1CLZH

Igg fab (igg3, kappa) fragment (mbr96) complexed with lewis y nonoate methyl ester
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
218
Chain Sequence
b'EVNLVESGGGLVQPGGSLKVSCVTSGFTFSDYYMYWVRQTPEKRLEWVAYISQGGDITDYPDTVKGRFTISRDNAKNSLYLQMSRLKSEDTAMYYCARGLDDGAWFAYWGQGTLVTVSVTTTAPSVYPLVPGCSDTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG FAB (IGG3, KAPPA)
publication title The x-ray structure of an anti-tumour antibody in complex with antigen.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 45
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1995-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1clzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1clzH01
3P0GB 4MJIA 2DDQH 4WV1B 3MUJA 4J3SA 3KPPB 1RV6X 4P9MH 3U4EA 2IFFH 4GO6B 4Q2ZB 2AJZB 4MCYA 4MJ6B 1N6VA 4R26H 3A6OA 3MLWH 3N1GC 1AR2A 4QRQB 3WKMH 4OZ4B 5I1JL 1MFNA 4GT7A 1U93B 1Z3GH 1DANU 2EYTA 1L7IL 3STBA 3UMTA 1D9KA 2CK0L 4HBCH 1IAOB 3VXUA 1WF5A 3QWOB 3O6FB 3QEHA 2B4CL 1QSEA 5AD0A 1OW0A 1YEFL 3LPGA 2J8UB 2DKUA 3EO9H 2GITB 1ZLSL 1IMHC 3IDXL 1QSZA 3P4LA 4HMCA 3VXME 5K9OB 4GMSH 3MLRL 4MMXC 4L4TB 4J6RH 3VH8G 3DXAB 1FYTE 1KB5H 2EIDA 4JRXD 4F9PC 1T1YB 2EH8L 2XQYK 3MLYL 3GIVA 5F96H 3OR7A 4KI5C 5HI4D 2W1NA 3BGMA 3HS0B 3PL6D 4JGJA 3U36A 4MDIA 3JWDC 5SWSE 5EOTA 4UNTA 4S1DC 1IGYA 4GBXD 4MNQD 1YN7A 4HS6A 1A6UL 5J12B 3S36X 4OSUL 2HJLA 2PTUA 2Y72A 1NCUA 3SKNB 3UTSD 3QIUB 1QSFB 5TQ2H 3WV0A 1MRFH 3HUJE 1KB5A 2NY5H 5I1EH 2AEPH 1J0YA 3NCJL 2OI9C 4P2YA 4PJ5A 1YQVH 4RWYH 5GQBA 2MWCA 4OD1H 3IS0X 5HI3D 3PABA 3MFFB 4P9HH 3ZZ1A 5D7LE 5FYJE 2KL6A 1EFXA 4FTVB 4LKCA 1I3GH 1RZKC 2HKHH 2XXCB 5EOCL 2ZJSH 5C6TL 2QHRH 2AQ1A 3BRFA 3PF2A 1JPFA 3OKOA 5FM8A 1FFRA 4BH8A 3U1SH 1ZT4A 5C0DA 1I4FB 3T2NH 3UROR 3TBSA 5ALCH 1XCTA 1UH4A 1ODAA 2O5YL 1BMGA 4PRBB 1JNNL 2RAMA 4JQXC 1CK0H 4XAKE 1OGTA 1MCSA 3UPRA 3WFHA 1KB9K 3OJDA 5DD6A 2R0KH 5A16B 1S9VA 2X4TB 1QFHA 3MLSH 1KT2B 3G9AB 4IJ3C 2ORBH 2D7PA 4G43B 35C8H 2CLZB 4HAGA 1ZSDB 2BNRB 2VXQL 1IC4H 3LQMA 2GSIB 3O3UN 5GJTL 3PWNB 1I7RB 3GBNL 1JV5A 1P7QD 5J1TC 3GJEA 2C3HA 3L6FB 3D0LB 4LEXL 2YA1A 5EO1B 4EQ3A 5JQ6L 2YA2A 3EDJA 3MRQB 1G7LA 2NYYD 2FGWH 3DGGB 4EDWL 4KMTL 4LSSL 5DC0A 5TJWK 5I30L 5ESAA 4Z18A 4GG6B 5DLMH 4DGVH 3BVNA 1JGDB 3MODH 2N7BA 1WWAX 3VE0A 3KNBB 5E94B 3QDJD 2Y25A 2YD7A 5BS0D 3D87B 3TIDB 5C0FB 3ZKSD 3T2OA 4FQJH 1YJDC 2P24A 1QACA 4PB0L 4JJ5A 1OHQA 5TDOB 5DUBA 2VDKL 2PYEB 4P23C 2P45B 5J3HC 4BUHA 2PCPA 4OCRL 4JRXE 4XP1L 1TCRB 1FNEA 1IT9H 1RUAH 3WE6B 4XVSH 4GS7C 4UAOB 5J11C 1NC2D 1EEZB 4ZS7L 2VLJA 3F7VB 1H5BC 2NY6D 1CGYA 3SO5A 3C8KA 4O9HL 4UINH 3MNVA 4XXDB 1BGXH 1MVFA 4NUJA 3FFCE 3ARWA 3LEYL 4KAQL 5ID1A 4ALAH 1H3WM 3SHSA 1JE6A 4C58B 3NFNB 1ZEAL 2XWJA 2Q6WA 3HZVB 5A2JH 3K81A 4BUGA 4DUVA 3VFVB 5CINL 2GJ6D 2EKSA 2OCFD 2Y06L 1AR1D 4AL8L 3UTSE 5DD0H 2LFGA 3WLBA 3BDBA 1Q8MA 4K3GA 1U92A 1VFOA 4LDLB 3MNVB 4G8GD 3FT2A 1CWVA 1YYLH 1A9BA 5E8EB 2W0FB 2H32H 5EN2A 1NCAH 2UWEF 3MRMA 2X1XR 3PHQB 2R2EB 1K2DA 5C8JA 1R5IB 1BAFL 5DVOA 1ZHKB 3RWHA 1TQCC 4PD4K 4JANA 4EUPB 1H3TA 5GISH 4DN3H 1R3HB 1MFEL 1XF5B 3WS6C 2VNCA 2IH1B 1H0DB 1MJJB 4DCQB 1F4YH 3IU3B 2NPLX 4X6EB 1RUQL 1MAJA 4Y4KB 1HQRA 2O5XH 4KKLD 3BPNB 1A14H 4L3CB 3N9GL 4WTZG 3MREA 2VZOA 3MUGB 2JJTC 3OX8B 4L29A 5DRNA 2H32A 4N8PA 4I2XA 1FVEB 1OTUC 4ZFOB 4IDJL 4QNPF 2O5ZL 3STZB 2FB4L 3MQIA 1T2JA 2P46B 3BZEA 3V0VB 4YNYB 5CFHA 1K6QL 4J4PA 4UV4H 1A3RH 4IMLA 5BO1H 1QNZL 4G9DB 2Y07H 1IZJA 2AXHA 2R23A 3CH1A 4X5LA 1KJVA 4UT6H 4ZODA 5ACZB 1RIVH 1Q72L 5A3IC 4OKDA 4ODUA 4P5KA 1KCKA 3BZFB 1DFBL 4MLIA 4YEEA 5J13C 1QBLH 4MSWB 4KK9C 4J3XA 4B5EA 3ZKMD 3RTQC 3FB8A 1LO0L 5TE7H 4F7CB 1DBKH 2GTWB 3ARGB 4LK4A 2LQRA 3ARXA 4XI5D 1OVZA 1QO3A 2Y4SA 1F00I 4OBSA 4X6DA 4NQEA 4GH7B 5CBEA 1A7QL 3V0AC 5GSVA 3QDJE 1N5YL 5JUEH 5BS0E 3SGKA 1TNMA 3QO1B 2DQCL 3CVIL 3JWOL 2Z31D 4KMLB 3ZYZA 2IAMD 4RFEA 2OJEB 4J1UB 3LRGA 2HN7B 2HLFD 1HWHB 3V6ZB 2P5ED 2YD4A 2F5AL 1JYVA 1AHWC 1NMCC 5DUML 5I71B 4WU5B 1WWWX 4G6JL 4EXPX 5HVGB 4HF5L 3ES6B 3IDGA 3GSVB 3HPJA 1YYML 5I9QB 4NZUH 1DLHA 5L7XH 3KPLB 1HOCB 4IRJD 4PBVC 1PEWA 4PJAB 3TEUA 1SJHB 1NFDB 3GI8L 2AP2A 1LNUB 2XY1A 5CHNB 5C07A 1U58A 5IJVA 2EE9A 1K3ZA 5JW4R 1IAIM 3BP7B 4W81A 1T1WB 1BD2A 2VDLH 5FM4A 5L88H 2XKNB 3WJLA 3MRBA 5DJCB 2VLKA 2GJ6E 1ZVYA 1S9KC 1XGRA 3ULSB 5D7JC 5C0JA 1NCWL 3K2UH 3SN6N 4G8GE 4W4OA 5F9WB 4L3EA 3QDGE 3DUSA 4WFHE 4EI6A 5B4MC 2Z91A 1CF8L 3C08H 3LKRB 4JPWL 2P7TB 3IGAB 5FKPB 2OBGA 3WFEH 5AYUH 4RBPK 5CGTA 3DX8B 4Y5YC 3RWGA 4YGAB 4OCXH 2ENYA 3AS0A 5IB4B 3QRGL 3LEXA 4U1HA 1HQ4B 4ELMB 1KLUB 3GKWH 1J8HD 4LSTL 2DF3A 1LO5A 2NY1D 3S96B 1D6EA 4QRPA 5D72H 4XPTH 4M5YH 2YN5A 1WWCA 2I5YH 3WFBH 3CMGA 4KK5D 4PUBL 3ZE1F 2COQA 3SDXB 4GXUN 1KJ2B 1DUZA 3A6BH 5DEFB 3T0XA 1VCAA 4GRLA 4PJXA 3OR6B 4PJCA 1JTPA 1FAIL 4XPAL 5C2BL 3IXTB 5BJTA 5E6IA 1NMAH 4Y8AA 1K3IA 3A67H 5T3XH 4YC2C 4XZUB 3NPZB 5FA4B 1E4WL 3VXRB 4G42B 2MMXA 2V7HB 4LRIC 12E8L 4LPUA 4F2MA 2BP3A 1T22B 4P5MB 1YNKL 2AKRB 3IU4L 1XGTB 2AGJL 1KG0B 2CPCA 1IKNC 1MCPL 3BWAA 3LOWA 1CTOA 1O7SA 4NM4H 4KJPD 1RZ8A 4M48L 4IHOA 4R90H 2RB8A 1CFBA 2NY0D 4JQVA 1DEEB 2CGRL 1QFWI 2VXUL 2VSDA 4N90E 4YQXH 4E41D 4Z76A 2E6QA 5GGTL 3QUZA 3D25B 3SY0B 5FDYA 2IF7A 3D69B 4JHBA 3TVMB 2UZYB 5DJDA 3D9AH 1NFDF 1CDGA 4EBQL 1DUYA 4A6YH 1W0VA 2XZCL 1U8LA 2AW2A 4AG4L 4NO2B 5HHVL 5GRJH 2P5EE 4RGNC 1GC1C 3PQYA 4HSQA 2OL3L 5IESL 1HYSD 5ISZB 2F9BT 4P4KB 4B41A 1R3IL 3LSOB 3QXUA 2AV7B 4XB8A 5LAXB 4GW4A 3QUXC 1A7OL 2DD8H 1IM9B 5DC9B 2BNQB 5K9KA 1QEWA 2BMKA 4LVNC 2J3SA 3BWUC 3LKQA 3V4UH 2Y23A 1CFQB 1OP9A 4A6YA 1OM3L 1F8TH 1HHGA 4JZJA 2VOTA 5E1AA 5J6HA 3QIBA 3ZHDA 5EG6C 4BK4A 3KS0H 5SWZB 5H37H 1QBAA 5DJ2B 1NCCL 4PJ9B 1MH5A 1I8KB 3H6JA 3F58H 1NUDA 3D39A 2E7MA 2XICA 1UWGH 2A6IB 1II4E 3D3VB 3GMMB 4QHKJ 2EXYD 3H3KA 3MGTA 1FFOA 4X80L 5EUOF 5INDA 4HXBH 5D7IF 5E1HB 1KEGH 3AY4C 2DM7A 2JLLA 3TA3B 2C4XA 4WENB 4N1HB 2BHUA 4NCDA 1IC1A 2FR4B 2X05A 1TETL 4TUOA 1KCUH 1YNLH 1CI5A 2ADFH 4KI5F 4NQVA 5KVEH 1JZ2A 5DK0B 1YEJH 4I77L 3D2UD 1MIML 1JL8A 3TBYB 4HUXB 4M7JL 1UWEH 4P3DA 4OV5A 4IOSD 1MRDL 3K0WA 2YPLD 3KLHD 4GAYB 4P2QB 3RPIA 3BHBA 3VXOA 3LIZH 3ZO0A 4X8XA 5EC1A 2R0WL 1J0ZA 1G7MB 4O2EB 1RZ7L 4PGEB 2OP4H 1NC4D 5F7UA 1M7IB 4I4WB 4YDIH 3E6FA 4YHOH 5JO5A 5L2KB 5DJAA 2XWBB 4OT1H 5BRZD 3VDAA 3C60B 1IQWL 2OS7A 4LLWB 3WNOA 2VC2H 1U8JB 4I18C 1SQ2N 4FQ2L 4XCEA 2BRRH 3LQAL 4JFYA 4XNQB 4O58L 1EEUA 1RJZA 4AMKH 1MJ7H 2EDWA 2XTJB 4XMPH 1FYTA 2LV4A 2X9YA 1G9MH 5DQ9B 5I18L 3U7YL 4YUEH 4P59L 5IVXB 1JF1B 4XBGB 4Z78A 4NKIH 1QBML 4MYWB 1N5AA 3FKUS 5SWQB 1ACZA 3DIFB 3PWVB 3OBAA 4TVPL 1U6AH 5FYJH 5SWSA 1MLCB 3MA7B 1JUFA 2X4UA 2YA0A 4PP2A 1D6VH 5IEKB 5F6HJ 1G6VK 1MQKL 3P4OB 1MCWM 3FOMB 4E41E 3LDBB 3HCVA 4DGIH 2YD1A 4HS8H 3OQ3B 5DHXB 2P1YA 3B6SA 3O9WC 3ZE2F 3RVTD 2ICWJ 2V2XA 4YAQB 5DJZB 1JGVL 4M4PA 3I3BA 1X3DA 1OAUL 2DQJH 5DRWA 5A43C 4HJ0D 3VFWA 4PGCB 3VU2A 2NW2A 1WJ3A 3X14A 2VLRD 3OKEA 1CZ8L 1JPTH 2DLEA 5ITBH 1A6VL 3PGFH 3VWJD 5I1AB 3SCMD 2HH0L 1OAQH 3BX7C 1XFPA 4N0UB 5EZIL 4GKZB 1OWWA 1D5BB 5EIIA 1UZ6F 1KXQE 4ZXBD 4YXHL 2DTSA 1UM6L 2B1HH 1FL6A 2E9IA 2IMMA 1I9JL 1OAYL 3HNTH 1N3NA 3AUVA 4Z7WF 4PLJC 4HH8A 1HZHL 1IGCH 5EBMB 2RCSH 4KXZH 2W92A 2YXMA 4L5FL 4NO5B 4IEFB 1S7SA 1C08A 4G8EA 3S35X 3QNXA 4MQSB 1DN0A 3EYUL 5BZDB 1U3HB 1Q9KB 1A2YA 1D9KC 3ARPA 4KUZH 3HTLX 4QCIA 1XMWA 2XN9B 1OPGL 2B2XL 2HYMA 3BPLC 4DVBB 1D5XA 3EYQC 2A9ML 4UDTA 3PWLA 5IG7B 1YUHB 3Q3GB 2ILLA 1M71B 1OW0C 3X3GH 1OAKL 1KFAL 2HFTA 5FGRA 3SQOL 1YMMD 5IK3A 1VERA 4R7NB 3ULUE 3BKCH 3WXVH 1C1EL 2VQ1A 1YEGL 3G6JB 1QHPA 3G5XA 1V3MA 3VXTA 4JM4L 5B39A 4WY7H 3CPLA 2YPLE 2FYYB 4JFDD 4Z77B 5FYLL 3FFDB 3QG6B 1Q9LA 5JOFB 1L9MA 5FYKL 3KYNA 1EZVY 1LEGA 2CKBL 4PRDB 3QIUC 3LS5L 4UV7L 3ZKNC 3L9RB 3PV6B 3Q1SH 3C5SA 4KHTL 1DVFB 3SDYL 5C08B 4DTGL 3P0YH 1C5DA 5KS9F 2EZ0D 1RUMH 2XKSA 1A6TA 4LVOB 5B21A 3BW9A 4ISVA 2AXFB 4QHNA 4JRXA 1TTUA 5ICXB 5F8QC 3SDAD 2WIIB 1AE6L 4K8RL 3BP4B 3BYYA 4URTB 4M6ML 3PL6A 4BJLA 1RHFA 4H5SA 3SE4A 3IETB 3HE6D 4M7ZB 5F3BA 3MA9H 4G6KL 3P30L 3LN5B 3QDHA 3OKYA 3BW9B 4GBXA 1GZPB 3MRPA 4NKDB 4MNQA 2YPVL 4D0BA 5I1CH 4JZOA 5EU7C 4MWFB 3UO1H 2PW2A 3WYRA 4UOJA 1RURH 1HIML 5LKNA 2VLMD 3O41B 4XVUD 5JLZA 1NUFA 4YE4L 5HHOB 1NGYB 5LBSL 5KN5B 4HFWB 3MOBL 4NYLB 5CILL 5JNYB 1QR4A 3MRPB 4OF0A 5FO9A 5DWUL 4X4YA 5J06A 2IQAB 4Y4FB 3IAGC 5EWIH 1JHTA 1QKZL 4U7SA 3GMOB 1K9TA 4BYHA 1NAKL 2VO5A 3SKJL 3B9VA 5D93C 4KKAD 1KB9J 2Y7QB 3FT4A 3TBTB 3FRUA 3QCUL 1JWMB 2WW8A 2R1XA 4H0HB 4X9FA 4MD4B 1ZLVH 5TGBB 4G9FB 5AUMA 2JCCF 1NMBL 1RK1A 1QUNA 2VR5A 5IW3A 5IV2B 5E8OA 2KDGA 1PZ5A 3R8BB 5A2KH 1I7TA 2DJ4A 4O02L 3L5WB 4B7LA 4ONOA 5GJSH 1X4YA 1BQLH 3OKDB 5DTFA 3WNLA 5E8PB 1EPFA 5FKAB 1P4LB 5DD1H 1HH9B 2VAAB 4J3UA 4LSUH 1A0QL 1J0IA 4L9LB 3MLUL 4MNHA 4NNYA 3TZVB 2X4OB 2XQBL 1IGIL 3QCVH 2N7AA 4S1RH 4C59B 1BPVA 3DV4B 4LIQL 4OGXL 2MTPA 5JPMB 4J23A 4LLVA 4Q6IA 1RZJL 2ICES 2RGSA 4R4BA 5TFSH 4OZIE 5JDSA 1A7RH 1YEDB 2ARJQ 5MEOB 2F53D 4U0QB 1N8ZA 4N5ED 2FO1A 1UH3A 1JHKH 1OAXH 1P7QA 1BLNA 5ANME 4C55A 4HXAH 4PP1D 2ZOLB 3PHSA 4RGMC 1KCLA 3Q6GL 1YMME 3DI3B 2DTMH 4TULL 3U4BL 1N0XH 2Z0BA 2A0LD 3MXVH 4H26A 2ZUUA 4PY7A 2AEWA 4K23H 3QHZL 3U6RA 4H25B 3WL9A 4CMHC 1A6WH 3V5HA 1FCGA 1RZIA 1CDYA 4JFDE 1V5JA 1ZE3C 1F11A 4HIXH 5B3NA 3HAEG 3QDJA 2ZG2A 1EHNA 1VACA 4OM1L 4GW5A 1CU4L 2FL5B 3UTOA 4K3HA 2RR3A 2NY2B 3EFFA 2H1PH 3KPRD 1QLFB 1HHHA 2QR0B 1U8NA 4AEIL 3EYOB 1P84K 5D1XB 2H2SC 4JY6B 5CJBA 3GUTA 1QQDB 1DBJL 5ENWB 5CZVL 3OKNA 2MCPH 2EDEA 1UADC 2IG2H 3O6LL 3BGFC 1CR9H 5FDWA 3EO0B 4LLYA 1NC2A 4HAFA 5E2WL 1SBSH 4NQSA 5DK2B 1S7QB 4PRPD 3V79C 3H7LA 2EDDA 2ZOKA 4OJFL 4RMRA 5L2JB 1OGAB 5DQDH 4JE4B 3KPMB 3U7AA 2VL5A 4PD4J 4NN6B 3IDJB 4ZFFB 3REVA 3DVNA 3HR6A 5CBAA 3AU1A 2GJ6A 2VLME 4JHAL 1XCQA 4O00A 3B2VH 3SGEI 3O3BA 1ETZA 3MGAA 2VKXA 2BXYA 4L8BA 1H15B 2FHBA 5EZOH 3WFCH 3PV7A 4HWBL 1AKJD 5HDQL 2DB8A 4WW1B 1NLDH 5HGAB 2I9LB 4Q9QH 3AFLA 4K7FA 1ZAGA 5K59F 4P99A 4N0CC 4Z7QE 2NY4D 1VADB 2ESVE 3U2SA 5T3ZD 1FFPB 2J2ZA 1AP2A 4BFBD 2KQNA 4JG1H 3FN3A 4J4PC 5EU3A 1SJEB 3QJHB 4JB9L 3ARGC 3C5JB 5KVDH 1HNGA 3ARFB 4PGBB 3RIAF 1JFQH 1L6XA 3MBXL 2YUXA 2I07B 3TNMA 1R24B 3O8XD 5F9JB 1G7QA 1A6AA 5JIIA 1FZKB 1J1OH 5I66A 2C3GA 3HZMA 2EDTA 1KTDB 1CL7I 1IAKB 3JTTA 1MFAL 1QFWL 1KIQA 1LWRA 2A83A 4U05A 1DBBL 3GI9L 4P57A 4LVHB 5IKCA 1MREL 1RJCA 3QEUA 2FATH 4IOFD 4KGJA 4HUVA 5E70A 4TTDD 4APQD 2F15A 1G7QB 2F53E 4MDJA 3B2UC 1BWWA 1RK0A 2E7BA 3F7QA 4JAMA 4K9EL 4LBEB 1WZLA 1EO7A 4WGVB 4LLMA 1AIFB 2XWTA 5E00A 4Z0XA 5I9QC 1NCNA 4LLAA 4H8WL 1TVBB 4FG6D 2OJZL 3FONA 1WZ1L 3UAJD 3MJ7A 4JO4H 1I3VA 3VFNB 3NH7H 5IR1B 1A3QA 1X5HA 5CEYA 2Q7YB 3RY6A 1EAPB 1FVCB 4N8CL 2BVTA 4GAJL 4RCAA 2VZSA 3BIKA 2WUBH 4BQ6A 1WFUA 3MLZH 1AXSB 1OD9A 1WEJL 4FZEL 1T4KA 5IHUL 5DRZB 4HV8A 3ETBF 5C09A 2Z31A 3A6CH 4LAQL 2IAMA 4LLQB 5F9WC 3KPRE 1UXSB 1CE1L 1UB5B 3HAEH 1QVOB 2DJSA 2B20A 4HULB 2WUCL 3I75A 5F7HA 3WJLC 3V52H 3NCEB 3R0MA 5F1NA 5HHQA 5ID0A 1DP0A 4Z9KB 3R06A 5INCA 1T21B 2J8OA 2Y9RT 4BSWB 5IT2L 4F58L 3PHOB 5BVPH 1G9NH 1NBQA 4CVWA 1SVCP 3AC0A 4OCSL 3QA3B 4W4OC 5DSCA 3CMOH 4W4NA 4TNVF 4FQ1H 1B0RA 4IRSD 2PYFB 3VMPA 3QXAB 4IRJA 4PRPE 4NP4L 1BVLA 2C5DC 3PJSA 4PJEE 4M7KL 5F1NB 3ARBB 4JKPL 2V6HA 4OZHB 1A1OB 1PLGL 4XP6H 3JSSA 5ADOH 2ADIA 4XPBH 3ZSTA 4MD5B 4JFZL 4EN3D 3HAEA 3KYKL 2V5SA 1B2WL 3W9EB 1MHPH 1MAKA 2PXYD 4U1IA 4LPTA 1RUPH 3UZQA 3LZFH 4LSVH 3H7BA 3MLVH 3TM6A 2W60A 4EVNA 4GRLC 4HJGB 2FX9L 3IB4A 5HPOA 4ZS6D 5CSGA 2CDEB 2DQUH 1HK6A 2YUWA 3MR9B 2F58L 2GK2A 2ZCHH 5AZEH 1IE5A 4U6YB 5E6IC 3NFSH 3RNQB 2CDFA 1L6ZA 5T3ZE 1J8HA 3HNVL 4PJBE 5IFHL 1F58H 3S6CA 4Y5XA 4M93C 3CVHL 3T4YB 1FZMA 1R3JA 3VA6A 3BQUD 1U91B 1FIGH 2B0SH 1RULL 4M8QA 4OZGF 1U8KB 1KENL 1SYSA 2R4RH 1ZT7A 3F12B 5FB8A 5L6YH 4S11A 5MEQB 3DV6B 3B9AA 5FF6A 3QXWA 2A6JB 5J6GB 3BAEL 5FV1L 3S37L 4JQVC 3T0DA 4HDIB 5I8EA 3VI4F 1JPGA 1JHLL 2VITA 1BBJB 3QXTA 4POYA 3QUZC 4Z95H 3HZKB 5AYQA 4PJFE 5F70A 4MAUL 5M7QA 5TPWL 3DLQR 2A1WH 4JDVA 4RA0C 3D6GA 1RIHH 3T3ME 1B4JL 2GFBB 4P4KC 1RZFH 1QLRA 4DN4H 2IALA 5CD5C 3S97C 4HT1L 3VGEA 5IBLD 1WITA 1WBZB 1W2KT 1A9EA 1SEQH 1T2QL 1UCBL 3QZWG 4I0PD 2Q87A 1GZQB 2W65B 1WBXB 2XV6B 4IMKC 3BFOA 4M6OH 1I7ZB 1KCVH 1N6QH 1XH3A 1CFVH 4GXVL 4E41A 1AO7B 4NUGH 1IBGL 5DURD 3GSOA 4ZNCD 1N7MH 3D18B 3GFUA 4XHJC 2D31A 4WDIA 2NTSP 3ZT7A 3WEXB 2QQKL 5F88A 4OZHF 1SYVB 4I48B 3QI9D 4PR5B 4RMQA 4XCCH 4Z8FH 1NKOA 4KVNH 3MCG1 4NNXB 4LFHD 1JRHH 1LK2B 2ATPA 4JZJC 2WIMA 5E24E 2J88L 4R9HA 2H9GA 1J5OL 2PO6B 3QIBC 4ZYKB 3QUKB 4J12A 5JORA 2R56H 3QO0A 2Z9TA 4S1SL 3HI5L 3OL2A 1I8IA 3VFTB 5FUCC 2DI7A 1JZ6A 1L7TH 4RQQA 5BMFH 1TZGL 1XR9B 1FNHA 2QQNH 3PP4L 4FMKA 1P1ZA 5DJ0A 2F5BH 3HC4L 4YHYB 1GXEA 4JREC 1F3DH 2MCG1 2EYRA 3PWJB 4M7LL 2DQFB 4OFYD 1UM5H 5CJOL 3TV3L 4RA3A 5IHZA 3GGWB 1NBYA 5T1KB 4S0TD 3JV6A 1T04A 4PRAA 5E99L 5E9DD 4KRMB 4D8PA 3IXAB 4CVZB 2AJSH 3OAYH 3RWIA 5IIEB 4XX1E 1YC8A 4UIMA 4X7CC 4U6VH 4ZFOL 4LOUC 1DQQB 3K4AA 5DZNA 3UDWA 1TMCB 3VFGL 3X17A 1SEBB 3DYMA 4MJ2A 4D9RD 4JFQA 5HYQA 2UYLB 4U1NB 4ETQA 5GRUH 2P8LB 1E28A 1XIWB 3DRQA 2OTWB 1KIPA 3CXDL 2F54B 2NTFA 4Y19B 1MEXH 3H42H 3KJ4C 2E7LC 1NGQH 1E4XH 1A3LH 2O26U 2W9DL 3QUML 4JRWA 5A2IH 3DETC 1NL0L 3OKMA 2IMNA 4WFED 1N64L 5SV4A 4ZPTA 2DMKA 3UPAA 3D2UA 2DJUA 1PJ9A 5F7KC 1TQBB 3NA9L 4OF3A 5C9JA 5C0CE 4KQ4H 4ZUTA 2YPLA 2FZ3B 3LN9A 5HYJB 3WIFB 5JXEA 3LDBC 4OQTL 5FA3A 4NO0D 5HHPA 4QHUA 3VWKB 5D1ZB 5I16A 5BQ7A 4BSJA 2PR4L 3TH4T 1JNJA 3L5HA 3EDKA 5E4EB 3BDYH 2WQRA 3QQ3B 2Y6SC 5BRZA 3T77A 4PG2A 3VI3E 5C7XH 4FQLL 2NY3B 4Y5VA 2DI9A 1FE8H 1I9IL 3QHFL 8FABB 4FQIL 1JWSA 3L7FA 3LKOB 1J0KA 4XWGL 5CGYD 1WCBA 1A6PA 3IJSA 1PZUB 3UBXG 2D0HA 3V5DA 4XP9H 3HFMH 3BD5A 2Y5EA 3VH8B 4DAGL 1P4IH 3CUPB 1DQJB 3F7YA 5F7YC 1QFWM 2K3TA 4KKNA 4Q58C 4HPOH 5ALBL 5KANG 2I60H 3BI9X 3K2MC 4UTAL 3WIIH 3W9DB 3RUGE 3MNWA 4PJGE 2V2TA 1VKXB 3NGBC 3OPZL 3FQUB 5ITFB 2HG5B 2VZTA 3C9NB 3P9MB 2FX7H 4M6NH 1X4ZA 1W8OA 4RAUB 1AC0A 4RMVA 3NCCB 5I1IH 3ZYJA 4S1DD 1OL0A 1ZANH 2IQ9L 5EBWA 1K4CB 3SE3A 1KN2L 4NRZA 3CXHK 2PUQT 1MNUL 2QL1A 4JKMA 2VLRA 4YLQT 3B4NA 5KJRL 4JR9H 4X0KA 4CAGA 3VWJA 3SCMA 1OTTC 4IIQA 1V05A 4KZDH 1XGQA 5EORL 5EU6D 5KSVB 1YDPB 5D2NA 2BHYA 2RFXA 1IEHA 4TRPL 4FN0A 1P69B 4O2CA 3H9ZA 4P0DA 4CW1A 4ZXBA 3NCYS 4LHUD 1J0HA 5FV2A 2DQGL 3P11H 2EDRA 1NANH 4G8FA 5KVFL 3BD3A 3QZWA 1QLEL 4FFYH 4MA8L 4NKOB 5EFIA 5BZWA 5C0EB 1N0LA 1HHIB 3D85B 5DJ6B 5KZCD 2C3VB 2D7MA 4HJJL 5HHNA 4YBQC 4NFDA 1JNHA 5E9DE 3UTPD 5FOBA 1D5ZA 1U8MB 4XVTH 3O0RL 4ZTOH 3FQXB 4GRMA 4O5LH 3HMWH 3T0VA 1FJ1B 1T6VN 2H3NA 1P9MA 1P5UA 3QULB 2X4RA 1E6JL 4X83A 5DMIL 4OZIA 4E42A 5IHLB 4HH9B 2X4QA 1ND0A 4G7YL 1WSST 5HSFA 1BX2A 3PXHA 3SJVB 2CD0A 4JY5H 3RU8L 4PJ8D 4U0RC 5ANMA 1DQDH 4KUCD 3SDCB 3DTXA 2AK4B 3TESA 5IB1A 3RA7H 1YMMA 1TNNA 1JZ8A 5EH1A 4WFEE 1QA9A 1P4BH 2X1QA 3L5JA 5BXFB 3CIQA 3QFJD 4ONGL 2C1PA 2VH5H 3CFCL 1HXYA 3V6BR 4PY8J 4C83B 1VEPA 1ZMYA 2VR9A 4HGWA 4Y1AD 4XC1H 5HI4C 4HD9A 1K5NA 5DMJB 5J56B 3SE4C 1XGYL 1S8DB 3MRJB 4MCZA 1I7UA 4P2RD 3VFSA 4TSBH 3VXSB 4G3YH 1HINH 3MOQA 3RL1B 4GBXC 4GMTH 2DQTH 4F80A 2CMRH 4GRWH 4Y4FC 4HZAA 1T6WA 4R2GB 5EO9B 1AJ7H 1NJ9B 3QP3A 4M7LT 1MCFA 3O2WH 3T0AA 1FL3B 1RZKL 3QPQD 4Q0XH 1UZ8A 2OX5A 1M1SA 3QNYB 1H3GA 5JTWA 3T0EB 5EBLB 3V5KB 3S35L 1X44A 3SDAA 3LN4A 2GUOA 2XY2A 2NZIA 5GRVK 3V4VL 3TO4A 3IFPA 5DA4A 3O2DL 3HE6A 3NACH 5EUOE 4P23D 5J3HD 4YPGA 4F57L 5HI3C 3DRTA 1J12A 2B8OT 2E6JA 1RHHB 3OKLB 1U8HB 4LRNL 1OCWL 3T65A 4L9LC 4Z7VB 4HWEL 4EKXA 1CDBA 3BEVA 3O45A 1KNOA 2VMFA 4YK4C 4FZ8H 3LV3A 3BSZL 2BK8A 3GBLA 3SDDB 4JO1H 5FECB 2ZCLH 5IVNA 1QBBA 2F19L 1CD9B 2ZNXA 3VFPB 4LCCB 4FQHB 3U9UA 3WHXA 3O4LB 2AJVL 4LGRB 4MA1B 4S1QH 4X6DF 4QXGL 1CL7L 2ZPKL 1YEEH 4XPFH 4KMQA 2CR6A 5ESVB 4OBRA 4Q6IC 2VDQL 5F7EH 3IVKA 1T0NB 4JFEE 3F5WA 4HIEA 3VGAB 1MUJB 4HQQL 1OAZH 1ERNA 2YXFA 1OLLA 1RJLA 5IFJB 5GXBB 1GAFL 5C0GA 3FO0L 1FNSH 4PRNA 3EOYG 3O6KL 4HEPG 1S7UA 3IAPA 1EXUA 4KTEL 3UTPE 1G7JB 4RIRA 2O61B 2X89D 1F3JA 2A6KA 1J8KA 3JXAA 2DWEB 2NYYC 5IFAL 4O4YL 2CRMA 1S78C 4R97C 1X9QA 4LF3B 2HLAB 1X6LA 3ULVC 3ARSA 2H8PB 4LSPL 2CIKA 2F53A 4FFVD 3T8XB 3ALPA 1BFTA 4U1MA 3S4SG 4YFEA 3QH3A 1FL5B 5DEGA 1PX3A 5EU5B 2BOBA 1YPZE 1HI6B 2HFEA 3GSXA 3PP3H 4Y2DB 1OD7A 2VDRL 1X5IA 2X1OA 4FQQA 4M3KB 1DQLH 1P84J 3JZ7A 4NGHL 2ZKHL 3FN0L 3VFOA 4XCFH 2FEDD 1KXVC 3DO7A 5IMKA 3IJHA 3PDDA 2XA3A 3GM8A 4Y1AE 3W0WB 1NAMH 4LSQH 4KK9D 4XX1G 4Z7WE 2NY6C 4P2RE 4U31A 4NRYB 5C0BB 4L4VB 1XGPA 4TQEL 1LP9E 4KZEH 3DO7B 5FUOL 3KPRA 3RWEB 4CMMB 3ZDYE 5JHLH 3X11B 3FMGL 4DK6A 1MSPA 5JW5B 4JM2A 3MRDB 5KVMC 3GSNH 1AR1C 4PJXF 1HKLH 4DKFH 1CXKA 4XCNA 1UYWL 4PJCF 4OAWB 1MFBL 2R1YB 5AZ2H 3BKYL 4KJQD 1X5JA 3P4NB 3TT1H 2IPUG 3HLAB 1CICB 3GHEH 2HTLC 4PJEA 1NAMA 4JM2B 1HEZA 2QSVA 3ARFC 1M05B 3C09C 4AEEA 5T3ZH 1TIUA 4XP5H 2GW5A 1Q0XL 2X9XA 1NGWA 2W9EH 3KPSD 2DWDB 2KH2B 5DI8A 2ZP0T 5GS1A 4ODSL 3B8SA 5HHME 2BY0A 4MHHG 4RZCB 2VXVL 3I9GL 3IFOA 4OKVA 5DK3A 4KKLC 3MXWH 2J12B 1A7PH 3VXMB 3IFNL 2AXGA 1JIBA 3FL7A 1ZOXA 2MFNA 1T1ZA 4R3SA 1A1MA 3CFBB 1A6ZA 1YEFH 4PJBA 3CFKA 4NO3A 3GJFB 1T66C 4BA8A 2IGFL 3TWCH 3T09A 1H3XA 1FO0B 3F7RA 4PPTA 3TYFA 4PV9B 3X12A 2CLVA 3VGBA 3V4PH 1ZA6B 1TZIA 4UILH 5FO8A 1LDSA 3O8XA 1IAIH 1QRND 4NQXB 3MLYH 1EHLH 4GQ9L 4KTYA 4XPGL 3MJ8A 5TH2B 3RY6C 4LCWB 5KSAD 1Q0YH 1R3LB 3UTQA 1NUGA 4XI5C 4BFIA 4HWZA 2HFFB 3HUJB 2Q8BH 4APQA 2HT4D 4OQ1A 2XZQL 5IB2A 4UT9H 4PJFA 1BOGA 3H9SA 2R29L 2WINA 4OSUH 4PS4H 2GTZA 2Z31C 2FWOA 2EDJA 5D7LB 3HG1D 2NXYD 4KFZC 1MWAH 4YHPB 3MJ9L 2HLFC 2DQEL 3I50L 2OK0L 2OR9H 1FLRH 5HY9B 3QDMB 3NCJH 2APXA 2R1WB 1X6NA 4LGPB 3KR3L 2E6PA 3KJ6H 2X70A 3DVGB 3CSGA 5CP3H 3ALXA 4IRJC 5F7NC 4R4FL 1NSNL 2YBRA 1LO4L 5JW3L 1BFSA 1Z9OA 3GJFK 4PIRF 4AIOA 4Y8DC 4KVCH 1KTLA 3WUWB 4QOKE 4GXUM 3VXPB 5EUKB 1INDL 1MWAA 3CAFA 3O2VL 4FXKA 4WUUD 1MY7A 3TPKA 5AWNH 5JMOC 2G5BB 4WFFD 1JNNH 3NFPA 1U8QB 3S4SA 3HZYA 1OQXA 4O51B 5F44A 4ZD3L 3HE7D 1G9NC 2P5WD 3I85A 1J1PL 4IRSA 5CWSA 5GSRA 4N0YL 2CSPA 1FPTL 1FFNB 3VGDA 4PJDE 3LHPL 3T04D 1VGEL 4RGND 3F8UB 3FO9A 2YRPA 5CP3A 5LGHH 2VUOA 4ZNEE 5GJTH 3C6LB 3QUXD 3B5GA 3KPSE 2JIXD 4EN3A 1RZGB 2NY1C 2ZUQC 4WWID 4LEXH 1NFIA 3SPVB 5DJ8A 4UDUA 1JNLL 3HR5B 3PWPE 2EO1A 1XR8A 4Q6YA 5JQ6H 2PXYA 4Z7NE 3UJJL 4KK5C 1KEMH 3CLEL 2J5LB 4ZTPL 5GS0D 1JGUH 3KXFB 3O3AA 4LSSH 3UC0L 3MRFB 4NM8H 3NCYP 4HIIA 4DVRH 4XNMA 3VG9C 1HH6B 1R5VA 4LU5H 2P49B 1CLOL 2QKIA 4XP4H 1OARH 4QRTB 4FP8H 5H2BA 1EHXA 1AFVL 1IL1A 3L5XH 3DROA 3IDIB 3IJYB 3L3JA 3OGOE 5DFVD 4P2OB 2EDNA 4WCYL 1KPRB 5EIVA 1MLBA 4LLDA 4QF1A 5J57B 3BH9B 1A22B 2QADB 4PB0H 2FIKA 4PFEA 4PJHA 1HHJB 3FFCB 3TNNA 3QXVA 4DGYL 4XP1H 5D71H 2UZIH 5KG9A 1C16A 1QRNE 2VDMH 4MNGE 4WVRA 4KJPC 2CLRB 4V1DB 2ENSA 3D48R 1RU9H 2NY0C 4BM7A 2LABA 1VEOA 4ZS7H 3INUH 3UTSB 4WU7A 4XHQA 2AK1H 4JGUA 5DT1L 1R3KA 4PJHB 3WO3B 5DZLA 1AGCA 3LEYH 4HGMA 4LPCA 1S9YB 4CVXB 1A7BA 5C71A 5EA0H 1ZEAH 1R5WA 2X44D 3DX7B 1I1FB 3MV8D 3GB7A 4K94H 4JQIH 2BZDA 3HG1E 1X7QB 4Y4HA 4LHUG 2EH7L 3TLRA 3WBDA 3OKKB 3BP6B 1TLKA 3RUGA 4I0PA 2A6DA 4UB0H 4PRHD 2WBJD 5HJ3A 4K3DL 1HYSC 1I9RL 3HB3D 4WJ5B 4RAVA 4PJIE 1I1AB 5CP7A 5GGVY 1BAFH 3DUUB 3G04A 5FK9A 2A2QT 3BOVA 3DBXA 4IBLT 3MOAL 4ZQKB 4F8TA 3L3DA 5B38B 5I1DA 3B3IB 1W72B 5IMOA 3QSKB 2OXHA 4XMKL 5C0AD 1KCRL 3QI9A 5I6XC 4NQTA 1OOAA 2D7OA 1Y0LB 3RZCB 4C56D 3VG0L 1OB1B 3LPFA 2BDNL 2ITCB 1ORQB 25C8L 2FBJH 4F15C 4WUUE 3N9GH 3O9WD 5EC2A 1URLA 4RISH 2JB5H 4WFFE 3GNML 1F90L 1S9XB 2C7UB 5E03A 1I1YB 1QOKA 1ZT1B 1BQHA 2BOCA 2V9QA 2OMBA 5D5MA 2P5WE 2O5ZH 4ODXB 5HGHA 1VHPA 4JRYB 4HX1A 2A74B 3LVEA 5DR5H 3K74B 3GEWB 3GMNB 2AJXH 4RGNE 5DS8B 2RJMA 4KPHH 4U6XB 4R96A 4OFYA 4KTDL 1FQ9C 2YOCA 3FAWA 1QNZH 1JWUB 4YGVA 3HPLB 5E9DA 4KHXL 4XNUL 1NQBA 5BVJA 4J8RB 2CKNA 2WMPA 4XCYB 1KTKE 3BGAA 1QR1B 1PG7L 4S2SA 5BS0B 1KJMA 4NSKA 3KLHC 1INEL 5JXEC 3O6FD 1PQZB 2XA8H 1LO0H 1I8MB 2EEBA 4FQCL 4L8CA 3RNKA 1OT1A 4UNVA 4CL7A 2UVFA 3BXNA 2IH3A 4MD0A 3TJHC 5DVMA 5C2UB 4PG2C 1YZZA 3TN0B 1N5YH 4JPVL 3BD4A 4J3OC 4X5WB 1FFQA 1LGVA 3FJTA 3MRCA 2B39A 4Y5VC 1JF6A 1WZKA 1ZGLB 2GCYA 1FZOB 2QJDA 3L3GB 4L4TD 2ZG1A 1BFVL 3G5ZA 1IGML 3AREB 4U3CA 3DXAD 2GSGA 4R7DB 3JV0A 1KLGA 3VJ6A 2BSSA 4NNPH 3KLDA 5FGCE 3UPCA 5I17B 4NO0A 3LKNB 1PY9A 1GGIL 4OLYL 4X6FA 4M6AA 4S10A 1CD1B 3LRSB 1YN6B 2DQIL 3M1BA 3GO1L 2VISB 4QLRA 1KPUB 2Z93B 3STLA 5IB3B 1TXKA 1YC7A 3CZFA 4X98A 4FXGB 5DRXA 4L3AA 3OHXB 4ODHL 3RX8A 4KJWC 3RY4A 4CRPA 4WHTB 3JWDH 4W6WB 4G8GB 4OD3H 1IGTB 3Q48A 3QDGB 3QIUD 3QXDA 1CDCA 1QSFD 5E2TH 3RVTC 3KLSA 3ZKND 4ZPVA 1RMFH 3B8YA 4W6YB 3SE3C 1TJHH 3CXHJ 3ORJA 5DRXB 4HJ0C 3MV7B 3TCLA 2NXZB 1Q9WB 1NCWH 1FVDA 1C5CL 2Z92A 5JA8B 5T1DL 5J4MA 4IIQC 4NN7C 2G60L 2YEZB 1NBZB 1CF8H 4CU6A 5TE6L 4F9PA 4PRHE 4NT6A 1S9WA 3ARZA 4LQFL 5D2NC 3I02B 3H3PH 4PJ5D 4ZXBC 1KC5L 5FO7B 3LKPB 3RWDA 5I73B 1DN2A 1Y18B 1X5ZA 1M6OA 4LSTH 1KLFA 4OZGE 4AM0A 2W59A 4HZLB 4PTUA 5C0AE 4TUJB 1W0WA 3BH8B 3QR2A 5JHDE 2I9TA 2DDQL 4PTTB 5I15H 3RIFF 3PIQB 4BZ1H 3OXRA 1S7XA 5F7DB 1G6RB 1XF4B 1AQDB 2JB6A 3I3DA 2IFFL 3GMQB 3RWCA 4UQ3A 5EU6A 3SDCC 1S7RA 4J3VA 4R26L 3GMPA 2VIRB 3BPOB 1P9MC 1G7IB 2XG4A 1MCCA 4XBPA 1NGZA 3WKML 5E5MB 2BNRD 2X4NB 1S7VA 5MEPB 4LHUA 4U1GB 1Z3GL 4NRXB 4LHQB 5IEHB 4GKNA 1A1NA 4HBCL 1AD0B 3FQTA 4JG0H 3FTGB 3BP5A 2EYSB 5F6IC 3T4AB 1MVUB 4HKXA 4Z7UB 3MRNA 4JVUA 3EW3B 1N4XL 1ONQA 3EO9L 5BV7B 2ITDB 3CJJA 2YPKA 2C1OB 3AAZB 1UC6A 3QAZB 4WI7A 3GMRA 1J87A 4HK0B 4P4RB 8CGTA 4NHCH 4LASH 3PGCA 4J6RL 5CJQL 3MNZB 4JQXA 1QYGH 5J0BA 4RGOH 3DGCR 5I76B 5LQBL 1KB5L 3NIDF 1P5VA 2J8UE 3T0EC 2EC9T 3O3DA 4PJ8A 4H1LB 4JZNA 4K55A 5F96L 4ZFZA 3L95B 1NLBL 5F8RC 3BUYA 1YPZA 3MTRA 1G7PA 1PKQA 2N56A 4L4TE 2PYED 5KW9L 3LQZB 4AG4H 1CFTA 3WN5A 1G1YA 5SX4H 1G0XA 4IDLA 3QFJA 1YJDH 2XZZA 4OLUL 4TNWF 3SDAC 4BH7B 4YDLB 4GG8B 1UXWA 4HKJB 2DKMA 4Y1AA 3O81A 2BY2A 3TO4C 4OFVA 2R2HA 3HE6C 4LSRH 4Q9RH 1FCCA 1MRFL 4P2RA 4I3RL 3KDMA 2NY5L 5I1EL 4YHIB 1ZVSB 2JK5A 1CFNB 1YQVL 4RWYL 2GI7A 2E8YA 2FCBA 2BVQB 3NMEA 4JY4B 4OD1L 1BP3B 1ZLUK 3L7EA 5HVHB 4P9HL 4YJZL 4XVUC 1K4DB 3PE9A 3GMLB 3EJZD 2FO4B 4DZBA 1FV1B 4QTHA 2ZJSL 2G75B 3BJLA 3U1SL 1LE5A 4KKAC 3T2NL 3GZKA 4OGZA 3ROOB 5ADPH 3OXSA 4NQUA 2ID5A 1OP5K 2KZ1B 3QUYB 1FG2B 3JV4B 1IEBB 2Q3ZA 1NDGA 4PJ5E 4E9LA 5EOQH 4DUXA 4F3FA 3GSQB 3MLSL 2ORBL 5A2LH 2OL3B 4Y4KD 3TC9A 1TETH 2P42B 1EGJH 4QHMA 2EIZB 3G5VA 4CN1A 2FBOJ 35C8L 2GIYA 5EU7E 1IC4L 3S5LG 4N0RA 5GRXG 3SO3C 4X4XA 4BFGA 4D0CB 2YD6A 2FGZA 5MI0C 2XXMB 4G6AC 1CG9A 5KSBA 3MJGX 1TTFA 3L1OH 3MRLA 1JN6B 1JBJA 3MO1A 1GGBH 4F7EA 1E27A 4KXZI 4OFKA 1I75A 2FGWL 5EZJB 4EQ2A 4GFTB 1WTLA 1NGPL 1A02N 4HCRH 2HJFA 3S3JA 4YHNB 5ESQB 2SEBB 3DSFH 5DLML 2NW3B 3V6FB 3LQAH 5MERA 2EIBA 1IGJB 2BNUB 1EO8H 4N0CD 1F4HA 4Z5RA 4XTRD 5GPRA 5DD5H 1EGJA 3OZ9H 3MZGB 5I18H 4P59H 2X89A 3IKCA 4YHZL 5LWYH 1YMHA 3UJIL 1CXFA 2A0LC 1P2CB 3ARGD 1JYXA 4GG6E 4FQJL 2FSEB 3D5OF 2KBGA 2GT9B 3CDFA 5JXAL 5J1AB 1MQ8A 2BSRA 4ONFH 5JOPD 3P9LB 5C0IB 1MQKH 1MHHA 1IT9L 4XVSL 4QYOB 1PDKA 5GZND 1UB6B 3SOBH 1JGLH 1T0MB 1O5DT 4GAGH 43CAB 1LQSR 2PYEE 3U48A 1INQB 1J18A 4ZUWA 1BGXL 4YDVA 4JM2C 2R2BA 2EDKA 4ALAL 2AJ3B 4WWKB 3U0PB 2MJWA 3M45A 3OAZK 1A6VH 3SKOA 5DEZA 1VFAB 2XFXA 3V9FA 4NQDB 3QQNA 5EZLA 4E0RA 5DD0L 4NC1C 5HGDB 1VGKB 4N0FB 2FH8A 3CX5K 4X7SH 2HVJA 2FLRT 2YHGA 1X5AA 3IF1B 1YYLL 2BSTA 2H26A 2ICEA 2DL2A 5E08L 4GKSB 1NCAL 5D96B 3ILPB 5E0QA 2YSSB 4WO4A 1TPXB 5HGGS 3RVVD 4LARH 2VLJE 1NEUA 3O3EB 2QEJA 3BO8B 5GS1C 1RVFH 4OF8A 4RMTA 1FN4B 3CFDB 4MMZC 5F9OH 3L3OB 1BF8A 5GISL 4DN3L 1QHOA 3VD3A 1XZ0A 4OIIH 3EYSH 3HKFA 3MLPA 4DJMA 2WP3O 2FNBA 3DX6B 5IW6A 4NN5B 4NZDA 1OTSC 4Q97A 5IM7A 5B8CB 1OPGH 2O5XL 4X6CA 3EOBB 2NY4C 4ZNEA 4HUKB 4HS3A 3VRJA 4ODTL 4HHAB 5EDXA 1HHKA 2VWEC 3E6HA 4DFHA 1OAKH 5I75B 2LE9A 3SQOH 1AC6A 2ATKA 3M17A 1RY7B 1IQDB 4M1CC 3CDGB 5JPNA 1C1EH 5I1GH 1IZKA 1NC4B 2E27H 5CD3B 3ROLB 5LGJB 2BY1A 3FRPG 5H35A 5KSUB 3O8XC 4LKXA 2Y07L 1LO2H 3TH3T 4OV6F 5JMRA 5HVWA 1FYHB 4UT6L 1UACH 3ZKXC 2HAZA 2EEAA 2IANB 2EICA 5D9SB 4ORGA 1BVKA 3IS1X 1QBLL 2B4CC 1KBGH 4L8DB 4NOBA 4IOFC 5SX5K 3MV01 4TTDC 4APQC 4M61B 3VXRD 1UVQA 1DBKL 4PGZA 3QNZB 3MX0A 2OQJB 3RJQB 4RFNB 3S34H 3RDTB 5D6CB 1AGBA 2V7NA 4ZUSA 1ZHBB 5M94B 4FG6C 1QRNA 3FQNA 4MNGA 3UAJC 3H0TB 4JFOA 1C5BH 5KSAA 2VZ1A 4EI5B 3ILQC 4I3SH 1FHGA 4LLUA 3VXQB 5JIPA 2XQYG 3I6KB 1KULA 4MA3A 5B22A 2EE2A 5JOPE 3TVMD 4GJTB 4YBHA 2VL4A 4OM0H 1XGUA 3ARQA 4NZUL 5L7XL 1N59B 3P77B 3HG1A 4HPYH 1J0JA 1WBYB 5LBSH 5LCVH 4CN6A 2CKBB 2ED7A 3OGCA 1A4KA 4YBLC 1CLCA 5DWUH 2V17L 4QY8A 4P4KD 3E3QC 1H3UA 5J7CC 5L88L 1WFTA 4PJIA 1LK3H 1SM3H 4OF7A 2AVGA 2G2RA 2JJWA 4IRSC 1GC1H 1NMBH 1RIUL 2Z4QB 1IM9D 3AROA 4WIQA 2WWMD 3MLTB 2BNQD 3K2UL 4PJAE 4RAHA 1HXMB 3RBSA 1JCKA 1K8IA 5JW4Q 2X4SA 3R1GH 2J5LC 2G9HA 3ARDB 1BJMA 1YECH 3C08L 3EBAA 3MRKB 1IJ9A 3P4MB 3UJTL 1MCIA 4K3EH 4WI6A 3VRIA 3WFEL 1IGFH 4GSDH 4ZSOA 3QEQB 3G6AB 5AYUL 4EN3C 1FNLA 5SWZD 1H8SA 4WUUA 3GK8H 4D9LH 2X4PB 5GS0H 2PXYC 4PJ9D 1IGIH 3GKWL 3AGVA 1NEZA 1WISA 1ORSB 2ADGA 3HE7A 4LIQH 4RMUA 4UQ2A 3VXNB 4ELKB 3O11A 4DZ8A 5D72L 2HJKB 3P0VH 1B9ZA 3D3VD 1Q9OA 2FECI 32C2B 1RZJH 3WFBL 2I5YL 1OQOA 2VLKE 3VD5A 3N85H 2QADC 4ZS6C 3MCKA 4MJ5A 1GL4B 3TA3D 2BVOA 5T1LB 4HEME 3PNWA 3S36H 2BCKB 4FNLH 5CSZA 3MV9B 4PRIB 1Z5LB 5GHWL 5GGRB 1IKFH 2JIXA 4JFDB 2R0LH 3Q6GH 1NMAL 2EC9U 3REWA 4JDZB 3A67L 4P2QD 2UV3A 4K7PH 3SDXE 3DHJA 3U4BH 4NJ9L 5D2LB 4P5TB 4JHZA 3GSUA 1G84A 3KPQB 1DJSA 3QHZH 4HUWB 5E8NB 3RHWK 2BC4B 4U49A 5L2KD 3MBEB 4X5XA 3C60D 4HUUA 4OUOA 1AD9B 5KTEL 2Q86A 1U8IA 3MRIB 4G8IB 3FCTA 1J88A 3K80A 5IOPA 4NM4L 5I74B 2FJHA 5CMAB 1CVSC 1EEYB 1F97A 1JZ3A 2DOCA 2HVKA 4PJ7B 4R90L 4PJXE 2XTJD 3SGDH 1O7VA 4XWOD 3VXRE 3HNSL 4UBDC 4PG9A 5H94B 4U1SA 4YQXL 3P40A 3PGDB 1I1AC 5IBLC 43C9B 4Y4HC 2ARJB 3WO4B 3D9AL 1DDHB 1GHFH 4E5XA 2ZSVA 4A6YL 5HYSB 1LE9A 2OTUA 4I0PC 1G0DA 3D0VA 2V9RA 5EOCJ 2UY6A 2J4WL 3MGOA 5GRJL 5A1AA 1XF1A 2OSLA 3FRPA 4AH2A 4Y16B 4K2UL 4HWNA 2IBZY 3MMEB 3NN8A 2J1KA 3PDGA 2VQTA 4OCYH 3EUUA 3NZHH 1T20A 3VW3H 3MV8A 2GJJA 5E8DH 1RUKH 5AEAA 4WUKL 3GSWB 5I2IB 2ESVB 3UBXB 5DHYB 3BRGC 1CDHA 2AQ2A 2D0GA 2N4IA 2GEEA 4WW2A 5T3XE 4JN2B 4ONHB 4OZIF 1S5IH 3V4UL 4PRHA 2VN7A 2WBJA 4I9WD 5HDQH 1AGFB 1F8TL 4UZGA 5DJYA 4HKZB 3FQRB 5LVEA 4LEOA 3PDOA 2QQQA 3WXWL 1BFOA 3KYOA 4MQ7B 1OWRM 1CFSB 1LEIA 4KY1H 3F58L 1FGNH 2GQHA 5HPMA 1UWXK 3VCLA 4C56A 1RFDH 4NPYB 1N2RB 4YDJA 1KEGL 3RWJA 2DQHL 4ZUVB 3SQBA 3MRHB 4ERSH 1KGCD 2XN9D 2YUZA 1TZHA 2ADFL 1JZ7A 4OB5H 3AREC 4XH2B 3D3VE 4QHLB 1MFAH 4WV1A 2AV1B 1UWEL 1DBBH 4YDJB 3MRRB 2YS4A 3KPPA 3LIZL 4Q2ZA 2AJZA 3C5ZB 1G9EA 4MJ6A 3ELAT 5DYOB 3B9KB 2EE3A 1TITA 1HSBB 4NZRH 4ZAKB 1T1XB 4QRQA 4R0LB 4K9EH 4OZ4A 5FUCE 3FO2B 3QIWB 4YDIL 5J9PB 3LS4L 1U93A 4OT1L 1IC7H 2DM3A 4CU8A 3HRZB 1IAOA 3TH2T 3P3YA 2BRRL 5KVGH 2WK2A 1UJ3B 3QWOA 3RGVB 4AMKL 3O6FA 1MJ7L 4YBQD 1G9ML 3DMMB 3V8OA 4GAJH 4YUEL 5IBTH 4M9OA 2J8UA 4GRWF 4I13B 5L2KE 2GITA 5HI5D 3FO1B 4NKIL 4FZEH 5K9OA 1DVFD 5IHUH 1H3VA 5C08D 4PYGA 5IROA 1JK8B 4DK3A 5IHBA 5FYJL 2E9BA 4L4TA 2B1AL 4NDMB 3DXAA 1OF2B 2C4FT 1D6VL 3JWOC 5E5UB 5CGYC 1T1YA 5CZXD 5IVXE 5GGUB 1F45A 4KJYB 3U0TB 4PRPB 4EIZC 4D0DB 4EUPG 4HS8L 4Z7QF 3HS0A 3HHRB 4LDEB 3CCHB 4M43H 4CN4A 1U3JA 1UKTA 15C8L 1Z2KA 4F58H 4JN1H 4NWUH 2DQJL 5T1MB 2P8PB 3MRGB 5GIRB 1VFMA 2J6EL 3OAUH 3PGFL 1OP3H 3GSNB 3QEGL 3CU7A 3SKNA 2RBLA 3QIUA 5HHOD 1QSFA 3QFDB 2CUHA 4G7VH 1MOEA 1AKJB 3BPOC 1IFHL 4F9LA 2QHLA 4YXLH 4PV8B 1LVEA 4QRUB 4U1LB 4BELD 4Y4FD 5ILTH 4LMQE 2B1HL 1P53A 1F6AB 2J7LA 3HNTL 1MCKA 1F6FB 1OSPH 1R0AH 3MFFA 4S0SD 4N0UE 5EU4B 5IBUB 4FTVA 1IGCL 3F65A 5TE4H 4I9WE 2FX9H 2YC1B 5MP6L 2VZVA 1JVKA 4OUUB 2VSCA 4NQCB 3Q6FB 3THMH 1WIOA 1AGDB 4JFPB 1WAAA 4F7PB 1SHMA 4KUZL 4X7TB 1I4FA 3HNVH 3EFDH 1DEDA 5IFHH 3ZHLA 3ZYIA 1ADQH 1VFBB 2LAGB 3TZVD 3EKCA 1S7TB 4PRBA 4RX4D 3HC3L 3X3GL 5A16A 2X4TA 1KT2A 3SE8H 3WFZA 4ZO8A 4JDTH 1MF2H 1DL7H 4G43A 1NKRA 1JI1A 1XF3B 3BKCL 3WXVL 1TCMA 2XN9E 2CLZA 1ZSDA 1H8NA 2BNRA 1MJUH 1ACYH 1UCTA 2GSIA 3U46B 2GJZB 5B3JE 2UWEB 1CLZH 1I7RA 3PWNA 1KUMA 4DOHE 1RAMA 3L6FA 2HWZH 1LILA 1J11A 3D0LA 5IUSA 4PJ8C 5ERWB 1BVZA 3H2WA 1GGTA 4WNQB 3SE9H 4NIKB 5EO1A 3IRZA 4MAUH 5TPWH 1ADQA 3HC0B 1JGEB 3MRQA 3DGGA 2LVCA 4JFXB 4HT1H 2VR4A 3G6JE 3WN5C 4GG6A 1QFUH 1JGDA 1E4XI 4RNRB 1CGVA 3L3IB 1DTUA 4PJEF 3P0YL 4HC1L 1RUML 1UCBH 3KNBA 4YIQB 5E94A 5HVHC 3WFDH 4I1NB 1FZJB 4N8VB 3QRFM 5T5NF 3CVHB 3TIDA 2P8MB 2CJUL 5C0FA 1S78D 2NY2D 5DMGC 3JWNC 4KROC 4TSAL 2DMBA 3ULVD 3QPXH 3IDMB 3SKMB 3VGHA 5TDOA 5D1XD 2PYEA 3KLAB 2HRLA 3QPQC 1WT5A 1EERB 1TCRA 4I3GA 3WE6A 1EAJA 3QUYC 3NPSB 2EEDA 3UO1L 2RQ8A 3KPOB 2J88H 4M62L 1RURL 1J5OH 1OP3K 1EEZA 1KIRB 3F7VA 3FQWB 2FJGB 3GIZH 4PJBF 4XXDA 3MUZ1 1FH5L 1OGAD 2LTQB 2DLIA 1W72L 4EUPH 5F89B 5EWIL 3PP4H 3NFNA 4NKMB 3HZVA 1J7VR 3VFVA 4YX2H 4M7LH 4PGDB 3RKDC 2IC2A 5HHOE 3UTTB 2GK0B 3GSRB 4ZOCA 4JO2H 1CE6B 5FHBH 1K8DB 4U4BA 5F21B 4MXVF 1CLYH 4MNQE 2FD6H 5E8EA 2W0FA 1P7KB 2EDBA 5GJSL 1BQLL 3PHQA 2R2EA 1R5IA 1ZHKA 3NCMA 4UT7L 4LSUL 2HA1A 1V3JA 4PJFF 2FH6A 3MUY1 3T3MF 4Z7OE 5F9AC 4DEPB 4EUPA 1R3HA 5C0CB 1JZ4A 5IJKA 4QT5B 1XF5A 4GUPB 2IH1A 2JELH 1H0DA 1MJJA 4DCQA 3FAXA 4TOYH 2HTLD 3IU3A 4KRPC 3JTSB 2HFGH 4X6EA 3ARFD 4Y4KA 4I5BB 1WLHA 5C9KA 4M5ZL 1N64H 2MHAB 4L3CA 5TFSL 2VN4A 1A7RL 3MUGA 4X9HA 3OX8A 4H0IA 3GBMH 1FVEA 1JHKL 1NANI 1OAXL 4ZFOA 5LG1A 2Q3AA 4OTXH 1RJYB 3STZA 3C6SB 4Z0BH 4RBPH 5TF1H 2NMSA 2XG5A 3V0VA 2DTML 4YNYA 3P73B 2AJYH 3I6GB 3HA0A 4OI7A 3MXVL 2AABH 4G9DA 2E7HA 4HIJB 2CK2A 4FFVC 3NZ8B 5D1QB 1A6WL 3T0BA 3DSNA 1ZA3B 4XC3H 2ERJB 5ACZA 3AXLB 3LQAC 2VE6B 4HIXL 4P46B 2K1MA 5DDHB 4PJGB 3BZFA 5GGSB 2VAJA 4MSWA 1L4IA 1T66D 1BOYA 4X99B 4DAGH 2VQUA 4F7CA 2FEDC 2GTWA 1LEKB 3ARGA 3RGHA 2QSTA 2B5IC 2CRYA 2W38A 1UQSB 4OQTA 4G80B 4XBEH 3QUMB 2BHZA 5E2UL 1CGWA 1GPOH 3EYFB 1QFOA 3UP1A 3VFUB 3QO1A 3LH2H 3LKSB 3CX5J 4WI3A 4CBPA 4WI4A 2YD3A 2IG2L 1Q1JH 4ZO9A 2OJEA 3CU1A 3QQ4B 4QGYA 1BBDH 4J1UA 1UG9A 1ES0B 1GIGL 2XPGB 2HN7A 4L8SB 1SBSL 1YNTB 4L1HA 3ULVE 3V6ZA 3BT2H 4V2BA 2GYSA 4WO4C 2IQ9H 4J3WA 2MSPA 4FQXB 1J05B 4WU5A 4CNIB 5DQDL 3MPCA 4YDKH 3MLXL 3ES6A 3GSVA 5C09D 4GQPH 5HGBB 3KPLA 2FECL 4KJQC 5I75C 1NGXB 1H3PL 1HOCA 2ZCKH 3B2VL 1V7MH 1S3KH 4J3TA 4PJAA 4TRPH 4F7MB 3VD7A 1SJHA 1NFDA 3ARBD 1LNUA 1IM3B 1OGAE 5CHNA 2JJSC 4LQ1A 3WFCL 2DQGH 4OLWH 3BP7A 2M1KA 1T1WA 2XKNA 3DO3A 4MAYB 5D6DA 4MA8H 2FRGP 5DJCA 4Q9QL 3UBXI 3S37X 4K71C 1RSFA 3ULSA 3OB0K 1G6RL 1KJ2H 5TQ0H 1T89A 1VENA 2H6PB 3S88L 5H37G 1ZV5A 4JG1L 5KANI 2R9HD 3NIFE 4GKOA 3NIDE 3LKRA 3VI3F 3WJJA 2Q76B 3EOAB 2P7TA 3IGAA 5KVDL 2Z8SA 5MHSD 5FKPA 3BE1L 3FB5B 2ADJB 3DX8A 4IS6B 3VMNA 4RSVA 5IB4A 1FC1A 1HQ4A 4GAFB 1KLUA 4ELMA 1J1OL 2MKWA 4GW1B 3QCTL 4OGAD 3OV6A 3S96A 4XRCB 3HI1B 3X13B 5BV7L 5IMLB 3SDXA 5C0RL 1K85A 1KJ2A 5DEFA 2OXGA 3RUGF 4PJGF 4LDOB 2V2WB 5KAQF 3OR6A 3CFJB 2C4FU 4NBZB 2BVYA 3WDHA 3IXTA 5KOVC 4BSVB 1CIDA 3Q5TA 5KSAC 1XGYH 4K7PY 2HP4A 1OLZA 3UTZB 4XZUA 4NHUB 3L3HB 4JO4L 5FA4A 2VUYA 3NH7L 2HT4C 3CSYB 3VXRA 4JEGB 4G42A 2V7HA 1IEAB 5EUOB 5DQJB 4F37F 5FCUH 5D7IB 1T22A 4P5MA 3WD5H 2AKRA 1XGTA 1KG0A 2NXYC 3S35H 3FHQA 1I3RB 5D5MF 4QRRB 4IOIB 5SV3A 1AGEB 1DEEA 4BQBA 5CUSH 1TJIH 1NDMB 3T08A 3ARDC 3O2DH 4N9GB 3RZWA 5IMMB 1AO7D 4QGTA 3CFEB 3RI5F 2CXKA 4CKVX 3D25A 4YO0B 1C7SA 4KK8C 3SY0A 1A7NH 3D69A 3TVMA 4FABH 3TF7C 5BVPL 1G9NL 3QJFB 4ODVH 2GAZB 3F62A 2X9WA 3CMOL 4FQ1L 1D5MB 4NO2A 1J1XH 3BSZH 2A73B 3T1FB 3C8DA 5ACLA 2QLVB 2WWKT 3BKJH 2OI9B 1D7FA 2F19H 4QTIH 1TTGA 4JFEB 1BEYH 3U30C 1C12B 5ISZA 1CXLA 4P4KA 3E0GA 3MCLH 3R8QA 4XP6L 3LSOA 5C09E 5GGQL 2AV7A 5LAXA 4XPBL 4UIKH 3HE7C 3O2DA 4RFOH 3W11D 3BEWB 5KZCB 1MHPL 1IM9A 1XF2B 3ZT6A 5DD3H 2BNQA 3CLFH 3GRWH 2AQ3A 1RUPL 3LZFL 4IMKA 1FRGH 4P5TC 3MLVL 1CFQA 3WS3B 1X5FA 1FP5A 1D5IH 5T1KD 2CRIA 4Y7MA 1T3FB 2BVEA 2VDPH 3SGJA 1TENA 5SWZA 1BZ7B 1GAFH 4BKLB 5AZEL 2ZCHL 3FO0H 5DJ2A 5B39G 4PJ9A 1I8KA 4KDWA 5GS0C 4IJ3B 5F7LB 5L9DH 4O4YH 2A6IA 1TDQA 3D3VA 3GMMA 4JPIB 1DCLA 4CADB 3ABZA 5I8CB 5MENB 5F97E 4UU9B 5ICYB 2F54D 1FIGL 1RZJC 2B0SL 3TA3A 3GRWA 1PG7W 1FNGA 3EGSB 2FR4A 2R4RL 2VB5A 5L6YL 1T7XA 1FNAA 5D7SH 3FOLB 5DFVC 4OGYH 5DK0A 2YZ8A 3TBYA 3TPUB 4HUXA 1T0PB 1ZHNB 5HYJD 4GAYA 3ZLQC 4P2QA 4Z7WB 4G6FB 4NGHH 2ZKHH 3PWUB 5ECJE 7FABH 3KG5A 4Z95L 1FNGB 3VWKD 1G7MA 5D1ZD 4O2EA 1LP9B 4JVPA 1J8HE 4ZUUB 3B5HA 4PGEA 2A1WL 4NKQB 3VFMB 1M7IA 4I4WA 1QPPA 4W68A 5L2KA 1RZFL 1PSKH 2XWBA 5DUPH 4DN4L 1HSAB 4LP4A 3C60A 2V5TA 4LLWA 1U8JA 1DE4B 2NY3D 4XNZC 2DIBA 5JXED 1IAII 2R8SL 1UA6H 3WNPA 4XNQA 4TQEH 1SEQL 2L4OA 3AM8C 2NNAB 1OSZB 5DQ9A 1KCVL 4EOWL 3FMGH 1N6QL 1CFVL 4P2CG 5IVXA 1JF1A 4P23B 3TJHD 4XBGA 4NUGL 3DPBA 5ETUB 2E7LA 5SWQA 1N7ML 3DIFA 2X7LB 3HI6H 3PWVA 2FX8H 1ZTXH 4YH6A 4GS7B 3CC5B 1MLCA 3MA7A 1FGVH 2CIIB 2OR7A 1TVHB 1MFBH 4WW2C 5J11B 4OD2B 1ZGLM 4XCCL 5IEKA 2PF6A 1H5BB 1PYWB 1ZHLB 2WBJC 3P4OA 4KVNL 3FOMA 5HHMB 1AO7E 1KPVB 2LAAA 3HB3C 1JRHL 1U95B 3U7WL 4OCLC 3RRQA 1BZQK 4LNRB 3RBGA 2R56L 4YAQA 5DJZA 4P3WA 3FT3B 2IBZX 4PGCA 4ODSH 4KJWD 1L7TL 1RQ5A 5BMFL 3EAKA 4M9PA 2QQNL 1KELH 5DZOA 4TUKH 5I1AA 5KS9B 3I9GH 5LJYH 4D3CH 4N0UA 5E7BA 1UM5L 3ULUL 4GKZA 1HN1A 3QHTC 1D5BA 2EDYA 4R0LC 4KUCF 2AJSL 2DQDH 1TQCB 3QIWC 4P49A 4U6VL 2WAHA 2GKIA 4WI5A 1YPZF 4WV1C 4UTBH 4YR6B 2IJ0C 3AS3A 2VZUA 5CCKH 5I1KL 5IVZB 2W0KA 3MYJB 1KJ3H 1UJ3C 3K3QA 5GRUL 3RGVC 5EBMA 4H20H 1W0YT 4NO5A 3DMMC 1U8PB 3K4ZA 3AS1A 1MEXL 5BZDA 3H42L 1U3HA 2YD9A 1Q9KA 3DJ9A 3BZ4B 1NGQL 1E4XL 1A3LL 2Y5TB 5DHVB 3RL2B 2XN9A 3TO2B 1LP9F 3O6FC 4DVBA 2NY7H 4HUMB 3ZDYF 5IG7A 1YUHA 5F1SA 3Q3GA 4AZ8A 1U8OB 1M71A 4KQ4L 3BUTA 3SDCD 4DFIA 2AK4D 5DJXB 2JCCB 1SY6H 2XZQH 4R7NA 1MI5B 5IROC 4MHHI 3BDYL 3ZE0E 4K9EC 3G6JA 5C7XL 1CD0A 5J13B 3EYVB 1T5WB 5HYJE 1FE8L 2FYYA 4Z77A 3FFDA 4H8WC 3RTQB 1S7WB 3QG6A 3TT3L 5JOFA 5FM5M 4QRSB 4NFBA 1HILB 4PRDA 1T2XA 4KC3B 3RVUD 3IFLL 4QOKB 3VXSD 1DQMH 4BK5A 3HFML 5F72S 3L9RA 3PV6A 3TBWB 4KRNA 1ED3B 5GGVL 4R2GD 1DVFA 5C08A 1T5XB 4G5ZL 5J12C 1NSNH 1SY6A 2I60L 4MZ3A 1WGOA 2ZSWB 3WIIL 5JW3H 2AXFA 4L9DA 3T0ED 1Z9SA 5ICXA 2WIIA 3NABH 5KSBF 3TBVB 4F9LC 5BRZE 1AHWB 1NMCB 2IPKB 4PJDB 4TSCL 3BP4A 5FUZL 1TFHA 2FX7L 3IETA 1MIEH 2IADB 5DMKB 5I1IL 2PW1B 3LN5A 3OSKA 1ZANL 3DI2B 1L0YA 4ZD3H 1GZPA 3KPSB 4NKDA 1JMXA 5JDJA 4YFDB 5IF0A 4GLRH 1FPTH 1U36A 3PWPB 5I19H 3RQ3A 4MWFA 3UX9B 5CJ5A 4JR9L 4YHMH 2F74B 1U0QA 4ZOBA 3TO4D 3O41A 3ARRA 1BZ9B 5HHOA 1NGYA 4OLZH 3SDDD 5KN5A 4HFWA 3W39B 4QKXB 3LEVH 1OT2A 2MPAH 4NYLA 5JNYA 4PB9H 4XB7A 5IF0B 2IQAA 4Y4FA 1T7YA 5D7JB 1LHZA 3GMOA 2Q8AH 3P11L 3DX9B 3UJJH 2Y7QA 5CJ8A 3TBTA 3ZMRA 1JPSL 5I1LB 4H88H 1JWMA 1BIIB 2D03H 4MD4A 5TGBA 4G9FA 4RRPG 3UC0H 5IV2A 1MAMH 4XVTL 1HDMB 4Y5YB 4ZTOL 2ZUSA 4Z6AT 4O5LL 3HMWL 2VLRE 3L5WA 3FB6B 1V7NL 3OKDA 5E8PA 4XNXH 5FKAA 2VJXA 1P4LA 1CBVL 1HH9A 2VAAA 1BHGA 4L9LA 3TZVA 5D2NE 2X4OA 5K93A 1A47A 1UKQA 4RX4A 4LCUB 4U1JB 3QG7H 4PREB 3DV4A 4JY5L 5JPMA 1DQDL 5HYFA 1IC5H 3S5LB 3C8HA 3RA7L 4EJ1C 2BVUA 4NC2B 3O6MH 4KQ3L 1YEDA 5HDBE 5MEOA 4EXKA 4G6AD 4OZFA 1LD9A 2DYPB 2VH5L 3GHBH 3V7MA 1CXEA 5TDPB 3ULVH 2AK4E 2ZOLA 4XC1L 3NA4A 5DGRA 4Y2DD 3VFRB 4JKLA 5D70L 4HKBB 3MROB 2DM4A 4TSBL 3DUHA 4G3YL 1HINL 4HBQA 4O2FB 4AT6B 1WT5C 4GMTL 4OZFB 1LD9B 2CMRL 4H25A 5F7FA 4ODWB 3DURB 4PJDF 1AJ7L 2APVA 2YWZA 4X6CF 4UAOC 4Q0XL 3W0WD 4PBWD 3KYMB 1T83A 3MACH 3VXSE 2AJUH 2FL5A 5C0BD 4L4VD 4BZ2L 1ZS8B 3CZJA 3H9HB 1QLFA 1MHEB 2YRLA 1PFCA 2QR0A 4WI8A 4Z7NF 3NACL 4TYUA 3EYOA 1I1CA 2QTEA 5D1XA 4JY6A 2QSCH 1WC7B 1QQDA 1EA9C 1DBAH 1QTYT 2P5WB 2Y36H 4KKBC 4QWWD 5ENWA 4IRZH 1SBBA 3T0EE 3KWWB 1U3ZA 1JF5A 3VG0H 3EJZC 2BDNH 2NLJB 2WNGA 5DC4B 4RGNB 2UUDK 3EO0A 4QXTB 25C8H 3KPNB 4FZ8L 5DK2A 1S7QA 1FDLH 1CICD 5JIHA 1KTRL 4F33B 2VABB 4JM2D 1FORH 2BERA 3QUXB 3TFKD 4JLRB 5L2JA 1OGAA 2A9NL 3KPMA 2HTKD 2EXWD 4U6HB 4WHCA 4Z7VE 1X5YA 5I1HL 3IDJA 4LVNB 4ZFFA 4S1QL 1YY9D 3U4AA 5IJKC 3ME0A 1YEEL 2L7JA 3AMLA 3G5YB 4Y4KC 5F7EL 1FBIL 5IB5B 4XNUH 1H15A 2CDGB 3BPNC 3BESR 5D4QA 4QXWA 4JPKH 4WW1A 4GRWE 1ZGLP 5L8LB 3BKMH 4JFFB 5HGAA 2I9LA 2ICWB 1OAZL 1INEH 5D1QC 3ZT5A 3RIAK 4XMLL 1VADA 3N1PC 4B53A 1FNSL 4P46C 2HT3D 4QEGA 5F9DC 1FFPA 3X3FH 5CEZD 4YEFA 1T7WA 1SJEA 2DBLH 3QJHA 2DS4A 4X6BB 5FGCB 4JKKA 1A4JB 2XNAB 1OTSD 6FABH 4AENB 3C5JA 5TF0A 3ARFA 4RDQG 4PGBA 1UH2A 4XTRC 1BFVH 2I07A 1R24A 5F9JA 1FZKA 4PJIF 2VLLB 4X8JB 1KTDA 1IAKA 5IQ9B 1CT8B 4LCWD 4M1CD 3MFGB 5IW1B 4L8SC 1DQLL 3L3KB 3ECBB 3FB7B 5CJXA 1MRCL 2P44B 3TYGH 2XZAH 4I18B 4ODHH 5C92A 4P3CH 4LBEA 1AXTH 4RRPA 1AIFA 1ZWIB 1CGXA 1V3KA 3BPCB 4Y89A 5CIPB 5GZNC 2APTA 2OMNA 5D7LD 2Z35B 1TVBA 1NAML 1MHCB 4LSQL 4F7TB 4AIZB 2PTTB 3V95A 5ICZB 3QDMD 2D7NA 3VFNA 5I71C 5IR1A 5TDNB 4AK1A 2Q7YA 4KZEL 1EAPA 3H9SD 1FVCA 4OCMC 4AEHH 2NZ9D 1JPST 5EO0B 4KV5E 4YHKH 4OZGB 1AXSA 2BVPB 5C0AB 4QO1A 3GSNL 4M1GL 1HKLL 1M7DB 5DRZA 2OR8A 5JHDB 4DKFL 5AAWA 4L4VE 4LLQA 3R4DA 4TNVK 1UXSA 2FJFB 3TIEB 3ILQD 4JHWH 1UB5A 3O9WB 1QVOA 4EDXB 5D6DC 3GHEL 4UUJB 3IDNB 1G7HB 3RVVC 4BSWA 1T21A 3KGRA 4OLVH 5T3ZL 3EJYC 3PHOA 3G08B 4XP5L 5F71A 5KBNC 2H2PC 3QA3A 1T89C 2W9EL 1RI8A 1F42A 2ARWA 4MJ4A 2PYFA 2NX5B 4U1KB 4NCC1 3QXAA 5F1IB 5FXCH 3WJJC 4HIHB 4ZDHB 1Z0NA 2QQLH 3ZL4H 3ARBA 3WSQL 4OZHA 1A1OA 3MXWL 4MJIB 2R4SH 3C6LD 5CGMA 1A7PL 4ZFGH 3K8KA 1H9VA 4MD5A 4KK6D 3U4EB 4NC1E 4MCYB 3W9EA 2WSKA 4MXQC 1G1CA 1LDPH 5K9QG 1N4XH 3KXFD 2EYTB 4TPRH 4HJGA 3ZTNH 1D9KB 3TWCL 3IDUA 3VXUB 4YHLH 2VDOL 3MUHL 2CDEA 3BPLB 3QEHB 3MR9A 5CJQH 1QSEB 5IQ7H 4U6YA 3V4PL 4UILL 3RNQA 5LQBH 5AD0B 1IAIL 3WHE1 4P2OD 2DI8A 1EHLL 1T03H 5CEZE 1EMTH 3T4YA 1NLBH 4JCMA 1Q0YL 2QADD 4XNYH 2X40A 5KW9H 1U91A 3T1WA 4WW2F 4NWTL 1U8KA 3FFCD 1PY4A 2Q8BL 1AQKH 3F12A 2NR6C 2VWEE 4UT9L 5MEQA 3DV6A 3ET9F 4OLUH 4V1DD 3GIVB 2A6JA 5J6GA 4PS4L 3OR7B 1FLTX 3QYCA 3BGMB 2P48B 4LCWE 4HDIA 3U36B 3U0WH 4MDIB 1MWAL 1BBJA 5FIEA 3BN9D 5EOTB 4I3RH 2OR9L 1FLRL 1IGYB 3HZKA 1YN7B 4K7PX 2CO7B 4I8DA 3TVMC 4HS6B 4MXVE 2VDNL 4HFUH 2GFBA 2HJLB 2ZG3A 3KJ6L 4OCWH 1WBZA 2Z8WC 3VMOA 1KB5B 4JO3H 3QDME 2WLZA 4PJ5B 2M8XA 2R69H 3H9SE 1GZQA 4UBDD 2W65A 1WBXA 4OFIA 3T0WA 1I7ZA 4KVCL 2ZUTA 2A38A 2L0DA 2YD2A 1AO7A 1I1AD 4MA7L 1CIUA 3PABB 1PX4A 4Y4HD 3D18A 1EFXB 1MCEA 4LKCB 1WIPA 3CK0H 5AWNL 3WEXA 2WWMC 4R8WH 1EJ6A 1PG7X 1SYVA 4I48A 4PR5A 3RZCD 1JPFB 3OKOB 4BH8B 4NNXA 5EB9A 1ZT4B 5C0DB 1LK2A 2D9QB 2I26N 4OIAA 3TBSB 1MCHA 2AI0H 1JMZA 5LGHL 1I9EA 1XCTB 1WUNT 3SGJC 2PO6A 3T2QA 5T33L 4ZYKA 3QUKA 5D93B 1OGTB 3UPRB 1FSKB 3WDJA 3WFHB 2J8UF 3OJDB 4PJ9C 5DD6B 3VFTA 1S9VB 2WLYA 4JRYD 1XR9A 1MPAL 4BQ9A 4AJ0A 5DFTA 3PWJA 4MQTB 1KEML 2DQFA 2UVEA 1JGUL 3E3QE 3TA3C 1NGPH 3GGWA 5E95B 4NM8L 1JV5B 5T1KA 2G5RA 4DVRL 2D7TH 3GJEB 4LU5L 3IXAA 4CVZA 4XP4L 3RX5A 1OARL 5IIEA 4FP8L 1DQQA 4YWGH 1BM3H 4NBXB 5C70A 1YEHH 3L5XL 1SEBA 1G7LB 3KXFE 2DKSA 2UYLA 4U1NA 4YHZH 3UJIH 1U41A 2P8LA 1MCLA 4WTXA 5ESAB 1YEIH 1XIWA 3BVNB 4OFPA 2OTWA 4D2NA 3WLWD 2F54A 3CGTA 5JXAH 4Y19A 3W2DL 3UZEA 3VE0B 3C60C 1N26A 3TN0D 3KVQA 3I2CH 5D71L 2UZIL 2VDML 2NQCA 3ARED 4RGMB 1KCSH 1RU9L 2XTJC 3DWTA 2P24B 4LPYA 4XWOC 2K7QA 3INUL 4FOMA 1B6UA 2AK1L 4JJ5B 2FZ3A 5FFLA 5HYJA 5DUBB 2IBBA 3WIFA 3QWQB 2PCPB 3VWKA 3D1MC 4YXKL 5D1ZA 1HE7A 4CMHB 1FNEB 2R0ZL 4ZMAT 4V1DE 5EA0L 3W5MA 4QXUH 3QQ3A 4K94L 1BREA 4JQIL 3RAJH 2VLJB 1WAAF 2CUIA 3C8KB 4PJHE 5HHXL 8FABA 4C4KO 4NUJB 4QHKI 3QDGD 4WFHD 5ID1B 3LKOA 4M1DH 5F7WC 4UB0L 1KXTB 5E08H 2BRQA 2XWJB 4U7MA 2Q6WB 2WWKO 3ZKQD 3VH8A 1IILE 3CUPA 1DQJA 2EKSB 1F4WH 3QB7C 4R4NC 3MV7D 3WLBB 2NXZD 1U92B 4HK3N 1HKFA 3BGFB 3FT2B 3W9DA 1A9BB 2I25N 4G6ML 5EN2B 3MRMB 4MXWH 1VKXA 4J2XA 4X4ME 3FQUA 4N1EA 3WNKA 5ITFA 2HG5A 1K2DB 1MCRA 3C9NA 5C8JB 3EJJX 3P9MA 4PYHA 3RWHB 2QV2A 2FBJL 4RAUA 1Y6NR 3ESVF 4JANB 4RISL 2JB5L 4LCIH 4ODTH 1ZVHA 1K4CA 4DQOH 3ZSSA 3BMWA 3ARTA 4GG6F 5DR5L 2HKFH 5HD8D 4GOSA 3BIAX 2AJXL 3QISA 1HQRB 4TN9A 3DOSA 4KPHL 1RD6A 5E6ZA 3MREB 5KSVA 1U3HC 1YDPA 5FYKU 4L29B 5DRNB 2DICA 2H32B 4I2XB 2NCMA 1CXHA 3KHOA 4X9GA 5JR1H 4JRYE 3RWFA 3BZEB 2X09A 3U9PL 5C0EA 4NKOA 5F6HI 1HHIA 4IMLB 3D85A 5DJ6A 2C3VA 1WFNA 2XA8L 4DUWA 2D4DA 3LMJH 3CH1B 1R6VA 1S5HA 2E8ZA 1KJVB 2R23B 1U8MA 4N90D 5D5ME 3FQXA 4FFWC 4ODUB 1FJ1A 4P5KB 2ICWI 3RWFB 2VXSH 3QULA 3WDIA 4K3JH 2IPTH 3FB8B 2QSQA 3ZDXE 4NJAL 1M7XA 4HH9A 3CSPA 3UYOD 1S5HB 1X4XA 3SJVA 1QO3B 4X6DB 4NQEB 4NNPL 3SDCA 4PBXA 2OZ4H 5HI5C 5E2VH 2MKLC 1CGSH 2AK4A 5CBEB 5GSVB 2ZZUT 4KH2A 4LCYA 3K8MA 2BFVL 1AY1H 1DVFC 4D9RE 1MFCH 4U6TA 1F2XK 4FFZH 4RFEB 5BXFA 5CLWA 4KDTA 4LVOC 1LO3L 1YY8A 5CZXC 2OLDA 5C0NC 3K46A 4C83A 3JWDL 1KYOK 2JKXA 4WGWB 3RVWC 4OD3L 4LCYB 2V17H 3SGDI 3T3PE 3G6DH 3IDGB 1S8DA 4M7ZC 3MRJA 3HPJB 3E1F1 3PG2A 5E2TL 5JZ7C 3VXSA 5FGBA 2C3WA 1RMFL 5FM5O 1DLHB 3RL1A 1TJHL 3SBWA 2E7CA 1YY8B 2DMCA 1RIUH 2OZ4A 5EO9A 3GKZA 4K07A 1NJ9A 5T5NG 5L8KB 4POUB 5DO2D 1FL3A 4HW6A 3HN3A 3NAAH 3QNYA 1U58B 2WV3A 5C07B 3VRLE 5IJVB 3T0EA 5EBLA 3V5KA 1F4XH 1BD2B 1EZVX 3UJTH 1EJOH 4AYFA 3MRBB 5DMGD 4KROD 2VLKB 3H3PL 5JW4N 1XGRB 1DSFH 3MV7E 4LGSB 4LPVA 3WNNA 5C0JB 4L3EB 4MB4A 3UYPA 3DUSB 5JA9A 4EI6B 2Z91B 4MZ2A 1RHHA 1U8HA 3OKLA 3QUYD 4Z7VA 5I15L 4ENEC 4BZ1L 3RWGB 2PKDA 1EVTC 3LEXB 4U1HB 1UEMA 2H41A 3SDDA 3WKNA 5FECA 4MS8C 4AEFA 1LO5B 3UCRA 5GHWH 1D6EB 4QRPB 5T5FL 4LP5A 3TZVC 3VFPA 2XRAH 4LCCA 4FQHA 4U33A 3O4LA 3RKDD 4JG0L 4NJ9H 1DUZB 5ESVA 5EIQA 5HXMA 3M8OH 4GRLB 4PJXB 4XAWL 1QRKA 1T0NA 4PJCB 2EC8A 4U7KA 1TJGH 3W82A 5BJTB 1YEKH 5E6IB 5KTEH 1MUJA 3R0NA 5A2FA 1DBMH 2UZXB 5EU6E 5IFJA 4NHCL</