1CLZH

Igg fab (igg3, kappa) fragment (mbr96) complexed with lewis y nonoate methyl ester
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
218
Chain Sequence
EVNLVESGGGLVQPGGSLKVSCVTSGFTFSDYYMYWVRQTPEKRLEWVAYISQGGDITDYPDTVKGRFTISRDNAKNSLYLQMSRLKSEDTAMYYCARGLDDGAWFAYWGQGTLVTVSVTTTAPSVYPLVPGCSDTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The x-ray structure of an anti-tumour antibody in complex with antigen.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IGG FAB (IGG3, KAPPA)
total genus 45
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1995-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1clzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1clzH01
1FVEB 3GO1L 4C55A 2VXVH 4XNZC 4L3EE 4U6XA 5K93A 1G7JA 3HRPA 1GJIA 2C3VA 3I84A 1JPFB 1W8OA 1ZVHA 4HV8B 5DFWH 4U6HA 4LLUB 3MV9E 5DFTA 2ESVD 5C07A 1NEZB 1LO4H 1IGML 4YXHH 5J0BA 2YPVH 4WEMB 2W60A 5GGVY 4LNRB 1MVUB 1FAIH 4WGWB 4W6XB 4XVJL 2JJVA 1MCPL 4PJ8A 4OD2A 5LGJA 4LMQE 4CVXB 2D7MA 1MRFL 4MA8L 3KLHD 3O41A 4LNVA 2XZAH 4LRIC 5A16A 3VXOB 1U8IB 1KACB 5C70A 3NTCL 3HMXH 4CVXA 1JI2A 4PRPE 4AZ8A 1NMAL 2XZQH 5A16B 1HH9B 3JBG7 3PJSA 2XZCL 4DOHE 1U8IA 3K3QA 2R1WA 4RX4A 3SKMA 1HXMA 1P1ZB 2BNRB 1UKTA 1IEHA 2LQRA 3ZKNC 3P9MA 3KLSA 3UTSA 4L8SB 4LPUA 1IGYB 4OLUH 1QFOA 2HRPH 1JN6B 2XKNB 4ODXA 5GRVL 1OTUC 3V0VA 1FNSL 3L5WB 3GBNL 4RNRA 4D3CH 2X1XR 5CINH 5L2KD 3EYSH 3LKQB 3V5HB 5TH2B 5GSRB 1VFUA 3QO1B 4B53A 3BKYH 5HHMB 3QEUB 4BFEA 4KMLB 5HHPA 4RGOL 3RL1A 4XNYH 2MHAA 3BQUB 4LRNH 1IGJA 4YDJA 4RFOL 4Y5VB 3V5HA 3FMGL 4HAGA 4MCYA 2IQAA 2KQMA 4P23B 1N64H 2D03L 4QRUA 4BH8A 3B5GA 5DMKB 1MI5B 5L9DL 3JUYA 3QUXD 1RURH 1FLRL 3AGVA 1MJJA 5KS9B 2GJ6A 5I15H 2NY7L 1DLFL 2FD6H 3U0PB 3U2SB 1ITCA 4WI6A 1F58L 1MI5A 1XF1A 2B2XL 4BSJA 2DQUH 3AS0A 3GI8L 2X4UB 4B5EA 5AD0B 2ZPKL 1I9RL 4PLJD 4JRXE 2DLEA 3ZHLA 3HE7B 4F7MA 5TPWH 3MROB 3NCYP 2CLRA 1FYTE 1UQSB 2EDEA 4JO1L 1P2CB 4GS7B 2FHCA 1MUJB 2AJXL 4A6YB 5BW7A 5I8KH 1MOEA 1B6DA 1ZWIB 3CSBA 2BHZA 1IEBB 4JDTH 5F6HI 1MFBH 2ITCB 3D3VA 3AC0A 3WLWD 4OF3A 1EPFA 2YRZA 4FQXA 2DICA 4P2OC 1GCFA 2WBJB 4IS6B 4BZ2H 1AGFA 1FSKB 2J3SA 2P8PB 3QQ3B 4LFHD 4Y4HB 3DJ9A 4UT7H 4JM2C 1QO3B 2IF7A 3W2DL 4JDZB 3KDMB 2EEAA 3MUJA 4M61A 5FYJU 4PREB 2BVOA 5IMMB 1UCBL 1BEYL 1ETZB 2FL5A 4X6BA 3UTTB 4GW5A 5C0AA 1G7IA 3RRQA 4M61B 4HUMB 4QLRA 4Z7VA 1XR8A 4RMSA 1JRHH 1NMCC 4GSDH 1KB9K 3OBAA 1QYGH 4LDOB 5HGDA 2BSTA 3C9NA 5TDNA 2NXYB 3SKOA 5JZ7C 1YN6B 5K9OB 2JLLA 5FDWA 4IMKC 3G04B 5FYJH 5TDNB 1WK0A 2YK1H 4TSBH 4WNQB 3P73A 2Z0BA 4MLSA 5DLMH 2JK5A 4JEGB 3D87B 1J8HA 3FQXA 3O45A 3RKDC 1ZVSB 4L5FH 3PWLA 4L8DA 3RWIA 4XBGB 4R26H 4KWUA 4NKQB 1I85C 1UB5A 4AEEA 1E4JA 4MZ3A 3O45B 4RISH 5I18L 2V9QA 1HZHH 3ZLQC 2CR6A 3T0BA 5GZOD 3QRGL 3B2VL 4JY4B 3BEWA 5IBTL 5GISH 4GKSA 1F11A 3GGWB 2V5SA 4XNQA 4CU7A 5GS0L 4P5MA 5IBTH 4PG2A 4TSBL 2I9LA 2CRMA 1I8KB 4OLWH 5GHWH 1IBGL 3IXTB 2IC2A 5BVPH 1KPVB 3KPSB 3T0EE 4QF1A 1VERA 4P2QB 1JRHL 4GSDL 3D39D 4LLWA 4JE4B 5FKAB 3AS3A 2JIXD 4NC1E 5H8DA 4EUPH 2EDOA 1T1XB 3GK8L 3WFHB 1S7QB 4HK0A 4JKLA 4QF1B 4LEOB 2XWBB 3DVGB 3ZKQD 3MV8D 5JUEL 4K7PY 5SV4A 4RRPA 3WN5C 2YPKB 2FSEB 3SDXA 4JHAH 5E2WL 3BZ4B 3NIDF 3LS4H 2EC9T 1JGVL 4P9MH 3UTZB 3E6HA 4JN1H 4TTGA 2EYRA 3CDFA 2H41A 3SDXB 3ALXA 1HHKB 1S7WB 3QDJD 3BZ4A 4N0CC 3B5HA 2QKIA 3FO9A 4ZPTB 1YQ2A 3U4EB 1FNFA 3FT3B 3GSVB 3QDHA 2C3VB 4P9ML 3KPRB 2HMID 5F21B 4UAOB 5ELIA 4JO1H 1A7OH 3HG1D 4N8VA 4WRLA 3I3BA 3MLTB 2VXTL 3RAJL 3GNML 3WXVL 4G6KL 1LO3L 4UAOC 3ZKXC 3IJHA 4TSCH 3T65B 3MRHA 4AMKH 5I2IB 1I7TB 1L0QA 3GMMB 4LCCA 1Z0MA 3VG9C 2FBOJ 4YDIH 3SE9L 15C8H 1N2RA 5IIEB 3ULVD 3O4OC 4MJ6B 4HJ0C 2HKHL 4YHZL 4M6OL 2FZ3B 5MENB 2Q3AA 4YGVA 1TJGH 5C92A 5BVPL 5EIQA 3QULB 4AH2B 5DD3H 1Q94B 3T08A 3QPQD 4QRPA 4YC2C 1QFWH 2P5WB 3PJSB 1LDPH 3GMOB 4K9EH 2VDPL 1UFUA 2AJUL 4GH7B 5IEKA 3QH3B 5DJXB 2P47B 3O2WH 5I15L 4P4KB 3EYSL 1MIEL 3ZE0E 4Z7NE 1GGIL 4TTDC 1IC4L 2YRLA 4M43L 3P9MB 4O2CB 5HYSA 4OLUL 3MRIA 5T3XD 3MA9H 4PS4L 2XTJC 2ZZUT 1SYVA 1W8NA 5EUOF 2FECI 2R1XB 5DLML 5CJQH 3FFCE 2DJUA 4NWUH 1D5XA 4YIQB 1R3KA 3BXNA 3I6KB 1G0XA 4N9OB 7FABL 2B0SL 3FT2A 2C3GA 5F9DC 4ZOCA 1LEGB 3RU8H 4KMQA 4IOFD 4X98A 4W4NA 3HMXL 3N85L 1S9WA 2QHLA 3K2MC 3R1GL 2YSSB 4BH8B 5DDHB 4WU7A 3X12A 4WCYL 2BMKA 5TF0A 3KHOA 1AXSA 4HT1H 1EFXB 4LCWA 4BSVB 1VDGA 4YBQC 3HNSL 5DDHA 1PX3A 1F6AA 3FOLB 3S7GA 1HKFA 3A6BL 1Y0LA 1AD0B 1OP5H 2NY5L 4FQHB 3O3BA 3T2PA 3DURB 1D6EA 3ME0A 5KVEH 1EFXD 2WV3A 1NAKH 3MROA 3NIFE 3TVMB 1ZLUH 3VRJB 1UGNA 5JO5A 5E6YA 1LK3H 2EEDA 4LSSH 4DVRL 5EO0A 3TT1L 1OWWA 5HPMA 1ZSDB 2YPVL 4J2XA 5BMFL 1K4CA 2VAJA 3F58H 2K9UA 2Z93A 1T1ZB 3FCTB 1ZEAL 3EFDH 4FFYH 5EWIL 3WFEL 4LKXA 2BNUB 5E2VL 2Z31B 1PZ5A 2B4CH 3KDMA 1A7PH 4PJXB 3V6BR 4UINL 5C0FB 3TCLA 1AJ7L 4F7TB 1CLZH 1T2JA 5ICXA 3D69A 1UT9A 5H37H 3VWJD 3X17A 2CD0A 3LZFH 4GRWB 4GRMA 5I1GH 1YEDB 1JFQH 5C6WH 3SDDB 3QIWA 3QISA 4JY5H 5FM8A 1BQLH 4LRNL 5FYJE 2NPLX 3Q5OA 1DBKL 3RWCA 5I73C 5JOFA 5A2IH 4XVUD 4M62L 4FN0A 3P0VH 4MAUL 1P6AB 3EIFA 3SKJH 1FDLH 4TULL 3BIKA 2P8MA 4LLQA 1E27A 1C5BL 4WWKA 2AV7A 1AKJD 3DVNA 1YEEL 2QQLH 3BQUD 4OCSL 3PHOA 1AD9B 3R06A 5DQ9A 1T6VN 2L7UA 4PJFF 4WI8A 5EOCJ 4FP8H 5IQ9B 4KTDL 1MH5B 3D18B 3NPSC 5TFSL 2D7TL 4JGJA 3O3DA 4YH6A 2W65A 5F89A 4O51A 2OR7A 5SWZB 2GW5A 2VLRB 4S0SD 1VFBB 3IFPB 4DN3L 4XNQB 3NCJL 4EXPX 1KLUA 2AXGA 4QRRB 3SE4C 4NBYB 5SWZA 4EXKA 1VESA 2WANA 3RY5A 4XZUB 1F4XH 1UCTA 3MLYL 5IBLD 3H42L 3O2DH 3REWA 4UTBL 2BNQB 5B8CA 2XN9E 1MCPH 2WUCL 3H7BB 4LCWE 2F5BH 1GL4B 4LEOA 5J13C 3RBSA 1Y6KR 2M2DA 4YLQT 5D7LB 2BNQA 1IGFH 4LLMA 3DROB 1K3ZA 1ORSA 5DUMH 1MLCA 4BYHA 3D85A 2FATH 3KHQA 1XAUA 4OB5H 1IGFL 3VFPA 1UEMA 5IESH 4F58L 2JB5L 2X7LB 1A3RL 4JVUA 1QRKA 4KI5E 1DR9A 3PUCA 2ESVB 2VZ3A 4PGBB 3O6KH 3LKPB 3GRWA 1YEKH 4BZ1L 3BAEL 4L8BA 4CW1B 4FFVC 4NKDB 2OBGA 5TE6L 3O6FC 5EIIB 2AEPL 5C9JB 1YDPB 2W38A 4NO3A 3WS6A 5HYJD 3MFFA 5DEZA 5ALBL 3RZCC 4LPYA 4OBSA 2HT3D 4HC1L 2CRZA 2Y6SD 2R29L 4J1UB 3TH4T 1S5IL 5JORB 1GGTA 3TNMB 4QO1A 5D96C 2FB4H 3MACL 2P4AB 5MERB 4P2RD 4GG6F 3I85A 1OP3H 1UKSA 2AS5M 3LQAH 3OAZK 2HVJB 3V4UH 3C6SA 2QEJA 4XBPA 4MJID 2VLLB 1CD0A 1MHCB 3QULA 5CIPB 1NGQL 4KVNH 4NO0D 3CFDA 5CEZL 3S4SA 4FQQB 5D5MF 2NMSA 5F44A 4ELMB 1JGUH 4LIQE 4EQ3A 2J8UA 2VL5B 4LVOC 4XNXH 3VA2C 1BQSA 1KJ2H 1HXYA 1LP9A 2E27H 1JFQL 3L5HA 4KK9D 1D7FA 4OD1H 5D7IE 1HIMH 2WK2A 4XAWL 5I1AA 1SYSB 1A3LH 4KUZH 4OM1L 1H5BA 1AJ7H 1CFTA 1MWAB 4MMXC 1XZ0A 4NBZB 1UEYA 3QEUA 35C8H 1NLBL 4Q0XL 4U4BA 1OAUL 3FO0L 5ID1A 1CGVA 4YC2B 2FGWH 2IQAB 5BRZA 3BN9D 3E3QC 1XGQB 4OLXH 2IANA 3PDOB 1JN6A 4JZOB 4G6KH 3F58L 5DK2B 4DQOL 5DRWB 2DYPB 3O4OB 3VXTB 3QNZA 1QTYT 5HHXL 2FDBP 3FOMA 2EXWC 3HZKB 3RIAF 5AD0A 4PFEA 5F7UA 2H1PL 5LGHH 2P24A 4OFDA 1YEIL 2P5WE 4K7PL 4YE4H 1KBGH 5JPMB 2NY6D 4FTVD 1NKOA 4KRMB 5KVEL 3G5YB 3VWJB 1OQXA 5E7BA 4Z6AT 1MUJA 3FZUD 3QPXL 2XA3A 5IFAL 1L4IA 2E7MA 3SO5A 4YHNB 4QTHB 3ARUA 4NJAL 5IM7B 3RVVD 3VXNB 3DHMA 2D4FA 3GZKA 1A7RH 5CJOL 5BRZD 5D71H 4F33B 3FO1A 1M7IB 5IK3B 3R1GH 3N85H 1HWHB 4FZEH 5IMOA 4R4NC 1B88A 3FB6B 1IEBA 4NYLB 4OTXH 5EG6C 2IBGA 3PGCA 5DUBB 4HCRL 5C0CE 2AP2A 4WU5B 5F7MC 1G6RH 2AJYH 4QY8B 1RUPL 5CS7A 3RVVC 1DL7L 3EJZC 3MCLL 3SHSA 3OKNA 2CPCA 1I1FA 3QEGL 4U7SA 4WWKC 2A6IA 4PGZA 5ESAB 4K3GA 2VC2H 3PGCB 4NQDD 1NLDH 4FQJL 4JM2D 1TITA 3O81A 1HN1A 3NZHH 1YECL 2EDQA 4GKNB 4PJ7B 3QZWB 2OCFD 4TVPE 2PXYB 2NY2C 3P73B 4EUPB 4CRPA 3KPNB 3WHE0 2O5YH 3ZMRA 4MHHI 4UNTA 4PRPB 3BE1H 1WT5A 1U93B 3N50A 3QIBC 4XXDA 4HQQL 1S7SA 1A6VH 2AV7B 3PWUB 2NY4C 5JXEC 1A7NL 3GRWL 4Z0XA 4M6OH 5HGHB 3MRCB 5GGRY 3VXRE 2HKHH 2PYED 4M1CC 1QYGL 1KIUA 2BNRE 4LFHG 4MAYB 5DTFA 5CJ5A 1I3UA 1FO0B 3PV6A 1U93A 3O11A 5DD5L 2EE2A 2CJUH 1BQHB 1JIBA 1FP5A 3RTQA 1IMHC 4WI4A 3NAAL 5DJ2A 1XGPA 2X4QA 3FHQA 4JY4A 3B6SB 5BQ7A 3FN3A 5F3BB 2FX8H 1S7QA 3DX7B 4KK5C 3TPUB 1AKJB 5K9KA 1C08B 4D0CA 4HWEH 3VG0H 1QLFB 2XWTB 4R90H 2C1OB 3DI2B 2GJ6E 3WKMH 1EMTL 3P11L 5HJ3B 1QVOB 1NFDB 2YPKA 4Y16D 3GMRA 3DYOA 4HKZB 3HZYA 2DMBA 5L7XH 1Q0YH 2VITB 2W92A 3GB7A 2N4IA 5E2WH 1A4JB 5HJ3A 1CDJA 4RAVA 1FQ9C 1OGAA 1U3HA 3CH8A 4XP1L 1RUKL 2QHRH 1B0RB 1I9RH 1H0DA 1X6LA 3H9SB 4P9HC 5B39B 3B9AA 1CGUA 2DBJA 1AI1H 2CO7B 2P5EA 1XF4A 4JLRA 1RZIA 3VCLB 5JQ6L 4Z78B 2X89A 4D9LH 4ZO7A 1DBJL 5IFJA 2YPLB 1TZHB 4HV8A 5F9OL 4Z78A 4NZUL 5IB2B 3V4VL 3FMGH 1WIOA 2X70A 4X7SH 4R8WL 3EDEA 2GK2A 4B7IA 4I8DA 1E6JH 3KYMA 2F53E 3MV7B 3G5ZB 1ITBB 1HZHL 2F54B 1MFCL 3BPLB 1RU9L 1BWWA 3GBNH 5MERA 1BX2A 1M1SA 2EDHA 3QDMA 3O41B 4EJ1C 1QFWI 4MQTB 4HZAA 1I7TA 4I0PA 5A2LH 4WWKD 2CIIA 5B8CC 3FAXA 2YK1L 2HT2D 5CCKL 4Y5XA 1LO2L 1KB5L 1OQOA 2VH5H 4Z7WB 3FTGA 3ZYOA 2J8UB 2VL5A 2R0KL 2VLMD 4XH2B 1Q94A 3PGDA 4TUJA 3WDJA 3L7EB 1MHPL 4TSAH 1EGJH 1FE8L 3CXDL 3BEVA 1MRFH 2PW2A 5ICYB 3RWEA 5I16A 5BS0D 4XPFL 1PG7X 4XVJH 2HTLD 1RZKC 4XWGL 5E24E 5J12B 5AAMA 3WIHL 1V3KA 4JZOA 4R7DA 3WEXA 3RZCA 2MHAB 3BQUA 1UJ3B 3V5KB 2J5LB 2H2PD 4JY6A 3MA7B 3BIAX 4GMTH 2HFGH 1R3KB 4BQ8A 5C2BH 3FOLA 5CZVH 5GGQH 1AGCA 1AIFA 1G9NL 3NIFF 3QEQE 2ZSVB 4PUBL 3GO1H 4UMGA 4P57A 3T2NH 3C09C 2DKMA 5IVNA 1YEHL 1UWGL 2QSCL 4LLVB 4U6TA 1LGVA 3FQUA 4N8VG 4PJAA 4MNQA 2GCYA 3UZVB 1WFOA 4ORGA 5HGAB 2H2SD 1X4XA 4G7YL 4GS7C 3V0WL 5F7WC 1D6EB 3IDJB 4YPJA 3U30B 2ZJSH 1SM3L 4PP1C 3ZDZF 3U79A 12E8L 3WJLA 3IJSA 3TBYA 4JO2H 4GW1B 4MD4A 4M5YH 3WS6C 1REIA 3HCVA 4OZIB 1J1OH 4OIAA 4DTGH 1W72L 1I1RA 2VLKA 4IS6A 1CGWA 3HG1B 3BZDA 1JV5A 1Y6MR 3FN9A 1F3DJ 3HCVB 4AEHL 3F7QA 3RKPA 2BJML 1INDH 2WSKA 5DVOA 4YBHA 4C4KO 1RULL 4ODTL 1H3GA 1KN4H 2NZIA 5KVFH 1PFCA 1WWBX 2WMPA 3SDYH 1PKOA 2W0LA 4OCNC 3K80A 2ZUYA 5CEZD 4HPYL 1RJZB 1NKRA 4X6FA 3ARBD 3K1DA 4N8CL 5IG7A 1KCUH 3P40A 5DWUH 5IT2H 4WFED 2VDLL 3GHBH 4FFVD 4GAFB 4NZRL 5E2UL 5EOTB 2UVEA 2ADJA 3NTCH 3PABB 5E99L 3RWFB 2XN9D 4WY7L 4W68A 4JO4L 3VMPA 1UXWA 4HHAA 2XZAL 4LSUL 1BF2A 4KJPD 5HHOD 5E2TL 4MAYA 2G2RA 4R4BA 4AG4H 2YD2A 3S88L 4Z5RA 2HLAB 4S0TD 4JPVL 4L4TB 5HYJB 5KSBE 4Z7UB 1GZPB 5CP7A 1BOGA 1FPTL 1LO4L 5J9PA 1EXUA 1YC8A 5ADPL 4NQCD 5IWLA 1NGYA 1F11B 3GGWA 4HAFA 2R1YB 1T0NB 1QSEE 5BOZG 1YYML 2I9LB 4X83A 4K3DH 1NEZG 3WS3A 4M7KL 2RR3A 1TMCB 5D1ZA 5BQ7B 3N1GC 3T1WA 3TF7C 1AGBB 1VFBA 3IFPA 3LMJH 4GXVH 1JZ7A 4LL9A 5D7LA 2BSSA 1JZ5A 4FTVA 1FL5A 1ZT4B 5DJCA 3HZYB 4HK0B 3IDYC 4KTEL 5D1QA 1IM9D 1NCCH 3BHBA 1RV6X 1DQDH 4LAJH 1XF3A 3O9WC 4K23H 4UOJA 5AEAA 1Q72L 5CJXC 4S1DC 5MHSD 3S36H 4IOSD 2JCCE 3NH7H 5EZLA 2YD5A 3EJZD 5CSZA 5D2LE 4E0RB 4K94H 4WIQA 5L88H 4ZAKC 4JM2B 2EDNA 4OZFG 2A1WH 2RQ8A 1A6WL 4NHCH 4WUKL 3W0WE 4DAGL 2YXFA 3BRGC 3U0WL 1HSAA 5HHNA 4F37K 2XQYK 5D7IF 3KJ4B 3V95A 2X7LA 4ZFOB 5I8OH 2UZXB 1R5WB 1RUML 1JWUB 1MWAH 1NGPL 3LQAC 2VN7A 5ETUB 1B0WA 5EN2B 3IDYB 5SV3A 5MEOB 5ADOL 3BPNB 2QADC 1P9MC 5DJ6A 4LPXA 3MFFB 3AMKA 2GTZA 1CICD 1J0IA 5FUZL 1DEDA 4JHWL 4LCCB 5B21A 3UX9B 2AQ1A 3CX5J 5CJBA 5B22A 1H3PH 4J1UA 5JORA 1IGTA 3LH2L 4M48L 3S34L 1P7QD 4LNRA 2CKBH 2HKFL 2RCSL 1EHAA 3IFOB 2SEBA 5HHVL 1OTSC 5JHDB 3IGAA 1EERB 3LN5A 1KYOK 3R4DA 2ZUTA 1N59B 5E8PA 5EBMB 4YWGL 3CU7A 2DTML 3TWCH 5IEKB 3QWRD 2VDRH 4HKXA 2NZ9C 2SEBB 3KYNA 4Y2DB 5CP3A 1WC7A 1GSMA 3DRTA 5L8KB 1N5YL 1QBLL 3LEXB 1BLNB 4HS3A 2MWCA 4EN3C 1UWXK 5C0ND 3LDBB 4OUOA 4PB0L 4DUXA 3MUHL 4OBRA 5HYSB 3ARGC 1T6WA 4OUUA 4LCCC 4Q9BA 5CGMA 3MBXL 1VFMA 4TPRH 1HXYB 1T03H 1K3IA 4WDIA 2QQKL 4UT6L 4JN2A 4XCEB 5D5ME 1U8PA 1YMHA 3QDJA 4M1GL 3QDGA 3S37H 5I1KH 3TZVB 4EI5A 1ZTXH 3K2UL 4NQCE 3QXAA 3R0NA 1QSFB 2O26U 4FG6C 4YUEL 3EO1A 4S1DD 2EIZB 4DKAA 1BBJB 3W9DB 4WUUA 1T4KB 1NANH 5FHAL 5GSRA 2F58H 3TVMD 1MCHA 4YR6A 4LU5L 3QXAB 4GBXC 5EZOL 4WVRA 2WQ8A 1OAKL 2PYEE 1BBJA 3W9DA 3G5YA 3MMEB 5DC4B 4IRJD 3RIFF 4ISVA 4JFZH 4JRYA 4PJBA 1JHTB 1YNKL 4K55A 1J0YA 3MRKB 3K81A 5HYFA 2AJZA 1SJEB 4BJLA 1OAQL 2J5LC 3QUMB 2R23A 1AO7B 1I9IL 4XPTH 4O58H 5LXGL 5C3LD 4FQCL 1NCDL 1MF2H 3DETD 4PBVC 2NXZB 4HF5H 1FNHA 4I3RL 3VXMA 2DQGH 4ETYA 4P4KC 3MZTA 1EK3A 4HJGB 1ZSDA 1EH9A 1I7UA 4Q9RL 1WIPA 1RJLB 3VD3A 3F8UB 2Z93B 2JKXA 3VXMD 2YUVA 3BDYL 2VKWA 3MUGA 2ITCA 3CCHB 4QNPF 2JF1A 5IR1B 4PY7A 4NUGH 1DBBL 3O6ML 4NO2A 5KN5B 3JWOH 1BIIB 4U3XA 2HH0H 1QO3A 4LAQH 1PSKL 3QEQB 3D69B 4EUPA 1F13A 3GIZH 4P9HH 4GRMB 3NN8B 5I1CL 3T4AB 4BQCA 1F2QA 4ZUTA 4NQTA 3MV11 2W0KA 1MJ7H 4JR9H 4X4MA 1UVQB 1I4FA 1L6XA 4CMMA 5GS2D 4J7RA 1IKNC 3BDXA 3Q1SL 4WTXA 2KZWA 3GDBA 2J88L 4IRSC 1WGOA 1A7QH 2W9DL 1CLYL 5DQDH 3CDGA 3PGFH 3KPNA 2FJHA 4S2SA 3WMSA 4HWBL 3S35X 5DQ9B 5HY9B 2NYYC 5DVMA 4PRBA 5GGTL 2R0WL 4MD0B 1OSZB 1MH5A 2O5ZL 3QG6A 4L4TA 3W82A 3BZFB 2G75B 4M1CD 5GGSB 3JV4A 1GHFH 2ICWJ 3PV6B 1YNLL 1KPUA 4FFWD 4NJ9L 5CFHA 1QR1B 1ZS8B 4Y4FB 3SBWC 3TPUA 1WEJL 5I1LA 3CGTA 4XPHL 3TIEA 4KZDH 4NKOA 1AR2A 2IBZX 3E3QE 4MQXD 3TA3A 3MLZL 2D9QB 3HC3L 3HI6L 3ILPB 3UAJD 3S9DB 4NT6A 1WZMA 2FEDD 4HUUA 3QUXC 1QBML 5CP3H 5MEQA 1AY1L 2JELL 3WO3B 1J5OL 3UPRB 4OF6A 5AG8A 1MY7A 4Y19B 2HH0L 2O5XH 4HIXL 1JF5A 4ZFGH 4NN7C 4LK4A 2I5YH 3OGCB 1CU4L 3O9WB 1P84J 1YYLL 4ONGL 3BJ91 2PR4H 2P5EB 4JLRB 5D72L 5DC9B 5C8JA 4BK5A 3O6LL 4CL7A 4U1GB 5BV7C 5FB8A 2NY2D 1OD9A 1IEAB 1YNTB 4EN3D 5D7IB 4F7EB 5DMYA 3UTPD 4IOFC 1ZT7A 2NNAB 2QQNL 1ZHLA 2IAMC 1QSEB 4I3SH 3T1FA 2L7JA 2APWA 4GQPH 4LSPL 1ZHLB 5DI8B 2IAMD 2G5BA 3U7AA 3T0XA 1G7MB 4NQVA 3WNMA 4JM4H 4WEBL 4PJ8B 5IF0A 3OKLB 4Z95L 2NY2B 2A38A 4D94A 2V5RA 2F54A 3JTSA 2O61A 1I9EA 1AE6H 1S7UB 3M07A 1QRNB 2IPTL 1MREH 5FV2A 3TBVA 1WFTA 2Q6WA 1IFHH 4PG9A 1FFPA 4OKDA 4OV6F 5T33H 2NTFB 4ZFZB 2XNAB 4PGEB 1ZAGA 3VFSA 3L3OA 4MXWH 1GC1H 3AXLA 1XIWA 3BD3A 1AXTL 4MQ7A 1GVIA 3BEVB 4J3XA 1FFPB 2B1HL 1NCWH 2EC8A 4JFOB 1TPXC 1YEGL 3ARWA 3TJEH 3D39E 1NDGB 3ZE0F 5I71C 3UTSB 4AJ0A 4KHTH 1XZ0B 3U4AA 3VFRB 1DQJA 2APVA 4KXZI 2UY7A 4IDJH 2WBJD 3RVWC 1P4IH 4E41B 1D6VH 4JFOA 3NBNA 1Q0XH 5HYQA 2XXCB 4YQXH 4PRNB 2V2XB 3PXJA 5TE4H 1FG2A 1IGJB 4HIHB 1N7ML 4UILH 3ARZA 2DQHL 5D72H 3C60C 2UZIL 3OXSA 4IIQA 3J8F7 2DYPA 1MLBB 3U30C 4WENB 5HYSG 4DFHA 4IRZH 4LSVL 3T0DA 2ADIB 5I30H 4LP4A 4JY6B 2I5YL 2XN9A 1UM4L 3PWJB 2AJ3A 3QCVL 1OWRM 4NP4H 5IKCA 1I1AC 2JELH 1AXSB 4QRTA 1C16A 2AJZB 1G7LB 3TO4C 1VFOA 2ENYA 2F5AH 3LIZH 3QI9A 1KULA 3DXAB 4XBEH 2YZ8A 2XA8L 4FQLL 1OCWH 1OGTA 3GSWA 3KWWB 4XPHH 4MQSB 3KNBA 1BWMA 1PEWA 4L29A 4OI8A 1SBSH 1K6QL 4ONOA 3DBXB 5HGAA 5IROA 3Q5TA 1A6PA 1JWSB 1KNOB 1CBVL 3QCTH 2NY0D 4YHYB 4ZUUB 1HQ4A 3WD5H 1RJLA 3ARSA 5LBSH 3T77B 4Z9KB 5F6IC 1RK1B 1RIVH 1CL7I 4WFFE 1MQKL 1K4CB 3MJ6A 4JQIL 2YD3A 1T1ZA 1A6ZA 1YJDL 4X6FB 2HTKC 2J88H 3OJMB 4JKKA 1DBAL 2BY1A 5T1LD 3NCYS 1KXVC 4M8QA 4ZUVA 1UXSB 4XP9L 4R0LB 1DEEB 4ZO8A 4XCYB 1T3FA 4ZQKB 4PJXA 1JNLH 2FLRT 1LO5A 3IAQA 4L8SC 3UYOD 3MV8B 4MB5A 4CMHB 1MHEB 1CFSA 5C0AD 4LAQL 2DBLH 1PZUB 2RB8A 5H35A 4GBXD 1SJVA 4PJDE 3G08A 3OKDA 3F5WA 4MYWB 1EXUB 4O9HL 2HRLA 4PRBB 4BK4A 3QG6B 2XFXA 3VFNB 5TQ0H 4H0GA 4K71C 4GKSB 2J8UF 5AAWA 2H2SC 3QFJA 4DKFL 1R24B 5C7XL 4FQCH 1MQKH 1MCDA 2FHFA 5DJ2B 2E7LC 3KPOA 1DQLH 3B6SA 5BS0E 3A6OA 2GSGB 5FUOL 4D0BB 1FSKC 1NBZA 5F3BA 4MNQD 4QYOB 4NNPL 4NT6B 3PDDA 5D96B 2COQA 2OP4L 3FQWB 3DSFH 1QP1A 3KPOB 1XF3B 4YXKH 3M17A 2DQDL 5AYUH 4D0BA 1AGBA 5ACZB 2CK0L 1NDMB 1E0OB 5H94A 1NJ9B 2NY3C 1EA9C 3DVGA 1S7XA 4CVUA 4YDVB 2BSSB 3MOBH 4JFEE 2NXYD 2Q86B 2GJZB 1JPGA 1QSZA 4LKCB 1W0WB 1GGBL 2P7TA 1J1XH 3UTTD 5GRJH 1F8TL 1G0DA 4YEFA 3D85B 1XF4B 3RGHA 4QRRD 2Y1VA 4HUWB 2CDFB 4S1QL 3TH3T 3SOBL 1INQA 1SMAA 1ZANH 1CICB 1J0KA 5I30L 1A9EB 2CUMA 1S9YA 4G7YH 4DZ8B 5SWQB 1IAIM 3GM0A 1F97A 5JA9A 4Y5VC 1I1AB 4PGDA 3BQUC 4NO3B 2C5DC 2G5BB 2OS7A 2CSPA 1NGWA 3NGBB 5E8OA 2C3HA 1KEGH 3TWCL 4YAQA 1C1EH 3FQRB 4V1DD 3V6FB 1PEZA 3BN9C 3VXPA 4FZ8H 2DWDB 3ZT5A 1MRCL 3LN5B 3FB7A 1NUNB 2BX5A 3CFCL 3FQRA 2HLFD 2OQJA 3PWPE 2R15A 1P7QA 2IJ0C 1H3PL 3F6LA 3D1MC 4UI2A 3VXSB 5FXCH 3RZWA 4P3CL 4CN4A 4ZFZA 1G6RA 1U8KA 3BP7A 3HPJB 4RRPG 2XY2A 3HS0A 1EEYB 4NZDA 3L95A 5KVMC 2WAHA 3BZEB 4XWGH 1HSBB 3AROA 3OV6A 1QQDA 2GY5A 3HE6D 1WWWX 4FQQA 4H88L 5I0ZA 1G6RB 2OJEB 1UZ8A 1WBXB 3SGEH 4E42A 4MSWA 1YEFH 4UNVA 3L7EA 5F1NB 2YBRB 1MHPH 2IAMB 4TSAL 3RWEB 5I16B 2FECL 2EECA 1X6NA 4NFCA 2IAMA 4MA1C 5EFIA 5L2KE 1OP5K 3I6KA 3OF6D 4Z7UE 4WDIB 4ZXBC 3RDTC 3ARFA 1A1OA 3KS0H 3K8MA 4QXGH 1S9WB 1CD9B 3KXFA 3CFBB 2OXGA 3EYFB 4HGWA 3GJEA 3HA0A 2BNRD 1QRNE 4X0KA 2IALB 5DK2A 1JNHA 3BT2H 1SJEA 3KPMA 5EOQL 3V8CA 3ZT6A 2AJVL 1AO7A 2E6QA 1IAIL 1ZLWH 3O3BB 3L3JB 1AHWC 4XPBL 1JF1B 1KJVA 5BOPA 3LMJL 3LAFA 4HUXA 2R4SH 1QFUH 2XTLA 1JPSH 1U6AH 2BY2A 5JNYB 5JO5B 3RVWD 3MPCA 2F53D 4ONFH 1EZVY 1J05A 4MD4B 1FPTH 5CGYC 3HN3A 4KV5F 5ICZB 1RUAH 1UA6H 5KOMC 5IV2B 5T3XH 2CDEA 5A1AA 3HC3H 1EJOH 1MEXL 3G6DH 4UQ2B 3QXDA 4XP1H 3FRUA 5IMOB 4PJEB 3FFCB 4FQXB 3QJFB 4ODHH 3FB6A 3CUPB 3MV9B 1YNLH 2FIKB 1CLCA 3QXDB 4WTZG 3ET9F 4HKJB 5HVGB 4ODWB 1UYWL 1KLGA 2X6MA 3UTOA 2OMBA 5FO7A 5LBSL 3OKNB 4M8VA 5I8EB 2DIBA 5IBUB 5DK0A 3HNVH 5IP4A 2W9EL 4POZD 3OL2A 4JPKL 4RGND 1K6QH 4XMLH 4NGHH 1XH3B 1GH7A 5EDXA 5JOFB 2Q8BL 3O4LA 2X9YA 3ZKXB 3GSNA 5JLZA 2ADJB 3BH8B 5C71A 3E0GA 4MCZA 4XBEL 2CJUL 1SBBA 3BPNC 3GSNB 1UZ6E 1CDIA 2VDKH 2DL9A 5DZNA 4YJZL 1EV2E 3CH1B 4FNLH 4M9OA 2VLRE 1MCEA 3QHFH 4L8DB 4NP4L 5E1HB 4M5YL 1CXKA 3ARYA 4QGYA 3QUYD 2J4WH 5HY9A 3PQYA 3U7WH 2A2QT 5FEBA 4R97B 4N5ED 2VXUH 5JPNB 3JTTB 1MAML 5D5MB 9CGTA 1FGNL 3GMPA 4YPGA 4QHKI 3ALWA 2FBJL 1KEMH 3AY4A 4LGSB 2BNQE 2QSCH 2Q7YA 5CKGA 1XGPB 4XP6L 5C09E 1BD2A 3JUZA 3H3PH 2VZTA 4I3RH 3MJ9H 4KKNA 3LCYA 3EYQC 2VC2L 4CNIB 3DX9B 5I75C 4N5EC 5GJSH 5KS9E 3GSQA 5FCUH 1JI1A 3RDTA 3GMNB 3ULVH 4GMTL 4CNIA 2AABH 3DMMC 4CBPA 1RZFH 2OK0L 4N90D 2CDGB 1H8NA 4HIEA 4Y1AE 2NNAA 2NXZC 1I1YB 4OT1H 2XACC 4NOFA 4L9LB 3CZFB 5ERWA 2VTFA 4WI9A 3P4NB 3UJJL 2IG2H 1YA5A 5IVXF 3X3FH 5KVGH 3T8XB 4NFDA 4DW2H 5FHAH 4HUVA 1D9KA 1TZHA 3QPXH 1QSEA 1UJ3C 5L6YH 5I1KL 2NXZD 4N8VB 2AQ2A 5IB2A 4HUVB 4K94C 2ORBL 1V5JA 1YEIH 1FVCA 3CD4A 4UT6H 3IVKB 3AS2A 1DE4B 1ZHKB 4TRPL 1AC0A 1NMCB 5I0DA 3MRHB 4I3SL 5KJRH 4JFDE 2QQNH 2V5MA 2I60H 1DE4A 1ZHKA 3ZTNH 1OB1B 1UWEH 4P2RA 4OLYL 3VFOA 4IJ3B 3BMWA 3GSUA 3RX5A 1S78D 4PGCB 2VDRL 4QT5B 2BC4A 4ZNCD 3RGVB 4ZXBA 3RUGB 1MFCH 3D0VA 4KRNA 1B2WH 1SEQL 4HKXB 2H32H 4KQ3H 1E6JL 4WI2A 5DRXA 3I75B 4G6JL 4Y5XB 4E41A 2Q3ZA 1A64A 2XNAA 4PGEA 1TVBA 4Q2ZA 4KZEH 2VLKE 1MWAA 1RHHB 4PRHD 1TTUA 1MAJA 5B38B 5B38G 4P4KA 4PJ9C 4HIJA 4P5KA 3A0OA 4QHLB 3L5WA 4RNRB 3RNKA 3KS0J 1H5BC 1FYHB 4WJ5A 3EO9L 3VFRA 3UO1L 3U48A 2FR4B 5HHPB 1AI1L 3MCG1 4ERSL 1U3ZA 2H26A 5EU6E 4HSQA 2BSRB 4KVNL 4Y5VA 4QHNA 5DRWA 1INEL 2D4DA 2AJ3B 3QHZH 4JFFA 3PG2A 4Y2DD 3WEXB 5I1HH 4ZSOB 1NGXA 2JE8A 4GRWF 3ULUH 2OTUA 3VFWB 2AERT 4J6RL 2VDQH 5DO2C 1MLBA 1CD8A 3QUKB 5KS9F 4HFUL 2P49B 3ZHKA 3Q2CA 4HWEL 3MZGB 4RBPH 3IKCA 4IRSA 4CADA 3S36L 1CLYH 5DQDL 2PTUA 1YMMA 4M5ZL 5A2KH 3RA7H 4KTEH 3UXFA 4EDWH 3T77A 3HC0A 1OAZH 1TCMA 1QA9B 5HHMD 5IW1A 5ACLA 4M00A 3G6JE 4DKDC 2YMXL 1K85A 4BQBA 4P9HL 4KROD 3IS1X 3X3GH 3MUGB 1EGJA 4QGTA 4PJGE 3M1BB 3ZL4L 3DUSB 1A6VL 3EGSA 2CR3A 4PY7B 1L0YA 4KI5D 4CDGC 2JB6A 3O6MH 1K8DA 1BP3B 1VADA 1KENL 1ETZA 3EGSB 4FMFA 4JJHA 4JB9H 3LN9A 3UTPE 4XPGL 3QZWA 3GFUA 3HB3C 4K2UH 4UTBH 1FYTD 1LK2B 3SQOH 4XHJD 1GAFH 4BFIA 4Y19E 5SWSE 4KI1A 3I3EA 3C5SB 4HF5L 2FEEL 1SJHB 5L2JB 5EPMB 3NCJH 4TNVK 1FIGH 4MJ5A 1AHWA 3U0TB 4LLYA 2CKNA 5T1KB 5J6GA 2VYRE 5E4EC 1U3JA 3UBXI 4KQ4H 4X6DE 4L8CA 1CD1B 4MJ5B 1GGYA 5FO9A 2DTSA 4XNMA 3D0LA 1CDCA 1IQDB 5E1AB 3HC4L 4DKEL 1F3JA 1C5BH 2G2RB 5GGSA 4NQXA 5I19L 3HI1A 1X5XA 1KC5L 1IQDA 5ITBH 2FCBA 2XOTA 3NCBB 3P3YA 4PRIE 3MRNA 1PKQE 3O6FD 3WO4B 4ETQB 5J4MA 2GAZB 4R96A 5DEFB 3IU3B 1N0XH 3ILPA 3W39A 2W0FA 1J1OL 4HEME 5EC1B 5CWSB 3NZ8A 3LPGA 3CMOL 5T5NG 1Z5LB 3ZTJG 2J6EH 4QWWD 1NCBL 4K7PX 2D7QA 4NWTL 3BWAB 5I66B 2EDKA 1SM3H 4C83B 3RWHA 2EDDA 3MRDB 1RZ7H 1UG9A 4BA8A 2VQ1B 2AJSH 3DX6B 5JDSB 4RAVB 4AEIL 3MGTA 1OTTC 3T3ME 4PG2C 3VFVB 3IF1B 5IJKA 1WT5C 2VAAB 1VPOL 3RWHB 2VQ1A 1Q9WB 2GSIA 3LQZB 1IT9L 3QUXB 3BP4A 4S1RL 5SWQA 2YPLE 5DURB 2QBWA 2CKBB 4P3WA 1UACL 3P4NA 1TZIA 5ISZE 3H9HA 5GGQL 4BQ6A 3FHAA 3UYRH 2CKBA 4YAQB 3I6GB 1J1PH 3NOIA 3K4ZA 5K9QG 5M94B 3IKKA 1CXLA 4OCXL 1JPFA 5E8DL 3T65A 4DZ8A 2DDQL 2NY5H 3TYFB 3K1KC 1T0PB 4LLUA 4OGYH 2YUWA 5J3HD 2ATKB 5IIEA 5IMKB 3GJFK 3F62A 4HT1L 4DGIL 2EE3A 1OAXL 3NMEA 2X4TB 3GSRB 25C8H 1CDGA 2VLJD 5F9JB 4JFHD 1KIRA 4M9PA 3V6OA 4C56E 3C6LD 1OT2A 3MBED 3BWUC 5ILTH 4TTDD 3QRFM 1U3HC 2A1WL 2EXYC 1K2DA 4JKMA 5C0GB 5L88L 2YBRA 4NWUL 2VUYA 4XH2A 1S5IH 2FX7L 3IDUA 2X9XA 3MQIA 3S4SB 3Q5YA 1H9VA 3SE8L 4F9PA 1T5XA 3WSQH 1NFIA 3TO2B 4JG1L 4YHLH 2EXYD 4Q6IB 1NC4B 3EFFB 4LBEB 3BZEA 2K3TA 5FA3B 5HDOA 2PW2B 5ICYA 2R1XA 4XVTH 2LABA 2EIEA 1A1OB 2VE6B 1CFTB 3O6KL 4WJ5B 5CBAA 1QSED 1CVSC 3FN0H 2ZWLT 2A77H 4JO3L 4Y2OA 2VDPH 2G60L 2VLRD 3QUMH 1NBVH 1TJHL 1VKXB 3L7FB 3V2AR 3QO1A 3RIAK 1FN4B 5EB9A 3ZKMD 4LGRB 5HI4C 4KU1A 4U7MA 4TOYL 4XNZB 1XIWC 2HWZL 1FCGA 1TNNA 4JFDB 1E28B 1KFAL 1A6TA 1MNUL 1SY6L 2B1AH 2OTUB 4GAJL 4NSKA 4WUUB 4D0DA 5I6XB 3S5LA 4RBPK 4OJFL 5I1DA 3S88H 1GYAA 3MRPA 1V7NH 3D39A 3DGGA 1H3UA 1RAMA 1EIBA 2NR6D 3H42H 3U0PA 2DQJL 3QI9B 1FORH 4Z7OF 3VXUB 1MIML 1OL0A 3O3AA 2ATPA 3IKCB 4OQTH 3BP5A 3TESA 1FZKA 2CLVB 5E99H 3IU4L 3SDDD 3ARBB 3VRIA 5E9DD 4JFEA 4JJ5A 5I71B 1SQ2N 4OZFH 1QA9A 1EMTH 3P11H 3MV9D 5TFSH 4FQXD 5GS1C 3VXNA 2RHEA 2Z31D 2PO6C 3OAYK 4JAMB 1QZ1A 3KPRD 2VDMH 1A9BB 4O00A 2X4OA 4ODWA 4FABL 4KAQL 5IFHH 5BJTB 1QD0A 1BF8A 5ANME 3GI9L 3KLAA 3RX7A 1K8DB 2RBLA 4R7NB 4N90E 1MCOL 1JPTL 3GK8H 4KV5E 3FFCA 1R5VA 2GYSA 1HNFA 1DTUA 3AU1A 4ZO9A 5E5UB 3CNKA 3RNQB 1TJIH 5IMMA 4M7ZC 4M3KB 5EBGA 3QIWB 3O4LB 1IM3A 3KJ4C 3BUYA 2A9NH 3PWNA 3TBWB 2G9HB 4D9QE 1CLZL 3RWCB 3VA6A 1LNUB 4U1NA 4G9FD 3HUJA 4UDTA 4XWOD 3WHXA 4LPWA 4P3DA 4UINH 1UM5H 1ORQB 1BM3L 4YX2L 1VGEL 3B2VH 1RK0B 5CEYB 1WV7T 3G6JB 3IFLH 4FFYL 5EWIH 2AGJL 4IHOA 1WTLA 3S96B 5FO9B 1IAOA 1WBZA 2YOCA 2P1YA 1A47A 3NZHL 3MRLB 2H9GB 4QRQA 3SPVB 1JZ4A 2CO6B 2BFVH 4DVRH 1RVFH 4O2FA 4G3YL 2GT9A 1UH4A 1U92B 4R9HA 5AUMB 3CDCA 1OSZA 4KK8D 5C2BL 2VXSH 5JOPE 1FRGH 1KJ3L 2GY7B 3BRFA 3PL6B 4F9PC 5BZDB 1RQ5A 2GT9B 3NACL 1NC4D 2PKDA 2DI9A 1CFQB 5CUSL 2AEWA 4CN6A 1KPRB 3P4MB 1I8KA 5GIRB 1G1CA 1Y18B 3RVTC 1S5HA 1KPVA 3KPSA 2FX9L 4Z7UF 4N68A 3P0GB 1CFQA 4Q6IC 5J13B 1BFVL 5DRNA 1BEYH 5C09A 4U1KA 2EDWA 4MXQD 3K4AA 2ZCHL 4NM4H 3UBXG 3UBXB 4I5BA 1NC2B 3C6LA 1ZGLM 1QHPA 1UH3A 3O9WA 1CQYA 3RDTB 3WKNA 5MEND 3LS5H 5F8QC 4HC1A 1I8MB 4X5WA 2ESVA 1J18A 5HHNB 3WNLA 3GSNH 3C8KB 3F12A 4POUB 4G3YH 5T1MB 3RL2B 3ZTJH 2AJXH 2BFVL 3N9GH 5MI0B 4X4YA 1S9YB 3V0AC 5FM5M 1M6OA 1A0QH 1MVFA 3QXUA 4EBQH 2HJLA 2Y5TB 4KXZH 3SDAC 4FQPA 5T1MA 3RL2A 5EO1B 1OM3H 1F5WA 3VH8G 3T1FB 1ACYH 4G42A 3MLTA 5HI3D 2Z35A 2DLFL 2OSLB 2AAVA 3NA4A 3SY0B 1F58H 5D7JB 4P46C 4C57C 5I8CB 3LEYL 4FG6D 1ZVYA 4MJ4A 4HUNB 1Z2KA 3VU2A 1A1NA 1IAMA 5DJDB 2XTJB 4HS6B 4M6NH 3S3SA 3VXOA 2IPUK 5I1EH 2ICWB 4XAWH 2BRQA 4XC1L 1MHCA 3X14B 3OKLA 4POZC 4YHZH 4NBXB 1KJ2L 1YY8B 2R56H 2UUDH 3DSNA 4HS8H 4TNWF 4XNXL 1OVZA 2O61B 4RIRA 4HJJL 5I73B 4APQD 1Z9OA 1I8IB 5EULV 3ULVF 1A6AA 3L95B 1S9KC 1JYVA 3WUZA 1RY7B 2E6JA 1NFIB 1WVZA 4KAQH 5I1JH 4I0PD 4LHUB 2IQ9H 1CL7H 3DUUB 5IQ7L 1HHJB 1WCQA 4UBDC 2VOTA 3U9PH 5L7XL 5EUOE 2DMKA 5ID1B 4UB0H 3GSNL 1V3LA 2VE6A 1W0YT 5JOEA 2ZOLA 1IKNA 4HIJB 3MXWL 1P9MA 4K71B 4P5KB 5GJTL 2IMNA 4GG6E 2FX8L 1I7ZA 3IS0X 4YDJB 3RNKB 4FFZH 3VWKD 1ZA6B 5CD3A 2BERA 5C0RH 2H45A 4OFIA 4XP5L 4F8TA 4GQ9L 4MXVE 4M3JA 1L6ZA 4GBXB 3FOMB 4EIGB 1QBAA 1LEGA 4TNVF 1HH6B 3BAEH 4MA8H 4ALAH 3Q6GL 2ZUSA 2BZDA 4NO0B 1BOYA 2GK0A 5BXFB 4OFVA 4GBXA 2R4RL 1A2YB 2LTQB 1J12A 3DYMA 2PO6A 3OR7B 5D7LD 1BD2E 3JVGC 3RKDD 4KMTL 1GZQA 3ZDYE 3CLEH 3L3KB 3E8UL 4RWYL 5CUSH 4HUXB 2HWZH 4F15B 4P57B 4K7FB 3MBEB 4NCC1 1HDMA 4I48A 3TBSA 1OARH 4CU8A 1EAPB 2DM7A 4ZS7L 4PJIA 3HI5H 1NBVL 1TJHH 4Y1AB 3QRGH 3DUHA 4KTYA 4C58B 4F33A 1E4KC 3M1BA 4PYHA 5DJZA 2HN7A 1FL6A 4XTRD 3VWKB 1GGCL 4M7JL 2V2WB 1T80A 1YECH 3HC0B 2J12B 4NYLA 2X4PA 2Q8AH 4O5LL 2EC9U 5DMIH 3WSQL 3MCLH 5KN5A 4ELKB 3FCTA 1RUPH 3ARRA 2DLGA 2MSPA 3NIDE 1JV5B 1NUDA 3HLAA 3MV01 1B0GA 3STZB 3WXWH 3TM6A 4G8GD 1G7IB 3UJTH 1JWMB 3S4SG 3IXAB 3G5VB 4GKOA 3T4AA 5LQBH 1SJHA 4LASL 5L2JA 3TCLB 3DTXA 4P5TD 4KKCD 1FDLL 1RJZA 5HGGS 1OAXH 1JPTH 1YEDA 1I9JL 3W0WA 1EEZB 1C12B 3K0WA 1LK2A 4W81A 3ARFC 1GOHA 1WQVT 2J8HA 5D2NE 2P8LA 5JW4Q 4Y4KD 4FABH 3CDGB 4JRXB 1DUZB 4NRYA 1BQLL 3IB4A 1BMGA 3I6LE 1F3JB 4L9DA 5EOTA 4X8JB 5IVXA 5HI5C 4XCCH 5ALCL 3ZYZA 4LLYB 5LWYL 2VDNL 1RMFL 4JDTL 3C5ZB 3WUWA 3RTQB 1DBMH 4F7PA 4R96B 5DEFA 1U0QA 5C0BA 1M05B 2HLAA 3CVHB 5E4IA 3RY6A 1CE1H 3IU4H 3O3DB 1ZEAH 5DMJB 3GUTA 1IT9H 2DI8A 3WUWB 4ZOAA 1LE5B 2EDBA 3TYGL 2IH3A 2E7BA 3CVIL 5BMFH 2AXGB 4W70A 4ODBD 3FRPG 1OGAD 1AP2B 1PQZB 1U3HD 2H8PA 3MRDA 2DS4A 5C08D 2HYMA 2ZUWA 5D1ZB 4AEIH 4QOKA 3RP1A 3ARTA 1JZ8A 2VZSA 3QB7C 3VE0B 5FKPA 4NQUA 3B3IA 4GW4A 4YDLC 3SJVB 1MRDL 4I4WA 1A4JA 4ELME 5CMAB 2F74B 5F3HA 1ZT4A 5DJCB 1HIML 4MNGE 2C4FU 4BM7A 3VDAA 1RZKL 2GFBB 3SDXE 3HE7C 2B39A 1X5GA 1U91A 1G9EA 3O8XB 3DX6A 4EOWL 1RZIB 3KGRA 3N06B 4ZDHA 3QP3A 4F7EA 2NW3A 1GPOL 1I3GH 5K59E 3F12B 5IFJB 4JFPA 4U0RB 3VGEA 3CSYB 1CDBA 2HRPL 1FJ1B 3LQAL 1U95A 5JMRA 3OJDB 1FLTX 3RU8L 1UENA 1JF6A 3MACH 1BJ1J 3MV7A 2YKLL 1WAAF 1II4E 1JGEA 1UB6B 1TQCB 3HFMH 3V52H 1G7PB 4HFWA 3C08L 1ZXQA 5EZJA 5D7JA 5I8CA 1NMAH 1NGWB 4N0UE 5B3NA 3PWPA 2FZ3A 5ALBH 3FQTA 4HFWB 1G7PA 1HHHB 3IDGB 4M43H 2ZUQC 1GAFL 1T7ZA 2HA1A 3VFOB 2LTQC 3O9WD 4OGZA 1BFSA 1LDPL 3QH3A 5DJXA 3AXLB 3EZ8A 4NDMA 4X6CA 1IGMH 5DRXB 4LLDB 3SDCD 4FOMA 1JK8B 1BZQK 2FATL 4K07A 1MCNA 2F54D 3BP7B 1J1PL 2D0HA 3ARFD 3SCMD 1O7VA 4U7KA 3KYNB 2GQHA 2Y07H 3MLVL 4WW2C 3JXAA 5LGKA 3HAEG 4N9GB 4EZMA 1CIDA 3F65A 2WUCH 3ZKND 4L8SA 4RA0C 1OAZL 5F7EH 5HVHB 1WFNA 2LVEA 3LKOB 3PHSA 3GNMH 3TO4B 1FH5L 3DX8B 4GQ9H 4MNGA 3VI4F 1S8DB 1CXHA 4YFDB 4LP5A 5C0EB 2XWJB 1FNGA 3LVEA 4LLAA 4P99A 4Z77A 4G6FD 3LB6C 2YD8A 3V6OE 3VXTA 4PJ5D 3QUKA 3MRJB 5JQHC 3I9GL 2IFFL 4ZPVB 1IZJA 5DFVC 4XCCL 4B0MM 3OKKA 3U9PL 3WE6B 1B6UA 5CZKA 3FAWA 1U2HA 2BVPA 2IPKB 1V7MH 2QQLL 3RGVD 5EBWA 3DXAA 1OAYL 4YBLB 3BPCA 3STLB 4FMKA 3D39B 1HDMB 3DGGB 1N26A 4I48B 4RZCB 4DEPB 2ZG3A 1EAPA 1B9ZA 3OB0K 2XTJD 1FZKB 2CLVA 4LQFH 3B9KD 2HVKB 1RUQH 5JW3H 2CLRB 2LU4A 1JWSA 3C87A 3MTRA 4HS8L 2HN7B 2HG5B 1IGIL 5D7JD 4P2RE 5C0BE 4Z76A 3UTSE 3T4YB 5ISZB 3ZYJA 4GG6B 4HJGA 2BVQA 2RFXB 1R3HB 2F9BT 5L0QC 5I74C 4OSUH 2GEEA 1T20B 4GMSL 5GGVH 4LMQI 2OJZL 1IE5A 2YD1A 5BRZE 1OARL 1OOAA 3EFDL 3WJLC 2AK1L 3SDCB 5ENWB 3KLAB 2FIKA 4EBQL 2MPAH 5C1MB 1MHHA 1A0QL 3CXHK 2OLDA 5JW5A 1ADQH 3A67L 1XGTA 4KVCL 4L5FL 3MLWH 3TT1H 1MCWM 4PJ7A 2AXFA 1EVUA 3HR5A 4EI6A 4AY0A 1S3KL 2WLZA 3B43A 4HMCA 3N1PC 3BUYB 1KUMA 5IB3B 3U0TA 3VD9A 4H20L 3MRLA 4WWKB 2VRAA 3EJYD 5H35B 3X13B 4R0LC 4WNQA 5B3JE 1TCRB 3DVIA 4FFZL 2X1WL 3SN6N 4IRJA 3GJFA 5KW9H 5GJTH 3KYOB 2J2ZA 4S2SB 1RK0A 4NHUA 1HHGA 3X13A 3ZDXE 5DR5H 5C6TH 4UIMB 3CFIC 1T89A 1Z6JT 3HAEA 3OF6A 3CFKA 2VZUA 2R1YA 4M5ZH 4RAHA 2MTPA 5C07E 1BQHA 5EORH 5FGBC 3MRNB 4UIMA 4P4RB 2XQYG 2OK0H 1BZ7B 1U8HB 5DRNB 3FQWA 2ZP0T 3QT2A 4U1LA 4P5TA 4KDVA 2FJGA 1AKJA 4J6RH 2A6JB 1FNEA 1Y18A 1D5BA 3AM8C 1U8LB 5I1JL 4RAUB 3QWRA 2JJTC 1GGIH 1ED3A 2GJZA 4G9FB 4MQXC 4GRLD 3DX9A 5IW6A 2AQ3A 5E56A 2VITA 5D1ZC 5DGRA 3G5XA 5DZLA 4Y19D 2Q1EA 4HJJH 4XPAL 2QR0B 4BSWA 4I5BB 5E6IB 1A5FH 1MCFA 3E2HC 3JWDH 4CW1A 2VXUL 3U7WL 5EIIA 1X7QA 4WFHE 5I1EL 3ORJA 8FABA 3CSYA 5IB5A 2A9NL 1S7WA 4YHOL 1IEAA 3E2HB 1U95B 1R3JA 1XEDA 1ZGLP 3CIQA 3CZFA 1DP0A 3HZMA 2VDKL 3E6FB 4LVHC 1TJIL 5JIHA 15C8L 3SE3C 3OB8A 1NPUA 1R3JB 5F96L 2Z31C 3KYAA 3VFUA 3RY6C 1YQVL 1FVDA 5KOVC 1LVEA 5EZJB 3DHJA 2ATKA 3D85D 5DHVH 2DM2A 1E4XI 2CMRL 2PTVA 5K9QI 3SJVE 4UT9H 1HOCA 3KPPA 4JRXD 3N9GL 3KPQB 3IFOA 4KK8C 4XBPB 4JZJB 4N1CA 1QLRB 1CK0L 1YN7B 4TRPH 2EH7H 3OKMB 4MDIA 3M8OL 2FX9H 2I27N 1ZKAA 3WIIH 5E8NB 2ZSWB 3IDIA 1JGVH 2BCKB 5L6YL 1YN7A 1WC7B 3DRTB 1L9NA 1HHJA 3HE6C 1LP9B 4HBCL 1UZ8B 4MNQE 5B39G 2GHWB 5JUEH 4A2LA 4YZFE 3X3FL 5D6CB 4MQ7B 3EDFA 4KK6D 4OV5B 3ZDXF 4LSTH 4F8QA 1BFVH 3I75A 5F93C 3UCRA 1T2XA 3OX8A 4PV8B 5KSVA 4MHHG 4Z7QF 5TH2A 1WJ3A 1S7RA 5C0JB 2XRAL 1CFVL 2M26A 4OT1L 4YXHL 3PNWA 4MXQC 3V6OC 4EUPG 5DK3A 3MRMB 3SBWA 3NACH 3GKZA 2H32B 3KXFE 3ULVL 2I25N 5DJAB 1C5CL 3BI9X 5HHOB 5GGUB 5GGVL 1VGEH 4OFPA 3A6CL 3STBA 4OSUL 3ECBB 4NNYB 4DVBA 4OZHB 4M93B 2IALA 3WIFA 1JVKA 3MOAL 4JRYE 3U46B 3S5LB 3B2UC 2BP3A 1T7VA 2X4UA 3ARDD 2EDTA 3MCKB 1I1CA 1DDHA 3KPSE 1BQHG 5FV1L 1F4WL 4PPTA 3HE7A 1CVRA 3P0YL 5J1TC 1S7TB 2NX5E 1P5UA 3CSPA 4G8GE 5C6PB 2LU3A 5F9AC 1HI6A 5DJZB 2ICWI 5DUPH 4X6CE 4MJIE 4DGVH 3WCYA 4HWNA 2HJFB 1T7WA 3D3VB 3GBML 4L4TE 3QHFL 4UV4L 3AM8A 4FNLL 1P53A 1I7UB 5FGRA 1PAMA 2LFGA 3IJSB 1X4YA 3CX5K 3DBXA 1QSFD 3FO2B 3CXHJ 5IW1B 4NQEE 2DKSA 1YEFL 3QUZA 3ALPA 3V4PH 4H88H 1SHMA 5DC0A 4HGKC 3FB8A 2VISB 4PREA 3HG1A 2WZPD 4JCMA 2Q8BH 3DV6B 2A73A 4NGHL 3I2CL 3EOYG 2X1QA 1I3RB 4IRJC 4P3CH 1MIMH 2JB6B 2A74B 1BBDL 1FORL 3HNVL 4N0YL 4L4VB 3ZDZE 3H0TA 3UC0L 4YDKL 1MFBL 1U41A 4U3HA 4OJFH 2OTWA 1HHIA 5I17A 1ZMYA 1O7SA 2NYYD 4R4FL 5DEGA 5IB3A 2VUOA 4XC3L 1N4XH 4X7TA 5IMLA 2UV3A 1XFPA 4X4XA 1EHXA 2BRRL 1VPOH 1PY9A 3GJFB 4ENED 3EJJX 1BQUA 1YEJH 1V7NL 1UB5B 4JVWA 2OL3A 5C0BB 5EU6D 5I76B 2H9GA 3G04A 4QRQB 3SPVA 1F2XK 3P9LA 3CK0H 3F5WB 4PJEE 3JV4B 4XVTL 1RURL 5JPNA 5L9DH 3W5NA 4WEUD 1CI5A 3RWIB 2HJKA 5FM4A 3BO8A 4U6VH 3WFBH 2ITDA 5E00B 1J1XL 3UZEA 4XGZB 4J8RB 3C08H 4K9EC 3F7RA 3V52L 1BJMA 4LLWB 5ITBL 3TV3H 4I4WB 3D3VD 3AY4C 3MOBL 1WBYA 3D25A 5ILTL 4HK3N 4KI5F 1MSPA 2A6JA 1YPZE 4GUPA 1DVFD 1I7RB 4KPHH 4IRSD 2OL3L 1F00I 4DGIH 4BH7A 1MCBA 3NFNB 2NW3B 5LG1A 4RDQG 1Q1JL 5FUOH 2ED8A 4YFLF 1JPGB 4LKCA 3ZE1E 3S35H 5IW3A 3O3UN 4OCXH 1RJCA 2ZUVA 4S10A 4IDLA 3TIDA 3H9SE 3KPRA 2A6DA 3O3EB 3UYRL 1BHGA 3HR6A 2CDFA 4ESKA 3MJ7A 3HZMB 1ZT1A 3SQOL 3UTQA 2E3VA 1M6OB 4GO6B 1TLKA 2B8OT 1QSFE 1VEPA 3QA3B 3SGEI 1J8HD 3OWEA 1HKLH 5E8DH 3PQYD 5L2KA 3SY0A 4L1DA 4P4KD 1ZHNA 1G9ML 3UTTE 1E6OH 4WV1B 3ZL4H 3CVHL 4J4PD 3NPSB 4PJFB 4A6YH 4DUVA 4Y2DC 3OAUL 1ULVA 4RQQA 5D7KE 4JFED 4OZFB 2P5ED 1DBML 2YMXH 4WTZA 4WGVB 1X5LA 1LHZA 4LLDA 5LWYH 1FGVL 3ARBC 4QNPE 5F9JA 4KRLB 2OQJB 5K9JL 1XF2A 3CMOH 4MVBC 3S8WA 5EOCL 4YHYC 1QLEL 5FYLE 4Z8FL 2A6KA 4PTTB 4PYGA 1MCWW 2I07A 6FABL 3PGDB 1QFHA 5DJ8A 3LQMA 1RIUH 2DMCA 4LCUB 5E5RB 4JG0H 1MFAH 3EOTL 5FOBA 1RZ7L 4LHUA 4AH2A 1X4ZA 4PJDB 4RFEB 1BLNA 1T5XB 4WI3A 3WD5L 1NCBH 1KTRL 3BGFB 4YIQA 2V2XA 3T0EC 3PP4L 2XWJA 1UJ3A 4GFTB 4PP2B 4XCEA 1ZA6A 3C8HA 3U7YH 5CBAB 4ZODA 2ADFL 5EFIB 3T0EB 5GGUA 4U2YA 1D5MA 3X12B 1KC5H 2XA8H 4FQLH 3ROOA 5I19H 1NGXB 4UTAL 1AIFB 3U4BL 3LIZL 1OT1A 4YFLI 3U82B 2M1KA 5GS2H 3MYZA 5BXFA 3FL7A 1Y0LB 5AZEL 1A6UH 3HMXA 2OP4H 1VEMA 3G9VA 3MNWA 4LSVH 4IRSB 3MBEA 2QSQA 1CF8L 4M6AA 3BD5A 1KTLB 4ZS7H 4LIQL 1W72B 2EIDA 3PQYE 1N6UA 1S9VA 5C0DB 4ENEC 3E8UH 4RWYH 4OLYH 2RFXA 1P4BL 4A6YA 5D6DC 1FO0H 1HQ4B 3O2VH 5SX4I 5L0QB 2WBWB 1P4IL 2V2WA 3QPQC 1Q9OB 4XPGH 1AFVH 1TETL 4WI5A 4JB9L 3BH9A 3TJEL 1DCLA 2Z31A 4OZIE 2UUDK 4LARL 5BV7B 4EDWL 4OZHE 5ENWA 3TBTA 1LQSR 3BIBX 1Q9OA 3V5DA 3UEZA 1YC7A 4DN4H 1FV1A 3HG1E 2MQ3A 4F37F 5DHXB 3MODH 4HWUA 3MO1B 3TN0A 5IR1A 2VIRA 1EBPA 1CZ8H 4IEFB 3EJYC 3MFGB 4W6YB 1N6QH 2ZG2A 4FQIH 5MENE 2ICEA 4L3ED 4JVPA 4HLJA 1Q9LB 3SCMA 2FJFA 3O8XC 3KYKL 4NC2B 5CBEB 1H3XA 4ODVH 1F3RB 1BVZA 3Q3GB 4UB0L 4N5UA 3QQ4B 5FK9A 2P5WD 1DBAH 5C0FA 3BKJL 2NX5B 3BGMB 3OG4B 1TCRA 1IM3B 4QOKE 5TDOA 3F7YA 3ULUL 2YWYA 2ZCKL 2VERN 4UNUA 5I1HL 4WI7A 1E27B 4NHUB 2WM0A 1RZFL 3C60A 2NX5A 4PRPA 4LPVA 3DECA 1OSPL 2GUOB 2CRYA 4OLVH 4X8JA 2PCPA 4YBQD 5KSBB 1P4LA 1WSST 1JHKH 4K3JL 1QSVA 4OIIL 3G6JA 3TZVD 2R56L 1JUFB 2DQEH 1EHNA 5J9PB 1AQKL 1J7VR 2VLRA 4YGAB 5E8EB 1ZLSH 3INUL 2D7NA 1CTNA 2DQTH 1V05A 1R24A 2CRIA 3BJLA 3QDAA 3VFGH 1O5DT 3FT4A 4XP6H 3R06B 5F97E 3UJIH 1LE5A 1RIHH 3B9KC 3I50H 3OHXA 1KB5B 5DD1L 4DCQB 4JFYA 4HK3J 5IJVA 1IAKA 2DWEB 2FO4A 1ACYL 4KDTA 4CGTA 1FGNH 1PX4A 1U8LA 2EO1A 5EA0L 3M17B 1OM3L 3B9KB 3EBAA 3IFNL 4WW2F 2Q7NA 5CHNA 4JKWA 5D1XC 2Q7YB 5GIRA 5F7NC 4QRRA 5MEQB 4HLZG 2I60L 3MLUL 3VI4E 5EA0H 1FZMA 4HJ0D 5ITFB 4P5TB 3LPWA 3S36X 3HKFA 3GMLA 2ORBH 1B2WL 1SEQH 1LO0H 5JR1L 3WN5B 2CGRL 4UIKL 3MGOA 4MWFB 4YQXL 3GMLB 1OP3K 3E1F1 5IW6B 2KZ1B 3E6FA 1TQCC 4MGXA 5M7QA 1M7DA 2W0PA 3E6HB 1CICA 2AI0H 4HXAL 4MAYC 4PB9H 5FGSA 3BKCH 2ZCHH 4NM4L 5DA0B 4IDJL 4KHTL 3ARED 4V2CB 3I6GA 2C4XA 1KJMA 1OSPH 1S9XA 2YN5A 1T1YB 1UC6A 4G8EB 3RVUD 4NQSA 4GAGH 4X4YB 3LKPA 2GTZB 1A7QL 2DI7A 4RGMB 2WWMD 1EEQA 4MAYD 3GHEH 3QAZB 4WHCA 2P45B 4U1SB 1H3VA 4ZNEE 4NRXB 1FIEA 3UJJH 1R3LB 2RJMA 1BX2B 1KIRB 3RVXC 2BCKA 2F19L 3O2DA 3VXSA 4PR5A 2PF6A 1L9MA 3I02A 5A43C 3EOAB 1CZ8L 1K2DB 3HPLA 1QRNA 2AKRB 4I9WD 2X05A 4AL8H 1QLRA 2A6KB 4PTTA 3ZSSA 2HT4D 3DNKA 1QQDB 3VI3E 4MDIB 4JZNA 4R4ND 2JCCB 2FBJH 2CH8A 3NA9L 4LARH 4PV8A 3L5XL 1SYSA 3Q48A 4MSWB 3HPLB 5BV7L 4ZAKA 5CIPA 4S1SH 4UV7L 3QIBD 1HH9A 3WLBB 3QEHA 3HNTH 1QBBA 2NY4D 5H2BA 1FO0L 3MJ9L 3O2VL 3LKQA 2C7UB 1YMHB 4HWZB 5SWZD 5IVZB 4W6WB 5D6CA 5EOQH 4OV5A 2NTSP 4NUJB 1IAII 4JPIA 4DVBB 4X7FC 3G6JF 4PP2A 1MCQA 4PJHE 3EYUH 3LSOB 3MRQA 5EU6A 2AV1B 3OKEA 4WUUE 1MAMH 3PNWB 1JNJA 2EE6A 2C1PB 1MJJB 5GS0C 5KS9A 4G5ZH 1H15B 2X4SA 3DARA 2R2EA 3FB5A 3KPLB 3MRJA 4I9WE 4TQEL 4RGNE 4WFGD 1YNKH 3PWVB 1QKZL 3B9VA 1MPAH 3DI3B 2AEQH 5D7SL 1HE7A 2WINA 4M1DH 2ZKHH 4HD9A 5J1AA 4C56B 3SDDC 1AD0A 1KG0B 4ODSH 3ARBA 1U42A 4KJWC 2X42A 4C54A 3DMMA 3CLFH 1KTLA 4NJ9H 2IBBA 1IRAY 4CADB 4K7FA 2F15A 4AENB 1KG0A 5D1XA 1F02I 3THMH 1M7IA 3QG7H 5GS1B 3F6IA 3IDJA 3OZ9H 1UJTA 2FH6A 1DLHA 3G6DL 1CGSH 1EJOL 5KANG 5KTEH 1I75A 4JAMA 4YHNA 1ZHBB 1UQSA 4X9HA 3VWKA 4P2OA 4PJIF 4ONFL 4WO4A 1WTGT 1RIUL 4ODHL 5JHLL 4R7NA 1RZJH 3RTQD 4NKIL 3PV7A 3NFPB 4DGYL 1KLGB 4OI9A 3O4LE 1MEXH 2WBJA 1A6ZB 3S98A 1N3NA 3ARGD 1A1MA 4F7CB 1EO5A 4OF8A 4NFBA 1DQML 1NL0H 4ZAKD 4YO0B 3RVTD 5FYKH 4GKZA 1I4FB 3LKNA 2ZNXA 1PSKH 3QDME 3U1SL 3CVHH 1LD9B 1KCKA 4S1QH 4ZFFA 3T09A 5TDOB 2FL5B 4X6BB 1W0VB 2JCCF 5HDLA 4XXDB 1NQBA 5A2FA 5IEHB 2OTWB 5I17B 4XRCA 1LD9A 2XKUA 5DYOB 1FHGA 3GBLA 4M4PA 3NVQA 3RWFA 4XT1C 5GRYA 4WHYH 3VGHA 2KBGA 4JREB 4M7LL 3G08B 3OKDB 5GRUH 4I18B 3BEWB 4WO4D 4X5XA 4RSVA 5IVXB 3QZWG 4M02A 3QO0A 2YR3A 2HFTA 5IQ9A 5ABDE 5FF6B 2X4NA 1KTDB 3SE3A 5FYKE 5HDBE 1A4KA 1FFNB 1OPGH 5DJ0A 3OJ2C 5DTFB 4NNPH 3DETC 3HI1B 4RMUA 2JJSC 3RWJA 1WCBB 4D0CB 1KLFA 2DQCL 2DDQH 4XB8A 1FNAA 3Q6FA 2ED7A 3QIBA 2DLIA 5DJ0B 5C7XH 2VR9A 1A3QA 1E4WH 1QVOA 4DK3A 4KRPB 1T66C 1K4DB 1ODAA 5KAQF 4J3TA 4LSDA 4QOKB 4RAUA 1JMZA 4I0CC 3D25B 1VACB 3GIVB 3LRGA 1EX0A 4U0QB 4YUEH 1I7RA 2FNBA 1EO8H 4LLMB 5E95B 2E9BA 3TIDB 5I9QC 1MLCB 3MGTB 4E5XA 5DF0A 3WN5A 3VFVA 1W0WA 4BH7B 4NCC2 2GFBA 4RGMC 3FO9B 4Q74A 3MC0A 2DL2A 5ADPH 2QV2A 4MA3A 2AJSL 2V9TA 3ULUC 3D2UB 32C2A 3VDCA 4PD4J 5ACMA 3H9SA 3KPRE 1YEJL 4G80A 1KJMB 1CGSL 1EEUA 3SOBH 1J8HE 2V2TA 4Y5YB 1N8ZB 3H3BC 4WV1A 4H26B 1LEIA 1N4XL 2Z92A 2OX5A 1HWGB 3DVFA 4JGUA 5KSAB 1BJ8A 2GITB 2MNUA 5E5MA 5IB1A 3HTLX 1WZLA 4U1SA 4YHMH 5HYEA 2FIRT 3CFJB 4PJHA 5DWUL 1T2QL 3NABH 3KYMB 2PN5A 5HVHC 4N8CH 4G6AD 3LH2H 1ZHNB 4M48H 1CGTA 4LVEA 5E5MB 4OFYA 4NPYA 5F1SA 5DJ8B 5DMGD 3G9AB 4QT5A 3CFJA 1NUFA 1HHHA 3IDGA 2DQDH 1ZOXA 4WO4C 5D4QA 2ZSWA 3IDIB 5HDQL 3DSFL 2YD4A 4QXTB 1T0MA 2LU7A 4G5ZL 4KQ4L 3CLFL 1J9CT 2JJUA 4P2QD 4F9LA 4G6FB 1J0JA 1TVBB 4M1DL 4CDHA 4NN5B 2PNDA 2YWZA 1DQJB 4UBDD 1T04A 2EEBA 2P5WA 2CK0H 1OY3B 1X5ZA 3D3VE 1T1WB 4LOUC 3FFCD 2VABA 5CGTA 1IGYA 4XI5D 3QJHA 4KGJA 1QUNA 4WUKH 4GRLC 4K2UL 2WW8A 3RZCB 3ETBF 1NFKA 2P46B 3FT2B 2IAND 4JN2B 5MP6L 4X9BA 3MJGX 1U8PB 5HSFA 4I1NB 5E08H 2CUHA 1G6VK 3BISA 3LN4A 1JHLH 3P0YH 3QWOA 2D3VA 4N8PA 3S3JA 1TENA 3WO4C 4P23A 3PWJA 5SX5H 4PJ9A 5FYLD 1AO7D 3AFLA 2Z8RA 5KG9B 4JFDA 2F19H 1MAKA 1G9NH 5F1IB 5KAQG 5IHZB 2LAAA 1YPZB 3VJ6B 3VGAB 5D2LA 4M7KH 1NCWL 1A21A 5K59F 1KJVB 1JF1A 1TZGL 1ZA3B 3VXUA 1GC1L 1CDUA 1LP9F 3STLA 4JQIH 5DD0H 5EO0B 3VRIB 1IFHL 4JPVH 4X7EC 3ZE2F 5IM7A 4OZIA 3FONA 4LCYA 3QFDB 1XCTB 3ULSA 3TVMA 3MV7D 2RAMA 3SQBA 4J12A 2EDFA 3BKCL 4P2OB 4Z95H 3L5IA 1CWVA 1PZ5B 2HT4C 3HE6A 1X5KA 1AGFB 2H3NB 1KCSH 2V5TA 1HEZA 1INEH 2FJFB 3QHZL 1KJ2A 2ZKHL 3CUPA 3MV9A 4IMLA 4XCFH 1X9QA 3QQ4A 5F7KC 5CCKH 1A1MB 1T20A 4JHBA 4FXGA 1H8OA 3EDJA 2EKJA 5F7DB 2BVYA 1CGYA 4PJDF 3EOBB 2R2CA 2W9LA 3MRGB 5E9DE 1YJDC 1XGTB 1BIHA 4F7TA 4YXLH 3BIKB 4Q7DA 5IEHA 3BVNA 2AXFB 1FCCA 4EI6B 3GM8A 3EOBA 4G6JH 3DGCR 4ZTPL 3DXAE 5EU4A 4KQ3L 2J6EA 2HFFA 2NLJB 1JTTA 1KELH 4PRIA 2QLVB 3P77B 4DTGL 3D0LB 5TE4L 3FQXB 4YXLL 2FJHB 5CEXA 1A8JH 2MKLC 3P4OB 1EBAA 4HUKB 3INUH 1HK6A 3EO0A 3TP4A 3C5JA 1NGYB 4X99A 3P77A 3TO4D 1J5OH 3MYJA 3O11B 1CG9A 3V0WH 3C5ZD 4OIIH 1SEBB 5DD6B 3EKCA 3L5XH 5SWZE 3BO8B 2G75A 2DQHH 5DD1H 3AB0C 1BFOA 2B1HH 4XCFL 4U1IA 3RUGF 1CG9B 3ESUF 4ACPA 4Z7UA 1YEHH 5DD6A 4UDUB 5ITFA 1AQKH 4U1IB 3JWDC 4I77L 3P4MA 3B3IB 3BKJH 3PP3H 3OSKA 1K8IA 4LEXH 1TDQA 3VGAC 1JHKL 4K3JH 3W9EA 2FWOB 5BO1H 4NNXB 1F6LL 5FHBH 3EYQD 4MDJB 1IM9B 2VAAA 5FYLL 2Y36L 3L3DB 4TUOB 4ONHA 1KCLA 4E0RA 4WEBH 5FYJD 1M7DB 5INDB 4PJCB 2FSEA 3WIHH 3HRZB 4QOKD 1NC2A 3C6LB 4PJIE 1ZK9A 4D8PB 4TN9A 4LSPH 3UTZA 5JXED 3H3KA 4CVWA 3V8OA 1I8MA 5FCUL 1A9EA 5FA4B 1YNTA 4LEXL 4ZPTA 4QCIB 5GZOC 4N0UA 5KW9L 5EU3B 5GS0D 1ZT7B 2DIJA 5ID0A 4KROB 3QQ9D 2B5IB 2R0KH 3D5OF 4CN1A 5F7YC 4ZFOA 2X70B 1LO0L 2YC1A 3F7VB 4N0UB 4YBLC 2Q76A 1NH6A 3PWPB 3DLQR 1ZLUK 4PJFA 2P42B 1XF5A 2NW2B 4IOIB 5JHDA 4Y16C 3REVB 3MSPA 1FL3B 3W0WD 2NY1B 5D93C 2CIIB 4XCNA 3ARQA 4FQJH 4X6EA 1QBMH 2XPGA 1MCIA 1YY8A 3VXSD 43CAB 1MFNA 3QEGH 4U05A 4ZTPH 5LXGH 1CF8H 1BAFH 3OGOE 3UJIL 4XCNB 1U3YA 1WBXA 4U6YB 4E42B 2ZCLL 4G8FB 2ADFH 1YYLH 4ONGH 5F1NA 3RIFK 43CAA 4NO5B 5FO8A 4NN7B 1AR1C 1ONQA 2DQEL 4ELMA 4Q2ZB 3ESVF 4HLZH 4D9LL 4G8FA 2MMXA 2I9TA 2NXYC 4Y2DA 5CJOH 2DQFA 2PW1B 4UUJA 5FO8B 1OAKH 3QEHB 5IHBA 3HI6H 1KIQA 5FFLA 4EQ2A 1T4KA 3S6CA 1H5BB 3ABZA 2F58L 3O0RH 1ZV5A 3MX0A 1J8KA 5IOPA 1V3MA 4PRHE 3EDKA 3H7LA 1D5MB 2VLKD 4LDEB 1OAYH 2D0FA 3V0VB 4Y4FC 1V7ML 3VXQA 2Q87A 4QXUH 1YUHB 4EN3A 2MCG1 4WFEE 3ULUD 5SWSB 4C56A 2IFFH 4G9DA 1MJ7L 5GGTH 1QSFA 4OZGF 3KYKH 1T89C 3MBXH 3U46A 3RGVC 5F70A 3QNZB 4F7MB 3QUMA 4ZOEA 5D2LB 1JCKA 1TZGH 1E6OL 1GOGA 1ZA3A 2EZ0D 1W72A 1S7TA 2R4SL 3SGKA 4JR9L 3TBSB 1EO8L 2HLFC 2EXWD 2CUIA 2EH8H 5HHVH 1OLLA 5J57B 2CDEB 1NAMA 4F3FB 3TBYB 2L4OA 4RMVA 3PL6D 4I2XE 5ISZA 2MCPH 4QTHA 4A6YL 4EVNA 3V6ZA 3BT2L 5CZXC 5I9QB 2V7HB 3R8BB 2E27L 2FH8A 2BVOB 3BE1L 3ISWA 1XIWD 1TPXB 2O5YL 4Z7NF 3S35L 2YUXA 4KKAC 3QNYA 4QEGA 4YO0A 3MRRB 3LKNB 3I3DA 2WWKO 4ZUWB 3RNQA 1DN2A 5ADOH 4Z7VB 1VADB 3EHBC 1NGQH 4Y4HA 1BJ1H 2A73B 3QNYB 1UH2A 5K9OA 1OTUD 1VGKA 3MRRA 1NLDL 4XRCB 5LCVH 3HUJB 1HCVA 4XHJC 1BECA 1SY6A 4O58L 5EZOH 2VZVA 1MHEA 3TJHC 1KSRA 4K94L 3IYLW 4ZUTB 5EZIH 4ZFFB 5EU4B 4OTXL 1JP5A 2P8MB 4LLQB 5D2NC 4K23L 4NN6B 4HHAB 4NN5C 5D71L 4YNYA 3ZKMC 1CD1A 3ZO0A 1NAMH 4HIIB 3MLPA 4UU9A 2VR5A 1WCBA 2W91A 5I1LB 3QYCA 4YHML 1MRCH 2DB8A 1MFAL 4JPWH 1EJ6A 4O51B 2PETA 1A3RH 1OTSD 2F8VA 2G5RA 4DCQA 1JPST 2J8OA 1T0NA 1EFQA 2BRRH 1KTDA 3TGXA 4ETQA 2DTMH 3MUZ1 5DUML 1FGVH 2J7LA 5JHLH 4TYUA 1M71A 3GIVA 3FFDA 3WYRA 3VGFA 4FS0A 3W9EB 3UBXA 5HXMA 5KTEL 5LJYH 4RGNB 1K4DA 4ZNEA 1S7VB 3CVIH 3ZT7A 4GUPB 5CLTA 1H0DB 2B4CC 2BOCB 2X1PA 2WP3T 1ORSB 4JHWH 5IB4A 2UWEB 2Q86A 4BSWB 4R3SB 4JKPL 1IC7H 5J11C 3OGCA 1SJXA 4UZGA 4QHKJ 1U9KA 3QDMD 1NCAL 3O8XA 5I1IH 3QUXA 4P59H 4R3SA 2MJWA 2DQIL 1A3LL 3UC0H 4U6XB 4K8RL 5CKAA 4CAGA 1BBDH 5ALCH 5B39A 2A6DB 1T1YA 3O3EA 5C0CD 5FB8B 3D6GA 4CJ1A 3VCLA 3I2CH 3GMQB 3GBMH 4D9RE 5KVFL 3UTQB 43C9B 3OJDA 4TULH 4PJHB 1INDL 3EDDA 5C07B 3V4PL 1HCFX 2A0LD 1OPGL 4AQOA 5J56B 3MV7E 1HOCB 3KPPB 3TYFA 5DJDA 3H8NA 2P48B 3UTSD 1Q72H 3EYUL 3OG6B 2E6PA 4KPHL 3CC5A 5LAXA 2AK4E 1W72H 2AXHA 1ZGLA 5CD5D 3EYOB 2HT2C 4QRRE 3RX8A 3WDIA 4PD4K 4UV4H 4OCLC 5GGTA 3ZSTA 4RIRB 1A6WH 4NHCL 5D70L 3RUGA 5I75B 3L3OB 2VLLA 5IF0B 1NC2D 3JWNC 5DUPL 2JIXA 2NY0C 3NH7L 2B4CL 4U6VL 5D2NB 3WFBL 1UWXH 3NA9H 2VABB 2R1WB 4H1LG 5B38A 2EZ0C 2R9HD 4PJ5A 2J1KA 2AEPH 2XXMB 1U8OA 5AZ2L 1JGLH 1CFVH 1YEKL 4Q6IA 2HTKD 1XIWB 1WIUA 1CQKA 5FA3A 2NY3B 1ND0B 4OFKA 1QFWM 4LSSL 4ODXB 1QNZH 5IVXE 2BSRA 2R69L 5E2TH 3A6CH 3LSOA 3MRQB 4R2GD 2BY0A 4F58H 2BY3A 1XCQB 2IANB 3PDOA 4OB5L 2AV1A 2GTWA 1RZJL 1DANU 1EHLH 4U2ZA 4YHPB 3VXQB 4KKAD 2EYSA 4N1EA 5A3IC 3CLEL 2XRAH 1XCQA 4H0IA 2N7AA 3AREC 2ZG1A 3QUYA 1CTOA 3ZE2E 1DSFL 4ZSOE 3BPOB 5MEPA 1GZQB 3MA7A 4GOSA 3OZ9L 3QCTL 2NY6B 2YSSA 3QG7L 4HPYH 3FKUS 4TVPD 1CXEA 2FO1A 1OGTB 3GSWB 2AI0L 2WQRA 5KG9A 3SDYL 2VXQL 4HBCH 4P48A 4LCWB 2CMRH 4RMTA 5CSBA 4L29B 2O93L 5SWSD 2R23B 3BP5B 1U2CA 5AWNH 5JR1H 4JGMA 3TPKA 4F80A 5F96H 4H8WL 1CK0H 4OZGA 2UVFA 2AEQL 5D7SH 4E9LA 4PJAB 4NQEB 1R3IH 2VLKB 3MLUH 1CL7L 3QHTC 1RK1A 4AYFA 1UM4H 3QCVH 4KUCD 1RJYA 4N0RA 3V6ZB 3QUZB 5FDYA 2VDOH 5GZNC 4HDIA 1IC4H 1P7KA 2ESVE 12E8H 4IRZL 3PIQB 4LVOB 1AQDA 4OLZH 4MB3A 2WIIB 2YPLD 2AJUH 1IILE 4UILL 5F7DA 5D7JC 2DKUA 4NO2B 4HZLB 4OQTA 4R8WH 4ZMAT 1KJ2B 4Y4KB 4XNUH 3H9SD 1VGKB 4UOW1 4Y8AA 2DQTL 2C4FT 2VQUA 4GW5B 4JO2L 3T2NL 4HZLA 4A2MA 1TTFA 2YUZA 4PUBH 1XR8B 1EEZA 4X80L 2R0ZL 5KZCB 4FXGB 3C9NB 3QNXA 3K8LA 4S1SL 1WUNT 3B5TA 3TBWA 4XCYA 2DLFH 2VLJA 4X7TB 5IMLB 3WHXB 5J6HB 1RUKH 2QHRL 1D5ZA 4R4BB 3QQ9C 3SE4A 1NCUA 1S7SB 5T33L 3MYJB 4WUUD 5DJYA 3PDGA 4Z0XB 1J88A 2PYFA 3RWDA 4KRPD 3O6FB 3KXFD 2IPTH 2NY5C 4PRIB 5JTWA 4UU9B 5F88A 2EYTB 2CXGA 4BKLA 4OZGE 3S97C 2GAZA 2IH3B 1N6QL 1ZS8A 4Y4FA 2NY4B