1CLZH

Igg fab (igg3, kappa) fragment (mbr96) complexed with lewis y nonoate methyl ester
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
218
Chain Sequence
EVNLVESGGGLVQPGGSLKVSCVTSGFTFSDYYMYWVRQTPEKRLEWVAYISQGGDITDYPDTVKGRFTISRDNAKNSLYLQMSRLKSEDTAMYYCARGLDDGAWFAYWGQGTLVTVSVTTTAPSVYPLVPGCSDTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG FAB (IGG3, KAPPA)
publication title The x-ray structure of an anti-tumour antibody in complex with antigen.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 45
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1995-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1clzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1clzH01
1U95B 2I5YL 2XNAB 3F7VA 3QDMA 1U3JA 2G75A 1FL6B 3UO1L 1QOKA 3FMGH 2X9XA 4XBGB 4CU6A 2HKFL 1NCAH 2J5LB 4YX2L 2ZG2A 4EEEA 3T4AA 2N4IA 3C60C 3RY4A 3ZDYE 5FDYA 3NFSL 1A4KB 3H9SA 2YSSA 4FZ8L 4AQ1B 1L6XA 2HH0H 4UU9B 1P1ZB 3S37X 5GGTA 4M7ZC 3I84A 3VWJA 4NWUL 4HLJA 3GB7B 4KJWC 3B2UD 3ZE1E 4LSRL 3KVQA 4JKMA 3RNKB 1DQQB 1FIEA 3L7EA 4MDIB 3A6OA 3ZSTA 3HFMH 5DRNA 3QIWA 3SE3C 2H6PA 3V7AG 2HN7A 3PWUA 2BSSA 4G8EB 1OY3B 1FPTH 2CR6A 1NUFA 3KS0J 4QNPF 5ALCL 2EYSB 3IJYA 3VWJC 3PWPD 3BE1L 1NCDH 1N59B 3GI9H 4HWBL 4OCYL 3NCYP 4QF1B 4OZFG 1DEDA 5C08B 1MVUA 4QXGL 5D5MB 3EOAB 3CDGA 4HD9A 1C7SA 2EDLA 4X7TB 5F88A 1FG9C 3TYFB 4NP4H 2YRZA 4C83A 1Y6KR 1G9ML 2CRYA 2XZAL 4CKVX 1RIUH 5CHNB 5ITFB 2FLRT 5D96B 2X05A 1U3ZA 1MI5A 4KV5F 3MOAH 3VGGA 2Y72A 4FXLA 4HC1H 4U3XA 4G9FE 2C3XA 3V5HB 2Y06L 4QHLA 4HMEA 3EHBC 3PWJB 4QYOA 2H32A 3D3VE 4IBLT 1BZ9A 5FKPB 2DWEB 2DQTL 4WDIA 4NRZA 4PJAE 3SDDD 3VW3H 1M71A 3DRTA 2C3HA 4QXWA 2GTZB 5FYLD 4HLZG 4DW2H 4OCWH 3EDKA 3SPVA 1S7SA 1I1AB 1A6ZB 3SE8L 2I9LB 4DKEL 1TJGH 1XF4A 4J6RH 4WFFE 1T0MB 2JJWA 2UVEA 5FUOH 5ERWA 1JF1B 4YFLF 4JRYE 4NFDA 4ZYKB 3QEUB 5E0QA 5DUPL 3PQYA 3B9AA 5BVPH 3IJYB 2CD0A 4U6TA 3GSXB 1I8KA 1SEQL 3J7HA 1FVDB 1E4XL 1S7VA 1MVUB 2W0LA 1KJVA 4CVUA 4EZMA 3BH8A 5TDNA 1Q0XH 1LDPH 4S2SA 2JIXA 4WUUD 5BS0A 3HPJA 4BZ1L 3G6JB 2BHYA 5A2FA 2HJKB 2ZUYA 2GJZB 5IBTL 5C0CB 2KZWA 2VXQH 2CIIB 3ZT7A 4LQ1A 4OBSA 3C6SA 3MRGA 1CDHA 4EXPX 3MBEB 1BOYA 4RMWA 2ICEB 1HK6A 4XNMA 5FB8A 1I7TA 1EEZB 3QDJB 4ENEC 4OCXL 4BJLA 3G6AB 1U2HA 4R7DA 2DBLH 5A16B 3GNMH 4KJYA 4NRZB 4YXKH 4Y2DB 2VXTL 3P4LA 4X98B 3B43A 3MV01 3LKRA 2FWOA 4MAUH 5FKAA 4OI8A 1KF9B 3TO4D 1OAZH 4YO0A 2BJMH 5I2IB 5GISL 4KJQC 5IB4B 4YWGH 3H9HA 1B0GA 3V0VB 2RJMA 2BY3A 3KPMB 2EXWD 3X14B 3M07A 2NXZD 2FB4L 3EYFA 2X2YA 2Y5TB 5ETUA 1JHKL 4UB0H 3U36B 4WV1A 4AL8H 1R24B 4AG4L 5E03A 1S7WB 3CZJA 4CBPA 2DI9A 1IQDB 1UWEH 2EC9U 4G6MH 5C0BE 3DRQA 1F11A 1MRCH 4K3EL 2ITCB 1RHHA 1DJSA 1CICA 1YECH 1OD7A 2APTA 4KK9C 1FVEA 2BOCB 4KPHH 2V7HA 2DTML 1Q0YL 3O6FD 4P46A 4LDOB 3P40A 3VE0A 4JR9L 3B6SB 4YHPA 1PDKA 3QFJE 2CR3A 4ODVL 5BS0B 3CCHB 1J0KA 5L6YH 4AZ8A 3KPNA 4MS8C 4NN7B 1S9YA 4QY8B 3I9GH 3ZL4H 1NSNH 2ZJSL 3BSZL 3F58H 2EDNA 3VWKD 3C6SB 5HHOB 3KXFE 4LLQB 4QTHB 4HZAA 4JGMA 3IFPB 5IIEB 3HNTH 4X6DF 5I8OL 5D70L 3WDHA 1CDUA 5I9QC 5MP6H 4OKVB 4NZUL 1K4CB 1ZT1B 1DBAH 5I0ZA 4G3YL 1UXSA 2J8UB 5HD8D 1QQDB 5SWSE 2VH5L 1JFQL 1F3JB 4HC1A 4PRNB 5IROA 4GG6B 4J4PD 2PYFA 5KSBA 1TZGH 3VGFA 2WIIA 3K0WA 4K94L 3N06B 2NX5E 4WV1B 1RZIB 5KN5A 1S9VB 5C8JB 5L0QC 3O4LE 3PV6A 3LB6C 3PXJA 2F53D 3ECBA 3MX0A 3PL6A 4PTUB 3QG6B 3A67L 5F89A 2VDOL 2BSED 3I02A 1U8HB 4L1DA 5IROC 2Z93A 3VXTA 3TT1L 4YC2C 4HEME 2VOTA 4LGSB 4XP9L 5IQ7H 3FJTA 4U6HA 4LCIH 4NHCH 5BW7C 2P8PB 4JVPA 1IT9L 4OCMC 1QBAA 4ZS6C 2I27N 3BKJH 3DIFB 5SWQB 1NAML 1O5DT 3PL6C 3KPLA 5GGQL 3ILPB 3UYRL 4NQXA 1B0RB 2DYPA 4K3JH 3L5XL 2GSGB 1RUKL 2XZCL 3BKYH 3JWDH 3H3PL 5I1IL 4N0YH 4L8SA 1MJUH 3RKDC 4O51B 1RIVL 3ILQC 1ZT4B 3PGFL 4QT5A 4WHDA 3SDAA 4UNUA 3QXDA 1LNUB 4W4NA 2UVFA 4Z7UA 5KVEH 3BPOB 1AR1C 4AYFA 2YD3A 4LPWA 1WSST 4HS8L 2DQGH 1BD2A 1UXSB 5C0FB 3RX7A 2FRGP 3NZ8A 3ZTNH 4L8SC 1I7RA 4P5TA 3HUJB 1GAFL 3MR9A 1R5VA 4X80L 2V2WA 4XCCH 1U8KB 4JQIL 1A6AA 4XHJC 4DAGL 1XCQA 2WW8A 1W0YT 4YDVA 5T1MA 1MWAB 3HMXH 4Z95L 3U6RA 1OF2B 4R97C 5GGSY 3RVXD 5CP3H 5F7YC 2DWDB 2F8XC 1NGZB 5F89B 2JELH 3V8OA 2NY2B 1RHFA 1ND0A 2R1WA 2VAAB 3NIGF 4M7JL 3SHSA 4LVOB 4X4XB 5EU4B 1W72H 3P4OA 2ATKB 4YXHH 4HK3N 1TNMA 1P4BL 3QEGH 5SWZE 5CFHA 3O6ML 4PREB 5F1NA 5KSVB 2R23B 4X4ZA 3MRBA 5KS9F 1A6TA 2ED7A 2ZPKL 1DZBA 5DMIL 5JXAH 3DHMA 3BJ91 1AXSA 2HRPL 3BDYH 4LMQE 3MLYL 3EFFA 2Z31C 4GW4A 4EVNA 1L0QA 3GO1H 2BDNL 4FFYH 3MNVA 1MCNA 2H3NA 4OJFL 1XGTB 2NTFA 4Z8FH 4X6CE 4G7VH 4U49A 3D2UA 3RVTD 1XGUA 4NKIL 5DC9B 4HFWB 3QXUA 5F8RC 2WUBL 1ZVSB 4G6KL 3FO1B 5E4EB 1CFVL 5B39G 1JGDA 3DOSA 3O4OC 3RJQB 3UAJD 4JRXE 2E7LC 4OBRA 3X11B 1EAJA 4BSJA 5DJDA 1JGEB 3ZT5A 4NUJB 5LQBH 4LLAA 4JFQA 1DQJA 1EBPA 4JAMB 1KCKA 4MNHB 5IWLA 2ZSVA 1M7DB 1AD0B 15C8L 4PJXF 1OM3L 3S4SB 1RU9L 1QFOA 4U1SA 3ULVC 4OZIE 4MGXA 3QDGE 4NYLB 4D0CA 4NO5A 4QRUB 1GIGH 4RIRB 3Q1SL 3SGEH 1MPAH 4JPWH 5F9OH 3NZHL 1NH6A 1RUMH 2DL2A 2JJSA 4YR6B 5IWLC 2OMNA 5F9JB 3GBLA 3VRIB 3QXAB 4L1HA 5ECJE 3MCKB 4PJ8D 5IFAH 3SOBH 1DE4A 3QUYD 4NIKB 4ZTPL 2APVA 2EDKA 3AROA 4KTEH 5DGQA 3QH3B 2AV1B 3NCJL 4P3CH 2NLJA 3D85D 1RZJH 1I9EA 3U30C 5GGRY 1NGQH 2VXVL 1HEZB 2R4RL 3O3EA 3LS4H 2XRAL 1XGYH 1X4XA 1MCHA 3CMOL 2JJSC 2IMMA 4UT7H 4YHLL 1YEDA 4QHMB 4ODWB 5J89A 2YD2A 5DD3L 3KPRD 4FS0A 2YMXH 3WLBA 4IHOA 3HHRB 2YZ1A 3JTTB 5ITBH 1RURH 3SBWA 2WQ8A 1FGVL 2RQ8A 3WN5B 1KCSL 1EMTL 1JN6A 4Z7NF 3U7WH 5I18H 4S1SH 3DBXA 5DJDB 4JGJA 3PDGA 1JV5A 4PLJC 3JTSB 4KK8D 4OB5H 4J3UA 5TFSH 1PSKH 4XPAL 5DK2A 4S0SD 5AG8A 1BEYL 1F42A 5ACZA 5DUBB 2OL3L 3UYPA 3ZZ1A 3H42L 2Y9RT 2YUZA 2HMID 5CZVH 4X8JA 5I19H 3BN9C 3ZDXF 2W0KA 1FC2D 3V6BR 4OZGF 4BH8B 3SBWC 2VNCA 3WIHH 3LN5A 3KNBB 3WUWA 3GI8L 5EO9B 1GCFA 1ED3B 4GMSH 4HIXL 4P59H 3VGAB 1VKXB 3SGKA 4N90E 1XMWA 4O5LH 5GS1A 3JSSA 4RISH 4ZSOE 5HTSA 5DD1L 3HMXA 1DE4B 3VFWB 1EO8L 5GSRB 1ZA6A 2GY5A 4JHZA 5DD0L 2WINA 4NJ9L 1WFOA 1A14L 4LPYA 5EOQL 1KB5H 4M5YH 3QQNA 5B22A 4D0BB 2PR4H 2D03H 3MRJB 4FP8L 3SJVE 1W72A 3SGKC 5INCB 4MXVF 4RFNB 4ZO7A 5DK0A 5GS1C 1JYXA 3ZKNC 1ZEAH 4EDWL 1YY9C 2DQUH 1MIMH 4R4FH 3A6BL 2F19H 2NY5C 3WS6A 5DT1L 4EIGB 4HIIA 2I60H 3P0YH 2P1YA 4MJID 3VMPA 2X5PA 4CMHC 3HE6A 5HGDB 3TCLB 1UM4L 3VXSD 3I6LE 3GSNL 1AGDB 1RK0A 4HBCH 1A2YB 5FA4B 1JN6B 2R15A 2VZ3A 3Q6FB 3DBXB 3MLSH 4XCYA 4M1CD 4NHUA 3MLVH 4R96A 3MRLB 2R39A 4I13B 4QHUA 1NFIB 5EORH 3MYJB 4TUKH 3BP4B 4GRLD 4DCQA 1JGVH 1F6AB 2VRAA 2NZ9C 3SDYH 2IH1A 3VFUB 2DQIH 4HCRH 3HG1A 3D6GA 4QRTA 2SEBA 1JF6A 4DWHA 2V9QA 1GGBL 5I16A 3EYVB 1YEJH 4OD3L 3WJLA 2GSIB 4X0KB 4OFIA 5ACMA 5ICXA 1N7MH 5E7FA 3JV0A 1H3WM 4K3DH 4NSKA 1MHHA 1HKFA 4LSPH 3GMNA 2NR6D 2R0KL 4YHIA 4KRPC 4JPIA 1EGJL 1QA9A 2V2TA 2OR9L 1DBJH 3O3DA 3R0NA 1JWSB 1B0WA 2ARJA 4KDTA 3B8YA 3WJLC 1YY8A 5DS8B 2VQUA 4AIZA 5DK0B 4QWWD 2A9NL 4XNQA 1HSBB 4U3HA 5FO9A 2HFEA 4LIQL 1DLHA 3BUYB 5FFLA 5HY9B 1P6FA 4LGPB 4P9HC 4PRHE 1EVTC 4Y0GA 3RL1A 4Y19E 1ZTXL 3HE6B 2ZUTA 5DJCB 2GKIA 1EZVY 4KDTC 2JLLA 1ZHBB 1JP5A 4HLZH 3JBG7 3MRIB 3ULUD 3MRDA 2CXGA 3VJ6B 5ID1B 5EU6D 2RBLA 3REVA 3GSWB 1WWCA 4HH9B 3S37L 2CK0H 5GS0H 2PXYB 4NQVA 3CVHH 3BMWA 4YXLH 1UWXH 2ADIB 4DCQB 1G7QB 3I6KB 1WCBA 2ERJC 2P5EE 3TNNB 4MX7A 5FA3A 1PJ9A 4F7PA 5E2WH 1EA9C 2VXUH 4WI9A 5AG9A 4JO4L 2A83B 3BESR 1T1WB 1NGXB 4XWGH 1TQCC 4OLZH 1UH2A 2ESVD 4LP4A 5ICXB 1MRDL 4XAWL 4S0TD 5J0BA 3S88L 4G9FB 1Q9KA 3DNKA 2X4NA 3BFOA 4BYHA 3P77B 2FNBA 4RCAA 3QEQE 1NDGA 1ZLWK 1AQDA 4R4NC 1FYHB 2FX9L 1E6JL 1TZHA 3D3VB 3T1FA 4ZAKB 4ZFGL 4PJAB 5FECA 3WIHA 4L4TA 5E99L 1YY8B 1YA5A 4ELMF 2ADFL 2EEDA 2VXSL 2CO7B 1G0DA 3L3KB 5KG9A 2IH3A 3QO1B 3S4SG 3DX6A 2DQHH 3OJDB 1AGCA 4XMPH 5CD5D 3IRPX 4XI5C 4LASH 4Q9QL 3DGGA 1KJ2B 4J12A 12E8H 1BZ7A 1NGWB 1I9JL 4QXUH 1FRGH 2DQFB 5CBEA 2ZCHL 3MNWB 4JRYB 1H3TA 1FNSL 1UWGH 4MNQB 5IW6A 5C09D 2OZ4L 5C0BA 2VQTA 1LEKB 1T4KB 2EDBA 5EIIB 3HZKA 3EOYG 4P2OA 4JFXB 1B9ZA 1HINL 3RRQA 3S35H 1K6QL 1BX2A 5AAWA 2YXFA 3ARGC 5JO5B 1AGBB 3FQTB 3I75B 3AXLB 1RSFA 1QHOA 4R2GB 1WCBB 2QLVB 2VYRE 5IHLB 2PTTB 3QFJA 3S3PA 3RBGA 4LPUA 4MX7B 1NL0L 1KTLA 1U8MB 4F7PB 5HSFA 2Q76A 2QEJA 4NOBA 3KWWA 3MV7D 3C09B 3HI5H 3QWOB 1X7QA 3IAPA 2FR4A 1LO3L 4P2OC 3KPSE 3ZE2F 4U1IA 1U8QA 5JUEL 4RAUB 3WNMA 3TBWB 5CZXD 3CXHJ 3HC3H 1EH9A 2WUCL 1I4FA 1ZLUH 1AQDB 4G6JH 5IHZA 1N6QL 2MKWA 1J18A 1AKJD 1TXKA 1SEBB 1URLA 1Z5LB 1ORSA 3BZDA 2AJXH 1MFBL 3CIQA 5SV4A 4G80A 4YE4H 4IMKA 1MHPH 4TRPH 1Q9LA 1ACYH 5IB5B 1OL0A 2FATL 2ZOLB 4DZ8A 3I2CL 5SWSA 5EU3A 1TTUA 32C2A 3DGGB 3CFDB 4BSWB 5D1XB 1CWVA 2MHAB 5IESL 2NX5A 3UROR 2A6JB 2QHRL 4IMKC 3QFDA 4HXAH 1BZQK 1KB5B 3O4LA 3T3ME 2NMSA 5D72L 1CFBA 1JHLL 1S5HB 4NO3A 4R9HA 4FNLH 5JZ7C 2X40A 1G1CA 2XA8L 1P5VA 2VAJA 3UTTE 1RPQA 1T3FA 4KXZH 5GRYA 3T8XB 3L7FA 5KVFH 4GXUN 1QSFE 5MI0C 5C07D 3T04D 2R9HC 3OF6A 3MBXL 1LK2A 4PB0L 3HC0A 4QRRB 4P99A 5E4IA 4OFVA 2WBJB 3KXFB 4JY5H 5J11C 4I3RL 2HT3C 5C0ND 2OYPA 1ZANH 2A6IA 3ZO0A 1RK1A 4PRBA 3ZHDA 2DD8H 4N0FA 4PJGE 4AEHL 2IC2A 5H2BB 3C6LD 4AENB 1DDHB 2BSTB 1J1XH 4Z7OE 3NFNA 1U9KA 1Q9LB 5D4QA 5DLML 5KSAA 2FGZA 2YRPA 3U48A 4DVRH 1G6RA 2GAZA 1UFUA 2IAMA 3RZCB 1ZLUK 1SJHB 3S36H 3BAEH 32C2B 3QUKA 3VD5A 2UYLA 4EOWL 4ZXBA 2ICWJ 4TUJB 3JVGC 2NNAA 4N8CL 2IANA 3ROLB 2QADD 4HF5L 1P69B 4ZUVB 5IV2B 5I1LB 3O4LB 3L9RB 5KVGL 3N0PB 5LWYH 5DRWA 1QUNA 4X5LA 1JPSL 2IAMC 2VDML 2Q6WB 4PY7B 5MEND 5FCUH 3C5ZA 1N4XL 4ZPTA 3W0WB 4PRPD 4DKAA 3QDHA 4DFIA 2J8HA 1TVHB 1A3RL 4YIQB 1MFCL 1OHQA 4H25A 3MRCA 5F7EH 3MO1A 1FLRH 2E9IA 1IRAY 1Z9SA 3WO4C 3H7BB 2C9AA 4L4VD 1X5JA 4XH2A 5A3IC 4MA1B 1C5DA 3LKPA 5J6HA 2XT1B 3C5ZC 1TJHL 4Y1AD 1S7UA 4GBXA 2MPAH 4JKLA 1LP9B 3C08L 3CVHB 2EDYA 4Y5XB 1Y6NR 2GK0B 1CDIA 1GJIA 4QRPA 1WGOA 3GGWA 4Q6IA 3NACH 1IEHA 1JPFA 5GGUB 2VO5A 2CDFB 1IGIH 2EDWA 1IFHH 2F15A 3ARFA 5I1DA 3BDXA 4AEIH 4X6CA 1MQKH 3CXDL 1BVLB 1U8LA 4GBXC 1BQSA 5F6HJ 2ADGB 4NQSB 1JNNH 4L3ED 1T7YA 4JRXA 2R2CA 4ZXBB 3UEZA 3E8UH 4Q6IC 2HJFB 3MA7B 3PWPE 4OAWA 5EBWB 5JW3H 3QJFB 2YPKB 1GGCH 3KLDA 1X5IA 1R3JA 4PJEA 3ARFC 4HUXB 4PV8B 1UXWA 1ZVYA 4BQ8A 4U3CA 1PLGH 4QHNB 4WY7H 4XXCA 3JWOC 5C0AD 4E5XA 3EIFA 4OZIA 3DUUA 1W0VA 3KYNA 5L2JA 3QDGA 3WV0A 3C5SB 5DVOA 5DO2D 1FFQA 3SO3B 4CJ1A 4KVCL 8CGTA 5ISZD 3HAEG 5SWZB 1KPRA 2P24A 3MO1B 4WI5A 3QULA 4APQA 4I2XE 4AMKH 4XXCC 5D8JH 5J6HB 1MREL 2Q86B 2DICA 3LRSA 4FFVC 4L8BA 1GZPB 3RTQD 4KAQL 3QAZB 5JMRA 5JPMA 1LE9B 1ZHKA 4Y2OA 1GRWA 1HXYB 4XCFH 5FYLE 2JK5A 4RAHA 1S9WB 5IEHA 3D0VB 1FFOB 2R29H 4HIEA 5TQ0L 1A7RH 2FECI 2K1MA 1BVZA 1RUQL 3DX7B 4LOUD 3C8KA 4BFGA 4LAQH 4APQC 4WWKD 4UUJA 1MJ8L 2VIRA 4N5EC 2MNUA 4EQ3A 2A6DB 5IQ9A 3U4BL 5K9OA 1JRHL 1UB6B 3LQMA 4NZDA 2IPUG 5AUMB 1E28B 1H0DB 4PJFE 5D93B 2V5RA 1HQRB 1LE5A 3VRLF 3WFDL 5HVHB 3Q6GH 1W0WB 2J5LC 1R3LB 1UM6L 4WUUE 4OGAD 3N85L 1A8JH 3ZDZF 2JE8A 4GW5B 4FZEL 1D5IL 3ZKSD 3RFZC 3EO9L 3V6ZA 1W0VB 1UCTA 5C3LD 3ME0A 1PZ5A 4QTIH 5FYJU 2ZG3A 4PRAA 1RULH 2XWTA 2O5YH 3SDCA 2OP4H 2R2EB 1IC4L 2PUQT 1RIHL 2YD4A 5J9PA 2W0FA 4ZSOA 4UZGA 4ZQKA 3EO0A 4PIRF 3VD3A 3ET9F 3MRKA 1ZHKB 1XH3B 1FL5B 5IGXL 5D71H 4KZEL 4KZDH 4Z0XA 4ZUUA 2OI9C 4JFEB 3QPXH 4RMUA 5EO0B 3IAGC 3E0GA 1HHJB 3QIUB 2ZUUA 4P48A 5HGAB 1QRKA 3C5JA 5EZIL 4XBEH 4F7CA 5CJQL 2PYED 4YPGA 4YDJA 1LE5B 4X6BA 4FOMA 25C8H 5D1QD 5HYFA 1CL7H 1J8HD 1DUZA 5DMKA 1P4LA 4WJ5A 1QBMH 4ZTOH 3ZE0F 1YUHB 5GRUL 5E70A 3P9LB 1KLGA 1GOGA 1QFPA 2X1XR 4UDTA 3UO1H 2EDJA 2HKFH 3SQBA 3VDAA 4YX2H 4OT1L 4NKMB 3NFSH 3WO3B 4WUKL 1Y18B 4FZ8H 1UKQA 5IB1B 2FGWL 5DJYA 4NWUH 1NMBL 5B39A 2BMKA 1T21A 4DGIH 4JPKL 4LSRH 3P9WB 4FQXA 4G8FB 2DMCA 3SKOA 3KPOA 3RX5A 1CGTA 1AXIB 1U2CA 3OHXA 3DHJA 4UNTA 4ZUUB 3SJVB 1L0YA 1BFSA 5MEPB 2XYCA 4OLVL 4WHCA 5ALCH 3DMMD 3NOIA 3BE1H 3O3AA 4HWBH 4WI4A 1TETL 1A9BA 4OCYH 4OTXL 5CMAB 1R3KA 2IQ9L 5E94A 1NBZA 4QXGH 3EDFA 4Y19A 1JYVA 4YGVA 4YPGB 2F53E 1RV6X 2NY3B 1HH6B 4NKQB 5EBMB 2AK4D 5EIVA 1G9MH 2XZAH 3HMWH 5FM5M 3VXRD 1G7MA 1I3VA 3KYAA 3VXQB 4Q0XL 2GFBA 4MXWL 2Y06H 4NN6B 3ARYA 3X17A 3K8KA 3FO0L 4JREC 1WZLA 5HYSG 5KZCB 1WITA 1F5WA 1FO0L 3WYRA 4IRJC 2ED9A 1U91A 2FECL 5CZKA 3KDMA 4EJ1C 4ZFOB 1QACA 1Q8MA 2Y6SC 1RZ8A 2NXYD 4F37F 4QNPE 3BZEB 1E4WL 4CUCA 4ZFZB 1I3UA 5IVNA 1C8PA 4N0UE 1F6LL 3REWB 1JUFA 3ARDB 2XN9D 5E6ID 2J3SA 3SE8H 1NFDF 4DKEH 5F21B 4FQXB 4X7EC 5T3ZD 3V5DB 2ATPB 5DZLA 1WCQA 4BSVB 4EDXB 4W4OA 4CVXA 2BVPB 3QPQC 2PCPA 1H3XA 3DV6A 4KV5E 5FYKD 1FN4A 5DUPH 3QCUL 4D9RD 4HK3J 1OOAA 4ZD3L 2EIEA 2OTWB 5J6GB 2MFNA 4PRHB 1S7RA 1Q1JL 1DN0B 1SEQH 4LKCA 4U6YB 5E5MA 1E4XH 1MLBA 2EH8L 4AIOA 5C3TA 5CGYD 1GGTA 1CQKA 4W4OC 3W5MA 1VFUA 4BZ1H 1REIA 2DM3A 4PJBF 5IMLA 3QQ4A 1MQ8A 3QUZA 3RWHA 5IBTH 5HGBA 1J12A 1G7MB 2YUXA 3EDJA 5D1ZB 5FUZL 3LQAC 1E27A 3FOLA 4MAYD 4OI9A 4N1HB 4FXGA 2YKLL 4AK1A 2RR3A 3OGCA 2H9GB 2P5EB 1YEFL 3PWNB 5GZOC 4M4RA 2VXTH 3FRPG 1EFXA 3FQWA 3O11B 5DEGB 3V4PL 4XGZA 4PJ9A 4KQ4L 4NO2B 4KHXL 5TPWL 3LVEA 4XAKD 2B39A 5GISH 2AK1L 5L2KB 3HN3A 4JFDA 5DHYA 5EIQA 3QEQB 4PS4L 1KYOJ 2MQ3A 2QSTA 3J8F7 2FB4H 2FEDC 1JHKH 1A6VL 5GGSA 2ZOKB 5KSBF 4P2RA 4G9DB 4AG4H 1T5WA 3ESVF 3CUPB 4KJWD 4UINL 1H15B 3LKOB 2AXGA 3DGCR 4K3EH 5CAYB 1N5AB 1QRND 1VERA 3OKLA 4PRDA 5JOFB 4AT6A 1TMCB 4LHUD 2DTMH 1Q0YH 3UTQB 4LVHB 1G7PB 4JR9H 2RFXA 1PD6A 2EICA 2X44D 4QRSA 4ODXA 4ODVH 3VWJD 2HG5A 1EERB 3IYLW 4LNRA 4WHYH 2DOCA 3QQ4B 3BPLB 3QUZB 5HYIA 2XA3A 4MCZA 4IJ3C 5AYUL 3HRZB 2ZJSH 3BSZH 4LLYA 3LMJH 4DUWA 1SY6A 1D5XB 4P2QD 3QYCA 3IKKA 5DFWH 5C0DB 1BIIB 4HWBA 5I8OH 5IEKA 3PHQA 4RX4A 1VFBB 3LKSA 5D70H 4FTVE 5IHUL 2K7QA 1FZMA 1G1YA 5T3ZL 1OARL 4NZUH 5F3HB 4U33A 3KPSB 3EHBD 4G3YH 1DEEA 5FYKL 4X6EB 3FO2A 4WIQA 4QXTA 2VH5H 1OTTC 1JFQH 1EXUB 2XV6B 4HQQL 1WBYA 1X5AA 3CH1A 5EZOL 3VFSA 4PY8J 1FNAA 1AY1L 1MI5D 4JB9L 3DPBA 3T2QA 4K94H 1D5ZA 4DN4L 5IB3A 3VXOB 3KPRE 2NQCA 2X4RA 4YHYC 3GHEL 1BM3L 4F8TA 2Q8AL 4GXVL 1A4JB 4LVOC 1SVCP 1IM9D 3A67H 2VDOH 4GKNA 1VADB 1C5BL 4LIQE 4X6DE 1RJCA 3CLFL 5CGMA 3H0TB 3HI1B 3TT1H 1N6VA 4XP9H 4KDVA 4GSDL 3EYOA 3PP3H 2G9HB 5CEYB 3VD9A 1F2XK 3WFHB 1TENA 5CEXA 1IT9H 4RDQG 5D2LF 2Z4QB 4TULL 4WGVB 4RAVA 2XWJB 1NAMH 1AI1L 5GGQH 5DZOA 3UYRH 1WV7T 5A1AA 3VCLA 3L5XH 5GGRA 3TJEL 1RUKH 2XZCH 3WHXB 4I77L 4I0CC 5I1IH 3H3PH 3P4MA 1OGAD 1YNTB 2NW2A 1RIVH 4N8VG 3PQYD 3UTTB 2VLLA 3PGFH 4MJ5B 4P23B 5JPNB 3BO8B 3LKSB 3IDJA 5BQ7A 1QSFB 4K7PX 1FZMB 3L3JB 3VFPA 4F58L 4MZ3A 4RQQB 2MSPA 2G5BB 1OSPL 4G6FD 4PP2B 4HS8H 1XGPA 3G5VA 3FO2B 5TH2B 4ENED 4NBZB 5HHXL 3U4AA 3MROA 2HA1A 2XWBA 3EAKA 3JZ7A 4XB8A 3S97C 1WBYB 4EQ2A 3KYOA 3AS0A 1GAFH 4X80H 2P5WD 3ZKMC 3G9AB 1S8DB 4JQIH 1NANI 4PJGB 4DAGH 3ULVF 2OTUB 5GGTL 2HVJB 4LCCB 4QO1A 5DQJA 4MJIE 1X5HA 1WBXB 4Z95H 3ZLQC 2OQJB 3IFOB 2LVEA 4ZPVA 3E6FB 3VXSE 3BWAB 4BKLB 3DTXA 4X4MA 5F7MC 4M7JH 4BH7A 3BT2L 2ARJQ 3AB0B 3PWPA 3B2VL 3BRFA 4BFEA 1P4BH 3B2UC 3O6MH 3W5NA 3SKJL 4KC3B 1WVZA 4KK9D 1UA6L 2J2ZA 1J05B 1C7TA 2ZPKH 4GW1B 5DMIH 3UBXG 1P7QD 4G42B 4QOKD 5E2UL 4WU5A 5FGRA 2HRPH 3MLYH 4HKBA 4TTDC 2FIKB 4CADA 2BDNH 3PP3K 5LKNA 3DVNA 2IFFL 2VLLB 3P11L 4YDKL 1D5MA 3VFPB 1U93B 4L9DA 1G7IB 3BPCB 5T1LA 3Q2CA 3U79A 3WN5C 4RNRA 4I2XA 1JI2A 1QLFA 4TNVK 2E8YA 1R5IA 4NKIH 4HHAB 3NIGE 2WUBH 3SDDA 4G6KH 1XGQA 1CFVH 4KGJA 3IU3A 4YBHA 1BAFL 3MV9A 5H8DA 2ZKHL 4MMZC 1T7XA 5M7QA 1B6UA 5KS9E 5M95B 2ARWA 4N68A 5IP4A 2XZZA 4PJIB 4U1KA 1NLDL 3GMMB 4LVEA 1D9KD 1NDMA 3TP4A 1MJ7L 5E6YA 4XTRD 1FIGL 3D9AL 1EHLL 15C8H 2FYYB 1OM3H 3ULUE 1RU9H 5EO1B 2JJVA 4PJFA 5EU6E 2FHCA 3BOVA 1T1ZA 5I1GL 3LB6D 2VDNL 1J0JA 6FABL 2VWEE 4UTBL 1U42A 3Q1SH 2YC1A 5EC1A 1P5UA 2HT2C 4JFHD 3GIVA 1ZE3C 5EOTA 3GSRB 3TWCL 3ZTJH 1UJ3A 3EFDL 3DROA 5FDWB 1U3HB 4ZTPH 3MRRA 3U7AA 1PYWA 4LPTA 2W9LA 4PLKC 2ESVE 4N5UA 4JO2L 1S9XA 2VXVH 1FAIL 5JDSA 2R4RH 1BBJA 4K94C 1JCKA 3CMOH 4YH6A 4KKAC 4YHLH 1UJ3C 2GQHA 5AAMA 3HKFA 3VFRB 1X5GA 1FSKB 1CQYA 4I8DA 3RKDD 5F3BB 4YHNB 4NBXB 4PJXE 1IC1A 1MLCA 5DD3H 1NAMA 1KPVB 3SDDB 4OLUH 4WTZG 3KLAB 3VFNA 2C26A 3PXHA 1MCSA 2M26A 3MA9L 1FGVH 3TO4A 1AR1D 1KCSH 1EMTH 2X70B 4OD2A 5IR1B 2DYPD 5C0IB 2VE6A 3K1DA 1K8IB 4G8GD 4XPAH 4GUPA 1BEYH 4X4YA 2OL3H 1HZHL 3H42H 1P84J 3X13B 1BJ1H 3WFBL 2A2QT 4WI7A 4XHJD 1M7IB 2D31A 4M9OA 4PJFB 5C09E 1T1ZB 2DL9A 2DAVA 4UQ2A 3KYKL 1BD2D 3BGFB 3GI8H 5I75B 4ONOA 5IW1A 4ISVB 1JHTB 3OX8A 4HIXH 1EEYA 2NXZC 3D69B 4XP5L 1KBGL 1FZJB 3O6FA 2X4TA 1T0NA 1HOCB 3Q5TA 3V8CA 5DD1H 4WUUB 3DROB 3WKML 1EO8H 3UXFA 5E56A 2J1KA 5IMKB 1RUAL 5DD0H 3MV7E 4NJ9H 3WD5L 4Z7NE 1UZ8B 3MRNB 3IXAA 5EOQH 1FNEB 2NY6C 2XPGA 2EDFA 4FP8H 4TN9A 4AEFA 1BIHA 3NGBC 1RVFL 2IPUK 3A0OA 2YPLE 1QBLH 4BK5A 2Z31D 1U8NB 4EDWH 43C9A 3RL2B 3A6BH 3TIDA 4HT1L 1KCUL 3ZDXE 3EGSA 1KTDA 5DT1H 1NAMB 1PKQB 4OZGE 3PP4L 2IFGA 1T1YA 1JNLL 1ORQA 5HHVL 1VFAB 3W82A 3L6FB 1UM4H 4IOSD 4LCUB 3GSNH 3DURA 3S7GA 2X4QA 3MFFA 4JFFB 1OB1B 4FABL 2W9EL 1I9RL 3CFIC 2CLRB 2H26B 1TIUA 4J4PA 3SDXF 3TZVB 4PGDA 4GUPB 2OJZL 4H26B 2R0LL 5DXWA 3CJJA 1FJ1A 1PG7W 3TPUA 2NW3B 5I76A 5EPMB 4XNUL 1YPZA 1RZGA 2F53A 2VQ1B 3HAEA 2R8SL 5D7IA 1GGBH 4MXVE 4OD3H 3CFJA 2FL5A 5GHWL 1ZWIA 4J4PC 5B21A 3O6FB 2BVQB 1MUJA 1FG2B 2X4TB 3ULVD 2X89D 1K2DA 3TC9A 3IKCA 3IJSB 5BZWB 1QNZL 2DI8A 4ODUB 2ADJA 2X4SB 3KPTA 4MJ6B 5I17A 3JXAA 2C4FU 5EUKA 5C07E 4P5KB 2Z8RA 1EGJH 5JIKA 2FJFB 2OR9H 4L9LA 4NQEB 4F7MB 5FHAL 4Y16B 2PO6D 5J13C 3HE7C 5FK9B 1OTSD 3X3FL 3VWKB 3SKMA 4OFDA 3L3HA 4K2UL 4M8VA 2A9NH 4LIQH 4N0UA 1HCFX 4NRYB 5BVPL 5K9QG 1KFAL 5JXEA 4Y4FD 5DFVD 3RUGF 1ZTXH 5HYJB 2XY2A 1LDPL 3VG0L 4Z76A 1LD9A 1T2QL 2MCPL 3FB6B 3BQUB 1S7TA 2R1XA 3G5YB 3VI3F 3S37H 3V7MA 4H8WC 5DTFA 1VEMA 5JXEC 1QPPA 3KPQA 4KTYA 3TPUB 3U9UA 7FABL 4I5BB 2Q3AA 3BIKA 3UPRB 2F53B 4WFGD 1JNHA 4JO4H 2BCKA 5MENE 1CFTB 4RZCB 2E7MA 4XZUA 2UWEB 4GRMA 2VUYA 3QCTL 3OXRB 4O00A 3ELAT 3BN9D 3X12B 3AUVA 3HC4L 3O0RL 4PRPE 1MRDH 4XAWH 3LHPL 2OJEA 3S88H 1RJYA 4Y8DC 4V1DA 2OL3A 1MNUL 5JLZA 4YBLB 4L4VE 2FX9H 2OS7A 5JORA 1A9EA 1E6JH 5C71A 4ZFGH 4Z78B 2F5BH 3BP7A 5E99H 3AY4A 4Y1AE 3V2AR 1SYVA 5IBLD 4NRXB 2ADFH 4AL8L 2VXSH 3BW9B 4LGRB 3RWGA 2A74A 1IEAA 2Q7NA 1IKNA 3C9NB 1FE8L 4O2CA 2IPKA 1WEJL 1CU4L 3TLRA 3GSOB 5C0RL 1PY9A 4Q9QH 3MUGB 4XC3L 3VU2A 2E7BA 3F7YA 4F15C 3JV6B 2J6EA 2PW1A 3GBNH 3ZKND 1I9JH 1YY9D 3VXMD 1FNSH 5E9DB 5DDHA 4R4BB 4BZYA 2OZ4H 4L3EE 1MY7A 1BBDL 1NC2A 2E9WA 1HINH 4MD0A 1K6QH 3AS2A 1F00I 4XMKL 4GMTL 5DQ9A 3G04B 3ULVL 1NLBL 2GITB 3UTSA 3QRGL 2GK2A 3OXSB 2DKSA 3RVTC 4EXKA 1NL0H 2DJSA 1NEZG 3BGMB 4ELME 1RJLA 5HDBF 5D2NB 2BRQA 5C0AE 4C56B 3O8XB 1LO3H 4J3SA 2NZ9D 2C7UA 3U83A 5JUEH 1I85C 3MRMA 3SGEI 1DUYB 1YNLL 4JO1L 1JI1A 2YEZA 2WUCH 3R06A 1XIWB 5ISZE 4WHTA 1OQOA 4MB5A 1N6QH 1T7WA 3GUTA 5C9KA 1CXEA 4UI2A 3HNSH 1MFBH 1KCRL 4PJHF 3QUYA 4Z7VF 1L0XA 2BSRB 2IALA 1CI5A 1P53A 5DD6A 1M6OB 2NY4B 2KH2B 1P9MA 3HG1D 3AM8C 1H8NA 4PR5B 3D85A 4KRPD 1SMOA 3RBSA 4ODSL 2FATH 5F9WC 3I2CH 4OF6A 5TE4H 3RHWF 4O2CB 5KVMC 4JQVA 4ZOEA 2KZ1B 4Z18A 2EYTB 1QR1A 1CE1L 3RI5F 4M61B 4ZS7L 3QI9B 1I3RA 4E41D 3VFVA 1KXTB 5IESH 1MHCA 3KPRA 3ZE2E 2QHRH 1I1YB 2VLKB 3EUUA 3BD5A 1NAKL 1CYGA 4K7FB 5EU7C 2C3VA 1P9MC 3LZFL 2BNRD 4DK6A 4O9HH 4DQOL 2NY1D 2B7DT 1EHAA 4JQVC 5D72H 4NFCA 5HYSA 1JHLH 5ID0B 2YBRB 4X6DA 3B9KB 2XA8H 5HHQB 1ZGLP 3O45A 4MA1C 4YNYB 3VGEA 4YK4B 4MQXC 3ZYJA 4LU5L 1CXKA 5TQ2L 1PBYA 3FB7A 4JPVL 4OD1L 4U1NB 5F72S 3QQ3B 2OLDA 4OZHF 4MNGE 4PGCA 3CFCL 3GSNB 2HFFA 5I66B 5ICZA 4XPBL 3MBXH 4P3DB 4Y5XC 5KVEL 1J5OL 1VGKA 4PB0H 2FZ3A 4LCWB 5JQHC 4I3RH 4KK8C 2CDGA 3MXVH 4ZUSB 3GMPA 5ESAA 5L88L 2VJXA 4HGWA 4L3CB 5IM7B 1DBML 4FTVB 1WBZB 2AJYL 4PJ8B 5C92A 2HMIC 4AEHH 3G5ZA 3QUYB 9CGTA 2FHFA 4IOIA 4F9LA 3S9DB 5DLMH 2XKUA 4ZG1A 1HILA 2NY5L 5CIPA 2LAGB 4R4ND 5TE6L 4JN2A 3FB8B 2CLZB 1NC4D 1CVRA 4K8RD 4YGAB 3VA2C 2M1KA 3FOMA 4EOWH 4LLVA 1FVCA 3FO9B 4OZ4A 3SCMB 4N8CH 5DD5L 1L6ZA 3GHBL 4GKSB 1MHCB 3D0LA 3KPRB 2VLMD 4MJIA 4XI5D 2PYEE 1JTPA 1G0XA 3FT4A 3IF1B 5KVGH 3VXSA 1AE6L 3SO3C 1JPSH 2VDMH 4PJEF 3VMOA 3L3DA 5CSBA 5F1KC 3D25B 4L4TD 1J8HE 3HPLB 1N4XH 5GQBA 3STZA 3MLXL 3ZMRA 1XF2B 1A3RH 1MFCH 4TNWF 3IFLL 4P3WA 3TPKA 5TDPB 4EI6B 4MD5A 1LO5B 3ARGD 1PQZB 4X6FA 5I1KL 1KULA 4LSDA 3U4EA 1SJEA 1FV1B 1TJHH 5DRZB 1HDMB 4M1CC 1XGRA 1YZZA 4L8DA 3IDNA 1B4RA 5ESAB 3EYSH 3UDWA 5DJ6B 1K5NA 1R3HA 4P2OD 2OCFD 2BP3A 3MGOA 2V6HA 4HJGB 1TPXB 3QO0A 4P9HL 1BFOA 4XRCB 3CXDH 1ZHLB 2VLJA 5B3JF 3UDWC 1VGEL 5JR1L 1H5BA 3MLZL 4YAQA 1IGYA 1IGMH 3QUXB 4IIQB 4LLVB 3QJHB 3TBSB 4PGEA 2CDEB 4HUVB 3IDMA 3UJIL 3OL2A 4I4WA 4LLWB 4K7PL 5FAAA 3U0TA 5KS9A 4MJIB 2G5RA 2F5AL 4LAJH 5BJTB 1GGYA 3S98A 3QUMH 4JO3H 1CVSC 3OG4B 1KLUA 2AK4E 3C8DA 2CPCA 5K59F 4I0KA 4IDJL 1H5BC 3VXRE 5EU6A 1U3YA 5KBNC 2A9ML 1JPST 3WEXB 4KVCH 1CFQB 3OAZK 4Z7WB 1KSRA 4GRLB 2FDBP 4R3SA 5JZ7D 2Q3ZA 2V9TA 4Y4KB 5F7KC 5CSGA 1YJDC 1XT5A 2I9TB 1QLEL 5F93C 1MREH 3ULUC 3CDFA 5D5MF 4KAQH 3LKQA 4L8DB 5I8EA 4LCYB 2VWEC 1RURL 1R3HB 4LBEB 2DQDL 1CD1B 5TQ0H 3RPIA 5E8OA 3GSUA 3MGOB 4KWUA 1RUQH 3AS1A 2HT3D 4GKZA 4U1MB 1QP1A 5T3ZE 3TT3L 4Y4HC 4QCIB 1PSKL 4PJXA 1RJZB 3N1QC 4LPVA 4C59B 3U4BH 1JRHH 3SQOL 1XAUA 5FYKE 5K9KB 5F7LB 3UZQA 4D9RE 3QSKB 4RRPA 4N0CD 4LSSL 2D0GA 3HZVB 5J1AB 5J3HD 3RWDB 4POUB 1CTOA 3EJJX 1I7UA 3WFDH 4HGMA 5MEOA 3L5WA 3QEHA 1UM6H 1YDPB 3N85H 3PGDA 3QIBB 2HJLA 4N8VA 3M17B 4FZEH 1D5IH 3M8OL 3EO9H 3FQXB 4L8CA 4JZNA 5DHVH 1V5JA 5B8CB 1XZ0A 3OR6A 1ZT7B 2PR4L 3HZYB 3WL9B 1IC4H 2AEQL 1RIHH 4ZOBA 4LRNL 3L3OB 3VH8B 4XCEB 3DYOA 2O5ZL 2W91A 4HZLA 1SBBA 2IQAB 4R4FL 2IAND 2Q7YB 1MCQA 4BFIA 5HDQL 4L29A 3OKMB 3MV7A 4A6YA 2P7TA 3VRLE 1QO3B 1XCTB 3G6JF 2CMRL 2ESVB 3BP6A 4XAKE 2CUHA 3TA3C 5A3ID 5IGXH 4KZEH 4ZDHB 5C0JB 4NNYA 1YMHB 5C0EA 1FQ9C 3L5IA 4UIMA 3P9MB 3W9EB 5JHDD 3MUHL 3M1BA 4FQHA 3ZDZE 1AKJA 4PJXB 5A2KH 1QLRB 4OZGA 1XR8B 5EZIH 2AQ2A 4NO0A 5LBSL 5CJQH 2YA2A 3JV4B 4HG4K 4PG2A 3QBTB 4UV4L 3MLTB 5CZXC 2QV2A 5IG7B 4JDVB 1ONQB 1QRNE 1IAIH 1M1SA 2X4OB 2P45B 1A3LL 4GBXD 4C54A 3UBXA 5LAXA 5ENWB 4MB4A 3O41B 3MTRA 3FB5A 3MYZA 5GRUH 1UH3A 3K8LA 5EU5B 3WFCL 5ICYB 3QT2A 5F7WC 2HLAA 2VDQL 4QRPD 3QR2A 1YQVL 2HJLB 4CL7A 4PG2C 4Z77B 8FABA 1Z0MA 5C09B 1D5BB 1G7JB 4JCMA 4OT1H 4J3TA 4JRWA 1KT2B 4WUKH 4P2QE 2ITDA 2VN4A 1ZSDA 3TO2A 1R5WB 1ERNA 2FGWH 5DQDH 3MACL 1NMBH 3L3GA 2AXFA 5T1KD 4X83A 4JPKH 3QUMA 3MGTB 5C07A 1NJ9A 3S3SA 3MRQA 4IOFD 5D6CA 4HS6A 4EI5B 5J57B 1OP5H 1HHIB 2H2SD 3ZE0E 4FFVD 3DLQR 4OLVH 2YPLB 4TVSa 1MI5E 3TNMA 2CK0L 2DKMA 2X10A 4LKXB 5J12C 3WIFA 3RNQB 1TETH 4XP4H 2P47B 4OTXH 3GIZL 2IQ9H 1GZQA 5J7CC 1HXMB 5D1ZC 1N3NB 2W65B 1IL1B 2FO1A 3NN8A 2KQNA 4Q9BA 1A1MA 4GOSA 3FCTB 3K3QA 4QKXB 1AGEB 1RZKC 2VZTA 2J8UF 4O02L 3PWVA 1G6RL 4Q0XH 1Q72L 2VLRB 1UYWL 4H0HB 2CLVB 4MXWH 3C2SA 5FF6B 3Q3GA 4TPRH 3OGOE 4HUUA 3CC5B 4M02A 4AH2A 4XWOC 1TNNA 1QG3A 4Q9CA 1FO0H 1K8DA 3I3DA 2E27L 2BY0A 3VRJB 4BA8A 1ITBB 1U8JA 4M8QB 2GCYB 5MENA 2Y07L 4ORGB 1LEIB 1E4WH 2Z8WC 3PE9A 3VGBA 2BOBA 3SGDI 1OGAE 4PRPA 1AFVL 4RBPK 4D8PA 4NN5B 3K4DA 3PQYE 5FM5O 3IDGB 2QADC 4MA3B 2QHLA 5LCVL 4DN3L 4WI3A 3KHOA 5ELIA 2AJSH 1PG7X 1NJ9B 2FO4A 4L4VA 4QGTA 2ZCKL 3FQUB 12E8L 1VACB 1N2RA 1QTYT 3ULSB 1X44A 5A2IH 4XVTL 5T1DL 2WLYA 3MLUL 3ROOB 3U0WL 5HI4C 3QCUH 1CD0A 2X4PB 5IMOA 4ZD3H 5ESVA 2DTSA 3TNMB 5FCSH 1Q1JH 3V6OA 5HI5C 2EH8H 3C6LB 4H1LB 5C08D 5F7DA 2JCCA 1S3KL 1J10A 4ETQB 3ZHKA 3RY5A 3NN8B 4UDUA 1JPTL 2JKXA 1OP5K 4EUPB 3MLWL 3FFDA 3LIZL 4L5FL 3IDIB 1MJJA 2BNUA 4XC1L 4UQ3A 4L3EA 5B4MC 5FUZH 4YPJA 1KN2L 3LY6A 1FCGA 1LEGB 5CSZA 3V6OC 3JWOL 4GAYB 3WHE0 2X6MA 1NFDE 3HUJF 3I6GB 2YKLH 4G8IB 1F8TL 1EO7A 4RGMB 1NBYA 2E8ZA 1IGJB 1YEFH 3NCBB 1KIRB 4BQ9A 4YQXL 1F4WH 4QOKE 2FCBA 1G9NC 3BZ4A 3V4PH 1EZVX 4HW6A 3CFKA 1Q94A 4ELKA 4HS3B 4KQ4H 3S96A 4KHXH 5ACLA 5HHPA 5TPWH 2QR0A 1QFWL 5CJOL 4QRQB 1NMCB 2AK1H 3T0AA 3FFCA 5ISZA 3FQRA 4PS4H 5D6DA 3U9PL 2VKWA 3S34L 2R2BA 5EWIL 4K7PY 1JTOA 4OCLC 5I6XB 4PJBE 1A6VH 4Z5RB 3BP5B 4Y1AB 1QVOB 3FT3A 5DHVB 4LPCA 1AHWA 3LEYH 1KN4L 4UINH 4CN1A 5EG6C 3O9WC 4XPFL 5H37H 5D6DC 5I73C 1JIBA 1BVKA 1U58A 3PG2A 3ABZA 1EUUA 3MJ8B 5C2UB 3D39A 4R0LA 2NZIA 4LHQB 1AHWC 5FGCE 4WFED 5C0CD 2BC4B 5AYUH 4NKDB 4WRLA 1B2WL 4JY4A 5IF0A 1CG9A 1P2CB 1OWWA 2R56L 3MBED 4JFHE 4LOUC 1EUTA 4UMGA 3BEVB 3CDYA 2YD6A 2B4CC 1TVBA 5KSBE 2AS5M 4R0LC 5IHUH 4ELMB 4PD4J 5T3ZH 1OARH 1FFNB 4Y2DD 4F7TA 5C0AB 1BQHB 2W92A 3VFTB 3VDCA 4DEPB 4GS7B 3QISA 1MCWW 2JJUA 5FYKH 4NZTL 3T77A 4PUBL 3OKKA 5AWNL 4IRJD 4LCCC 4LARL 1TZIB 4HQQH 3V5KA 3C2AL 1ZV5A 5EZOH 1IAOA 2Y6SD 5MEQB 1AY1H 4UIKL 4JB9H 2ZUXA 1OQXA 5A43C 3GMLA 3ZYIA 4DN4H 2ZSWB 1FO0A 1C08A 4ALAH 2WP3O 3GMRA 4F3FB 1BM3H 4M9PA 1RY7B 2Q8AH 3RTQB 4GXVH 3ARBB 2WBKA 5JA9A 3PNWA 5EN2B 5INDB 1YEGL 3CPLA 3RDTB 1C5BH 1I7ZB 2OBGA 3CLFH 1OP3H 2BVOA 3BIAX 1FYTA 4GSDH 5SX5H 4G8GE 2X4UA 4WWKB 2Z8VC 2HFGL 1FFPB 1GPOL 4LEOB 1Y0LA 3U2SA 4TULH 4FQQB 2JB6B 2PYEA 1AI1H 3LAFA 5DJZA 5I1JH 2D9QB 4O2FB 5DI8B 1CL7I 4KQ3L 1CZ8L 5FV1L 1BD2E 3TJEH 2VDLL 5KTEL 2DLHA 5HHOD 1J8HA 4I77H 4HUWA 3W9DA 1KNOA 4ODHL 4WTWA 2YOCA 4LSUL 4ONHA 4JFZL 5AD0A 3KHQA 3GEWB 2YPVL 5CJXA 2O61B 4F58H 3U1SL 1KB9K 5J8OA 4YEEA 4MNGB 5TDOB 4DGVL 4AEEA 2AAVA 4J3XA 4OCNC 1OSPH 4HUKB 2MCG1 1KG0B 4KROB 5CWSB 5HHXH 5GZOD 5JW5A 3FN0L 1ES0A 1N5YL 5H94A 1AXTL 5D7JC 2Z9TA 1WLHA 4G7YL 5D2LE 4DZBA 3MREA 4GQ9L 2H8PA 3P30H 2HVKB 5BV7H 5GGTH 3BH9A 1YN6B 4NZRL 4XX1G 5KJRL 4Y5VB 2FEDD 2ZP0T 3O2WL 3OKDB 3TYGL 4KMLB 3IS1X 4ONGL 2P48B 1DP0A 4RWYL 1NEZA 5JW4N 3E1F1 3TN0B 3BT2H 3DMMA 3B9DA 3B2VH 1FL3B 2W07A 3SY0A 4S1DD 4JFDD 3RWEB 1EK3A 3SKJH 3WBDA 2XFXB 3T65B 1UA6H 2PYEB 3CX5K 3IJHA 3LN4A 2GUOA 3OKNA 1HKLL 3MJ7B 5GSVA 1JK8B 2Y5EA 2AK4A 2FD6L 4P2RD 5D1QB 4P2CG 1OP3K 3W9DB 3OJMB 1W8OA 5SX5K 4G43A 5I1HL 2IFFH 1HNGA 3ULVE 2CIKB 3P11H 4YDKH 1MCIA 4J1UA 5FXCH 5JOPD 1MCCA 3I50L 4PGBB 4CVZB 4JZJB 1KTRL 5JW5B 4GT7A 4OV5A 4ZFFB 4EUPG 1RZ7L 3ARQA 1BAFH 1OAKL 3GJEB 5H94B 2ZKHH 1BOGA 1XR9B 5IMMB 5E2VL 2XN9A 4WEBL 5E6IA 1KIPA 3DX9A 2WMPA 1OTTD 5KSUA 3VFMB 1A0QL 4GLRH 3RGVB 3S5LG 35C8L 2W60A 4ERSL 1NLDH 5I75C 3RY6C 3BKML 1MJ7H 1WC7A 2NXYC 1FIGH 3D9AH 4HDIB 1EHLH 3B5HA 5DRXA 3OR7B 1E4XI 5I1GH 2VDNH 5HVWA 4YDLB 6FABH 4PB9L 1SM3L 4UTBH 3SY0B 2Z0BA 1ZHNB 3TWCH 3IDUA 5E00B 3TCXA 4TSBL 3INUL 3LQAL 4AIXA 3EFDH 4NWTL 2IEPA 4WFGE 1CIDA 5GSVB 2LTQB 1ZGLA 5D9SA 4Y5YA 2Q87A 3IVKB 5I30L 3KJ4B 3VXRB 2D7QA 3MJ6A 4JO2H 3THML 3D87B 1FAIH 3MRFA 3T08A 1C16A 4MAYA 4KZDL 4JFOA 4RMVA 5DJ8A 2VL5A 3IDXL 2JJTA 3MJGX 3IRZA 3QZWA 1LO0L 4LFHG 1AP2B 3MMEA 4HWZB 2A6KB 1TTFA 3IT8D 3F5WB 2QKIB 5GIRA 1CXLA 3RA7L 3GSVB 3MA9H 1WISA 2P8MA 4MAYC 2R1YA 5EZJA 2JJTC 3UX9B 3LSOB 1V05A 4NM4L 1T2XA 4OIIH 4GQPH 2GW5A 1A1NA 1HZHH 4CW1A 1YEHL 4RMQA 4OUUA 4JLRB 4DTGL 5EBLA 3VXME 5E1HB 3WFBH 1MHEB 4FMFA 5F6IB 3DX8B 4IS6A 1QRNA 4NT6A 3KYKH 4WW1B 1A7OL 1CT8A 5DYOB 3RIFF 1YPZF 4HIJB 4HKJB 1NGPL 3V4VH 2EIZA 4LHUA 4XP5H 5D7IF 1KBGH 3SE3A 3MXWL 1G6VK 1U8OA 3RWFB 4XPGL 3WKMH 2BXYA 2AJ3B 3MNZA 1RUAH 3O6KH 3HA0A 5GS3A 1MCOL 2IBBA 4DGIL 4XXDB 3WD5H 3ZT6A 1UVQA 1NANH 3TBTA 2XG4A 2JTDA 4NC0B 5HHNB 4P2QA 3AREB 1Q9OA 1AC6A 1RVFH 4XX1E 4QEGA 4HXBL 1SY6L 5BV7C 4WW2B 5HYQB 1ADQA 4TTDD 4HT1H 1KCUH 1KCLA 2VISB 3GMOA 3NPSC 1MWAL 3PP4H 5DEFA 1V3LA 2ICES 1JNLH 3BQUC 3OKEB 1G7HB 5HHVH 3CZFB 4TUOA 2BNQB 3GFUA 4TQEL 4U1HA 2XY1A 2V17L 5GJSH 1A1OB 3HG1E 3U46B 4E9LA 4FQLL 1BJ1J 1KTKE 5LVEA 3T0XA 4FABH 2W9EH 5F96L 1I9RH 3C60B 2CJUH 3HMWL 4F2MB 4O58L 3QNYA 5E1AA 3LQZA 2OJZH 2QJDA 2R0LH 4JVUA 4E41E 5ANMA 1DQLL 2P8LB 4KUCD 1KIUA 1YMMD 4F37K 3F7VB 4XNUH 3QDMB 1JWMA 2G75B 2BNRE 3PABA 5T1LD 2R8SH 1IM9A 3T4AB 5GHWH 3BMVA 1HH9A 3H9SB 4YBLC 2YSSB 2Q20A 4ZOAA 2VR9A 3MV9D 4NKOA 4HGKC 1QNZH 2DI7A 1EJOL 5GS2D 3VWJB 3OWEA 1NGYA 3BKCL 5FM8A 3NFPA 5DJ2A 2HT2D 1T04A 2Y7QA 3VI4F 4F8QA 5HVFB 2WANA 3L7EB 4GG8A 5FHAH 1X6NA 4MSWA 1JZ7A 3K1KC 2Y25A 3X3FH 2FSEA 2GJJA 5DRNB 1D6VL 3QIWB 3SDXE 2H6PB 5L8LB 4K2UH 2HN7B 3PWUB 3OB0K 1OGAA 2B1AL 2BSSB 1EJ6A 3D5OF 3E6HA 3W39A 1R6VA 4PLKD 3AGVA 1FNGA 4JG0L 4MQSB 1KFAH 2EDRA 4U1LA 5I8CA 4KKAD 2HKHL 1DFBL 3CDGB 3LPWA 5F88B 3ZYOA 5DVKA 3VG0H 3RWIA 4ZUTA 3HLAA 1T2QH 2MCPH 4C83B 2A38A 1RMFL 5FEBA 4S10A 4M7LH 5AYQA 1MI5B 3EDDA 3LQZB 2P5WA 2P44B 5E8PA 4QHLB 5IUSA 2VLME 3WNKA 7FABH 4D3CL 5DC4B 3PGCA 3MV8D 4QYOB 4RMTA 2H32B 1T83A 4KKNA 1TCMA 1BZ9B 2EYRA 3IGAA 3RPKA 1T22A 1XIWC 4HX1A 4WDIB 3QCTH 4L4TE 1M71B 1HH9B 3DRTB 4JDZA 3HC4H 5E6ZA 3O0RH 2DKUA 3LHPH 3ES6A 2Z35A 4P4RA 4MQTB 1NFDA 4CRPA 1MIEL 3RUGE 3SPVB 4W70A 1NGYB 3NVQA 2NTSP 1S7SB 1KJMA 3MRHA 1MNUH 1WZ1L 2PW2A 3UCRA 5I1AA 1T83C 4KKCC 1XF4B 4E42A 1VHPA 4JM4L 3VFGL 4JZOA 1P7QA 4QOKA 5ERWB 1OTUC 3VI3E 4CMMA 3BD3A 3QI9C 4N1EA 5JNYA 1OGAB 5MERA 3MC0A 3WLWC 1H8OA 1T7VA 3PQYB 3QNZA 3N1GC 1FE8H 2NY6D 1WEJH 1CU4H 1I8KB 4HPYH 3STLA 5C0RH 1U0QA 5FO7A 4XC3H 1S7VB 5ADOL 5I8CB 1KJVB 1ZXQA 1EHXA 3BH8B 4PJBA 5TDNB 4S2SB 2JIXB 4NC1E 1A5FL 3D1MC 3HPJB 1WAAA 1CGWA 1MRFL 1X4YA 1NPUA 1R0AL 1BBDH 1HHGA 5TF1L 2YK1L 3NAAL 3LMJL 1LP9F 1OWRM 2B5IB 4XMKH 2E9BA 3LV3A 4LRIC 1IGTA 1CK0L 4GMTH 1KACB 2APXA 4UT6H 3ULVH 2H45A 3MRGB 5FYLL 3ARSA 1NLBH 4XNMB 4UNVA 1PG7L 2E6PA 4AM0A 4DGYL 3QRGH 5FB8B 1E0OB 1I7TB 2IADA 3IFNL 5CEZD 1D9KA 3RVUD 3V7AE 4R7DB 3H9ZA 4KJYB 2ZUVA 4ZO9A 4PYHA 4I18A 1IJ9A 1S7XA 3LKRB 2FWOB 2OM5A 2XKSA 5FKAB 1YNLH 4JO1H 1J86A 5B38G 3UYOD 2LU3A 4G9FD 1K4DA 1F4YL 4YO0B 1P4IH 1G0YR 5EUOA 5CLTA 3H9HB 4RGOL 1B0GB 1GH7A 4HJJH 5A40E 3WFEL 1D9KC 3EYFB 3RVWD 4PP1C 1KCRH 1K3IA 5ETUB 4XTRC 4ZAKD 1HSAA 1KENL 3ARVA 2ZCLL 1OT2A 3BEWA 4I18C 5BW7A 3DUHA 3P4NA 3OAYH 2QL1A 4U05A 3DRQB 4UAOC 1F11B 4ODSH 1RHHB 1CICB 4IRZL 3CLEL 3VXUA 3HE7D 3EJZD 3RP1A 3O6LL 1FVEB 1CE1H 1IGFL 2C1OA 2D7PA 2V7HB 4P46B 4ZS7H 3UMTA 1QEWA 3VE0B 5HDBE 4YHPB 3MRPA 2DMKA 4M48L 4UBDC 1C1EL 1NAKH 4WVRA 3ALXA 4MNQD 3LZFH 3KPNB 1S9YB 4X5WA 4U2ZA 4DQOH 2AJZA 4PJCA 4OLEA 2N7BA 1Z9LA 1MFAL 3QWQB 4NM8L 4G8GA 4PJHE 4YFLI 4Z7VE 3EZ8A 4GAFB 4LU5H 3MUZ1 2V5TA 5TQ2H 1N8ZA 4JPVH 4OD1H 4OF8A 1S78C 5DUML 5JXED 3B3IA 3CFCH 5HHMD 5CD3A 1T6WA 5FGCB 4XPBH 1MFEL 2Z92A 4MDJA 1J5OH 5L0QB 1HQ4A 2AQ3A 5CJ8A 2OR8A 4PBXA 5LGKA 1AO7D 2XTJB 5L88H 2I07A 2PYFB 1FNHA 1C12A 5EFIA 5KSBB 4YC2B 1DBMH 2WIIB 2AJYH 4Q2ZA 2IANE 4OFYD 5H35A 1VB9A 4HJ0D 5KN5B 1MCEA 4S11A 5IBUB 5ESQA 3QUXC 4IIQC 3PV6B 2NY5H 3ECBB 1U8PA 3PL6B 3VDBA 5TE6H 1ETZA 1NKRA 3I02B 2Z93B 3KGRA 4PRIA 5JHDE 4X99A 3VXTB 5ALBL 2Z31A 5D2LA 5IJKA 4OZHE 3GHBH 5DD5H 4U6HB 2BVTA 2EDTA 2EKSA 4LSQL 1CE6A 2B2XL 4M43L 4V1DD 5CEZL 5I71C 3OAYK 1CXHA 2A1WL 1KPUA 3KPLB 1AE6H 4NQXB 2DS4A 2XG5A 4CNIA 3ETBF 2DYPB 3T4YA 2J88H 3MLXH 1Z6JT 4L8SB 5IJKC 5IT2L 2C3WA 3BVNA 3ULUF 3IFLH 1JZ4A 5EZLA 4QT5B 3HZMA 3SDAB 3V6FA 3QXDB 4P57A 4QRPE 4TSCL 2E7LA 3SKNA 5I8KL 4JJ5A 2CKBA 1VSCA 4Z7UB 1T2JA 5I1KH 2EE3A 2WAHA 4OGXL 1HQ4B 5F7NC 4DKDC 3ARTA 4QRRD 1BD2B 4R97B 2WBJD 3NZ8B 2DM4A 1JPGA 5I0DA 1I7RB 5EOCL 4P5TB 1X5FA 1NC2D 2X89A 2R4SL 3MR9B 1DBBL 1R5VB 2V2WB 1EEQA 4JM2A 1FCCA 1KJ2L 1A6AB 3JUZA 1UADC 4JEGB 1XCQB 4YDVB 4PJEE 4P9HH 5T1MB 3UTSD 1CGXA 3VG9B 3EYUL 4M6NL 3L3IA 3U6RB 5BVJA 5D7KD 2PO6A 4JY6A 1B90A 1I1CA 2KL6A 3RZCD 1VGEH 5JR1H 3MLZH 2R1WB 1ND0B 3NIDF 1MAML 5D2LB 3T0DA 4JM2C 3QIBC 3P4OB 3UJIH 3F8UB 3GRWL 4K7PH 1JTTA 4RDQF 4Y4FA 4H8WL 2F5AH 3QB7C 5F1NB 3QRFM 3VXNA 3MRBB 5B8CC 4HIHA 2P43B 3DV4A 1A6TB 2PO6C 4P49A 2AKRA 3HCVA 3LKNA 1OTSC 4JVWA 5HPMA 3LEXA 4Z7QF 4YJZL 3TJHC 1AXSB 4LLDA 3T4YB 4QGYA 4IDJH 4P4KC 3W0WD 3EFFB 4XNXL 4GW4B 4W68A 4EVNB 1P7KA 5AZ2L 3PWLA 2A9MH 3MNVB 3O4OB 5EZLB 1MVFA 1SHMA 4R7NA 2AGJL 4Y4FC 5DFVC 2H3NB 2NTFB 3R0MA 4R8WL 5B3JE 4W6YB 1QLEH 3TH4T 4MQXD 3D2UB 5E8NA 1XGUB 2HP4A 4TTGA 4R90L 4OLUL 1JGDB 2WV3A 4K8RH 1OP9A 3PDOA 4JGUA 2DQDH 3IU4L 4L3AA 3GMQA 5AEAA 3V4UL 1VEOA 1DQJB 4JFQB 1NFKA 3TT3H 3TVMA 5K59E 1B3JA 4NZJA 2ZSVB 3O2VL 3SQOH 1T5XA 4WFHD 1NCNA 1S5IL 4U1SB 1DANU 5I74C 4FG6C 3STBA 1AQKH 1T1XA 4LSSH 4PPTA 4D0CB 5IKCA 4NO5B 2D7NA 1M7XA 2HTKD 3U30B 3PIQA 2BVUA 5C08E 2C5DC 3EOBA 3TVMC 5D5ME 3Q5YA 4LLUA 3DO7A 3D18A 3VXMA 5IBLC 5BOPA 2J6EL 3M8OH 1AR2A 5F7UA 2OK0L 2YD7A 5HGHA 2IPTL 2NLJB 4FQCL 4R7NB 4HG4J 4H0IA 3O3EB 5IK3A 4FFZH 2AEQH 4LRNH 2JB5L 3SEPA 1LILA 1YEDB 4U2YA 1QBLL 5IVZA 2D0FA 2O5ZH 4I0PC 2G2RA 1KXQE 3O3BA 3GJFA 5HDQH 3VXPA 4FN0A 4C58B 4RGNC 2CMRH 4IHOB 3WLBB 1ZS8A 2NY0B 1OGTA 4EBQL 1AH1A 3QNXA 4OFKA 3PJSA 3K74B 1JV5B 5GRVK 3GMQB 3DYMA 5DK2B 4MJ2A 5ACZB 2XQBL 1M05A 5K9JL 2YRLA 5LBSH 3HI6L 1ZLWH 4X8JB 3BX7C 4UV4H 3CMGA 2Y36L 1IGCL 3LN5B 3WUWB 2WIMA 3BPNC 1A3LH 4OZFH 4BUGA 1NCUA 4DK3A 4OM1L 1DLFL 3EOBB 5F9DC 3WFCH 4E41A 5GS1B 2VDQH 1YQVH 1FZKA 2DLEA 3HR5A 3VXMB 1ITCA 3G6JE 2CO6B 3UJTL 1ZA6B 1IEBA 2BNRA 2WINB 4NN5C 1KIQA 5C0CE 4XNZB 1Q9WA 1A7PL 5HJ3A 4CMHB 3AVEA 2VLJD 1FFRA 1UB5A 1W72B 5IVXA 4U0RC 2EDOA 3DYPA 2GJ6A 3MACH 4HIIB 3BXNA 2NY1C 5IB2A 4LNVA 1YQ2A 1RK0B 2HT4D 3FRUA 5B3NA 4UT9L 1U92A 4CDHA 3SDXA 1OSZA 3S5LA 4JFED 4XCYB 4NHUB 1LO2L 3NA9L 4R96B 4JFYA 3MLRL 4QHUB 3EYQD 4XBPA 4ODBD 3GIZH 1M05B 4OF5A 2X9WA 1J87A 2IH1B 3FT2A 3HG1B 4QRTB 2PNDA 4KRPB 2SEBB 3FTGA 4Y4HD 1UKSA 5I16B 2JCCF 5TF0A 1NC4A 2OR7A 4O02H 1G6RH 2AEIT 1Q72H 1UYWH 5GZNC 4GAJL 1QZ1A 1CTNA 4Q97A 3R1GL 4NSKB 1MHHB 1B4JL 3GMNB 1IEBB 4YHIB 2E27H 4EN3C 4JPIB 1G7LA 1QA9B 2V2TB 3O3DB 4OKDA 1YNKL 2ARJB 2F5BL 4K8RC 2Y07H 5HHOE 3RWJA 3WS3A 4AIZB 1AFVH 4XNQB 5FO9B 4NQDD 2HFEB 1DLHB 2KBGA 5LCVH 4DN3H 3RUGA 1I1FA 1F02I 5ADPL 3CU7A 1ZVHA 3RL1B 4NPYA 3WMSA 2ZCKH 3ARGA 5GXBB 4UV7L 4XVTH 2ERJB 4IRSC 3GBNL 5T1DH 3FRUB 3MLUH 1N26A 2J8UE 1U92B 3U0WH 1AD9A 3SJVD 5M94B 4Q74A 3MRDB 3UBXI 1UQSA 2A73A 3REVB 3DXAD 1A21A 1TQCB 4OFPA 4NQVB 3TA3D 4HKXA 4BK4A 4D0DA 1S3KH 4JQXC 1U8IA 5DF0A 1ZK9A 1JPTH 3TEUA 3FTGB 1TVDA 3MLWH 2NY3D 4XB7A 1TCRA 5FA3B 3NBNA 3LIZH 4L5FH 3AFLA 1N0XL 4XC1H 2BY1A 4PTTA 1KN2H 4X9BA 5ABDE 3JWOH 4LF3A 1Q9KB 2X4NB 3CSYA 4JFDE 5DHXB 2CK2A 1FNLA 4DEPC 3DSFL 1NDGB 1F8TH 5KZCD 1WT5A 1INDL 1YEIL 1Z9OA 4NC1C 3KPPA 1TZHB 3HNSL 2O5XL 3K4AA 4YQXH 3T1FB 3T0EC 4DFHA 3RHWK 3UJJL 5FECB 4P2RE 4L4TB 4NO0D 5GRWA 3RWJB 1CGYA 1FORL 1YJDL 3RI5K 2DMBA 1QFWH 4FXKA 5CJOH 5KG9B 2IH3B 3ULUL 3DX6B 4OZFA 1DQDL 4QHKI 1CS6A 2FJGA 1FDLL 1I1FB 3ARDD 4U6XA 3P0VL 5TE4L 2AV7A 1CIUA 3JUYA 1AGCB 4PGZA 3U9PH 1WT5C 3L95A 3S34H 5JOPE 4Q9RL 5EWIH 1BZ7B 4ONFL 2YS4A 3GSQA 2IBZX 1T66D 5CBEB 2WLZA 1YEKL 1KN4H 4HKZA 4MLIA 5IW6B 3QQ9C 5C0BB 4O9HL 3HUJE 4NGHL 4PJDA 4WU7A 2VB5A 3HZKB 4P2OB 4XCNA 4XPFH 5T3XD 5DVMA 5F97E 1BX2B 4D0DB 1Y6MR 1JRHI 1BMGA 1J8KA 2APWA 5EC2A 3QFJB 1ZLSL 1KTLB 2Q76B 5CILL 3KWWB 1WZMA 1X7QB 4O2EA 4E0RA 2FR4B 4X9GA 2D7OA 5D1ZD 3BI9X 1B2WH 4U1IB 1U8QB 1OAXL 2X41A 3R4DA 3G5XA 3T3PF 2R56H 4NJAL 1I4FB 4JANA 4UTAL 3MXVL 1KELL 3LD8C 4PJHA 5IHZB 1F3DH 1UACL 4Z7VA 3WNOA 3V52L 3KPPB 1ORSB 2AEWA 3JVGA 3CFBA 4PJIF 4G80B 1OW0C 1HE7A 2R69L 2NPLX 4N0CC 4XWOD 4NZTH 1KC5L 4PUBH 5AWNH 5J3HC 1GL4B 2Q8BL 4KKLD 5L2KD 4DZ8B 4LARH 5EU3B 1XF5A 5SWSB 3C2AH 4DVBA 2MTPA 3KJ6L 1OPGL 1CLCA 4UIKH 1CCZA 4KUZL 2APFA 2GT9A 5E5UB 3OKOA 5F1IA 1AIFA 2XKNA 2NX5B 4WEMB 4PJ5D 4G5ZL 3NCMA 3QHZL 1DVFA 5FV2A 1EBAA 3QWRD 4MQ7A 3QFDB 5MI0B 2ZNXA 3IETA 3TN0C 4BELD 1IKFL 1HI6A 5IFJA 1YEGH 4TNWK 4A6YL 4XCNB 2AABL 2PF6A 3P3YA 4NO3B 5E2TL 2LFGA 2V2XA 5J11B 2C1PA 3HS0A 5JHDA 5HI4D 1U36A 3V0WH 2HTLC 3F12A 1WTGT 2HFGH 4OZHA 1GPOH 1T3FB 2QSQA 3L7FB 1DVFC 5I1EL 1FBIH 5HI5D 3SGDH 5TGBA 1T20A 1JGUL 1IAII 1ZA3A 2DN7A 4K23L 4KQ3H 1CZ8H 4ZFOL 1LK2B 3HC0B 2VDLH 5KTEH 4MD4A 4Y8AA 2XXCB 4ODHH 2A6IB 2VZ1A 4LSVL 3EYSL 4LSUH 3L5HA 1RK1B 1X4ZA 1XF3A 4JFZH 5B4MD 4PRBB 2YPVH 1HIML 4N0FB 3U1SH 2UZXB 2YA0A 3N50A 5T5NG 4DGVH 3W11C 4IMLA 5LGJA 3NFNB 3H8NA 4XVUC 1MF2L 5KSAB 4FQJL 4M6ML 3E3QC 1MCWM 4NC2B 4RA0C 1G6RB 2GAZB 1OT1A 2IAMB 1WWAX 1V7NL 3CX5J 3FN0H 1N5YH 3RGVC 1AXTH 4U0QB 4X4ME 5T3XL 3QUKB 4G7YH 5IOPA 1IGML 2UYLB 3ARWA 4GQ9H 2NNAB 5T1KA 2PTUA 2IANB 4NZRH 4P0DA 2UZYB 3T2PA 1BLNA 3IXTA 5KJRH 2ICWA 3QUML 4NCC2 4JO3L 3O2WH 5DRWB 3TYGH 4POZC 4C4KO 4HK0A 4N8PA 4TOYL 3G6DL 1RI8A 1LK3L 4JKPL 4ONGH 5F71A 3C5ZB 1BGXL 4J8RA 4RWYH 4ZPTB 4HSQA 5K33A 2BXZA 5DJAA 3TBVA 3O9WD 2EH7L 2XICA 1RZKL 2B0SL 3FFCD 3KJ4C 4H25B 5TGBB 3MRCB 5B38A 1YMME 4IOFC 3UTZA 3B8SA 4YBQC 5MHSD 1ZA3B 5E24E 4JCLA 4XH2B 43CAA 2YUWA 2VZOA 1HKLH 1C5DB 1J0YA 3LKPB 4LQFL 2FD6H 1FZOA 3DVGA 2H2SC 1S7UB 1Z2KA 4GBXB 1DQML 1YN7A 2AW2A 2R2HA 4WO4A 5I1HH 5C86A 3MV9E 3UTTD 4P23D 1X5LA 3DETD 4QRPB 3GGWB 1U95A 4Q6IB 2XNAA 3HR6A 1I1RA 1JPFB 3IDYC 5T5FL 2O93L 3I50H 1FL6A 3ARFB 4XBGA 5I1DB 2NYYC 4X6CB 3D39D 5JA8B 5KAQG 1U8LB 2FEEL 4LP5A 1A4KA 1KEGL 1RZ7H 4WO4C 1LO4L 1OAKH 4R6UA 4UU9A 1P1ZA 4JRXB 1IAIM 5E2VH 4X7SL 4OAWB 4WEBH 2FH8A 1UM5L 3GB7A 1A0QH 1R3JB 4PJEB 1WFUA 35C8H 3RNKA 4ERSH 1DQQA 4MDIA 1UXWB 3BKMH 1I3GL 4Q58C 1DBKL 4E5XB 3TFKC 2IWGA 4OZIB 4G8EA 3DUUB 4ZOCA 3KYNB 3EJYC 5L2JB 3QDGB 2EYSA 4PB9H 1SM3H 5DJAB 1N59A 4QF1A 1KPRB 1BQLL 2P24B 5C08A 4TSBH 3INUH 2EC8A 3LQAH 1IQWL 1L4IA 5D5MA 3QULB 3MV8E 4NWTH 3EOAA 3EDEA 2FH6A 4APQB 4X7TA 3AREC 1UH4A 3TYFA 2YUVA 5I30H 3LRSB 1UENA 4L8BB 4WGWB 4U1JA 4WW2C 5CHNA 2VUOA 3WHE1 3WIIL 5JPMB 3ARXA 2YD8A 4PBWD 3THMH 2VITA 3RKPA 1G9NL 2JK5B 1L9NA 3V5HA 5IEHB 3IDXH 4HIEB 1GC1C 5IVOA 1FYTD 1LO0H 3PWJA 3NCEB 3C8KB 4N1CA 4UUJB 5FKPA 2VIRB 2DWEA 4OCSL 2LABA 5IQ9B 5K9OB 3V0AC 1NBVL 2NCMA 3RA7H 1F4XH 5D96C 4C4KT 1NBQA 2GTZA 2HWZL 2UWEF 5I15L 2XQYG 1X5YA 2OX5A 1IAIL 1AJ7L 1IC7L 1I1AA 1A6ZA 2I9LA 4NM4H 5F9AC 2ZWLT 1T0MA 5D7JD 1YEHH 4KI5F 2DDQL 1JF1A 2VDRL 2Y23A 4DTGH 2EIDA 4ZYKA 3QEUA 3V6ZB 1RZFL 1PZ5B 1A7OH 2APBA 4PRAB 3GSXA 1QFHA 1I1AC 2XWTB 1NGPH 1MCJA 1FVDA 3MXWH 3SDCB 2OI9B 3K4ZA 1NCWL 5J9PB 2W0FB 5DQDL 4XPGH 4ZSOB 4MLSA 1JVKA 4ZQKB 4GRWF 3K2UL 5CEZE 1U3HD 3QIWC 3G6JA 3EO1A 1MEXL 3EO0B 3GK8L 3X3GL 1MCOH 2B4CL 3U82B 2HJKA 1PX3A 4U1JB 3ALWA 2DLFL 2GJZA 3CSBA 5C0CA 1M4KA 3MRKB 2EEBA 2CIIA 2B20A 2VITB 4K9EC 4Z0XB 5L7XL 3MBEA 1V7ML 2ICEA 1OLZA 4HXBH 1SY6H 4OLWL 5DFTA 3ARRA 4O4YL 1EEZA 5C7XL 3QDJA 1JJUA 1MWAH 3G6AA 5IFHL 3KR3L 4KVNL 4XP4L 5A16A 2YWYA 3C5JB 4Y2DA 4X98A 4F7CB 3TIEA 1EPFA 5EDXA 4TQEH 3QXTA 1RQ5A 2V17H 1INEL 1YPZE 4WI8A 4M6OL 4YDJB 5KOVC 5J06A 1WFNA 2H2PD 4FQLH 4IRJA 1IZJA 5D7IE 5FUCC 4X6BB 1PY4A 3T0WA 5F96H 5IB4A 5I2IA 3MBEC 3V0VA 3KPMA 4OQ1A 1DUZB 2VDKL 1I8MA 3X14A 4O58H 1N6UA 2MMXA 5DMKB 1P4LB 4WJ5B 1NMAL 1DQLH 2Y5TA 5HPOA 2CQVA 1KLGB 4Y2DC 3U36A 1DR9A 4TPRL 1KEML 1R24A 2DQCL 4UDTB 1S7WA 4MNQE 5DURD 1IQDA 1I8LA 3R8QA 4C57C 4HFUL 2ITCA 5DMGD 3VD7A 4NQCD 4RMSA 2BOCA 2DQJL 1UZ6F 3B6SA 5DJYB 1EJOH 2CRIA 3BKCH 3CCHA 5B39B 2BMKB 1T21B 3EO1B 3QHFL 3UTPD 5HHME 2DJ4A 4N0RA 1I8LC 2AJSL 4ACPA 3MLPA 4QY8A 3SKOB 3KPOB 2AI0L 2F9BT 4BFBD 1INQA 1D6VH 5HHOA 3OHXB 4LLQA 4QTHA 2WZPD 2B1AH 1AO7E 3IFPA 1BHGA 4MA8L 1KCVL 5D7LD 3TH3T 5IIEA 2GI7A 2QQNL 3O3AB 4JG0H 3GKZA 1A9BB 3H2WA 1R3KB 4OKVA 4NN7C 5E94B 1NBZB 3TIEB 4JREB 2I24N 2HKHH 3FZUC 4Y19B 1K4CA 4YGVB 1DFBH 1ZT1A 2B5IC 4JFFD 4IRJB 2J8UA 4XPTL 1QQDA 3BIBX 4HV8A 1RMFH 1F3JA 1I8MB 4PRNA 1EO5A 1CDJA 4GG6A 1WAAF 3RVVC 4LEXL 3TZVD 2GFBB 4JDTL 3VI4E 4V1DE 1RZIA 1S9VA 3MSPA 4Z0BL 2D7MA 4D3CH 5C8JA 1JL8A 2ILLA 4PTUA 3QG6A 1U91B 3KDMB 1F4WL 5F7HA 1U8HA 1RZ8B 2YN5A 4X7FC 2HRLA 1H3VA 2VR5A 1MIEH 4WV1C 1JUFB 2P8PA 4HH8A 5JIHA 2PN5A 5HDLA 1WZ1H 3DIFA 3KLHC 5SWQA 1FHGA 5EUOF 3Q5OA 4JM4H 1VCAA 3VFGH 2D4FA 3ILPA 1KYOK 4NQED 1CICC 1B0RA 4Y16D 3ZHLA 4QRRE 4CVXB 1INQB 2GSGA 2PCPB 3DV6B 1JGLL 1FN4B 2W9DL 4P46C 1ZGLM 3LEYL 2J4WL 4JHWL 4O51A 5C6PB 1MFDL 1ZT4A 3CAFA 5CS7A 1MCFA 3GBMH 4S1DC 3WNNA 1S7RB 1MY5A 4IDLA 4LKCB 4UOW1 5E5MB 1LNUA 5ADOH 1MLBB 2X42A 1TDQA 3UTSE 3K46A 5HYJD 5BOZG 5D7KE 1A5FH 5DC0A 5C0FA 2DF3A 1MRFH 4HV8B 5IMLB 3BQUD 3RWHB 1R0AH 5HGBB 5TF1H 2YK1H 3HUJA 3NAAH 2BRRL 1CK0H 1U8KA 4GLRI 1E27B 5BZDA 3FOLB 5FYLH 4N9GA 4PJCF 4FXGB 4HUNB 4M1GH 3BPOC 1PG7H 5CINL 4DGYH 1MWAA 5GS2H 2GYSA 1WTLA 1OF2A 3OGCB 3SKUD 4OI7A 3IFNH 1BWMA 2Z8SA 2DWDA 1NGZA 1BFVL 4EKXA 1EFXB 2XTJC 3FQWB 3SE4A 3F7PC 4XGZB 4PJ9B 3W0WE 2VAAA 4MYWB 3BZFA 5EU7E 5CGTA 4X4XA 5EU4A 1F4YH 2ATKA 1U6AL 4RGOH 4JFDB 5DHYB 1WJ3A 5LJYH 1V8HA 4S1RL 4PV9A 4PREA 3WFEH 5KSVA 4KI5D 5IJVA 2R23A 5TJWK 1F4AA 1KENH 1RUPL 5GGSB 2ZCLH 3KAAA 2D9CA 4P2RB 1A22B 3SE4C 4ALAL 3E2HB 4XP1H 1T5WB 2NY2C 4BZ2L 2YR3A 1LP9E 3RIAF 2AXGB 3RX8A 1ZMYA 4IJ3B 4IRZH 3CLEH 3OKLB 4PRDB 4KRMB 4AT6B 4XMLL 3O6LH 1IGFH 1XGTA 4Z7WF 2RFXB 4I9WD 4QRSB 4M3KB 4ODXB 4PLNC 3TGXA 4M48H 1C1EH 2HG5B 4LNRB 4MJ4A 4HFWA 1ZVSA 5E9DD 3FO1A 1GYAA 4WFHE 1UKTA 5I1JL 4MCZB 4LLYB 1CXFA 3SDAC 5EULV 3X11A 5BZDB 1MFAH 4BQCA 2VABA 4NM8H 1JGEA 4N9GB 4NUJA 4YHML 5FHBL 4OLXL 2QBWA 1OCWL 4JAMA 2EDQA 3MJ9L 1Z3GL 3PHQB 5IEKB 3H9YA 4MNHA 1M7DA 1AD0A 2EE2A 5DUMH 5E4EC 4C56D 1MFEH 3S4SA 3O8XD 4P5TC 4YHYB 4XPHL 3BZFB 4NYLA 1DEEB 1CF8L 4QRUA 4YUEL 2C4XA 4RIRA 4QXTB 1XIWD 4H20L 3MZTA 4PV9B 3VG9C 3CH1B 3VFSB 5IJVB 4YR6A 1Q38A 3QG7L 1QSED 3OKYA 5F9JA 3EOTL 3VRIA 3QXAA 2IG2L 3MCKA 2L0DA 1D5ZB 1L9MA 3P30L 5IB3B 5BV7L 3WNPA 2X4RB 4JM2F 3QH3A 2NY4D 2AV1A 4KKCD 2YXMA 4GKNB 4PJ7F 1HEZA 1A64A 3PUCA 1OTUD 5FYJD 5ALBH 3QI9D 4QHMA 3EYOB 1UEYA 4ODWA 5EB9A 4RA3A 4OCRL 3WLWD 4LSQH 2B2XH 4M43H 5CEXB 4AY0A 1ADQL 2VLKD 5CEZH 4RAVB 1CR9L 2QSCL 2A1WH 3JTTA 4KFZC 3OMZA 3VCLB 3WN5A 2UUDH 4JHAL 5GGRB 3PF2A 3GM0A 2VABB 4M4PA 2CRZA 4I3GA 3B9KD 3JTSA 3P4MB 2NW2B 5E7BA 5IT2H 4V2BA 5KANG 5DUBA 4KKBC 1LHZA 4TSCH 1VEPA 3IDJB 5I8KH 5BQ7B 3RGHA 1YMMA 4BH8A 4OGXH 3ZYZA 4RMRA 3PHSA 2PETA 1XGPB 3G5VB 3KNBA 4LCWD 3I3EA 5EO9A 3DARA 2VLJE 3HAEH 4BQBA 3MROB 1ED3A 4D9LL 1OAYL 2XWBB 5EOCH 1VKXA 3ISWA 3KYOB 2R4SH 1DBBH 4FTVD 1KJ2H 4FQIL 3VFWA 3AMLA 5GSRA 3L1OL 5DQJB 4XNYL 2CH8A 3EYUH 4M6NH 4ZPVB 2V7NA 4D0BA