL 1J0IA 2FEEL 5HSFA 1PG7L 3KLSA 3NFNA 5FECA 3QWRD 4YDIL 1EHXA 5CJ5A 4QRTA 4WY7H 4WW2B 3RDTD 4HMEA 4HXBH 1Q94B 4AK1A 1Q72H 4RAUA 2AQ3A 2BHZA 2DS4A 3F6LA 4EXPX 3ULUE 5ICZA 4XP9L 1GC1L 1WIUA 5JZ7D 3BN9D 3RHWK 2AJVL 2Q76B 4ZPVB 1SVCP 4E0RB 2P8LA 3PNWA 1B0GA 4PJ9C 2IAMD 3IDJB 4GRWH 5FYLL 1SJEB 3WXWL 3ZTJG 4PJFB 4CDHA 4PG9B 2F53D 2ILLA 4HMDA 1MAKA 5D6DC 1DLFH 4WEUD 3KPNB 4KKBC 5CUSH 5IJKC 1OM3L 4EI5B 3H9SE 1MJ8H 2NYYC 1ORSA 4XXDA 1P84K 5I1CH 3HTLX 4PP1C 5AYUH 1PZ5B 1UXSA 5CSZB 5C0GA 3CH8A 3U0WL 2DM2A 3VFNB 2V5MA 4NT6B 5HDLA 3RWCB 4EDXA 2ZPKH 2ICWB 4Y19A 5J6GB 1BM3L 4YH6A 5TQ0H 2QSCH 5H94B 3H6JA 4P46C 3TWCH 1FYTD 1LEIA 4N0CC 5GS1B 5CD5C 3IJHA 1VADA 5IUSA 5F8QC 5D2NA 4BH8A 3Q3GA 1KEGH 2AXGA 5IW6A 5DQ9B 4KV5F 3PGCA 2Z4QA 4RWYL 1I7ZA 1UYWL 2ZUVA 1J1OL 4XI5D 5KTEL 2W65B 1U3HB 1QVOA 4LSSL 1CFQB 1ZT4A 1ZHLB 3NIGE 3GFUA 5I1DA 2F8VA 3KPLA 1FC1A 4TTGA 4K7FB 1JYVA 1T03L 3RWFB 1SYSB 4GXVL 4XCYA 2OL3L 1JK8B 2UWEA 4UDTB 5LG1A 4C56B 4EI6B 1X5JA 2A6JB 3KPPA 3D18B 2VXQL 4ODUB 4R90H 3PIQB 4MXQC 4HUVB 5T1DH 2CKBB 1XCTB 3FN3A 4ZODA 3LQAC 2YD9A 3RVUC 3WNMA 1OAZL 1FVCA 3MR9A 3LKOB 1FZJA 4KI5D 3TIEB 3NIGF 4C55A 5TF1H 2HT3C 4I0PC 3TO4B 1YMHB 4YC2C 5D71H 4U3XA 1YEGL 1EV2E 2FH6A 2XY1A 3DURA 1YECL 2G60L 4K94C 1HKLL 1RSFA 1NGYA 3RBSA 5E8OA 1AJ7H 2XTJD 2VO5A 4GG6F 2I26N 3MLWH 3T0EA 5GGRB 2CDEA 3L5IA 4GG6B 4FNLH 5LBSH 5AZ2H 5IFHL 1A02N 1RU9L 1RJYA 1F2QA 3O9WD 1QBMH 3J7HA 4U4BA 4LIQL 4FTVE 3RU8L 2QSCL 2X4NB 4IRJA 5E0QA 5BJTB 2OMBA 1T2QL 4G8GD 3MSPA 4YPGB 1B2WL 2APBA 4ZPTA 5F7LB 3T0EB 4EIZC 5GRVL 1A6UL 1MHPH 4QRPA 1U92A 5HGBB 1U6AH 3A6BH 4LHQB 1AGBB 4YFDB 3AU1A 2NXZD 1BAFH 1F00I 3HKFA 2OQJA 3BEWB 4LSRH 4WI6A 4R96A 4WFGD 5E56A 1LE9A 5FK9A 3BW9B 3DRQA 1II4E 1I9IH 3PNWB 4F7PA 1KIPA 4JFDB 1DBJL 2VLRE 5EC2B 2C3VB 2VXQH 4PRPA 3UC0H 5MEPA 4I0PB 1NJ9B 3BT2L 4K3DL 3TO4C 1D5IH 1KTRL 1X6NA 2HKFH 2CQVA 5K9OB 4GXUM 2AP2A 4YZFF 3S35L 3TYGH 4XC3H 3UBXB 4DGYL 2GT9A 2FX8L 1UWXK 1A3RL 1N6QL 1KB5B 1W72H 1XF2B 4WU5A 1T1ZB 1EUTA 2P5WB 3MRNB 5DFWH 1P7QA 4JG1H 1BQLH 3LD8B 1L4IA 4GRWB 3HMWL 3DOSA 4OI7A 5EPMB 1VADB 3KJ6L 5J06A 1YN7B 3FB6A 2VJXA 4P2YA 5IMKB 2NY5H 2OX5A 4OF6A 3JTSA 5TFSL 2PXYC 2NXYB 4QRRB 5E8DL 1ND0A 2VXVH 1WEJL 1TCRB 2C7UB 2FGWH 4XC1L 2FIKB 3RVUD 2R23B 3QG7H 1HINH 1HWHB 2E7CA 1OTUD 4PR5B 4WY7L 1TQBC 4YO0A 3VFUB 4P48A 1DUYB 2ZG3A 3QCTH 3QPXL 4UT7H 3MODH 5IF0A 3BPOB 3P0VH 3MLTA 5EPMA 5E9DE 2YPKA 4Z9KB 4AMKL 1RIHL 3P0YH 5CEZL 5EZJB 5TDOB 4JN2B 3BOVA 3TESA 2AJYL 2ITDA 3L3JA 2F53B 3WCYA 5BVPH 3DX7A 4I8DA 4WHTA 1ERNA 1BVKB 3BGMA 3ZE1E 5IMLA 1QFOA 5DJ6A 4JR9L 1QSEE 3EJZC 3W9EB 3GIZH 3X13B 3V6OA 1D6VH 2I5YL 4OLYL 2P44B 4RWHA 3G6AB 5ILTH 1UJ3A 1PKOA 2BVOB 4PRAB 1HQRA 4BJLA 1EUUA 3UMTA 4KRPB 1KG0B 4AIOA 4L8CB 5E6ZA 4EDWL 4WW2A 3A67L 5FYJD 1XGUA 1JZ7A 1R3KB 1QRNE 1NAKL 4HS8L 5MENB 4YEEA 2GJJA 3B2UD 5IV2B 4K7FA 4FQIL 4LCCC 4NDMA 3MRFA 1EERB 4TVPH 3WFBL 3ZKXC 2WUCH 5D2LA 4PRAA 4OFDA 3TVMB 2ZSVB 4GQ9H 1RZJC 1O7VA 5BMFL 3NFSL 3B8SA 35C8L 5T3XD 2ZCLH 3HG1A 4WUKH 3QXAB 5JHLH 3WNLA 1EO8L 3BPOC 5GGTA 5LCVL 1QHOA 4HIJB 4NDMB 4N0UE 3GIVA 4JRYA 3RA7L 4HUKB 1YA5A 4PJ7F 5I76A 1CF8H 2NY2B 5DHXB 4I4WA 2HTKC 1M71A 1CGYA 1OQOA 4KTDL 2R39A 4JAMA 4LLMB 1LE9B 3NIFE 4APQD 3TT1H 5DJDA 5BO1H 1JRHI 2QQLL 1EPFA 1S7TB 1UM4H 1JGVL 3O6LH 1WIOA 3CCHB 4G43A 3RKDD 4K94H 4MD4B 5DK0B 4NC1E 2YHGA 2AK1H 4KKCD 1T4KA 2AXFB 1DP0A 4Y5XC 3AM8A 4WI8A 1JTTA 2DKUA 4IRJC 3BHBB 1QD0A 1M05A 5FYKU 3QH3A 4NQCA 4PJHB 1A5FL 1HEZB 1D6VL 3ARDA 2YRPA 1CD8A 5EUKA 3FO2B 3LEVL 3B2VL 1CXFA 1P4IH 1Q0YL 1QYGH 1NEZG 2QQKH 3KS0H 3IXTB 1ZGLP 2A9MH 3ALXA 5IQ7L 3FT2B 4LSTL 3T0EC 4PJAF 3V4PH 4X6CF 3RRQA 4Z78A 5DRZA 3DMMB 1FRGH 5LGHH 1H5BB 1VESA 4P23C 3O9WB 3I6LE 3V52L 1BQHA 5HYEA 2C4XA 2F54B 3HZYA 3UTSA 1T89C 2BRRH 2IQAB 4CJ0A 3MNWB 2JB5H 3ARDB 3TO4A 1XR9B 1F5WA 2SEBB 4HLZH 4Z7WB 4N90E 4XBGB 1HHKA 4P9ML 1WCQA 3GMMA 3RIAF 3WO3B 3MLZH 3AY4A 1BECA 1G6VK 2WUBH 1WZLA 3OR7A 4PGZA 4PJ5A 5EORL 3RUGE 2HT2D 2OSLA 4DZ8A 2HJFA 3BKCH 5DQJB 3V7AE 2JF1A 5DZOA 4HJJL 1FL6A 5GGQH 2Q8AH 1DBJH 3RY5A 4UOW1 1KJ2H 2HN7A 4QTIL 1J0YA 4Q2ZA 1ZWIA 4WUUA 2E9IA 2EC9U 3TH2T 1A3QA 4GSDH 4EBQH 2OJZH 5EWIH 3CFDB 2QADD 4JFDD 4FQXB 1TJIH 1NL0L 4IRJB 4ZQKA 3SKNA 4G8IB 3P77B 3QQ9C 4GFTB 4U1LA 4I0PD 3ZL4L 1DDHA 3T8XA 3DXAA 3VE0A 1N3NA 4V1DA 1FNFA 1G1YA 1BQLL 3L6FB 4K94L 1TTUA 3FO0L 2PXYB 4X6DA 1VCAA 2DWDA 1MFNA 1R3KA 4JKPL 5DHYA 1AGBA 3MOBL 3GMLB 2IPKB 4ZSOA 1MHCB 1I7RB 1S7UA 4LCYA 4QHUA 3WLBB 3S88H 1DVFD 4UT9L 5IB3B 1D5XA 3RY4A 4BFGA 5IW6B 4ELME 3KHOA 4YXKL 2W65A 2PO6A 5GGVH 1YECH 4BZ2L 1AGCA 1JNHB 2J4WH 5DJ6B 1HKLH 1EAJA 1RK0B 1JPGA 1XGRA 1P5UA 1JWSA 3KPLB 1T66C 4J8RB 4AIZA 2FO1A 1H3UA 3V6ZA 1A14H 3VXQB 4XNUL 3T4AA 3V9FA 4U49A 4YDLB 4OI8A 5JOPE 5EZOL 5B4MC 4J6RH 4OCMC 3S5LA 5FFLA 3P73A 1D5BB 3SKOA 4I18C 4ODXB 4XPAL 5I1AB 4UOW0 2WUBL 5EORH 1I3VA 2GK0B 1C5CH 2VXTH 5E4EB 3IDYB 3ULVD 5ILTL 2EDQA 5C6TH 4KKCC 4KJPD 1A6AA 4KH2A 3QNZA 4HX1B 4MXWH 4LRNH 5E1AB 3QO1B 1CL7L 3GK8L 4ELKA 2B1AL 5ELIA 2M1KA 1CTOA 4IRSB 2NR6D 1SJHA 2HWZL 1HILB 1HZHL 4MZ2A 4G6ML 4FQPA 1VEMA 3MLVH 2J3SA 4KK8C 1MRDH 1NEZB 1WISA 5F93C 2AABH 2ARJA 2DI9A 3RAJH 3SDCC 5E03A 1QSED 4JFED 2HVJB 4YHYC 3I50L 4PP1D 2YPVL 5L8KB 4KK6D 2IQ9H 4XMPL 4F7MA 3LSOB 2A9NH 4IMKA 3REWB 1JNLH 1T04A 2GJZA 1L0QA 5BXFA 3TYGL 2XWBB 1N6VA 4XNYH 4TSBL 1K8DA 5DUPH 1AQDB 4M7KL 3LS5H 3ZDYE 4K3HA 1QFWI 4ZFOB 1C7TA 3BPLC 2J8HA 2EDLA 2FECI 5EC1B 5CFHA 5C0CE 3A6OA 3TT3H 5DD0L 4XPFL 4DKAA 1S7RA 1EVUA 2OQJB 3OBAA 4UQ3B 3VXME 1INDH 2HJFB 3UDWA 2EDWA 1HQ4A 4PJDA 4DTGH 3RVTC 4RZCA 2Q76A 1JZ3A 1WEJH 3MUY1 3OPZL 5F9OL 3I2CH 1KC5L 3GSNL 4LSPH 5T3XE 2EO9A 3FB8B 1QFHA 3ABZA 4M4PA 4YHNB 3JV6A 4R4ND 5EC2A 4J3WA 4IOFC 4GW1B 5CJOH 4LVHB 1NGWA 1N2RA 4L3CB 3OGCA 4GKSB 3SKNB 1CFTA 3NA4A 9CGTA 3FZUC 4IRSC 3VFOA 4LDOB 4NQCE 3C6SB 5KSBE 5ADPL 1CFSA 3ALWA 1W0YT 5B21A 5D9SB 3TA3C 3BP5A 1T1XA 5ICYA 1H3TA 2A73B 4Z8FL 1LP9E 3MUZ1 4ZUTB 3O8XD 3IDIA 5KVGH 4KJWC 2UZXB 3HPJB 3QYCA 1ETZA 4MMXC 5DJDB 5BS0D 3VH8B 5IEKB 3WS6A 2HTLD 3EKCA 5HGDA 3C8KB 1S78C 3PHQA 5GGSA 5CEZD 3IU4L 3JWNC 1Q9LA 2GQHA 3H3KA 4OT1L 4M93B 2C3WA 4F57L 3FN0H 1QSFA 2X9XA 3VFUA 4OCRL 4RFEB 4AT6B 5C1MB 5HVGB 3VWJB 1J1XH 3L3KB 1UM6L 2WBJD 4KVCL 2ED9A 4KKBD 3FO1B 4N0RA 1UEMA 3V0AC 2GSIA 3S4SB 1BGXL 4ZDHB 3TO2A 2FD6H 4Y88A 2ZUUA 1MWAH 5CIPH 5EO1A 3FO2A 4WI2A 1T7ZA 3I9GL 4G3YL 1JPST 3PE9A 4RFEA 2HH0H 2DLTA 2EXYD 2XKNB 3BP4A 4DWHA 4KWUA 2YD2A 1GGUA 3KPSE 3RKDC 5HI4C 4ESKA 5JOFB 2F54A 4NYLB 3CDYA 1R24B 1AC0A 1RULH 2FEDC 2JJSA 4JFPB 4YGVB 3M1BA 3OJMB 1MEXL 3BH9A 3ROOA 1FAIH 5MENA 3QAZB 3EJZD 3C6LA 4ZFGL 4DZBA 4RQQB 1U93A 1I7UA 1P53A 2EKSB 1A6VL 4WU7B 3C60B 3N1PC 3P4MA 3QIUB 4CL7A 2VE6A 1BZ9B 5DO2D 1LK3L 4YHZL 4FXKA 3TV3L 3VFTA 1QRKA 3EYSH 2CDFA 2PETA 3NFPA 3K3QA 4HZLB 3U2SA 3MJ9H 4LOUC 1FAKT 3QUML 3D2UD 1A1NB 1OM3H 5C71A 1HYRC 1RJLA 4JM2B 4H25B 3U7YH 1MJ8L 1IVLA 4RMWA 4JN1L 4RA3A 4H5SA 3CDGA 4OZGE 3EYQD 5K9JL 4PUBL 4PJFE 1VERA 5DZLA 4IOFD 4HIIA 5FF6A 2BX5A 2P5ED 3MLYH 1I3RA 4MNQA 3RWDA 1KNOA 2PYED 2M2DA 4WI3A 3WD5L 4GQPH 5KANI 1P4IL 4LAQH 3O6FA 3ZTNL 4LPWA 1KELH 2QJDA 2E27L 2Z9TA 4NCDA 2VUOA 1A2YB 3TNNB 5J12B 3VFGL 1DN2A 3VFMB 3QFJE 2V7HB 2XACC 5C0RL 4P57A 5GRUL 2HFFA 5I8CA 1OARH 5DC0A 1IC7H 3GK8H 5I1EL 5IWLA 3OZ9H 5ADOH 2YD6A 4HJGB 1NKOA 5JORA 2DYPB 5J1SC 4MD5B 2FDBP 4Y4KB 4CNIA 4O02H 5TDNB 4YBQD 5D9SA 3G6DH 1IGYB 1Q9KB 2VXSL 3EYVB 4J1UB 4QHLA 1D5MB 2DQCH 3S97C 5GPRA 1HHGA 4MLIA 4C54A 2C1OB 1MFAL 3SKOB 2R2EB 2C7UA 1E4KA 5I1GH 4BKLB 2HTLC 1MAML 1A0QH 4FA8A 4GW5A 4JO3H 3X12B 2DQJH 5D8JL 3OV6A 1IEBB 1MLBB 4JVUA 1C5BL 2ICWA 4Y19B 4MVBD 2FO4A 2J6EL 2EYSA 3FQTB 2XNAA 5D71L 2OTUA 3V5HB 1IC4L 3QI9D 3CUPB 4S2SB 4Y16B 1T5XB 4XCFL 2YPKB 3QWQB 3BAEL 4MAYB 1CICB 2FRGP 3CX5K 3FJTA 3R0MA 4LLYA 2HLAA 1IGTB 3MRGA 3DX7B 1DVFB 3CFCH 4R97B 1B0WA 4P4KD 1UCBH 5C07A 4L5FL 4LNRA 4ELMB 3GBNL 3QDGA 3WEXB 2P8LB 4Q2ZB 5F7YC 1ZS8A 5IFHH 1UB6B 3B8YA 1KFAH 1G9MC 3ILPA 1FNGA 3Q6GH 1Y6KR 3BPNB 5T5FL 1DEEA 5HVFB 4ZNEA 3OB8A 2WWMC 3F7VB 1CD1A 1W2KT 4M3KB 1LO4L 3G04A 1SYVB 3ULVC 43CAA 4OGYL 5C0NC 4J12A 3MO1B 3BD5A 4OZGA 4M62H 2BSED 1C08A 2PXYA 4BSWA 2R0LL 3DVGB 1QQDB 5CMAB 4IMLB 1OCWL 2ID5A 1U93B 2NY5C 2X4PA 2Y1VA 3L3KA 4GS7C 1ZHBB 5L7XH 1OOAA 5TH2A 4M6NH 5FHBH 5HHOE 4NBYB 3QNXA 4HDIB 4LSDA 4FQQA 4KQ4L 1WIPA 4K8RD 4OT1H 1M4KA 5IP4A 3QDMD 1U8NA 4ALAL 2W07A 1FZOB 1NGXA 4KJQC 5C07E 3A6CL 4U0QB 5K59E 1UQSA 3CFBB 4AG4H 3O45A 5CMAA 2CDEB 1KLUB 3QEGH 4F9PA 1MCWM 3C9NB 1KPUA 3FOMB 2Z93A 1N6QH 2DQJL 1XF1A 3KPSA 3OG6B 1AGFB 2YK1L 3RVXD 4AEHH 2X1QA 3GI9H 1E6OL 1MUJA 4KDWA 3C5SB 2IQ9L 1H3GA 4IHOA 3C08H 1U2HA 3HPLA 4HKJA 4J7RA 3CFBA 1U8KA 1IEHA 4NO2A 2GITA 2Q3AA 4TNWF 5H37H 3FOMA 1KPUB 3RWEA 5DJAB 1JWMA 4PJIB 3MV8A 5EU6D 1D9KA 4YBHA 1ONQB 3K1KC 3PGDB 4L8BB 4WHYG 2PR4H 1FVDA 1K6QH 1NCDH 4LU5H 5I1LA 1BOGA 3ET9F 3QCTL 2Y07H 4X7EC 3Q6GL 4PY7A 1INDL 4G8FA 4YHOH 4NO3A 1A6PA 4HKJB 3LZFH 5HHQB 3KPRD 3BN9C 3KPRE 1I1FB 2V2TA 2FLRT 3W0WA 5FYKL 3OPZH 1WK0A 3KWWA 3GHEL 3H42H 4MNGE 5DD1L 3H0TB 2OJEA 5D1ZD 4OZHE 2R8SL 3RVWC 2J1KA 1I7ZB 1I3GL 4FQHB 4F7MB 5DRWA 3MZTA 3WIHL 2XKSA 3AM8C 1OGTB 1PKQA 4KJWD 3CH1B 1SVZA 2DQGH 4HC1L 3BRFA 1G7IB 5E8EB 1MCJA 3O6KL 2APXA 3VG9C 3QIBA 2ZOLB 3QIWA 5FGCB 1JK8A 2UWEB 2WK2A 3OF6D 3D2UB 5IWLC 4KQ4H 1UB5B 4W6XB 4XRCB 4WJ5A 3OWEA 1WT5C 3L95A 4QXGH 5DRWB 5C0ND 4MB4A 4EDWH 2FECL 5I8OH 1YYML 2PYEE 4OIIH 3LV3B 3FCTB 5IESH 3UYRH 1RUKH 3NIDE 3JV0A 1KJMB 1Y6MR 4PJDF 3BYYA 3QRFM 4PJAB 4DN4L 2YN5A 3WFBH 4QHNB 2QBWA 3BRDA 4ZD3H 1U6AL 5HYJE 4HT1H 2PTUA 2HP4A 2D0GA 2LVCA 5DHVA 3GO1L 1E6OH 1NGWB 5TDOA 4F58H 2Z8RA 2R56H 2J88H 3VWJD 5JW3H 1CGUA 4O02L 3CFIC 3TIDA 3RGVA 1WQVT 1ZVSA 3FCTA 4AH2B 4UV4H 3QPQC 3TZVC 2WSKA 1HSBB 4MWFA 5GS0C 4M61B 1CGSH 3DVNA 4DFHA 4M00A 4U31A 5CIPA 2VR5A 3AXLA 4Y0GA 5DXWA 3T3PF 1ITBB 5MHSE 4PJCE 1CLZH 2JJSC 4NUGH 4NQDE 4PRHD 4KZDH 4OIAA 3AGVA 4MAYA 5SX4I 4DUWA 4FABL 4HWBL 2AGJH 1MVFA 1AE6L 4ERSL 3MRDB 3RFZC 4LLVA 3L3OB 2HT3D 1JUFA 3UTQB 1ZT7B 3LKQB 1AXIB 5EOQL 5C0GB 2NLJB 1D5ZB 3GHEH 2JLLA 2X1WL 5FCUL 3VFRA 2ESVE 2EXWC 3MFFA 5F97E 4PGJA 3SKUD 1DUYA 1I3GH 5DA0B 3BEVB 3VFVA 4TQEH 5CAYB 4FG6C 4HS3A 2BVQB 4WEBH 4S1QL 5DVNA 5IBLD 3QWOB 2V5RA 1G7MB 4I3RH 1WWCA 1DCLA 3LAFA 5E2VL 1ZHNB 3GBNH 3RIFK 5F6HI 1AY1H 2E3VA 3DUSA 1MF2H 1IGYA 2NY7L 3MGOB 5CINH 3UJIL 3EYSL 2QQKL 2BDNH 1DQTA 5JNYA 3HRPA 3KYMB 2A6DA 1KTKE 2OZ4H 3B9KA 4M48H 4U6HA 5DMIH 3V4VL 5IQ9A 3V4PL 3SDDD 2ZP0T 3BSZL 2Z31A 5F89B 3MROA 3D85A 1RUKL 2Q87A 2WQ8A 1GHFH 1L7IL 4NYLA 5TE7H 3BKML 4GRWE 3MUGA 3MZGB 4L8DB 4CADB 5CP7B 3H9HB 2NY1B 4LAQL 4GKZB 4FFVC 3HMXL 2OP4H 5F6HJ 3BH9B 2FYYA 4RMVA 3DHJA 5B38B 4QCIA 4ZO9A 4KDTC 5KSBF 3VJ6B 3EJJX 1T3FB 1YDPA 3IFOA 3K46A 4UTAH 1NANI 4ZAKD 5C0RH 4G6JL 1XR8B 4UIKH 5DDHB 4QTIH 3MLSL 1TVDA 2DD8L 2H45A 5HDBF 1RUML 2HLFD 4JG0H 3HRZA 3MPCA 3NCBB 3QCVL 4HS8H 1DBKH 1JF1A 3HPLB 3RKPA 4F37K 1WCBB 3OJ2C 5DMKB 5CCKH 2BSSA 4FZEL 5J8OA 4GG6E 3F7VA 3QDGE 3QXTA 3QQ4B 4D0DA 1AO7B 2MMXA 3U4BL 2N1KA 3ES6B 4LLWB 4JFFA 4LMQE 1IAIH 3VXNA 4U6VL 2HFEA 4WJ5B 3IFOB 3DV4B 3SDAD 4K3GA 1CXLA 4DGVH 1VPOL 3ARDD 4Y2OA 5BOPA 4DK3A 2OK0H 2Y36L 1ZVYA 3UEZA 4D0BB 2DQCL 5EO9A 5I9QC 1NUNB 5L0QC 1N0XH 5JA9A 4APQC 3MRJA 4GT7A 5I1JL 1KF9B 1MI5A 3DBXB 3QQ3B 4HEPG 4LQFH 1TPXC 3ULVE 2E8YA 1KT2B 3QRGL 4KGLA 1YYLL 4LCWD 2ICEB 5GIRA 3M45A 5DK0A 4N8CH 4ODUA 1JNJA 1XF3B 4CMMB 4R9HA 1IGML 1TTFA 4XHQA 4X6CE 3BEWA 4Y16D 3DUUA 5SX5K 4ZUWA 3SE9L 2XXCB 4WWID 2NTSP 3MCKA 2H32B 4QRPB 2ADIA 1TZGH 5K33A 4MGXA 4YE4L 3DSNA 1TVHA 4PJBF 4YXHH 4WGVB 3EYFA 4OF5A 4OZ4B 2LFGA 4M5YL 4KMQA 2ESVB 3V6OE 4OTXL 4UAOB 3SY0A 2QKIB 4HULB 1CDYA 4XTRC 1S7VB 1ZXQA 2X89D 4HPYL 3FHQA 5I16B 4EUPG 5D1ZB 2A0LD 4KAQL 3OB0H 2I9TB 5T1MB 5BVJB 4XVTL 2FWOA 1F4WL 1FH5H 3FQXA 3B2VH 5MEOB 4N1CA 4LPYA 1JRHH 3ULVH 2BOBA 3QEQD 3LQZB 4PREA 4YHMH 25C8H 3BYTA 3GSWA 3VFVB 2H9GA 1RUMH 1WBYA 5T1LA 1X5FA 3MJ6A 5TE6L 3UTTD 3R06B 1IGCH 1KB5A 5IJKA 4OQTL 3V5KA 1I7TB 2ARJQ 4XT1C 5DJ8B 3QUMA 3W2DL 4NJAL 4WV1B 4XCNB 4Z7NE 1HDMA 1NGPL 2R23A 1CVRA 4P9MH 3FQXB 3H0TA 4OCLC 3CLEL 1VFMA 4ALAH 5MP6L 4J8RA 4QRRA 3ZKMD 1CZ8H 2IAMB 5HDOA 5J13C 2VN7A 3F5WA 3JV4B 3EOBB 1JPSL 1ZT1A 4HJJH 5HGAA 3SJVB 4LHJB 4XNYL 2A6IB 3DTXB 3S9DB 1LHZA 3RL1B 3MLPA 5JW4M 4BFIB 3TYFA 3P3YA 1RZ7L 4ODVL 3LB6C 3HG1E 3MUHL 1MFEL 2OTWA 3QG6A 4EBQL 2FNBA 5K9OA 3BEVA 4PGEB 4ERSH 1VEOA 3SGJC 5ICZB 2NX5D 4KXZH 1FFPA 2DTML 3BUYA 4LDEB 5BV7L 2EE9A 2BY1A 4X4YB 5D1ZC 4MSWA 2A83A 3CSPA 3ULUF 1QFWL 3TBSB 5D2NC 4PJIF 3O2DA 4JZOA 1Q1JH 1A64A 2VLKA 4XAKE 3T77B 4XI5C 5IB4A 1XGRB 5KS9B 4WEBL 2BNRE 1A1OA 3TCLA 1IL1A 1ZV5A 3LZFL 4WTXA 5HGHA 1HYSD 3PGFL 2H6PA 3SQBA 1AY1L 2J2ZA 4JJ5A 2E6JA 4OKDA 3VDAA 2RHEA 1MRCH 4BZ2H 1IKNA 5KAQF 1T1WB 4PJIE 5DJ2A 1R5WB 1U8QA 2CJUL 3D0VB 3C09C 2R1WA 3QXUA 4YC2B 1NLDH 4ETYA 5GJSL 4G6AD 1I85C 4U1MA 4NO0A 5DJAA 4X6BA 1GRWA 1ITCA 4PB0H 5EULV 3IDGB 4J3UA 1D9KB 3TBYA 1G6RB 1U8OA 5I17B 4L3EE 5IBTL 4XPAH 4UILH 4Y4KA 2GK0A 3RWGA 2RFXB 3WL9A 1ZVHA 3O4LB 1YEDB 2YUWA 1OW0A 1TJGH 4JPWL 3E0GA 2XQBL 4NKDA 3RDTB 1YMMD 3KG5A 4Y2DA 2AAVA 3D25A 4X7DC 5B39G 3B3IB 3SY0B 3U0PB 1EEYA 4DGIH 2VH5L 1PLGL 3MLRH 4AEFA 1C16B 1PY4A 1R3LB 3CH1A 5JXAL 5BVJA 1AO7D 4XP5L 4J3SA 4OF0A 1MI5B 1OSPL 4PJXF 5DI8B 2AEWA 2L4OA 4OLXL 3O4LA 4UQ2A 2Q8BL 3WE6A 4Y5XB 2LAGB 4NZDA 5KG9A 5EA0H 1IGFL 3MJ7A 2DKMA 3H9HA 3BQUD 4P2OC 3UZEA 1HH9A 2DQHL 3MOQA 5HHVH 4JRYD 4YIQB 4BQBA 4HWBH 4M1GH 1F58L 5C07B 5IB5B 1G9EA 3TBTB 1JGUL 4XP6L 3GJEA 5ETUA 2HMID 4HQQH 5GRZA 1GAFL 3DIFA 4APQA 3F7YA 1KCSH 3ARGB 4GAGH 1TQBB 3M17A 4YHYB 4GUPA 4NQXB 4ZG1A 3I85A 4PJ8B 1EFXA 1P4LB 1FFOA 2C1PB 1FPTL 4JGJA 1UA6L 2APFA 3WFHB 4P2QA 2VL5B 5H8DA 3T65A 2N4IA 3MA7A 4YEFA 4Q58C 1Q94A 2BSRA 5F96L 1RU9H 2HVJA 1MIMH 3B5HA 4LPTA 3ZTNH 1P1ZA 2NMSA 1P9MA 5TJWK 1MY5A 3F62A 4MYWB 3LIZL 4G6FB 2VZTA 1ZSDA 2JJWA 1K8DB 2W59A 1HEZA 2AI0H 3ARBC 3IDJA 1ROWA 5E94B 4I3SL 1OAUL 4I13B 2XQBH 2FSEB 2MPAH 2R4SL 4JM4H 5E08L 3JZ7A 3O2DH 2XFXA 1OARL 4F9LA 4WO4A 5IFJA 3ZKQD 3MGTB 1HN1A 3UTPE 1T66D 4TPRL 4LVHC 2H6PB 4WHDA 3TO4D 1EEZB 4KMTL 2L7JA 2V17H 1XIWC 3HI1A 4NKOA 4RNRA 1HE7A 3JVGC 3IDUA 3TWCL 3UC0L 2EXWD 1OAYL 2GAZA 4AENA 5FYJE 1CDBA 4O51A 5CZVL 4ZFFB 3SJVD 4JFHD 2G75A 1FSKC 3EO9L 1QR1A 5E8NB 4PGEA 1JL8A 2CKBL 1CDHA 2GSIB 1ZA6B 4NQEB 3N0PB 5LAXA 1D7FA 4JQVC 3V0VA 5DYOA 4KRPC 5EBLA 4NHCL 3TEUA 1OL0A 4NFBA 1IT9L 3KXFE 4RRPG 3V6OC 1AC6A 1DE4A 4UZGA 2F15A 3T0AA 3V4UL 1JWSB 5F3BB 4GKNB 3O11B 1KXTB 3KJ6H 5BZWA 5HHMD 4GOSA 5CP3A 1P2CB 4TSCL 5JOFA 2W9EL 3VRJB 4FP8L 2MFNA 5C08B 4WW2C 2QV2A 2EYRA 2R9HC 3TVMC 3BVNA 4R7NA 2GTWB 3BWAA 1QFWH 4JDVA 4OZFB 4KHTH 3ROLB 2EZ0D 3SGJA 2VZOA 1JJUA 4NPYB 3GMLA 2YC1B 3MODL 3DRTB 1GC1C 4LSUL 3IJSB 2FHFA 5L6YH 3ARZA 2B5IB 5EIIB 1OTSC 5EU5B 2VLRB 4LPVA 4NUJA 4ORZC 2X05A 5CEZH 5F1NB 5C0CA 4Z7VF 3BIAX 1BZ9A 2MNUA 4Y5XA 4B7IA 4QHLB 4HX1A 2PO6D 1TZGL 3R8BB 1X4ZA 1IJ9A 4QRRE 2KUTA 1OAUH 1BLNB 5I30L 3VD9A 3MCLH 4FXGB 2D4DA 1SM3L 2JB6A 1KCLA 3MRRB 3QUZD 1HH6A 2X40A 4L4VE 4N5UA 1JPGB 4PJGA 3MXWL 3X3GL 1A2YA 3NN8B 5LBSL 2I5YH 2E6QA 4JFXB 3QEUB 4KMTH 4MNHB 2BZDA 4A6YL 3B43A 4JPVH 4RGND 5F9JB 1KCUH 3H3PH 3O2VL 1J8HE 1R24A 2F5BH 3K1DA 5D93C 4P23A 4YZFE 1A6WH 3ELAT 1OAYH 3CZFB 3HAEA 3CAFA 1AFVH 4YDIH 4ZFOA 1FHGA 3EO9H 2P24A 5E5MA 5F3HB 3SE3C 1F90H 3ZT7A 1YEIL 4NCC1 1NBYA 3BXNA 2ADGA 3D69B 3MA9H 2BNQD 5JW4Q 1U8LB 1WTLA 4TOYH 4HMCA 4GQ9L 4PJEB 3EZJB 3PHOB 4JFQB 3VI3F 3GRWL 4PJDB 1IGJA 4P23B 3RJDA 3HUJB 4P5TC 1CQYA 1IKFH 1AKJA 1I1AA 1KIPB 3DX9B 5HBBA 3RHWF 3HZVB 4PLJC 4YDVA 3GUTB 3EIFA 2Y4SA 4HWZA 1DQLL 4ZS6D 1EVTC 1CLOH 2FHCA 5EA0L 2JJUA 3ZLQC 2KZWA 4X80L 3WS3B 1AD0A 3BQUB 3ARFC 3CZJA 5EU4B 3ME0A 3VFWB 4PYHA 1VACB 3QP3A 1UKSA 4JFQA 4ZFZA 3TT1L 4JO3L 1G7MA 4G80A 4PRNB 2OCFD 1W72L 3MRHB 2IPTH 3IAGC 1JGUH 2NX5B 4XP6H 4ZUUB 4JQIL 5D1QB 2V5YA 5B3NA 3QNYB 1MQKH 2ADJB 4NKDB 5E99L 5C9JA 3W39A 3UX9B 1LK2B 3IXTA 4XCFH 5EBMA 5DMGC 5IJVB 4ZSOE 1AD0B 1N5YH 1BFOB 4YNYA 3X14B 3WSQH 1IKNC 1MREL 1NGZA 1YNTB 1WUNT 4ZO7A 4ZYKA 4PRPE 3NA9H 3VGBA 2FLBT 5EU7C 1W0WB 1HINL 1X44A 2CRZA 3QDAA 2F19L 4FQXD 3MUGB 5FUZH 3ZKXB 5H94A 1QSFB 1KPVB 1T2XA 1GGTA 3QNYA 4PJCB 4PJ8D 4WHYH 2P47B 2KQMA 5C0EB 1XMWA 6FABL 4LHUG 4PJ7B 1E4XL 5EDXA 3D48R 3GMRB 4P4KB 5DSCB 3R1GL 4GBXB 1NPUA 4LLUB 1S9WA 5HI5C 1IAOB 4JKMA 1UWEL 5CEYA 5FOJA 3X12A 4OI9A 1C5DA 5FA4A 1R6VA 3HI5L 1VB9A 3L7FA 1OGAD 1CFQA 1ZT4B 4KPHL 5JDJA 4X7SH 3SO3B 2P7TA 5BS0A 4Y2DC 2X42A 2UZYB 4AENB 2UYLA 5IB4B 3EFDL 4KUZL 3QQ4A 1WTGT 5DRXB 1CICA 1RZ8B 3O0RH 4NM4H 1MOEA 4ORGB 4QRSA 2B0SH 5GGQL 3G5ZB 1MFDL 2R1YA 4YQXL 3P30L 3VW3L 2I25N 5JQ6H 4RAVA 3U6RA 1ZKAA 4R4FL 2KKQA 1ZLWK 5E5RB 1LWRA 5GS1A 1R5WA 1NAMA 2ZOLA 4JFZL 1HNGA 4HUMB 1FNSH 5ACLA 4DVRL 2EE2A 1IE5A 4OLXH 5F7FA 5GS0L 1T83A 4EOWH 4OCSL 4XAWL 5FA3A 2IBZX 3FOLB 4Z7UF 1V3MA 5ESVB 1NC4B 2HTKD 5L2KE 1BIIA 4YUEH 1TMCB 1OWWA 5E2WL 1OVZA 2WWKT 5TPWH 2BFVL 4HFUH 4I9WD 1CI5A 5FYKE 1BZ7B 4HD9A 3IAPA 5J3HC 3RL2B 1GGBL 1DFBH 3CDCA 1TNMA 4HIIB 1RHHA 1E6JH 5AWNL 4NKOB 3S5LB 2F19H 5FUZL 3VD7A 2B5IC 2YEZB 3HLAA 2FX7L 3TPKA 1WAAA 5GS2D 4GAGL 3PV6B 1QBLL 5L6YL 3RDTC 1JP5A 1S7WB 4LASH 2I24N 3UDWC 2VZ3A 4OF8A 4QTHB 4PJGF 1LE5A 2KL6A 3E3QE 3ETBF 5CSBA 1NMCB 2ZUXA 2EXYC 1NBZA 4NKQB 5I30H 1D5MA 4NJ9H 1VACA 2WV3A 3PL6A 3PWUB 2YEZA 2XZQL 4FQLL 1NBVH 2IANE 2VDPL 6CGTA 3UTQA 4JQXA 4ZTOH 4PJAE 1BF2A 3PQYE 5FECB 3T0BA 4KUZH 5E7FA 1U95A 3TLRA 1Q9KA 3EYVA 2GITB 2PW2A 1IM3B 3LRHA 4OLUL 1Q0YH 1QYGL 3DWTA 4M1CC 4G6JH 4GRWF 4LEOB 3HN3A 2WWKO 1KENH 4Z7UA 1I9JH 2G9HA 5B3JE 1J87A 2YPLE 4JDVB 4OZFA 4X8JA 1N8ZB 3L3IB 5GQBA 1KCRH 4A6YA 1RUAL 3HUJA 4BSVB 2HWZH 4YHLL 1FNLA 4Q6YA 1I1FA 2V2TB 5CEZE 2J8UA 4W4OA 1XGQB 4P57B 3GMMB 4YJZL 3OX8A 1JN6A 2W60A 2ZOKA 3FAWA 3OR7B 3IFNH 2MCG1 4MAYC 5IHBA 1J8HA 4WI7A 4NZTL 4UOJA 1RJZB 1NFDF 1OB1B 4HIXH 2FIKA 3BW9A 3QULA 4U1IB 4OGZA 1I75A 4HCRH 4J23A 4NQSA 1NCAL 4GMSL 2RCSL 4Q9BA 1EHLL 3O6MH 4XXCC 5E9DD 5DD0H 2HVKA 4OF7A 1LNUB 4F2MA 4GW1A 2BCKA 4YGAB 4P2RD 5B38A 4YNYB 4LLVB 3I6GB 3P77A 2ZCHL 4B53A 1PQZB 3MO1A 3KLAB 3KYKL 3SCMC 3S96A 4Z7WE 3UYPA 2CD0A 5DDHA 2DJ4A 4JRWA 4NC1C 1RAMA 4OLVL 2Q7YB 2APTA 2IANB 5JIIA 1U8NB 4MA7L 2BMKB 3MOBH 3B9KC 5HXMA 3T09A 1U8LA 2XZQH 2NXYC 4LSUH 4NP4L 4OAWA 1DQQB 2AQ1A 3I6GA 1W72B 4NRZB 2DLFL 2HLAB 1F11B 1U41A 1CE1L 4UU9A 3WLWD 5BMFH 1GL4B 1G9ML 4JFFD 2XV6B 2XTLA 4GBXC 3AAZA 3ZE2E 1YZZA 3RWHB 4JHBA 4S0TD 1QTYT 3O45B 5CP7A 3UYOD 1Q8MA 5GRYA 2B1HH 2WIIB 3AS0A 4HBQA 5JHDA 2VR4A 4NO2B 5HHOB 2BY2A 1E4JA 4OV5A 1NFDA 5FHAL 1DR9A 4NQDA 4XZUA 4N5EC 1FZMB 1A7RH 1JVKA 5KSBA 1SJXA 1J8KA 1LO0H 3UBXG 1BX2A 3O2VH 1TITA 2EDEA 1OD7A 3PV6A 3K7UA 4FZ8L 1RZFL 1DSFH 1KOAA 5ISZA 4KFZC 2NY3D 3EDJA 3MFGB 2P8MA 3WFCL 4QOKD 2V5TA 1N4XH 3STZA 1I1AC 2MTPA 3D5OF 3L5XH 4HXAH 4Z7VA 3PWUA 3MLXL 3LCYA 4P46D 1MWAL 5DJZA 3BJ91 1NGXB 1FZOA 4EXKA 1AHWC 3D39D 4X4XA 8FABA 3KPQA 5IOPA 4AL8L 2I9TA 1U95B 3CCHA 1RIVH 1WZ1H 3B9KB 1NFIB 2VSDA 4EN3B 3RP1A 4NN6C 4XWGL 1WFOA 3NTCL 3FQRB 4OCSH 3N85H 1GGCH 4XAWH 3SOBH 3S7GA 3STLA 4F7TB 2EDNA 3I50H 3STZB 3QFJD 2Y7QB 5JW5A 3VFTB 3LQMA 2GJZB 2XIDA 3GSVA 5TE4H 4M7ZC 4NSKB 4QWWD 1MCOL 5I1JH 1UVQB 4IS6B 1RURL 3RY6C 4QRUB 2WQRA 5D7IF 4AJ0A 4UINL 5DEFB 3UTTA 1S7WA 1FIGL 2A77H 1HSAA 4XVJH 1JWMB 2CO7B 1I3RB 4KI5E 4MNQB 3RWDB 4CMMA 4DEPB 3VI4F 4L9LA 3ISWA 1A4KB 1MCCA 5DUML 3O3BB 3EOBA 4B7LA 2BHUA 4XMKL 2G60H 3MJ9L 5I1LB 1I9RL 5B39B 2DRUA 5KVFL 3B6SB 4F33A 5D72L 1KJ2L 3L5JA 3I75B 3HE7A 2XA8H 4HHAA 2XICA 3AMKA 1IRAY 5C92A 4JPKH 1EBAA 3HS0A 4WNQB 1JPFB 2BOBB 4X98B 4G9FB 1ADQA 4HPYH 3RGVB 4PJCF 1PKQB 3BZFA 5IBTH 4K3JL 5IM7B 3INUL 3VFNA 3CVIL 5JUEH 1X5AA 3RNKB 3UROR 2NX5A 4ZUUA 4LFHD 2GJ6B 3KLHD 4PV8A 3PQYD 4KHXH 3TJHD 2Q7NA 4AZ8A 1XF3A 4LVNB 5IT2H 1KN2H 2PYFB 4RGOH 5D70H 5EIQA 3LHPL 1QSFE 2VLKD 3DUUB 5KSAA 4TVPD 1QLFA 1F11A 2B7DT 4YHLH 2AERT 4V1DB 1T1ZA 4MCYB 1MFDH 4YQXH 1V3LA 2AEPL 4U1NA 4YHPB 3VWJA 3IFNL 2IPKA 3K81A 3T0XA 1ZHKB 5J1TC 1CD9B 3VXOB 1AGEA 5FO8A 1J1PH 2FATL 4MB3A 3Q6FB 5C8JA 4KROC 1YY8B 1MFCH 1S9VA 3OKNB 4ZNEE 2HFGH 4ZXBA 5KSBB 3KLAA 2VDML 5CZXC 1XCTA 1J86A 2DN7A 4JRYE 5IFAL 2CRMA 2DBJA 3QJFB 2IANA 1EMTL 4R26L 1AGDA 4PRBB 4JG1L 1MFEH 2XI9A 5DVMA 2PF6A 5IK3B 1U8IB 1DEEB 1MJUH 5HYQB 3GBML 3QWRA 3O81A 4Y4KD 3OKDA 2VXVL 3RDTA 1ZGLB 5M95B 5HGHB 1V05A 3QUMB 5JPMA 4JKWA 4R3SB 4NHUB 5E1HB 4Z7QF 3OQ3B 3B5TA 4PJBE 2OBGA 3DVGA 4PS4H 4DW2L 4NQVA 4H8WH 1IC5H 2W60B 3ARQA 4IM8A 3NAAL 4HZAA 4KRPD 2CMRH 2WINB 3KR3L 2FJFB 2FZ3A 3S36L 3RNQA 1AXTH 3GIVB 1SBSL 4JRYB 1RUPL 3QEUA 2VISB 1QG3A 1AO7A 3SDYH 3LRSB 3PWLA 1A6AB 2DKSA 5C0AA 5F71A 5KG9B 1N59A 4RSVA 1NANH 4H88H 4TVSa 1KULA 1R3JA 2GSGA 4KK9C 4OFKA 3MV8E 1FJ1A 5FDWB 5IHUH 4KHXL 4QWWC 4D0BA 2APVA 5ITBL 5MEQA 4TSBH 2CK0H 1CLCA 4LKCB 3TVMD 3NACH 3QCUH 4JR9H 3KYMA 4HWNA 4C56E 3U9UB 4LKXB 3NIDF 1OAXH 1X4XA 2XWJB 2RFXA 4OD3H 5T3XL 1TCMA 3CPLA 4J4PC 2XT1B 1YMHA 1F3RB 2YKLL 4QHKI 2IALB 1ZLSL 1FLTX 4YDLC 3T4AB 4XBEL 5KN5B 4JDZA 3ZE1F 3O3BA 3DSFH 3NVQA 3VFPA 1E28A 1NC2A 2V9RA 4CADA 5TF0A 1I9JL 1INEH 2NY6C 1OTTC 3HAEG 3QXAA 1LEGA 4D94A 3QEGL 4NNXA 1NFIA 4XP4H 1EFXD 1MFCL 1J05A 3GKWL 3HS0B 2AXGB 3T1FA 4CN4A 2J6EA 4WENB 3TZVB 2ZSVA 3WN5A 1Q72L 3FT2A 3GMQA 1XR8A 1FYTE 1L6ZA 5KVDL 1Z2KA 1PLGH 3L3DB 4WWKC 2PNDA 4QLRA 3AS2A 3R0NA 5TDNA 4OLZL 1BVLA 1VFBA 3NMEA 4WDIB 2R0ZL 2GEEA 1C7SA 3ARXA 3ZHDA 1VFOA 4P5TA 4S11A 4K7PH 4MCZB 4XZUB 3CVHL 2KZ1B 1IGFH 3LEYL 4LEOA 4POZC 4ZOBA 1BX2B 3CMGA 1Q0XH 2EYTA 4PS4L 1FDLL 1FN4B 2X4SB 4TTDC 5KOMC 5J9PA 2FBJH 3HE7C 3GMOB 5B39A 5JR1L 4XCEA 4M1GL 4XPTL 1MLBA 5B22A 1UT9A 4Z76A 3GJFB 1T7WA 1ZWIB 1KIRB 4F57H 2Y06H 3DIFB 4PREB 4U1HA 2D31A 1S8DA 4GRMA 2FEEI 5IHUL 1NH6A 3CFKA 2EIEA 5BS0E 4MA3A 5I6XB 4XC3L 1HI6B 2OR9L 3H9SB 1FN4A 5IOPB 3WKML 5EO0A 5F7DB 5FCSH 1ZT1B 3SJVA 4P2OB 1IQWH 5CILL 5EBLB 3W82A 1SEBA 1LO3L 4X6DB 4CVXA 4QT5B 3ARFA 4JPKL 4HV8A 1R3HA 3UAJD 2X9YA 1RIUL 4IRJD 1BIHA 5SWSA 4F9LC 2X10A 2X89A 1TVHB 2D03L 2E7MA 5INCA 4G8GA 5DK3A 1V7NL 4MQXD 3DSFL 4I2XA 3BH8B 5J13B 1FC2D 4M1CD 2Z31C 4L1HA 5DRXA 5I8KL 1QRNA 4QRUA 4X99A 3LIZH 2AV1A 5IKCB 4G6KL 1XIWA 4NQEE 2QTEA 3G5ZA 1J5OH 3BVNB 3L5HA 2OR7A 4H8WC 4M62L 5EU6B 4DVBA 1MCPH 5ESAB 4KK5C 1U92B 5ANMA 5T1LD 1CQKA 5GHWH 2RAMA 3P40A 5IT2L 4RISL 1A6ZB 1OCWH 2OSLB 1A6VH 3OR6A 1RIHH 3P0YL 3V6ZB 2C3XA 2BNQE 2OS7A 3MRIA 3ULSA 4F58L 1D6EA 2LV4A 2Y72A 1RK1A 2CXKA 5IEHA 1W72A 3VMNA 4CDGC 4GRLC 4NM8H 3VGAB 2VN4A 3WFEH 3KYAA 4KI5C 4UU9B 4W4NA 2DM3A 3G5VB 5ICXB 4BZYA 4Y5VB 1UFUA 1BZ7A 3U9UA 5K9JH 3HR5B 1HHIB 4ZQKB 5I1HH 2WIIA 4HK3N 2XG4A 2VLJD 5IVZA 5I6XC 3FO1A 5C2BL 4YFEA 3ARSA 1AE6H 4HKBB 3K80A 1IT9H 5E94A 3TO2B 4PTTA 5EOQH 5SWZD 3C5SA 1S7XB 3GI9L 4U2ZA 5I18H 3W11D 4LPXA 4QXTB 5GGRY 3X11A 3U0TB 5BV7B 5C0DA 1MCOH 4PBWD 2A74A 4P23D 3QQ9D 5E24E 1A6UH 1MHPL 3BZ4B 4R2GD 3S3SA 1I4FA 5T1KD 4X6BB 2VLRA 4FP8H 4CN1A 5I66A 5KSAB 4XPHH 1FSKB 4POZD 4X6FB 4OZFG 3REWA 1JHTA 3THMH 1S3KL 3B3IA 1N26A 2C5DC 5GS1C 5GGSY 1A4JB 4KV5E 1KB5H 2ORBL 5K9QI 4KKLC 2EH8L 5INDB 1I1AB 3DX9A 4G7VL 4CAGA 4F8QA 5FO8B 1EO8H 2YBRB 2ICCA 1DANT 2VYRE 3GZKA 4OZFH 3PP3H 4WTWA 1NGQL 1L0YA 5ITFA 1AKJD 5GGTH 5DA4A 4MB5A 5H37G 3QEQE 2F5AL 1G7HA 3CSBA 4KU1A 4MQ7A 3O3DA 3QI9C 2X4SA 3TNMA 5FUOH 3UO1L 4RA0C 4PJ9D 3ZT5A 4HUUA 1BQHB 3PL6C 2O5ZL 3ULUD 3SE3A 5HYQA 5JO5A 3IGAA 1XR9A 3TA3A 3T0DA 4U0RB 1MI5E 2DQUL 3WN5C 5BOZG 1KCKA 1OT2A 5ETUB 4QO1A 3GSXA 2NY6B 4QY8A 1FQ9C 4TUJB 3VFSA 1RVFH 1JFQL 4NHUA 4PLOB 1KLGA 1T7YA 4O2EB 5E8DH 4P4RA 3AVEA 1KCVH 1INEL 1T2JA 4HUWB 2OL3A 1YYMH 2OZ4A 4J4PA 5BXFB 1XCQB 4I5BA 1G7PB 2VSCA 4PJHA 5CP3H 3LHPH 5HI3C 2CLZB 3Q48A 3MRFB 4FN0A 5DFTA 3HG1D 2BJML 1KPRA 2VR9A 3H9ZA 4F7CB 1S7RB 1FLRL 3MQIA 4M5ZH 5JPNA 5LGHL 3ZZ1A 4N0YH 2X44D 4NT6A 3RWCA 2ED7A 4HIJA 2QQNH 4X0KA 1L7TH 4HS6A 3RTQC 1N64H 4DUXA 1YUHB 4YHNA 5BS0B 2B4CH 1A6ZA 4UQ3A 1FORL 1C12A 2CIIA 2D31B 3FKUS 3IJHB 2P8PA 3P2TA 5CS7A 5F88A 5J57B 1ZEAH 5GZOD 1G0XA 3JWDC 1JV5A 5D7LA 5C0BD 1FYTA 3IFPB 1T7VA 4O2CB 3MRHA 5I1KL 1JUFB 2Y5EA 2DIJA 2IPTL 2UUDH 5EOCJ 3NFNB 4HUNB 1UACH 4NIKB 5GSVB 3CU7A 1J05B 4KY1L 4HH9A 4HJ0D 2BOCB 3IJYB 2GHWB 4Y16C 3V7AG 5AUMB 4YXHL 3P9LB 4Y1AE 5INCB 3QZWB 5F88B 1NL0H 4ZOAA 1NBVL 5DURB 2EDKA 4QRPE 4NZRL 4LLUA 4DAGH 1B0GB 1A7OH 1LD9B 4N1EA 1U8PB 3DXAB 3I6KB 3G9VA 5ESAA 2EDJA 4PJ7A 2EDHA 4Q9QH 2BDNL 3ULVL 4ZFFA 5D7IA 4GBXA 3VH8G 3PUCA 1WZMA 3WIIH 2XTJE 1TENA 3KNBA 2CH8A 4D8PB 4PB9H 5CEYB 4X6FA 4X6EA 1MCPL 4Z7VB 5IBUB 2PO6C 3UTSB 4HXBL 2VLMD 4WO4D 4OZGB 3ULUH 5SWQB 1YPZA 4JEGB 4W6WB 5KW9H 3VXSD 4JDTL 1KJ3H 1FE8H 4QCIB 5DJCA 1J1XL 2YA0A 3C09B 3MV11 4MDJA 5E8PA 2NXZC 3IDXL 5DD1H 4O4YH 3Q5OA 3EGSA 3D6GA 5FYLH 4NM8L 2UVEA 2VERN 3G9AB 4RGMC 2VDRL 1DLFL 2Y7QA 2H2PD 4MQ7B 3SE4C 1KLFA 1X5XA 1W0WA 1S9YA 5HHPB 1N64L 2VABA 5CWSB 1URLA 2GW5A 3HI6L 3MV9B 1M1SA 4PY7B 5IBUG 3IVKA 1BJMA 4YPGA 5L2JB 2XKNA 2UWEF 1DLHA 2VLJB 4PLNC 1NLBL 2G5BA 1QACA 1MQ8A 1ZLUH 2YR3A 4OLZH 1GOHA 3QO0A 1HWGB 3D1MC 4KQ3H 2A9ML 4MNHA 5TQ0L 4AEIH 4RIRB 1K3IA 4OLVH 5DMYA 4G42B 5FA4B 3IS0X 2H3NA 1NAMH 2CPCA 3QZWG 1NMAH 1BWMA 2HG5B 2NW2B 3H3BC 3MRJB 1X5HA 3V6FB 1AP2B 1S5HA 2DQDL 5GZNC 4DCQB 4PFEA 1MCWW 1Z9OA 2P5WE 4NNPL 3C60A 4H0GA 4OLWL 1BFTA 4BK4A 2ICEA 2AABL 3QPQD 3CU1A 5IEHB 3HMXA 2D4FA 4F15C 2I07A 1CL7I 1YQVH 2H2SC 4PJXB 1M7DB 4ENED 4OGAC 4ONGL 5DEGA 4XB8A 2VLJE 2ORBH 4Z7WF 3DROB 3L5WA 3BJLA