1CLOL

Anti-carcinoembryonic antigen monoclonal antibody a5b7
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
213
Chain Sequence
QTVLSQSPAILSASPGEKVTMTCRASSSVTYIHWYQQKPGSSPKSWIYATSNLASGVPARFSGSGSGTSYSLTISRVEAEDAATYYCQHWSSKPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title VL:VH domain rotations in engineered antibodies: crystal structures of the Fab fragments from two murine antitumor antibodies and their engineered human constructs.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords A5B7 MONOCLONAL ANTIBODY
total genus 50
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 1996-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cloL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cloL01
1XF4B 3U7WL 4DKFL 4MVBD 4MMZC 3FQXA 3SQOL 4UBDC 4O2EB 1BVZA 4GAFB 2X40A 3LN4A 1U8IA 1G0YR 5TH2A 3IJSA 4KKBD 3KVQA 5IFHH 3MNWA 4DEPC 5IMOB 5DJYB 4QY8B 1DP0A 3RDTA 1OPGL 3CDYA 4GAGL 4Y16C 3O4LE 2XYCA 3PJSA 4JAMB 2XXCB 5HI4C 1CBVH 5D7LA 3ROOA 2O93L 3CX2A 2P49B 1C1EL 2XKUA 5BS0E 5CAYB 2PF6A 2XZCL 4H1LB 4QXGL 2OCFD 2ADGA 2ZOLA 4EBQL 3I6KA 2IGFH 3SDAA 5HYJE 1B2WL 1E6OL 4YBQC 5IQ7L 4R7DB 1JWUB 2ZCLH 3EOTL 2VLRD 4X9BA 4XMLL 4APQD 2P7TB 2DTSA 5HD8D 3V6FB 1T7ZA 3V5DA 3G6JF 4R4ND 1PKQB 5EU6E 1VSCA 4NPYB 2WSKA 3BZFB 3SPVA 5E2WL 1J9CT 2IFFH 2BZDA 3H0TB 3MLTB 4X8JA 3W2DL 1I8IB 3QDME 4OB5L 3JWNC 4PRHB 3D6GA 1YN7A 3CDCA 4JHBA 4X6DA 1QSEB 1IGTB 1QFOA 4CVZA 3TN0B 1B6UA 3G6DH 5TDPA 4CAGA 4OCRH 3E1F1 1J1PL 4D9LH 4O58H 2NLJB 1G7IB 5KS9E 3N9GH 4DKAA 1HHGA 3MJ9H 1ZLWH 1WZKA 3VRIB 5MEPB 4A6YH 4XCYB 2YK1H 1KIRA 2DTML 1BM3L 4NDMA 2VLRB 4ZFOB 1T1WB 1LO2H 1NCWH 4O2CB 2ED8A 3T65B 5I71C 3KLSA 4PRPD 4TTGA 4Q9CA 3VFVA 1OSPH 4F3FB 3KYMB 1EBPA 3NCYS 3V5HB 4OUUA 1AJ7H 2NY5H 1M7IB 4JFHE 1XF3A 1LEGB 3MRLA 5AAWA 4G9FB 5C0BB 4KY1H 4EI5A 1GH7A 3HMXA 2OTPA 5C8JA 4JR9H 1TDQA 3MCLH 1U91B 1KCVH 2FIRT 3MO1B 4CVUA 2GT9A 3ILPA 1MREL 3GRWH 5I2IB 4MA3A 1NUGA 3WBDA 5D9SA 2NY2C 2GTZA 5KZCD 3OXRB 5IBUG 1R3KB 1S5HB 4F37F 3UROR 1JRHH 3WIHA 4PRPB 1NDGA 4JFYB 1UXSB 2YWZA 3H7LA 1WF5A 4TUKL 1ZS8A 4WFGE 1Y6MR 3QDMA 4MB3A 5JO5B 2PR4L 3S3JA 4DKDC 1ZGLB 3RVXD 4WO4B 1N26A 2XNAB 1UADC 1HKFA 3DETD 1Z9OA 3TCXA 3MNZA 3HNVL 5A2LH 4PGBB 2X4NB 3ME0A 4N9OB 2E7BA 1HKLL 4WI5A 3DYOA 1JYWA 2CXKA 4M6OH 1KCSH 5IQ9B 4FQJL 1ZHNB 4EI6B 2HFFB 5GRXG 2OXGA 1XF1A 2VLJD 4QOKE 1WZ1H 5FECB 1DUYB 1H8SA 2HJKA 3FN0H 2UV3A 1IC4H 4X4XA 2CJUL 4NZUL 5I1JH 1MQKH 1XIWC 2FHFA 4WCYH 3C60C 1CD9B 3HE6D 3O4LA 4L4VE 3K8KA 1F8TL 4ZUSB 4UV7H 4BH7A 2RJMA 3NCYP 4G8GA 1EGJH 3IDGB 4TULH 3S5LA 3RWEB 4KZDL 1QSZA 3RUGF 4DOHB 3NFPB 1IAOA 5EFIB 3VCLB 3DHMA 4M1DL 1N7ML 2YN5A 4KK8C 3O3DB 4JO2H 5SWZB 4N9GB 2PETA 5ITBL 2R2HA 4YX2L 3OHXB 1RUPH 1XF2A 4RNRB 3ZKND 3QIBC 3KGRA 4E41D 3ARGA 4PJEA 4LRIA 1OGTA 2O61B 1Q94B 3LS5L 3TPUA 3BQUD 1A7BA 4MAYC 2R8SL 4NCDA 3C5ZA 5D2NA 1W72L 4N1CA 6FABH 3MLRH 3FFCD 4LLDA 1IGJB 1YNKL 1ZTXH 4MWFB 1G9NH 4C56B 4IIQA 5E24E 2O5YH 4GJTB 3TA3B 1DQQA 1S7SA 4Y5YC 2JTDA 4Q0XL 2D7NA 1MWAA 1F11B 1IC7L 4JG1H 3MOQA 2WMPA 4ONGL 2D7TH 4NZUH 5GSRA 1XGTB 4PRDB 2ADFL 2NY7L 1WK0A 4JHZA 4MD0A 1RUML 3GIVB 2E8YA 4XNMB 1TZGH 4KKLC 3G5VA 5KTEL 2APBA 2ARJQ 3I2CL 5TFSL 1TJHH 1SEQL 1QLFA 3BMVA 4LQFL 4NYLA 1WIOA 3D39E 1I7RB 3WUWA 5IB2A 4Z8FL 1RIVH 3V52H 3TM6A 2EZ0C 3EYUL 4ZFOL 2BY3A 4AEHH 1CXEA 2PXYD 4TULL 4GBXA 5CZXC 1H3PH 5D2LF 2HWZL 4JFEE 2J8HA 2VQUA 2FEEI 1XGRA 1FZOB 2WWKO 1F6AB 2YD6A 4JVPA 3TJEL 5DFTA 2NTFB 4LEOB 5HDBF 4ZAKD 1P4BH 2KL6A 2F5BH 3T0EC 4PB9H 1FLTX 1VHPA 3ARBB 4WWKC 2IQ9L 3WLBB 3IDIA 4NM4H 4PYGA 3TWCL 2DI9A 3OSKA 2X05A 1PZ5A 4Z7UF 5FFLA 3QIUD 2IADB 3V4VL 1VCAA 4G9DA 2N7BA 1KPVA 4NWTH 4PJ9B 3P77B 1I4FB 5JDSB 2CK0H 1AXSB 3ZO0A 3O4OB 1J8HA 3UP1A 3OMZA 1U3JA 1DTUA 3MTRA 3OPZL 1D5XB 3ZT5A 1DVFB 1E28B 5HY9B 2DI8A 1ZK9A 3T77B 2R23A 1O7VA 2ZP0T 3C09B 4WWID 4GAJH 1JP5A 5AAMA 1OTSC 1FYHB 4WHYG 2OLDA 4M9PA 3QUMB 1U8HA 2NY0C 3CVIL 4HQQL 1ITCA 3ARBD 5HPMB 5J7CC 3GSVA 2Y5TA 4TNVF 1DQTA 5BCAA 1C5DB 5D72L 5DJ6A 3LRGA 4ACPA 3P9LA 4IRSB 1SMAA 3BH8A 2Y6SD 2DBLL 4X4MA 3R4DA 4PY8I 1TJHL 4YHYC 1N0LA 5JIKA 5KVMC 1MHEB 1XMWA 3FAWA 3JVGA 2B4CC 3JWOL 2VLME 3SGDH 5HVWA 1GCFA 3DUUB 1KNOB 1KJMB 5TPWH 1EH9A 3K2UH 1HQ4B 1ZLWK 4I4WA 5IJVB 3S36L 4IOIB 4CN1A 4Q97A 3BUTA 3ARWA 4MS8C 4Y5VA 3GMLB 5GZOD 4W6YB 3RKDD 4P59H 1P7QB 4M6AA 5AWNL 2J8UF 5FECA 2VQTA 1I9IL 4YHMH 4PJ5D 1DUYA 1TIUA 3K8MA 4ZOCA 4KGJA 4YC2B 2VXQH 4YPGB 3H2WA 1P2CB 5EU7C 3RTQC 1MJ8L 2EH7H 1LQSR 1FH5H 2JK5B 1PG7H 4LHJB 4HF5H 4YXKH 1B4JL 1ZLVH 6CGTA 2CLVB 5LG1A 3B2UC 3LEYH 3VMNA 1L4IA 2ZJSH 4YDJB 5IEHB 2VDPH 4RGMB 5ESQA 3GSWB 2ESVB 3TLRA 1MUJA 3HC4L 4YDIH 5KJRH 3U1SL 4J8RA 3EYVA 4JFDB 3RX8A 3FTGA 2VXTL 4BQ9A 1YPZA 3WHE1 4IMLA 1JHKH 2VDOL 3RRQA 5KW9L 3F5WA 4QKXB 4PJ8D 2K7PA 4TNVK 4TYUA 4Z6AT 3C60D 1HWGB 2IANB 3MRRA 4JY6B 5J89A 4UT9L 2IMMA 3O6FC 1I3VA 1QNZH 2YD1A 2ZPKL 1OSPL 2P5ED 3MRKB 5LGHH 4DN3L 3NACH 3GMPB 3BPOB 4KZEL 4NHCH 4X80H 4U6XA 3RTQD 3MACL 3MUY1 4U1SB 3CSBA 1KCUL 5EC1B 3BJLA 3RUGE 1S7WB 1DE4B 4M7JH 3AVEA 2VJXA 1N5YH 5F71A 3BGFC 4K3GA 4BQ6A 4KU1A 5IB1B 4PJGF 1F90H 1NGWB 1HYRC 3SDCA 3WE6A 1MLCB 4CJ0A 4I0CC 3GGWA 5ADPL 4P5KB 5EZOL 3L3OA 2P8LB 5T1LA 1ORQB 3BZFA 1U8PA 5C08B 4DGIH 4UTBH 1LNUB 1KB5L 4OZFA 2J88H 15C8H 3HN3A 1FFRA 1P53A 2J6EH 3ARFC 4NYLB 3H9HA 3MBXL 3O6MH 3VD9A 2IMNA 5F96H 3EDDA 2YD2A 1UT9A 1LDPH 1JPGA 5IGXH 2D7MA 2AGJH 4P2QD 3PWUB 4JCMA 4QHNB 5KN5A 3O9WB 5HHPB 5AG9A 3TZVB 4I48A 3FQNA 4OM0H 2P45B 3EYSH 4ZFGH 3AAZB 4KRLB 4PV8A 3P4LA 2NQCA 2F53D 2EH8L 4XP5L 2NXZC 3SKNA 1KENH 4UU9A 4N0RA 3RWHB 3VFVB 1FGVH 2R0LL 4GW4A 2VSCA 5F7YC 1T21A 5F3BB 4FFZH 1QA9A 1RZJC 4XPTH 1I4FA 1CZ8L 2D03H 3KPOA 1BJ8A 4ODUA 1QSED 5I8EB 5D7JB 1F6LL 1PLGL 1KF9B 2FJFB 4PJCE 2VE6A 5I1EL 3SGDI 1VPOH 3ZHKA 4K8RL 3DURA 3QFDB 2DQFB 4KXZI 3Q6FB 1SBBA 3T0EA 1KCUH 1EJOL 4IRJB 5JPNB 5ADPH 1U6AH 3CPLB 4FQXD 5ACLA 3T4AB 5K9QG 5I1HL 4JQXA 2BOCB 1FC2D 1QSVA 2F53B 3BH9B 2XKNA 4EIGB 4H20L 4PGEB 4Z77A 4PJFB 1ORSB 1FDLH 1GGTA 5D71H 1MSPA 2DMBA 4RAUA 5L9DH 1NKRA 3H7BB 5F1SA 1JNHA 3H9SB 2H32A 5C3LD 4QCIA 3OAUL 1E0OB 1R0AL 3JTTA 3RWFB 3MBXH 1IKFL 3I85A 5JOPD 4PP2B 5IMMB 2FJHB 1H15B 4EDXA 1VGEL 1I3GH 4JM4H 3VFPB 4CMHC 3NZHL 3IDUA 3MJ9L 2R0KH 4CJ1A 2Z8WC 2YRLA 3WEXB 5I0DA 3QPXL 4NQED 5JW5A 1UB5A 4ZOEA 1JPFA 3HG1A 4J4PA 4TNWF 2VLKE 3MRNB 2C3XA 3NA4A 3B9KB 4LF3A 1P2CA 4N0FB 1AGEA 4XH2A 2E8ZA 5IG7A 4B50A 4YBHA 3KDMB 2ATPB 3RNQB 1K2DA 1HXYA 2DICA 1BBJB 2O5XH 4QT5A 2X89A 3QO1A 4PY7A 3L95B 1EFXD 2HTKD 2HVKB 4GLRI 4PJHB 5D7LE 5FA3B 1YUHB 1C08A 1A6ZB 5C2UB 3DWTA 5DC0A 3QRGL 1JTTA 4ETQB 4WNQA 3RKDC 2IBBA 4WJ5B 3GSNB 4JREC 2FD6L 1T89C 1H3PL 3TO2A 2VLJB 3MREB 4FG6C 1QLRB 1RULL 4XBPB 4FZ8H 5IVXE 2DIJA 4YGVA 2OJZL 5I6XB 5DMJB 1RUAH 3PIQB 4KGLA 4HS8L 4OFPA 4K23H 2CUHA 4LU5H 1EO8L 4UB0L 5IQ7H 3MGOB 1T6WA 4PG9A 3IU3A 3G5YB 4MWFA 4OFIA 1DQMH 4HUMB 5GGSA 3SN6N 4HJ0D 4ZUUB 4HXBH 1NEZA 5IV2B 1A7RH 5A40E 2HKHL 4U1SA 1UWGL 4UIKL 4Y19A 3JWDL 4JRXA 1U8OA 3B6SB 1JE6A 1EHLL 4XXCC 3FONB 4LKCA 2X44D 3GRWA 3KXFA 4YC2C 4PJXE 3TBWA 4D0CB 4Z7UB 3VFGL 2P24A 2YUWA 5FYLL 1IFHL 5A3ID 2MKWA 3EKCA 4JFDE 4Y88A 1BAFL 1G0DA 5FYJL 4MA7H 4OI7A 1K3IA 4NQTA 4X0KB 1XH3A 1JPTL 1X9QA 1OSZA 3JV6A 1K6QH 4OF6A 4MAUL 5GS3A 4MA8H 3MC0A 1KIPA 5D72H 5BXFB 3LIZL 4GKZB 2H3NA 4Z7OE 1LO2L 1Y18B 1G9NC 3MV7D 1IGFL 5EZJB 4LSVL 2CRYA 2VRAA 3GSXA 5GRJH 5MP6H 5D96C 4U2YA 5DTFA 5FGSA 5ESVB 4B41A 4ZSOA 3U30B 4NJ9L 2OJZH 2VZUA 1JHLL 1JI2A 4KQ3H 5L2KD 3FMGL 4FTVA 4X9FA 3P9MA 1U8IB 1HE7A 2LTQC 1UC6A 1Q0XH 5I66A 2BNQD 4WI8A 3FO2B 4QXUH 4XCFL 2D0GA 2YPKB 4Z7QE 3SKJH 3W0WA 3S37X 4FFVD 4I3SH 3SY0B 4PJ9A 3REWB 1ERNA 1CL7I 5D7IB 3TO4D 3KPOB 3CIQA 4QNPE 5HHME 1PVHA 4NKMA 2DMKA 1OHQA 2PXYB 5I17A 3BRGC 1R5WB 4Z5RA 3KPMB 2MHAB 4IS6B 3Q6GH 5CSGA 2G5RA 1CR9L 4LLMA 3QWRA 4KJYA 4LRNL 2FCBA 3UTPD 1KCRL 4P5TB 4YDIL 1WVZA 5KJRL 3L9RB 1RK1A 5F7UA 1QSFD 3UXFA 7CGTA 4R96A 5DD0H 5EIIA 2Y5TB 3HE7A 1GGIH 1WWCA 1BBDL 2NXZD 4AG4L 3D9AH 3D48R 2R0ZL 5JNYB 3L3GA 2IAMD 1QUNA 4G8IA 4XZUB 1FN4A 1QYGH 1RJYA 5LGJB 4PJFF 3WNPA 43C9B 4JDZB 1ONQA 4ELMA 4YDVA 1YEIL 3BJ91 4Z8FH 3VWJC 4GKSB 4JCLA 3VW3L 5IIEB 4NN6B 1TETH 4XHJC 3WL9A 4OM1H 1UYWH 2QV2A 2VXVH 2AJXH 2WW8A 2F8XC 2FZ3A 3B9AA 3SDAD 3DHJA 3RY6C 2HWZH 2XN9B 2H1PH 5IVNA 2C4FU 5H35B 3HKFA 5E2VL 3KPNA 3F6IA 4ENEC 2VLRA 4ZFOA 4R0LB 4JHAH 1BFTA 5MEOB 3BD5A 4WI3A 5DS8A 2DF3A 3KPRD 4CN6A 5F7WC 4L1DA 5E2TH 3JV0A 2HJFA 1ZT4B 3IFOA 4JR9L 4M48L 1NFKA 3VH8A 1A3RL 4YEEA 3WNKA 2UWEA 3DGCR 4O02L 1DN0B 1HHJB 5FDYA 2X4PA 2AQ3A 3SOBH 3P9WB 3MLWL 4R4FL 5FCSH 4JFDA 4AL8L 5FF6A 5DVMA 5HI5C 5T5NG 2YUXA 3HI6H 2VZOA 2R8SH 2WBJD 3HAEH 4NCC2 5D9SB 5CWSB 1EZVY 2DWDA 3LN5B 1EBAA 2HH0H 4PUBH 2A6JB 4JY6A 1I1AD 5JPMA 1EV2E 4K9EL 1CQKA 3KPRB 1NBYA 3S35L 1MIEH 1G6RB 3RIFF 1FVCB 1CK0H 1CICC 4TTDD 4XXDA 1KIQB 5FYJU 4E41E 5B38G 1SM3H 1MCSA 2CIKA 1AKJA 1J1OH 3ZDYE 4BZ1L 4Y8AA 4RRPG 4K07A 1IBGH 3OKOB 3LKNB 3MLVL 2EYSA 1SEQH 3VRJA 4OCNC 1ZHBA 1IVLA 2CJUH 3BIAX 1Z6JT 3AB0B 4GRLA 1CE6A 4I0PC 3BP6A 5K59F 5F6HJ 5C6TH 4LMQI 5HHNA 2WINA 3ILQC 2UYLA 3HRZA 3KR3H 1SBSL 4IMKA 3NIFE 2WWMD 4IRSD 3MMEB 1R3LA 2PTVA 2R2BA 2VLJE 1P69B 4H20H 4QOKD 5I75C 3GBMH 3HAEG 2DLGA 5D6CA 4HWBL 1OQOA 4Y4KC 2V2XA 4FQXA 4G7YH 5D7KE 1QQDB 2FDBP 3NFPA 5AD0A 1FV1B 5KVFL 3W81A 2BNUB 5JHDA 2X4OA 3QO0A 3HMWL 2VL4A 3LH2L 3RGVA 4JN2A 3CX5J 3FQNB 3S35X 5I1CH 4B53A 5LWYH 3P30H 1G7PA 4TRPH 2ZUYA 3KPTA 4OZ4B 3GJFB 1A1OB 1QO3A 2W9DL 1ZT7B 5BV7L 2YEZA 1XF5B 2BY1A 4P3CL 5DJAA 3LB6C 1FC1A 2EXYD 2LU7A 1AQDB 1MWAH 4LSPL 1KXVC 4U6HB 4N90E 2XQBH 1JJUA 1A9EB 3BPNB 1HINH 4Q0XH 2AP2A 1Z9LA 2BNQE 5KSBB 1DQQB 1OTUC 3Q3GA 1T03H 1NFDB 3C2SA 3UPRB 1D5BA 2AXGB 3QFJE 4JM2A 5FYKL 1ZSDB 5ALBL 2OI9C 5E6IB 3VXOB 2OL3H 3T0EE 3LQMA 3MPCA 3QG6B 5FUOL 4JLRA 3RI5F 1GOHA 4H8WH 5GZND 2CPCA 1LILA 5EH1A 4TN9A 3QIWB 5J3HC 4HT1H 4OZFH 3QUXB 2W65A 4K8RH 4UIMA 2FATL 1FNEA 3AU1B 2M2DA 1UH4A 5LGJA 4CW1A 3PWJB 4U7KA 4OIAA 3LV3A 1JRHL 4PRID 3RIAF 4Y89A 5TE7H 3I3EA 4KMTH 2WUBL 5FKAB 3KNBA 1A7QL 1FDLL 2H32H 2JJUA 5IGXL 5DRWA 2A0LC 3VWKA 2KDGA 4BK4A 1F4HA 2AVGA 4GG6F 5BV7B 1JN6B 2QQLH 4HS6A 4DGVH 3L6FA 1R0AH 1QHPA 5DEGA 1KT2A 2IQAB 3W5MA 4N1EA 4UI2A 2A9MH 1DQDL 3WSQH 1F4WH 4EDWH 5BQ7A 5ETUB 4EQ2A 3WXWL 2F54B 1UGNA 4MA7L 3WS6C 5HHOD 2JIXB 3NCFB 4G8FB 3BKJH 4YAQB 3NIDE 4D9QE 3E8UL 1AE6H 1I1FA 3MO1A 1XZ0A 4FG6D 4RFEA 2AXHA 3LKSB 4HK0A 3T77A 4M02A 4L4TB 5GGRB 5IMKA 4A6YA 5TQ2H 4PB0H 4OTXL 4MJIA 1YN6B 5F3HB 4DN3H 1FFOB 5C0GA 4KZEH 2GW5A 3QP3A 1IJ9A 4GO6B 5GS0H 3KPPA 1OARL 1NBYB 3RFZC 5JO5A 4RRPA 5DJCB 4ERSL 3K2MC 1LO5A 3PP3K 4LOUD 4X5LA 5D1ZC 2PW1B 4JFFD 3EOAB 4QXGH 4GG8A 4GKNA 4C59B 1NEZB 2JJVA 4X98B 4H5SB 3H3KA 4P2CG 1PG7W 4DGYH 5I30L 5ACZB 3IAQA 4YXLH 5EBLA 4I3RH 4RFOL 3W11C 4N8VA 1A1MB 5IFJA 5IM7A 1UACL 3KXFB 5EIVA 4PJ9D 1MCDA 1ZHKA 2FNBA 4F8QA 1HNFA 3RNKB 1OF2B 1IM3A 1IZJA 1LP9B 5I1DA 4CN4A 1TXKA 5MEND 4TUJB 4ALAH 4YDLB 2AJVH 3T0XA 2B5IB 3IFLH 3DX7B 1AE6L 4RZCB 3GSQB 4J3TA 4OQTA 4D9QD 2H8PB 2CLVA 2WQRA 3IS1X 4R4NC 1Y18A 3FB6B 4HUUB 2J5LB 4MXQD 2FO4B 2A83A 2C9AA 4OTXH 5F88A 4NBXB 5GGVL 3V0VB 5L2JB 4KAQH 1P4LB 3N50A 1RHFA 3OB8A 3K74B 1QBBA 3SJVB 2DL9A 5GJSL 5D7KD 3DVIA 3BZDA 1HH6A 3OR6B 4U1GC 1TVBA 3WV0A 3RUGB 3RU8H 2IANA 3BKML 3IJHA 2Q76A 1WAAE 3CMGA 4P2QE 4ONHA 1F13A 3MCG1 4L8CA 4NKOB 4I1NB 2DBJA 3FO9B 3QFJA 4U7SA 1DEDA 3V79C 2FLBT 1Z5LA 2HFTA 3K80A 3QAZB 3OV6A 1FZKB 4LNVA 8CGTA 4K94L 1S8DA 2Z35B 1A3RH 1LEKB 4XPAH 1VFBB 4MAYB 5B8CC 3QUZD 1KTRL 1KLGA 5IWLA 3WS3B 4I5BA 4DZ8B 4PJ5E 2IJ0C 4URTB 4DUVA 4PB9L 1A6AB 5ICZB 3IXAB 1EFQA 2E27L 4FQHB 4L3EA 3UX9B 1KJ2L 2ZSWB 2NX5E 1P6FA 4NO2A 4AIZB 4Y4KB 5E70A 4ZXBD 2AV1B 4I0KA 5HGDB 2ZCKH 1JGLL 4X7TA 3VH8G 1YEKL 2EDEA 5F97E 4PRAB 3PWJA 2DQJL 4ZTPL 3IDNB 1I1AA 4WY7L 5FGBC 3ZYIA 3Q1SH 1JIBA 2FZ3B 3BP7A 2HG5B 4LQ1A 5DRWB 4GG6A 4LEOA 3ESVF 4HGWA 4HW6A 3IF1A 3I9GH 2NY4C 4UQ3B 4XVSH 1KG0A 5C9JB 1ZEAL 5CJ5A 5FOBB 3BRFA 4YHOH 4QHUB 1VGKA 4I9WE 3VFUB 4M6MH 4OM1L 3W9DB 4DUWA 3IFNL 2YPLE 1A6VL 1SEBB 4WI7A 1BOYA 4KPHL 3QIBB 3DOSA 2XZZA 4L29A 1T22B 2P5WA 4S0SD 1FPTH 3S36H 1JTOA 3QFDA 2PKDA 4QNPF 5CKAA 1FSKB 4P46D 5IBUB 3FAXA 4OBSA 2V7HA 4HWZA 2VYRE 4L8SB 4WHCA 4XNQB 1NGYB 4DK3A 5F7DB 5L0QC 4Q2ZB 5IESH 1C5DA 1B88A 4FP8L 4QO1A 4U6YA 3SPVB 4JRYE 3H7BA 2PW2B 4P0DA 4KJWD 1MI5E 3R06B 4XRCB 1NEZG 5DD6A 1YN7B 3DRQB 4HIHB 4P9HL 5GS1B 4MDJA 1MHEA 1QSEA 5CLWA 3BYYA 3RWDA 2W0FB 3LD8B 4YBQD 3ULUF 3FHQA 1PSKL 4IRSC 2EIEA 1UB6B 1IC7H 4JG1L 3BIBX 4WFGD 3KHQA 5GGRY 1K8DB 5CEZL 3BKCH 2FJGB 3OKNA 1L0YA 3LVEA 1XCTA 3CVHB 4HGKC 2QKIB 2Z31A 4ZDHB 1BVKA 3OBAA 1J10A 3HC3H 4J4PC 1AGEB 4XH2B 4XCYA 1MIML 2F5AH 3FB7A 5AZ2L 3SGJC 4UT7L 1HXYB 1M7IA 4FMKA 4NQEE 1XF3B 1XGPA 4OV6F 2NXYD 4G6KL 5C09D 5JOEA 5JTWA 3DUHA 4GW1B 4NHUA 5I1LB 4S0TD 5DJ0A 1JL8A 4G6FB 3V6OA 4LBEB 3O6LL 4RBPH 4WENB 1E6JH 3O3EB 1HN1A 1MJ7L 2IH1B 3ISWA 5I2IA 5KS9F 3ZE0F 4CMMA 5IESL 1SYSA 3MRIB 3MREA 4ZYKB 1QLRA 3WO3B 3VU2A 1QBAA 4NRXB 1PY9A 2COQA 2ZG2A 4XWGH 5HVFB 3PGFH 3D18B 1CR9H 3LS5H 5H94A 2BVQA 5E56A 5B39A 4FQPA 3FO9A 4WWKD 3UTZA 5EU4B 1T04B 4L9LB 1MHHB 2MPAL 3UPAA 1I7TB 5TDOB 4P9HH 3OJVC 1SM3L 2CR3A 4MHHG 3LEXA 2OM5A 1JPSL 1XGUB 2DQIH 1H3VA 4YDKL 4NO0A 5FEBA 4X7DC 4L4VB 3LQAL 4E0RA 1BOGA 5GGSY 3T2QA 4V1DB 4L8DA 4BSVB 3WFZA 1VERA 4LKCB 3RWJA 2D9CA 2F74B 4R97B 2VXUH 5DRXA 4MCZB 1ORQA 3P73B 5T3XH 3LKPB 2BNRE 1UQSA 2H2SC 1ZHNA 4EI6A 3I2CH 2H1PL 3BGFB 1JYNA 2DJSA 2PUQT 1ZANL 3UMTA 4S1QL 1KTDB 3QNYB 2X1QA 4H0GA 1MHCB 1A9BB 4QRQB 3ES6A 3RTQB 1YZZA 2VR4A 5JQ6H 4NQVA 5GRUH 4Q6IB 3ARPA 4I2XA 4OLWL 2N7AA 2EKJA 4YXHL 3O0RH 1J0ZA 3DO7B 1QVOB 1CDJA 1EVTC 1JV5A 5E6ZA 5D96B 4Y4HD 4RMSA 1CLZH 2LU3A 3TIDB 1M1SA 5GSVB 5C9JA 4GRLC 2KZWA 4ZXBC 3P3YA 3X3FH 5ID1A 5DMKB 2VDRH 4HFUL 4JO4L 3RDTB 1K8IB 1FAKT 2NY1D 4PYHA 3FJTA 1JNJA 2VDPL 3C9NA 2CR6A 1OVZA 1R5VA 1I75A 1FFNB 1QLEH 3QPXH 4NKMB 5IK3A 4K94C 5CBAB 3VD5A 1EJ6A 4R3SA 4H0HB 3GI9H 4OD3H 4OZGA 4MNHB 5D5MA 3VI3F 4RBPK 1A5FL 2QQNL 1LO4H 1YN6A 1S7VB 3TA3A 1RJLA 3PQYD 2EIBA 4WUKH 3ARDD 3D3VB 4P5TC 3MBEB 2X1PA 2XN9E 1F11A 3ET9F 5JDJA 4PJIB 1C5CL 1HH9A 1UYWL 1UZ8A 2VQ1B 1T1YB 2DYPD 2YR3A 5EC2B 3RWFA 2NCMA 5D93C 4X98A 3W11D 3CX5K 4FXKA 4GKSA 3RBSA 3MJGX 4MJ6A 1NSNL 1UM5L 2VN7A 3BE1L 2FLRT 1YQVL 4KMTL 2XN9A 5DYOB 1X5JA 2YBRB 4HDIB 4DAGL 3OZ9H 2VZ1A 1RULH 2VUOA 3QXAA 4KVCH 1DQML 2VLKA 4ORGB 3P0YL 4Y4HC 4AMKH 1BD2B 2CMRH 2EDHA 4OAWB 1IEBB 1QFUL 1LMKA 1U41A 4X6BA 4UOW1 1WITA 3I02B 4K23L 1J0YA 1LK2B 4NBZB 3VXTA 3DX7A 3RNQA 2DQTH 3DX9A 3ULVE 1KPVB 2VDNH 1UA6L 2OTWB 3X11A 4JFFB 4DOHE 3ARGD 3ARDC 3FB6A 4P5TD 5B3JF 4JB9H 5ISZB 4EI5B 3IDIB 4KDWA 1HHJA 1AO7B 3FB8B 1RZKL 2FO4A 4RDQF 3FT4A 4XI5C 3GSNL 2ZOKB 4L3ED 4WNQB 1E27A 1T5WA 2KPNA 4IRZH 3TYFA 3KWWA 4PTTB 1R3KA 2CD0A 4U1LA 5F1KC 4LLAA 1CDGA 3PP4L 1NGPH 5JUEL 3WIHH 1FORH 1WT5A 4XTRD 1NDGB 1NCTA 3TYGL 3IGAB 1G7JB 2R23B 4FN0A 1LWRA 4OJFL 5INCB 3KPRA 3P9LB 3MRJB 3AFLA 3D18A 4LCUB 1UZ6F 3UTTE 2CLZB 5BOZG 2BVQB 2NX5B 1OARH 1OWRM 2AXJA 4NM8H 5HHOB 1UJTA 3G5YA 3BWAA 3RA7L 1SHMA 5TDOA 3GUTA 4M3JA 5E2UH 5GGUB 3V4PH 2BNRA 3FFDA 1QBLH 3VRJB 2HFFA 2HN7A 5L88H 3D0VA 1IGCL 2OSLB 4G5ZH 2ZUXA 4D0CA 5ANMA 3L1OH 1BQHA 2BCKB 4MLIA 5CP3A 5HVHC 1UACH 5JLZA 1JWMA 4OGYL 1H9VA 1SYVA 2GK0B 2EDBA 1DQLH 2OZ4L 2GSIA 3C5JA 4HBCH 1WWBX 3EFDH 3S97C 2AS5M 5AWNH 5H2BA 3FFCA 4TVSa 2QQLL 5B38A 2MTPA 4XVTH 3AS3A 3WCYA 3TVMC 4HD9A 5HSFA 5KSAB 1GGUA 3MV9D 3PDGA 2ICEA 1J1XL 1FHGA 4BZ2H 5FO8A 3E3QC 2NY5C 4PR5B 3BP7B 3BGAA 5L0QB 3VWJA 4XP4H 5J1TC 3PNWB 5C0ND 3F62A 2W0LA 2W9EL 4ZFGL 1MVUA 5IHBA 2KH2B 4YHLL 3KYOA 5BO1L 1G9ML 4NSKA 1U8MB 1NL0H 3MLXL 4Q74A 4ODVH 4LEXL 5IW6B 3ARXA 1FGVL 2R0LH 4JVUA 5DT1H 1J87A 4YHKL 1E4KA 3DXAD 4Z7WE 1LK3H 1TQBB 5C71A 5ALBH 2P8PB 1ZLUK 2JELH 3RL2B 2ZCHH 2MHAA 5T3ZD 1PFCA 3MV9B 1V7NH 2VZSA 4IIQC 4X7FC 2RR3A 2JE8A 3V7AE 4AEHL 1W8OA 1MLBA 1EA9C 2D0HA 2AABH 2X1OA 3C5ZC 4O2FA 3RVTD 3U4BH 4I18B 4CKVX 1T1ZA 4JFPA 2XZCH 5MENE 3EO9L 5AG8A 5IVXF 4X9HA 4HBCL 3I50L 1B0RB 4GMTL 4PJ9C 4M7JL 1E6OH 3MLWH 3CSYB 4R4FH 3L3GB 4RFOH 1UXWB 2UVEA 3VRLF 1J5OH 3GJFK 2GJ6A 3EZ8A 5D1XB 3SO3B 5L8LB 1EIBA 3DV4B 3K1KC 4XPFL 3OTTA 3T1WA 3OKMB 1J7VR 1MI5A 4NQDE 1XR9B 3L5WB 5SWSB 4XP4L 4ZUTA 5DUBA 5F89B 3QUZB 4OCYH 3TVMD 1HHHA 4OF5A 2A9ML 1CLOH 3G5ZB 1WIUA 2B4CH 2I5YL 4PJAE 3NTCH 3LN9A 2NMSA 1V3MA 3LQAH 1BZ7B 2YMXL 1H3TA 2CKBL 1MJUH 32C2B 1QP1A 3ARYA 4LHUA 4X6BB 1PSKH 5I9QC 1OTSD 2BSTB 2IAMB 5JDSA 4LIQH 4PV8B 1XGPB 3ZLQC 1RIHL 5GRWA 1XAUA 3UCRA 3IJSB 5EUOE 4HFWA 2E7HA 2XTJC 4LP5A 3WO4C 5A43C 2OS7A 1A6TB 1AO7A 1NCUA 3FB8A 3WDIA 5BOPA 1F2QA 5JR1H 2R29L 1JF1A 3K4ZA 3MLVH 3SDAB 3HC3L 5JIHA 4JAMA 5D6DA 2DLTA 4R97C 5GHWH 4OQTH 1IKNA 2ID5A 3VWKD 5ALCL 4QRRA 3QISA 2YOCA 5I15L 4XP9L 5I1KL 4Y1AD 1U0QA 3VXUD 1UKSA 2OX5A 4RWHA 4U4BA 4NRXA 5CMAA 2R56H 3JV4A 2WWKT 5EOTB 1P84J 1YA5A 2W07A 1X44A 3H0TA 1CLYH 1G6RL 5GZOC 4L8BA 4N0CC 5I8CB 4LAQH 3J7HA 4V2CB 1UJ3A 2AJ3B 3QIBD 4U6VL 5GGTH 2BVOA 2DN7A 2VIRB 5C09B 3IDYC 3HFMH 4RAUB 1WFUA 2APTA 5IJVA 3DUSA 4LRNH 1AQKL 4PRHA 3GMQB 2IALA 4Q6YA 1DLHB 2C1OA 2ENSA 2Q20A 1KEGH 4GRLB 2VC2L 3I84A 3HPJA 4A2MA 5DMYA 2F54D 2NW2A 5IMMA 4TRPL 2D31A 1YY8A 1OCWH 1RZKC 5GS2H 2F58L 2R0ZH 5MEPA 3TBYA 4F3FA 1S9XB 1H3XA 4JDVA 2HT2D 3HZMB 2HLAB 5JOFA 3FQUA 4RZCA 4LP4A 4P4RA 3WFHA 1CGWA 2R9HC 3FN0L 4HMEA 4XVSL 3QEHB 3V4UL 4F9PC 2G75A 3INUL 4BKLB 3KLHC 1OPGH 3VFRB 5CZXD 3ZTJH 2AQ2A 2BRQA 1RK0A 3VFOA 4M5YL 4HWEH 1K2DB 5K9KA 1BX2B 5CEXA 4WJ5A 5JR1L 4OT1H 3RL1B 2ZG3A 4QHKI 1JGDB 4K7FB 4OF3A 5GHWL 1YUHA 1P84K 1DL7H 2WAHA 1DBKL 3ILPB 1YMMB 3QDGD 2OQJB 5C07B 3W9EA 4OLWH 3IU3B 4PRPA 1NGXB 5FYJE 3SOBL 2XWTB 4DVRL 5GZNC 4JO2L 1R5IA 2HTLC 3OAYK 4R3SB 4HS8H 4EIZC 1BZ9B 5LCVL 4HHAA 5C70A 3HFML 2XRAH 1NMAH 2BFVH 4PD4K 3OKEA 1AIFB 3G6DL 4Y4HB 5E6IA 1S7VA 3WFCL 1I1YB 4PJCB 4Z76A 3DPBA 3N1MC 1AP2A 2Z92B 3OR7A 2P4AB 1KXTB 3PWPB 1LO0H 1A2YB 4HS3B 2ZSWA 4NZJA 1U8OB 3BZEB 3PHSA 1YEGL 1S7XB 3FB5A 2OI9B 3D85B 1I3RA 2NY6D 4RGOL 3TBWB 4UOW0 4K3DH 4J4PD 3OJDB 5FYLH 4M1CD 3NFSH 3SGEH 4PJGB 2HT2C 3TA3C 3LDBB 4A6YL 1JPTH 4JN1L 5C0RL 3CH1A 4ZTOL 3TBTB 4QTHB 3QNXA 4Y16D 1RIUH 1ODAA 3BQUC 2LQRA 5T1KA 2OR7A 5EZJA 3TJHC 1TZGL 1MY5A 3IFNH 1SQ2N 2AEQH 1BVLB 4FZEH 5LAXB 2VLKB 3VXRD 5I66B 5FYKE 5SWZD 3O3DA 1QFHA 1A4JB 1VGKB 5F7KC 1DBKH 1JMXA 3VXTB 2XY2A 4ZXBA 3IDMB 4HPOH 2AJZA 1FPTL 2GUOA 4G8FA 4RMQA 4OV5B 2FJFA 1ED3B 4H26B 4IIQB 1E4JA 2WIMA 5DUML 1AGCB 2YPKA 3PHQA 4EQ3A 1D5IH 1AY1L 3DURB 3MUGB 5B39G 3RWCB 4OI8A 2XV6B 5GRVL 4JPWH 4MXVE 4NQCA 4QYOB 5HYSG 4UUJA 3AC0A 1INQA 4XNXL 2Y7QA 4RA3A 4FQJH 1B90A 2YUZA 2IBGA 5H37H 3THMH 3X13B 4J6RL 2DMCA 2H32B 3RQ3A 2HMID 3TCLA 1X5LA 1KTLA 2NY1B 4YHLH 3PHOA 5EZLA 3GJFH 5EN2A 1GSMA 4X6DB 1MCRA 1NC2A 3VD7A 2GJZB 1R3HB 1BF2A 4X6CE 4E42B 2XA3A 3MFFB 5DSCA 4DWHA 1HHGB 5C2BH 1N4XL 4OIIL 4WU7A 5MEQA 5GGVH 3VRIA 4WGWB 5IB2B 1NMBL 1WCQA 2X4SA 2VLMD 1K8DA 3MV7A 3EJYD 3OKLB 1A21A 3E6FB 5F7NC 4GRWF 4NGHL 4UOJA 3QULB 2NW2B 1NANI 3RNKA 2CDEA 4PJDB 4HT1L 1OT2A 2EEAA 5DQJA 4PS4H 2JCCA 4G3YL 2UZXB 2HVJB 4U31A 2P1YA 2X4TA 3KLDA 1AFVH 1EERB 1AGDA 4M1DH 4P9MH 5J11C 2V2TA 2BNQA 3GJEB 1MAMH 2HVKA 3QWOB 3WUZA 4BH8A 4F33B 1KN4H 4G5ZL 5BS0B 5FA3A 5DS8B 3UYRL 4DEPB 3GHBH 2G75B 2ATKA 4LU5L 2NYYD 6FABL 4KTEH 5CZKA 3ZMRA 5L2JA 4S1RL 1QR1B 4KK9C 5K9OA 5DVLA 5HHXH 1GAFL 5DO2D 3X3GL 2AEPH 1BJ1H 3KXFD 3ZSSA 1A7RL 3H3PL 2WUCH 3B8YA 1FRGL 1T4KA 5EO9A 4F7EA 1JGLH 4YHZL 3QEGL 3X14B 5EUOF 1O0VA 5EU6A 1BD2D 3PIQA 4W6XB 5KAQF 3OXSA 2BX5A 4BYHA 3ULVF 1U8HB 4UMGA 5KVDL 5DD5L 4U1GB 4MS8D 4KI5E 3HE7D 2UY7A 4ZAKB 3MFGB 1NMCC 2G5BB 5CJXA 3FO1B 1TPXC 1VFBA 4MAYA 3CU1A 4BQ8A 5EULV 4NKDB 2EECA 5A16B 1HXMA 1EUTA 2H2PD 4Z7NF 3AREB 4XT1C 5CP3H 5E5MA 1FYTA 4MB4A 4X4XB 4X4YA 3BIKB 3OAZK 4YPGA 3P73A 3VFSB 4ZSOE 4NZDA 1CBVL 4OD2A 4Y5VB 2Q7NA 3RZCB 1ZA6B 1S7XA 5D8JH 1RJZB 5EU3A 4JQVA 4WWKA 1H8OA 4GW5B 5D1XA 3BPOC 4Y7MA 5FB8B 5T5FH 3QEUB 2VISA 1KACB 1A6WL 3QXTA 2QL1A 2H26B 3MODL 4UTBL 2VR5A 1W0WA 1BECA 3T0WA 1I1AB 1HILA 5TE7L 3STBA 4HX1A 3M8OH 5D6CB 3TH3T 1ZT1A 2IH3A 2OP4H 3UJJH 3QI9A 3IF1B 3FCTA 5ESQB 3UC0L 3U79A 4NWTL 5CSBA 3EO0A 4NPYA 2AK4E 1YQ2A 3HMWH 4PJBF 1J05A 3QHZH 3S35H 1FQ9C 2MQCA 3W0WB 1KEMH 1W2KT 4Y4KD 4QXWA 3S6CA 4WU5A 4ODVL 2ARWA 3D2UD 2J4WH 4JFXB 1Q72H 4NFDA 1P7QD 2NY3C 1LO4L 2UWEE 1RZ7H 2W9DH 5EBMB 3FT2B 4F15B 2GY5A 4XHQA 4LLMB 1DE4A 5F7HA 2Q7YA 5D7IF 4J3WA 5C6TL 3LHPH 4UUJB 5MI0B 1MLCA 1FYTE 4NO5B 2P8LA 1D5BB 2ESVD 4KI5F 1PDKA 3QZWA 4OUUB 3RX5A 1E4WH 3PGCB 1CT8B 2XZQH 5IFHL 5DHVH 4HWBH 4UAOB 4G7YL 4KH2A 5BVJA 1A6PA 5C08A 3MFFA 3SBWC 3QEQB 5IWLC 4D2NA 3UO1L 1UB6A 5D93B 4R90L 5ILTH 4JFFE 2RGSA 1IAIM 4QHNA 2DLEA 1DLHA 3QXDB 4CUCA 4JFOA 2ARJB 3K8LA 2R1WA 1DLFL 4FQCH 2DM3A 3LOWA 4LCIH 4N0UB 4LDEB 5ICYA 4PFEA 3IXTA 5JHDD 2XRAL 4NOBA 1UA6H 3WIIH 1B4JH 3LKOA 4ORZC 3KNBB 1M7DB 4W81A 5E9DE 3SCMB 3U0PB 3PE9A 3O2DL 2AJVL 3CFCL 5C0AB 2NY0D 4WHTB 3HC4H 4LHQB 4HS6B 3M1BB 1PQZB 2X10A 2YD7A 1CXFA 2JB5H 2VSDA 7FABL 1FVEA 1GHFL 3U7YH 3T2PA 2VE6B 2X4NA 4Z7OF 1DVFA 1E28A 5HY9A 3U0TA 4NCC1 3UYPA 5J1AA 5EO0B 4RMWA 3T0BA 3Q6FA 3PJSB 3KWWB 3LKSA 4M00A 3GEWB 3QPQC 5C7XH 3FRPG 4QRPA 2JCCE 1D5MB 1AC6A 1ZANH 2EYTB 3RJQB 4FTVE 1NLDL 3DVGA 4I8DA 4CADB 2ZPKH 3UTSA 4S1DD 5I75B 4IRJD 1I8MA 2IPUG 5T3XE 5H94B 5CSZA 3MRGA 1BP3B 2VXSH 3NGBC 1FFOA 3FO0H 3O9WD 5F9WB 3SDDD 5FUCE 1RZGA 5JZ7D 2ERJB 4PJFA 3HB3D 3QUML 1CYGA 1KJMA 4HPOL 3GUTB 1XGUA 5F1NA 5LBSH 5DJCA 2NY6C 1R24B 5DUMH 4XCCL 4N8VB 4KDVA 3CFDA 4HIXL 3BPCA 1YNLH 5HVGB 3QB7C 4I13B 4YWGL 1UB5B 5MERA 1A0QL 2EIZB 2ZUUA 5BVPH 2JB6A 4EZMA 2X9YA 2EXWD 5MHSD 3STZA 1W72H 4M5ZH 1IC5L 1NUFA 3BN9D 4UQ2A 3UYOD 4F7MA 3VXSB 2WP3T 3FQWB 3X17A 3D85A 4ZFFB 3GNMH 4PRHE 3HG1B 2ZCKL 1YEFH 2FB4L 3B9KA 2PXYC 4N0FA 2VISB 3EJJX 3V5HA 3CH1B 3GFUA 1MCEA 1MWAL 2X4OB 3QO0B 5GS0C 3L95A 1MCIA 1RUKL 4G9FD 1S7TA 4G8EB 2W59A 1IGFH 3PNWA 4K3DL 1OQXA 4NKIH 4MSWB 1NC2D 1IQWL 1H8NA 2NY1C 5CIPA 4W6WB 2OR9L 5KANG 1AR1D 4AEIL 4MA8L 1R3JB 4ODSH 4MJID 3VXSD 3FRPA 2HRLA 4WCYL 5I1AB 4NQEA 4KRPC 4R8WL 4ODHL 4Z18A 2QBWA 2GUOB 4FABH 3PWLA 3PWVA 4L3CA 3FO0L 4RDQG 3BN9C 2G2RA 1TZHB 3DTXB 3GMOA 4AK1A 3UPRA 3QUMH 3U30C 2FX7L 5C0NC 4Y2DD 4OGAD 2NTFA 4POYA 3VXOA 2IWGA 4N8CL 3GIZL 4HCRL 2BSSB 1J5OL 4P5KA 3WFCH 1RUPL 1RAMA 1DBBH 3FN3A 1L7IH 1F3DH 4NO5A 4I18C 2BRRL 1XH3B 1OGAD 4ZO7A 5D4QA 3JV6B 5GRVK 5ABDE 2DM7A 1YDPA 1ZGLM 1FG2A 3ROLB 1WBYB 4JB9L 4JRYA 2YUVA 5F9JA 1MCJA 2X4QB 2ESVE 3OKMA 4XC3L 4YLQT 1JGEA 1PG7X 2FEDD 4RWYL 4WU7B 4ELKA 2FWOB 3N1FC 5EU6D 3SDXB 1W0YT 1XIWB 1MY7A 2CKBH 3MRBB 2OR9H 2Z4QB 1VADB 1YEIH 2APVA 3IKCB 1KT2B 1LP9E 4G42A 2D7TL 4WFHE 4R8WH 2NY7H 4Y19D 2AAVA 2WWMC 3ZDXF 4XNYL 2KQMA 5D2LA 5C0AA 3WLWD 4BFBD 3IU4L 4E9LA 1J0KA 2YPLA 4YUEL 4WVRA 5J13C 2C4FT 1CGVA 3NABH 4MX7B 2ITDB 1Q94A 2Q8AL 3GO1L 1FL3B 1RIVL 4X4ME 1C16B 1YEDB 5EA0H 3O6FB 3AGVA 1G6VK 3T3PF 1NBZB 1VACB 2I27N 5FIEA 5JXAL 1TTGA 1WLHA 2XTJB 3WO4B 1A6WH 4GG6E 4PJIF 4C56A 3HI1A 2C3GA 3EFDL 4GRWB 1EX0A 4XVJL 1KN2L 5D1XD 3VI3E 4AIOA 4Q2ZA 3UTSB 4K3JL 4LSSH 5HGHB 4LHUD 1X4XA 3NH7H 1NGZB 4JE4B 4OFDA 1NAMA 3VGEA 1GRWA 4X6EB 3CFBA 1N6QL 4F9PA 3TWCH 4Y1AE 3QDJE 4R26H 2LV4A 3R06A 1L9MA 1FJ1A 1QLEL 4GH7B 5EB9A 4PJBA 5GS2D 4RMTA 1KEGL 5TF1H 3E2HC 5IIEA 3CMOH 2VLLA 3MLXH 4I3GA 3MLSH 5DR5L 5F6IC 5GGVY 4NZTL 1J1PH 4D9LL 3RWDB 5SX5H 1CD1A 1FNGB 4W4NA 2YWYA 1JWMB 2ZSVA 5IR1B 3O9WC 2HP4A 3NVQA 1AD9B 3QUKA 3RX7A 1IAMA 1DBML 4R0LA 4ZFFA 1DUZB 2A9NH 3GMPA 1LK3L 1EAPB 4OZIF 3E3QE 2MSPA 4HUUA 3W39B 1WAAA 3QEHA 5J3HD 2X4PB 4NWUL 3WLWC 4FQLH 3A67H 1S7WA 4JZJA 3H9SD 1J12A 3O3EA 3VH8B 4P4KC 4PRHD 4WI2A 5EA0L 1NCNA 4F58L 5KG9A 4LCWA 4GXUM 4H88H 1BJMA 3CNKA 1CICD 4GW1A 3DBXA 4GXVL 5HHXL 1WTLA 1EXUB 1BMGA 1BGXH 2DLFH 3L3OB 4YHIB 4OF0A 5IW1B 1F6FB 2I60H 2WBWB 3DRTB 4X7CC 4DVBB 3S8WA 1YPZE 4PJAA 4U1JB 2NR6D 3REVA 3ULSA 3NN8A 4NKOA 2E7MA 1BFOA 4NUGL 1LEIB 1EEZA 4XX1E 1UM6L 1PX4A 2LVCA 3D39D 4WGVB 1MRFL 1K4CB 2VABB 3S96A 3CFCH 1NC4D 1NJ9A 2PO6A 4N90D 4FQ2L 1JNLL 3VXMA 4HV8B 2X6MA 5DRNA 4O4YL 2UUDH 1IE5A 1MCKA 1IMHC 1I7TA 4EN3C 5DR5H 2FHBA 2NYYC 5KW9H 3T8XB 1FNSH 4OJFH 4OZGF 4RFNB 5D5MF 2R29H 4G6FD 3MCKB 3PQYE 4N5EC 4WDIB 2DWEA 1HIMH 3TH2T 1NFIA 5BVJB 3B9KC 1PY4A 1M71A 2ZOLB 3QEQA 3LKQA 3MMEA 3PDDA 2P5WD 3RP1A 1QBLL 4QGTA 5FGCB 2DOCA 2FWOA 2XT1B 1U3HA 1YMMD 3QDGB 5ESAB 3GB7A 4MJIE 4OKVA 3VFTA 2ZUQB 2ZKHL 1XT5A 5AYQA 4PG2A 4OFYD 3ARED 3WJLC 3V7AG 3VXNA 5AD0B 1I8KB 3U4EB 4QLRA 3MXWH 5HYFA 3V6ZA 3OF6A 5J6GB 4KTEL 2ZUWA 1I8IA 3MJ8A 3REWA 3BO8A 3QHZL 4P48A 3ZT7A 2BXZA 2Y07H 4BK5A 2BVPA 1BZQK 2ORBL 3MOBH 1DLFH 2Y06H 1QO3B 4PJ7A 3O6ML 4LCYA 3EOYG 3X3FL 1S7QB 4BZ2L 4L9DA 4XMPH 4RGND 5C0DB 2I24N 1NCAH 1HI6A 2GK2A 3B43A 4NN5C 5IVOA 5FHAL 4X6CB 3HC0B 1LDSA 1FGNH 3PL6B 4GQ9H 3UBXG 5CMAB 5F7DA 4R7NB 3OG4B 1CFVH 3BAEL 4OD3L 3DX8A 1FNSL 3ZKSD 2ATPA 2X09A 4NQUA 4YE4L 3H6JA 4MQ7A 1BBJA 4QT5B 2BC4B 5CBEB 3LRSB 3SDCB 5CINL 3WE6B 3VFNB 2R4SL 4I2XE 4OZHA 4G9FA 1I85C 4E41B 4P2RA 3RA7H 5TGBA 4FXKB 4XAWL 3BDBA 4WV1B 1QRNA 5TPWL 4K71C 4KKBC 3WFBH 3CSPA 2FEEL 5IOPB 2DRUA 4H1LH 3C5ZD 1MEXH 2K7QA 1FZMB 2Y23A 5EBGA 5JORA 2FGZA 2FX7H 1FNGA 1CD1B 4F8TA 3L5XL 1JF6A 2JB6B 1UXSA 3PWUA 4PJDA 3UAJD 5IR1A 1HHIA 4HFUH 3UJTH 1KB5A 4G7VL 4JDTL 5KS9A 2Q6WA 4UDTB 3OZ9L 5ECJE 4XPFH 4OLVH 4RGNE 1V5JA 5GS0D 1C12A 4N1HB 2VERN 2A74A 4HKBB 5D2NE 1I1FB 1IQDA 2NXZB 3P0VH 1LE9B 5LCVH 4J3XA 2DQDH 5EBWA 1N0XH 3DARA 1HSBA 1N5AB 4LCCC 3ROOB 1OGAA 1CGTA 3QUXD 1S7TB 3Q2CA 2H9GA 3LN5A 2E7LC 4YAQA 2X4RA 4LCWB 4RGOH 1QR4A 4HZAA 3TESA 1A02N 1EDQA 4FFZL 4JJ5B 3TYFB 3LSOA 5E99H 3FOMB 4XCEA 2AJSH 5IMKB 3ULVH 5B4MD 4JPKH 3RWGB 4NUJB 2WK2A 3QZWG 3ARDA 3L3IB 2XWTA 1PX3A 5JIIA 5FYKH 3JWOC 5DWUH 4HMDA 1S9VB 3IDXH 3MOAL 4RIRB 4L4VA 2PO6C 5EBLB 3BP5A 1T0MA 2DYPA 5HHOA 1BOGB 4Q9RH 2KKQA 2R2HB 4HV8A 4Z95L 4Y4HA 2IPTH 2AKRA 1FCCA 3OL2A 1INDH 4XXCA 4MCZA 1QRKA 1S9YA 1RQ5A 1ZXQA 3IETB 1WWAX 4V2BA 3UBXI 1N7MH 4BQBA 3SY0A 4IBLT 1KN2H 1IRAY 5JW5B 4JGUA 3HS0B 1BQHB 2BCKA 2DAVA 2VXQL 3GSQA 5LXGL 4P2OC 4NQSA 3HPLA 4U1HA 5CS7A 5C86A 1OTTD 2J8UB 4C57C 5CD5C 1JGVL 2E9WA 1D6VL 2A83B 5F88B 3T0AA 5A1AA 4QHKJ 1NANH 2VB5A 5JW4Q 1DQLL 2AI0L 2OZ4H 3V0VA 1HILB 3P11L 4OZFG 1J0JA 3MRBA 4PR5A 5DHVA 3NPSC 4HAFA 4P5TA 5E8NA 1FSKC 3L9RA 1NUDA 4FRWA 1P4IL 1BD2E 2L7JA 2Y72A 4MVBC 5HDBE 3BZ4A 3VGHA 1A1OA 3V6ZB 4Z7VF 1A4JA 2Y25A 4L8CB 3U36B 4B7LA 2EIDA 4JREB 2G60L 2BVPB 2D4FA 4ONFL 1KLUB 3VGAC 4H26A 4MJ2A 1S8DB 2Z0BA 4TUOA 1UWEH 2Z35A 1YEDA 5EBMA 3G04B 1VFMA 2HMIC 4O5LL 3T08A 3T2OA 4MCYB 5MP6L 4NC1C 4NWUH 2NNAB 5GS0L 4JHAL 3W82A 1H5BC 1OW0C 4LMQE 2NY4B 3DMMC 3RVUD 4HH9A 1WICA 4XP9H 5I1KH 2IPTL 2VLKD 3VXRB 3V52L 3BVNA 4UT6L 2IPKA 1W8NA 1JF5A 1PBYA 3DMMA 4JFZL 5IKCB 1KCVL 1TITA 2JJTC 4NO2B 3NIGE 3CZFB 4CDGC 1DBBL 3SE3C 3VXQB 4ELME 3TCLB 4PJ8B 3VXUE 5EOCH 2BRRH 1NCBL 2P24B 2QQQA 1INEL 4XBEL 3A6BH 4IM8A 2GJ6B 1GPOL 4CW1B 4YQXL 1ZAGA 1P4BL 4X0KA 1OSZB 4MJ6B 4MXVF 4NBYB 4Y5YB 4TPRL 2V6HA 3DV6A 5CWSA 3MV7B 1E4XL 5IEKA 1CXIA 2IEPA 3FQTB 4HGWB 4KKCC 1ZVHA 4N0UA 4UQ3A 2F15A 1QD0A 5ETUA 1H0DA 1HHHB 2JCCB 3VFUA 1IM9A 2GHWB 1DDHB 3GSUA 1UKTA 1G7MA 4LARH 5GRJL 4FTVB 2I5YH 5E00A 4HC1H 4M1CC 1M05A 3ZE2F 3UZVB 4HUVB 32C2A 3T0DA 5E9DD 1T22A 5C08D 1AXIB 1F3JB 3QIWD 4I4WB 5GRZA 1V7NL 2HTKC 1MIMH 3QRGH 2YD3A 4GSDL 3IFPA 5BZDB 3PL6C 4WEMB 5DLMH 4K94H 3D25B 4N68A 4M62L 1I1RA 2J8OA 5E0QA 4HKZB 1D5MA 3NMEA 4M43H 5C6WH 4Z5RB 1EXUA 2EYTA 2NR6C 1FFQA 1EJOH 5F7EH 4QF1B 3KAAA 1MWAB 2ITCA 3LKRB 4KJYB 3ZHDA 3QEQD 4JG0L 2B1AH 4U1JA 2FX8H 3B5TA 1K3ZA 3V9FA 1DANU 4K2UL 3LZFH 5EOCL 2OP4L 4ZOBA 5EG6C 1YJDC 4K71B 4YHPB 3ARQA 1G9MC 5FXCH 5IHZA 1OW0A 1A14H 3I6GB 3GMQA 5IM7B 1R24A 3AXLA 4AL8H 4ODXB 2B4CL 2GCYA 1YNKH 4DCQB 1U95A 5CEZE 4Y19E 4QXTA 2R0WH 2NY2B 4JM4L 4X4YB 2CO6B 1MELA 1ZLUH 4I9WD 1AQKH 2EC9U 2PN5A 2E7LA 2C1OB 1OB1A 2BHUA 4LSUL 4WW1A 3F6LA 4ZTPH 2QSCH 3FQUB 3HE6C 1ZE3C 2D7QA 3SDDA 3U83A 1Q72L 3NFNA 4X9IA 3MZGB 3LKQB 4BKLA 1TJIH 1A6VH 1ROWA 3NIFF 1P4LA 5C07E 2NPLX 3SJVA 1QOKA 3LPWA 2RCSL 4AQOA 3MRIA 3TBSA 4QTIL 4PJXF 4K7FA 5B3JE 3VI4F 4HIEA 4ODBD 1KXQE 1FIGL 5FHBL 3MGTB 3RL1A 4O51B 1G6RH 2Z93B 3L5XH 2M1KA 1CQYA 2CDGB 3EO9H 4EOWL 3RKPA 4L3CB 5ITBH 3AS2A 4K7PX 3UO1H 4YR6A 3MXWL 5B39B 5CCKL 2DIAA 5E2WH 2WIIA 1T66D 4YHZH 5HYSB 5IW3A 4F2MB 2A6DB 1PKOA 3MXVH 4LCIL 3W5NA 2Y07L 4HG4J 1F3DJ 1YC7A 4XI5D 4HH9B 2YD4A 3KYAA 4YIQB 3PGDB 4KK9D 1FO0B 1A7OH 3C08L 5E8PB 1J0HA 1IGIL 1P1ZA 2ADJB 4QEGA 1MQ8A 5F3BA 4TSBL 3ZL4H 4JM2F 1CT8A 2A6KA 4JY4B 4OCXH 3U82B 2WLYA 1BAFH 5FYJH 4M1GL 5HHNB 1II4E 1D9KD 1BQUA 4XTRC 3FOLA 4LSPH 1NCWL 1CZ8H 2D03L 1BEYH 4AY0A 4HS3A 1XR9A 3DSNA 1FE8L 1Q0YH 4RGNB 3BHBA 4KHTL 5F8RC 4RFEB 4Y5YA 4Y2DA 5CJOH 1Q9WB 4QRRD 3WDHA 1CGXA 3G5ZA 1VDGA 5HGBB 1AH1A 3B3IB 4G6ML 2I07B 5FDWB 5FOBA 2IF7A 3RGHA 3ZKXB 4ERSH 3QNZA 2OMNA 3NABL 4M9OA 1CDYA 4LSDA 2F19H 3C6LD 1G7MB 2H6PA 1G7PB 3QIBA 3UDWC 4CVZB 1BVLA 4YFLI 3C9NB 3RWIB 5DK0B 1U8QA 4P5MA 5IP4A 5SWZE 1NSNH 4HKBA 1S78C 3PHQB 5I8KH 2EH7L 3TT3L 1UJ3C 4MNHA 4NC2B 5A2FA 5I16B 5L9DL 3SBWA 1OP3H 4KVCL 2QHRL 2V7HB 3QXVA 2XQYK 4PGCB 1JVKA 3K1DA 5IK3B 1JZ7A 3T0VA 2EEDA 1NGYA 4DZBA 2ZWLT 2KUTA 4U1MA 4U2ZA 2YXFA 1I85A 3JV4B 5FUCC 3D3VA 3U1SH 1KCRH 2DQTL 1M4KA 3RWCA 1T6VN 2BVYA 2EDTA 1FLRH 3QUYB 4FQ2H 3KDMA 5E6ID 3P0VL 3MRGB 5FM8A 1A3QA 4I77L 2IG2H 1H3GA 5DQ9B 3BUYB 5D6DC 2X2YA 1EO5A 3QXWA 2VQ1A 3ARDB 1FJ1B 2PYFA 4OCRL 2BHZA 4PBVC 3L7FB 3MNVB 1HDMA 3G6AB 4FQIL 4YBLB 5DJZB 1U91A 2J8UE 1Y0LB 2VDKL 5AEAA 3CUPA 1GZPA 4HMCA 5DI8A 5EN2B 5F9WC 1QBMH 2VLJA 5E1HB 1DSFH 5IROA 5HI4D 1NCCH 5MERB 3KPSD 3ULVC 3CVHA 4U3CA 4WFHD 2ZUVA 3MYJA 4KDTA 3ZTNL 5FV2A 2DD8L 5BJTA 1GIGL 2L0DA 1EGJA 2MCPH 1SY6H 4HXAL 1A1NB 2J8UA 1F90L 2P5EE 3O0RL 3RHWF 1D6EA 1GL4B 3H9YA 3BSZL 1JGUH 5DUPL 3SGKA 4JVWA 4F7CA 4MJ5A 4EJ1C 1AGDB 1KJVA 3B6SA 5DHVB 1SYSB 4G8EA 3VDAA 1MAML 3EBAA 3FT3B 3K4AA 2WZPD 4DZ8A 4HF5L 4YXKL 1EEUA 3WXWH 4PJ8C 1YNTA 1EZVX 1UM6H 1NMAL 2BFVL 1L7IL 3T0EB 1OAZL 1OL0A 4M93C 2VWEC 3RZWA 1TQCB 2XN9D 2XWJA 5BV7H 3L7EB 3GSRA 3EGSB 1KCKA 5T1MB 2VXTH 1RD6A 1NGQL 4HUKB 4JJHA 4P23D 4O4YH 1I8LA 1TZHA 1YEGH 3DTXA 4ZSOB 4PRIE 3HUJA 3EOBA 3NGBB 3A6OA 1T03L 1E4KC 5J4MA 4F9LC 2NNAA 1JZ6A 2UZYB 3G9AB 4LCWD 3UJIH 1FAIH 4BSJA 3QG7H 4OCWL 4RNRA 3CVIH 4HQQH 5B21A 2AK1L 3BVNB 3QIUC 2MCPL 3FO2A 3GZKA 4PGJA 1DCLA 3CK0H 3EYQD 3T3ME 5JQHC 2FO1A 1OAUL 5E8PA 2Q87A 1RPQA 1G7LB 4JZOA 2AEQL 4FXGB 1SBSH 1MFDH 1UH3A 2WBJA 4EVNB 1XCQA 1ZVSA 4OFKA 4PJGA 3M45A 4QRQA 5BV7C 3IVKB 1N8ZB 4YHYB 4ZQKB 2EDLA 1M71B 1OAYH 5GIRB 5SWQB 1BIIB 4QXUL 4XCFH 3SDAC 3VXMD 2XG4A 2R15A 3P0YH 4M7KH 2A6IB 1BWMA 4JO3L 2X9WA 4NQCD 5KSAD 4DQOH 3CDGA 4K55A 4WW2C 3Q48A 5IB3A 4IJ3C 3EO1A 3HE7B 3WNMA 2W0KA 3I6LE 2QR0B 2CO7B 3C2AL 3P4NB 5I1CL 4KTDH 1SJXA 1RFDL 5FO8B 1MJ8H 4DTGH 3BXNB 1IL1B 2AXFA 3KYNA 3MLRL 3FCTB 1VKXA 1MVFA 1PGRB 4O9HH 1J8HD 5TH2B 1SVCP 5EPMA 5JHDE 4NSKB 1U8QB 4P5MB 1WFNA 2OBGA 1D9KC 1EAJA 2EDQA 3MUGA 3QFJB 1UWEL 1XIWD 5F9OH 5C08E 2CLRA 5D1QB 1T20A 4LVHB 3TYGH 5CD5D 2O26U 4I18A 4JFPB 5ANME 2GSGA 2XWBB 2A38A 4PTUA 1WT5C 3NCMA 4LPVA 4KK5D 2HFEA 1EHAA 1G84A 4Y19B 1AR1C 2I9TA 4RAVA 4UT6H 2C1PB 3AY4C 4MA1C 3P77A 2FRGP 4GXUN 4I5BB 4N5UA 1CDHA 4MQ7B 5DHYB 3SJVD 3EYUH 2C4XA 1J8HB 3CZJA 3HZVB 4BFIB 1PKQA 1B0RA 2ZNXA 3DV4A 1DFBH 2FX9L 1MJ7H 4IOFC 1VFUA 3SDCC 4J3SA 5DEZA 5TDNA 4YDLC 4LFHD 5DI8B 2RQ8A 5IHUL 5DYOA 4OGAC 4GMSL 3ARFD 2DQGH 2DQCH 3MRCB 3UTQA 3TN0A 2DS4A 4LHUG 2R2EB 3QCUH 3RY5A 2CDEB 1BD2A 3V5KA 2ZNWA 5DJ6B 2D2OA 3LKOB 1OM3L 2CIIA 5KOVC 3QDAA 1HHIB 2KZ1B 4RX4D 3DXAE 3MSPA 4KMQA 1KJ2B 4FP8H 4NQDA 4FQCL 3AY4A 2V2TB 4L5FH 3VFGH 4JM2D 4LARL 5ISZA 1UVQA 2YXMA 2B8OT 3C5SB 1XGYH 1M7DA 4S11A 2P42B 2IFFL 3LKNA 3RDTC 3HI5H 4HLZG 4CGTA 5D7IA 5JW4N 1ADQL 4M7ZC 4LSTL 3H9SE 4JGMA 4ZS7L 1FVEB 1A47A 3PDOA 2ICWI 2HAZA 4HK3J 1FYTD 2EE6A 1D9KA 3D0LB 1G7JA 4F7TB 4BM7A 5EOTA 5C0BE 3MRJA 3GM0A 2R2BB 2Z93A 4LIQE 4Y0GA 4QRPB 2CDGA 4HWZB 4APQA 2C3WA 3QA3A 4G8GE 5T1MA 1YYMH 2RCSH 3RTQA 4Z95H 3PXHA 1CN4A 5FUZL 4LLWB 1EHXA 4YR6B 4ZPVA 3STLA 4EN3D 1MCBA 3CFKB 2MKLC 1CL7H 3HUJB 3R8BB 1URLA 2JIXD 3DSFL 5C9KA 3QI9D 2R2CA 4F2MA 1GGCL 1D7FA 4ELMF 1OLLA 3DNKA 1TVHA 2X70A 1FYTB 2DQGL 4OZ4A 3T8XA 4ZUWB 2EDFA 4HKJB 3P30L 3WDJA 4N5ED 1FL6A 2QLVB 4Z0XB 3TBYB 5DJAB 2C3HA 2YC1B 3SKOB 1AQDA 2HKHH 4AYFA 1JFQL 4LKXB 4JFQB 3O6KH 2FGWH 4C54A 1FNFA 2HJKB 2DWEB 1R5VB 2UUDK 3GMNA 4F7PB 4LSTH 3S34H 5IMLB 4KI1A 1IC5H 3MGAA 1CFVL 5J56B 3IFOB 2HLAA 5JOFB 3K81A 4NC1E 5GGQH 4F9LA 1CDUA 2BY2A 5H8DA 2IH3B 4U7MA 3U2SB 5HGBA 2GEEA 5I1LA 1DVFD 3EYQC 5FDWA 1C7TA 3NPSB 4D8PB 5CIPB 1BX2A 3BAEH 3MUHL 1HZHH 1MHPL 4CBPA 2UZIH 4B5EA 1P7HL 4YHOL 1GGBL 2Y4SA 5E08L 5F1IB 4PREA 5T3XD 2JJWA 4PIRF 4QRTB 4NQEB 3BPLB 4FZEL 2RIKA 4KZDH 2V5MA 1TJGH 4XAWH 5LBSL 1F8TH 5D71L 1NAMH 5EU4A 1WSST 1JGUL 3VA2C 1HCFX 4LLUB 4WFFE 4M03A 3SGKC 2FIKB 4HK3N 3SE9L 1S7SB 4FOMA 4HHAB 1RURH 3DMMB 5IKCA 4GT7A 5C1MB 1IT9L 2AV7A 4ZUVB 5F96L 1I1YA 5D7JA 3VFNA 4HCRH 4H1LA 1OP3K 3V6OC 3PWPD 3MLPA 4O58L 3U6RB 4PJ7E 1IKNC 3JWDC 5DJZA 3ECBB 3MRMB 4OB5H 3RAJH 2VMFA 4XWOC 4XMKH 3D85D 2EZ0D 2ED7A 3FB5B 4G8GD 2A77H 4N8PA 3CXDL 2BOBB 4ZFZA 5JUEH 2R1WB 5F3HA 5IEKB 1ULVA 1PW3A 2W91A 1S7RA 2OK0H 4PB0L 1MFCL 4YH6A 3HCVB 4Y16B 5FYKD 2A1WH 2X7LA 5GGTA 4IEFB 3E6HB 5BJTB 4NNYB 2APXA 4Q6IC 5DJDB 1K6QL 5KS9B 2XPGA 5D2NC 3SO5A 1KJ2A 2B1HL 2AJZB 1QFPA 3BWAB 4KUZH 3A6CH 2VDMH 1DSFL 1UG9A 3SE8H 1RI8A 4LRIC 5EU7E 1ED3A 1U9KA 1I8LC 1ZT7A 3BD3A 3NAAL 1TNMA 2IADA 4ZXBB 2HN7B 4C83A 2B0SH 4U0QB 4KY1L 3SGEI 1PYWB 2PCPB 3N06B 3AREC 1X6NA 1QTYT 1AGCA 3GIZH 1UEMA 4Y5XC 3PWNA 2VN4A 4Z7VA 1F00I 2GFBA 5D7IE 1QZ1A 4HCRA 5CGYD 2EC8A 3DROA 3VGBA 2PR4H 5DUPH 1MFEL 4L8BB 1OGAE 3SKMA 3LS4H 4M4PA 4XVTL 1RVFL 4IDJH 3FFCB 3QA3B 2NZ9C 2APFA 2DM4A 2EXWC 3GBNH 3O2WH 4S1SH 5F6HI 1EUUA 1VGEH 3DUSB 4MQXC 4LDOB 2DQHL 5DJ2B 3F7RA 5J6HA 4HUWB 2XACC 2HKFL 1YC8A 4HC1A 1YJDH 2R39A 4E42A 4FFWD 4GBXD 2D31B 1A64A 1IAIH 4XPGH 3V2AR 1WBZA 1KNOA 4JFYA 5C6PB 3QJFB 3CMOL 2N4IA 1U58B 5IROC 1J1OL 2DJUA 4KFZC 3SE8L 1EHNA 2A1WL 4JPIA 4P46B 2R4SH 4B7IA 5CEZD 3V7MA 4EVNA 3F12B 4R2GC 1RIUL 4OAWA 4UV4H 1SY6L 3NFNB 4LGRB 4LAJH 4MNQE 4OLUL 5D1QC 1FO0L 4LLVB 4F7PA 3K2UL 3O81A 3QI9C 5J9PA 3NAAH 3B5HA 3T09A 4ZNEE 2VH5L 4OLYL 1WJ3A 5L2KA 2A9NL 4GS7C 2YSSB 4Z7UA 2DKSA 3ZZ1A 1X5FA 1MF2H 3BISA 2DJ4A 4EOWH 1T5WB 3RVWD 4EI5C 5AZEH 1Q9OB 5I8KL 2X42A 1KYOK 4JDTH 4AIZA 3BXNA 1FH5L 1UXWA 3F5WB 4N8CH 1BFOB 5JW3L 1MAKA 3MYZA 3RIFK 4LPUA 3PWLB 4L3AA 5EPMB 2DLHA 2ORBH 2PTTA 4IDJL 5FKPB 3VFWA 4HJJH 4DQOL 1DZBA 8FABB 2E6PA 5AYUH 1YJDL 3M8OL 1J8HE 2FL5A 3QCTL 3G04A 3O8XB 1V3KA 3QDJA 4ZD3L 2NX5A 2VAAA 2HG5A 1FORL 4LGPB 1T20B 4B0MM 4GG6B 3HRPA 1EEYB 1B9ZA 1E4XH 2ICWJ 4BA8A 4ZAKA 4NRZA 2XQYG 2AJYH 5CJXC 4HWBA 2HT3C 5DJXB 4PTUB 2PO6B 3BIKA 2HFEB 4AT6A 2BNRB 3WFEH 1BQLH 4C56E 2BSTA 2IAMA 3HZKB 1NEUA 3IAGC 3KYKH 4F80A 1RUMH 2BERA 3TJHD 5KANI 1JZ4A 1RJZA 5EU3B 1X5XA 3GKZA 3HLAB 1NFDF 3F7VB 3EYFB 2VH5H 3ESUF 3VFSA 3U6RA 1IARB 2V5YA 1JF1B 3D69A 5C07D 3O8XD 1AO7E 3WN5B 3DI2B 5D2LE 2H8PA 4XNZB 2RAMA 5D1QD 5ESAA 5GSRB 3ARBC 4WWKB 4WIQA 4Z78A 3MV11 1RMFH 4U3HA 2Q8AH 4M48H 5HJ3A 4OZIB 3B3IA 3R0NA 4FQ1H 3GI8L 4S1RH 4U6YB 3MRFB 2ICEB 4Q9BA 2NY3D 1YMME 4I3RL 2B1AL 4I48B 1IM9B 4BZYA 4JO1H 5I8CA 1DDHA 4LNRB 4UNTA 1MPAH 1ZHLB 2Q3AA 2H6PB 1ZKAA 2XFXB 4UU9B 4QRUB 3N85H 4KVNH 1QFWM 1XGQB 3U9UA 3WL9B 1F3JA 4FFYH 1ADQA 1BIHA 3O6FA 15C8L 3OJMB 43CAB 5SV4A 1XGRB 3BO8B 1MIEL 1F6AA 2NY6B 3LAFA 3S3PA 3QH3B 3ARFB 3OPZH 1MFNA 4PGCA 1U8JA 1J86A 4PJ7B 1VFOA 1LP9F 5IT2L 4I77H 1GXEA 3JSSA 3NA9L 3P4OB 3O41B 2DQFA 2EKSA 1ZT4A 4ZO8A 1KTLB 3CPLA 3RY4A 3CFBB 1ITBB 1IC1A 3C6LA 4OCLC 1OY3B 3IXAA 4PJBB 1HINL 2V2WB 1PLGH 3LEVH 4ESKA 4PGEA 1JYXA 5FF6B 1TJIL 4LBEA 5TJWK 3OB0H 2VLLB 4ODTL 1JYVA 1U3ZA 2BC4A 5CBEA 3WS6A 2P5EB 1S5IH 1NLDH 1JGDA 3ULUL 3MA9L 5TDPB 2NW3B 4L8SC 5ICYB 4GMSH 12E8H 2NLJA 3KJ6H 4OSUH 4P49A 1W72B 4HKJA 5IB5A 3JBG7 1JWSB 4EDXB 3TVMB 3VD4A 2VR9A 2Y1VA 5SX5K 4QOKA 3BQUB 3ULUC 5F9AC 4WHTA 1T04A 4YQXH 1KG0B 4UDTA 1OTUD 4UINL 5J12C 1HYSC 3TIEA 4S2SA 3F12A 1LGVA 1Q38A 4NNPH 2NZ9D 1QKZH 5BRZD 4NO0B 3SDYH 3EFFA 2NY0B 3PGFL 4HZLA 4G6JH 2Q6WB 5J9PB 4XBGA 3D87B 1HSBB 1UKQA 1VFAA 3M1BA 1CE6B 1CXKA 2IAMC 1XR8B 2E5EA 4G43A 2DLIA 3WKMH 1JFQH 4HFWB 2FB4H 5FA4B 4MD5A 2ENYA 4CVXA 3SDCD 3S9DB 2C7UA 3IRPX 5JZ7C 2VC2H 2ED9A 1HKLH 1I8MB 1CK0L 2DQIL 1OCWL 3N0PB 4EEEA 1QHOA 5F1IA 2X4RB 4HGMA 1YEFL 1WZ1L 3IB4A 2V2XB 4N0YH 5T5NF 4XBPA 4G6MH 1JTPA 5EUOB 3LSOB 1KBGL 2VOTA 2XIDA 1ZS8B 3EYOA 4X99B 1AGBA 4P2QA 2J5LC 5E4IA 5DD6B 5GRUL 3M07A 1N6VA 4HLJA 5T1KB 4E5XA 3Q0HA 5GGSB 4EI5D 4KWUA 2YS4A 2FIKA 3MNZB 3ZDYF 2ILLA 2WP3O 2NY5L 1FFPB 1RUAL 2BVUA 5BMFH 3STZB 1CI5A 4UQ2B 4F7MB 1X5ZA 2YD9A 3QIUB 4QRPD 4R2GB 3HPJB 5E8EA 2N1KA 2DQCL 2WBJC 4OFVA 1NCBH 2B7DT 5T3ZL 4L9LC 5HI3D 1JK8A 1MFEH 5HYQA 4P23A 3GRWL 1S7UA 2FGWL 5IJKC 3O4LB 4HUXA 4FQXC 4GS7B 3DVNA 1AC0A 3T0ED 3S34L 1LHZA 2NXYB 1ZSDA 4Y5XB 5IB1A 2QHRH 2RBLA 3P4MA 1GHFH 1T7WA 3U7YL 4JKPH 2O5YL 3CDGB 3F58H 5TE6H 2DIBA 4UIKH 4LSUH 4X7SL 3E8UH 5CEXB 3QUXA 4UIMB 4LOUC 1R3JA 3E6HA 3V4UH 3MJ8B 1DANT 1KV3A 4Z7WB 1HZHL 1MHPH 4EXKA 1S3KH 1LD9B 4N8VG 4GAYB 1U8NA 3VXRE 3BGMA 1S7QA 2AEWA 1RUQH 5IF0A 1WEJL 2YD8A 1Z9SA 5C0DA 1QRND 4MAUH 1CE1H 4KHXL 5ACMA 5I1AA 3C8KB 1RHHB 5I16A 4PPTA 5C0RH 4HKXB 4XCNA 2G60H 1ACYL 2YBRA 3E6FA 4HDIA 3BX7C 1X5YA 5GJSH 1ZWIA 3QQ3A 4G6KH 3BE1H 2G9HB 1NMCB 1U8JB 4ORGA 4U1MB 4M43L 1V8HA 4P46C 1F3RB 1EGJL 5DVKA 1G0XA 2I9TB 1FVDB 3L5JA 4DGYL 2WV3A 5F72S 5DRZA 4TNWK 2Q86A 5BMFL 5I1HH 3RWJB 1FNAA 1TZIB 1A0QH 1YEJL 3CLEH 5LXGH 5T33H 5J13B 3QWOA 4BH8B 5TF0A 2R1XB 1Q0XL 4E41A 4XNMA 5A3IC 3FT4B 4G7VH 1UQSB 2CKBB 5E7BA 3QQ9D 4YX2H 2GIYA 3SKJL 2X41A 3MRHB 2YHGA 3Q6GL 1U8KB 2BHYA 1XIWA 3QXDA 1A14L 2W9LA 3BMWA 3MXVL 4J12A 1U8LA 2M8XA 1GPOH 4JANA 2EXYC 2VDNL 1S9WB 4HEPG 2NW3A 3V0AC 4NQVB 3DXAA 3ALPA 1SJHA 5IBLC 2DQDL 4M6OL 1MCNA 2CIIB 1KB5B 3T04D 5JXEA 2CLZA 2AJYL 4NJAH 5H35A 5CIPH 3N9GL 2YMXH 3QBTB 3FN9A 3O3AB 2YPLB 4OKDA 1MFAL 2AJSL 2V5RA 3L3HA 3ZKMD 3U0TB 4D9RD 4O5LH 2HJFB 4NN7C 4KK6C 5EWIH 1G7QB 3ZYZA 3IDMA 4HZLB 1JZ3A 1G7HA 1NQBA 3WEXA 2ITDA 3QG7L 4G43B 5CJQL 4Y4FD 3KPSB 3QHFH 1FL3A 5KVEL 4MD5B 3EDJA 4IHOA 2XTJD 4ZODA 4F7TA 1MCQA 4P99A 5F21B 4HIIB 4MNGA 1ND0A 3NCCB 3GI8H 4Q9QL 1N3NB 2DI7A 5IHLB 2DWDB 3HI1B 1CIDA 4LCCA 4PJHA 3ULUD 1IGCH 4JO3H 1I7ZB 3WN5C 3M17A 5DDHB 5L8KB 4Z7WF 5HGHA 2FL5B 3TT3H 4KUCD 1AGBB 4P2QB 4TPRH 5C0AD 1XF4A 1EEYA 5INDB 4U1KB 2V17L 4N0UE 1SJEA 2MNUA 5I1GH 3EO0B 3BEVA 4NJAL 4XMKL 3GI9L 3IETA 4XHJD 5DJYA 3RPKA 5EDXA 4DFHA 4WY7H 4ODWA 5C0FA 2C26A 4WW1B 3BP6B 3FQRA 4JFXA 4PBXA 5E8EB 5GJTH 3HPLB 4KRNA 4U1HB 1DR9A 5I8OH 3GMNB 1S7UB 4J1UA 3VXUA 4XP6H 3V6OE 4EN3A 2R4RL 2Y5EA 3QHFL 5F9OL 5KVEH 5F1OB 1BPVA 3LHPL 5C0EA 5I6XC 1X5AA 2DB8A 3H8NA 2E6JA 2VDML 4X80L 3TBSB 3MA7A 4OLYH 4DN4H 2BMKB 2BNUA 2QR0A 4YFLF 3LPGA 3MJ7A 4L4TD 5HDQL 3CFEA 1GIGH 4RCAA 2E6QA 1UM5H 2J12B 3SQBA 1KSRA 3MV7E 1N59A 2QSVA 3MUZ1 4JFEB 5JQ6L 3MLUL 4WTXA 3VJ6A 2HJLA 3DBXB 1T4KB 3QCVH 5EO9B 4F7EB 1JUFA 4WW2B 4OI9A 1MCLA 2F19L 4HWUA 3DRTA 3MV8D 4DVBA 1HOCB 1B3JA 1VENA 5INCA 4ZS6C 3GMOB 1XF5A 5HTSA 1D5IL 2FHCA 4HSQA 5E8OB 3VXMB 5GISL 4EUPH 3MODH 3LQAC 1V7ML 3QH3A 3TFKD 5LWYL 5HYSA 4DW2L 3ARRA 3SE4C 2AK4A 2GSGB 2DQUL 4RMVA 5I1IL 4XNUH 1TNNA 4PY8J 1CFQA 3FFDB 1NCAL 3CZFA 1Z2KA 1SEBA 2FYYB 4R9HA 5DRZB 2AV7B 1N64L 4POZD 2D9QB 1M6OA 5E6YA 3SDDC 4XP5H 2V2WA 3RVWC 3GGWB 5CEYA 3U46B 4NRYA 1BBDH 1SYVB 3MV8B 3TO4C 4AG4H 1JHKL 4LLYB 2IFGA 3ETBF 2DBLH 3QIWA 4KJPD 5EORH 3RZCD 5J1AB 2P5WE 2VKXA 1FL5B 4TSBH 5E4EC 4JY4A 3DV6B 3QDGA 2H2SD 2P5EA 4M1GH 3UTQB 2XG5A 1VADA 4UT7H 3VXNB 5E5RB 3IKCA 5EIIB 3TV3H 2B2XH 3QYCA 2Y9RT 1W72A 4FQQB 4S10A 2PO6D 3EJYC 3KPLB 3QCVL 4XPBL 4U0RC 4MD4B 1BLNB 3V4PL 3WFBL 3GB7B 2Y36H 3TFKC 3FQXB 4U1IB 3MACH 1EPFA 1I9IH 4YHML 1OT1A 2DM2A 4YDVB 2BVOB 5C09A 4PLJD 2F8OA 5FCUH 5FUOH 3L3KA 1OTTC 3MRQB 3QQNA 1V7MH 2UVFA 2ICWB 4LCYB 4NUGH 5BQ7B 3AS1A 5I74B 3VE0A 2LAAA 4LPYA 5IQ9A 5IJKA 4EUPG 4NM4L 3QSKB 1MRFH 4MNQD 3AM8C 4LAQL 2EE3A 2AEPL 4BUHA 1NCDH 3PL6A 3K4DA 2WUCL 3FT2A 4MLSA 2C7UB 5HGAB 3EOTH 2AJUL 4ENED 4FMFA 1HI6B 2NY3B 1U3HD 3GM8A 4M6NH 3D3VE 1DQDH 3HE6B 1MCPH 3WSQL 4A6YB 4L3EE 1CF8L 4NN6C 4DKEL 1G9NL 2CXGA 4DGVL 4JZJC 3BT2H 2F53A 3V5DB 1V3LA 4KKAD 4NHUB 3BKJL 1IAOB 4RQQA 4J6RH 3B9VA 3QZWB 1IBGL 2K9UA 4KJQC 5F9DC 5K9KB 4KHTH 4X99A 2MQ3A 1WZLA 4IDLA 4R0LC 3IRZA 5SWZA 3SDXE 3LRSA 4Y4FC 3O2DA 3EOAA 3C8DA 4MNGE 4PGDB 1C8PA 5EU5B 5T1DH 3LPFA 4MSWA 1F45A 2Y36L 1H15A 4ODSL 4U1NB 3TNMB 3LB6D 3MOAH 3MYJB 1DL7L 5J1SC 1AD9A 3QUKB 5IFJB 2IANE 4XXDB 1EMTH 3ZDZF 2CGRL 4P2RE 3KR3L 1AKJB 3EHBD 1KULA 3CD4A 1IM3B 1OF2A 3IDYB 5EO1B 1C12B 1YEJH 2A74B 1JI1A 3O6LH 3IAPA 3LH2H 3N1PC 3AM8A 3WD5H 3O11B 1AIFA 2GTWA 1KJVB 4L1HA 3DX6A 2ZZUT 3QHTC 3GHBL 3U4AA 1J11A 5FYKU 1D6EB 1F58L 3UPCA 3HRZB 4PP1D 2EEBA 1AP2B 4NO3B 2X5PA 3V4VH 3G5VB 4MYWB 1UH2A 2GT9B 5D7LD 3MJ7B 1N5AA 4P3CH 4NQCE 3NN8B 2JB5L 1I3RB 2HRPL 1ZOXA 5IBTL 3ZDZE 4NUJA 3OJDA 1JUFB 1A9BA 4AM0B 1HHKA 4JHWL 4F37K 3GK8H 3VGGA 1Q9LA 2VUYA 1Z0NA 2E3VA 3ZL4L 5KVDH 1RZ7L 1P7KB 4QTHA 4WW2F 3F8UB 3F58L 5TE6L 3EGSA 3RWGA 4HWNA 3CFJA 2VDQH 4X6FA 1IC4L 2Z4QA 5JXED 5IVXA 4ONFH 4ZUUA 1BEYL 4NRZB 5DT1L 1DJSA 1S3KL 3E2HB 2K1MA