1CNUA

Phosphorylated actophorin from acantamoeba polyphaga
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
GIAVSDDCVQKFNELKLGHQHRYVTFKMNASNTEVVVEHVGGPNATYEDFKSQLPERDCRYAIFDYEFQVDGGQRNKITFILWAPDSAPIKSKMMYTSTKDSIKKKLVGIQVEVQATDAAEISEDAVSERAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of actin monomers with Acanthamoeba actophorin (ADF/cofilin) and profilin.
pubmed doi rcsb
source organism Acanthamoeba polyphaga
molecule tags Contractile
molecule keywords ACTOPHORIN
total genus 39
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 1999-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1cnuA00
2FH2A 1TMWA 1VFQA 1T44G 2FH3A 1PD0A 1AK7A 5KYWB 2NUPA 1TVJA 4CBWG 1J72A 5HVKD 2FH1A 3EGDB 2VACA 4KEDA 3EG9A 5FAEA 2VIKA 1VKKA 1NPHA 1SVYA 1P8ZG 1D4XG 2KVKA 1NM1G 3EH2A 5KYUA 1SVQA 3EG9B 4PKIG 1SVRA 1NLVG 4KEFA 2D8BA 3CJBG 2XFAA 1COFA 2NUTA 4BEX1 1DEJS 1RGIG 1HQZ1 2FGHA 3EGXB 1CNUA 2MOTA 4S10C 3EH1A 1M2VB 3A5NS 3DAWB 5KYUB 1JHWA 1Q8XA 5KYWA 4KEEA 3CJCG 3FFNA 1M2VA 1PD1A 1KCQA 2I2QA 3A5MS 1F7SA 1M2OA 1ESVS 1PCXA 5DD2A 3L50A 1M4JA 2LJ8A 5IVUA 1YVNG 2W0IA 1T3YA 1QPVA 2HD7A 5KYYA 1V6FA 5FAFA 2VILA 1CFYA 1MDUA 5HVKB 1AK6A 3Q2BA 3CI5G 2NUTB 4PKGG 3TU5B 2FH4A 3A5LS 1H1VG 1WFSA 4CBXG 1C0FS 2LXXA 4LIZA 1T3XA 3EGDA 2L72A 5KYNA 4PKHB 1X67A 2FF6G 4JD2H 1YAGG 1EQYS 5L6WC 3A5OS 1P8XA 4Z94G 1T2LA 5KYXA 2MV2A 2MP4A 3FFKA 4CBUG 2LLFA 3FG6A 2XF1A 1Q8GA 1D0NA 3EFOB 1C0GS 5A1MA 1WNJA 1UDMA 1NMDG 1AHQA 2QTVA 2NUPB 3EGXA 3FG7A 5KYXB 3CIPG 1WM4A 5KYYB 3EFOA 2FF3A
chains in the Genus database with same CATH superfamily
2FH2A 1TMWA 1VFQA 1T44G 2FH3A 1PD0A 1AK7A 5KYWB 2NUPA 1TVJA 4CBWG 1J72A 5HVKD 2FH1A 3EGDB 2VACA 4KEDA 3EG9A 5FAEA 2VIKA 1VKKA 1NPHA 1SVYA 1P8ZG 1D4XG 2KVKA 1NM1G 3EH2A 5KYUA 1SVQA 3EG9B 4PKIG 1SVRA 1NLVG 4KEFA 2D8BA 3CJBG 2XFAA 3DA7A 1COFA 2NUTA 4BEX1 1DEJS 1RGIG 1HQZ1 2FGHA 3EGXB 1CNUA 2MOTA 4S10C 3EH1A 1M2VB 3A5NS 3DAWB 5KYUB 1JHWA 1Q8XA 5KYWA 4KEEA 3CJCG 3FFNA 1M2VA 1PD1A 1KCQA 2I2QA 3A5MS 1F7SA 1M2OA 1ESVS 1PCXA 5DD2A 3L50A 1M4JA 2LJ8A 5IVUA 1YVNG 2W0IA 1T3YA 1QPVA 2HD7A 5KYYA 1V6FA 5FAFA 2VILA 1CFYA 1MDUA 5HVKB 1AK6A 3Q2BA 3CI5G 2NUTB 4PKGG 3TU5B 2FH4A 3A5LS 1H1VG 1WFSA 4CBXG 1C0FS 2LXXA 4LIZA 1T3XA 3EGDA 2L72A 5KYNA 4PKHB 1X67A 2FF6G 4JD2H 1YAGG 1EQYS 5L6WC 3A5OS 1P8XA 4Z94G 1T2LA 5KYXA 2MV2A 2MP4A 3FFKA 4CBUG 2LLFA 3FG6A 2XF1A 1Q8GA 1D0NA 3EFOB 1C0GS 5A1MA 1WNJA 1UDMA 1NMDG 1AHQA 2QTVA 2NUPB 3EGXA 3FG7A 5KYXB 3CIPG 1WM4A 5KYYB 3EFOA 2FF3A
chains in the Genus database with same CATH topology
2FH2A 1TMWA 1VFQA 1T44G 2FH3A 1PD0A 1AK7A 5KYWB 2NUPA 1TVJA 4CBWG 1J72A 5HVKD 2FH1A 3EGDB 2VACA 4KEDA 3EG9A 5FAEA 2VIKA 1VKKA 1NPHA 1SVYA 1P8ZG 1D4XG 2KVKA 1NM1G 3EH2A 5KYUA 1SVQA 3EG9B 4PKIG 1SVRA 1NLVG 4KEFA 2D8BA 3CJBG 2XFAA 3DA7A 1COFA 2NUTA 4BEX1 1DEJS 1RGIG 1HQZ1 2FGHA 3EGXB 1CNUA 2MOTA 4S10C 3EH1A 1M2VB 3A5NS 3DAWB 5KYUB 1JHWA 1Q8XA 5KYWA 4KEEA 3CJCG 3FFNA 1M2VA 1PD1A 1KCQA 2I2QA 3A5MS 1F7SA 1M2OA 1ESVS 1PCXA 5DD2A 3L50A 1M4JA 2LJ8A 5IVUA 1YVNG 2W0IA 1T3YA 1QPVA 2HD7A 5KYYA 1V6FA 5FAFA 2VILA 1CFYA 1MDUA 5HVKB 1AK6A 3Q2BA 3CI5G 2NUTB 4PKGG 3TU5B 2FH4A 3A5LS 1H1VG 1WFSA 4CBXG 1C0FS 2LXXA 4LIZA 1T3XA 3EGDA 2L72A 5KYNA 4PKHB 1X67A 2FF6G 4JD2H 1YAGG 1EQYS 5L6WC 3A5OS 1P8XA 4Z94G 1T2LA 5KYXA 2MV2A 2MP4A 3FFKA 4CBUG 2LLFA 3FG6A 2XF1A 1Q8GA 1D0NA 3EFOB 1C0GS 5A1MA 1WNJA 1UDMA 1NMDG 1AHQA 2QTVA 2NUPB 3EGXA 3FG7A 5KYXB 3CIPG 1WM4A 5KYYB 3EFOA 2FF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FH2 A;  1TMW A;  1VFQ A;  1T44 G;  2FH3 A;  1PD0 A;  1AK7 A;  5KYW B;  2NUP A;  1TVJ A;  4CBW G;  1J72 A;  5HVK D;  2FH1 A;  3EGD B;  2VAC A;  4KED A;  3EG9 A;  5FAE A;  2VIK A;  1VKK A;  1NPH A;  1SVY A;  1P8Z G;  1D4X G;  2KVK A;  1NM1 G;  3EH2 A;  5KYU A;  1SVQ A;  3EG9 B;  4PKI G;  1SVR A;  1NLV G;  4KEF A;  2D8B A;  3CJB G;  2XFA A;  1COF A;  2NUT A;  4BEX 1;  1DEJ S;  1RGI G;  1HQZ 1;  2FGH A;  3EGX B;  1CNU A;  2MOT A;  4S10 C;  3EH1 A;  1M2V B;  3A5N S;  3DAW B;  5KYU B;  1JHW A;  1Q8X A;  5KYW A;  4KEE A;  3CJC G;  3FFN A;  1M2V A;  1PD1 A;  1KCQ A;  2I2Q A;  3A5M S;  1F7S A;  1M2O A;  1ESV S;  1PCX A;  5DD2 A;  3L50 A;  1M4J A;  2LJ8 A;  5IVU A;  1YVN G;  2W0I A;  1T3Y A;  1QPV A;  2HD7 A;  5KYY A;  1V6F A;  5FAF A;  2VIL A;  1CFY A;  1MDU A;  5HVK B;  1AK6 A;  3Q2B A;  3CI5 G;  2NUT B;  4PKG G;  3TU5 B;  2FH4 A;  3A5L S;  1H1V G;  1WFS A;  4CBX G;  1C0F S;  2LXX A;  4LIZ A;  1T3X A;  3EGD A;  2L72 A;  5KYN A;  4PKH B;  1X67 A;  2FF6 G;  4JD2 H;  1YAG G;  1EQY S;  5L6W C;  3A5O S;  1P8X A;  4Z94 G;  1T2L A;  5KYX A;  2MV2 A;  2MP4 A;  3FFK A;  4CBU G;  2LLF A;  3FG6 A;  2XF1 A;  1Q8G A;  1D0N A;  3EFO B;  1C0G S;  5A1M A;  1WNJ A;  1UDM A;  1NMD G;  1AHQ A;  2QTV A;  2NUP B;  3EGX A;  3FG7 A;  5KYX B;  3CIP G;  1WM4 A;  5KYY B;  3EFO A;  2FF3 A; 
#chains in the Genus database with same CATH topology
 2FH2 A;  1TMW A;  1VFQ A;  1T44 G;  2FH3 A;  1PD0 A;  1AK7 A;  5KYW B;  2NUP A;  1TVJ A;  4CBW G;  1J72 A;  5HVK D;  2FH1 A;  3EGD B;  2VAC A;  4KED A;  3EG9 A;  5FAE A;  2VIK A;  1VKK A;  1NPH A;  1SVY A;  1P8Z G;  1D4X G;  2KVK A;  1NM1 G;  3EH2 A;  5KYU A;  1SVQ A;  3EG9 B;  4PKI G;  1SVR A;  1NLV G;  4KEF A;  2D8B A;  3CJB G;  2XFA A;  3DA7 A;  1COF A;  2NUT A;  4BEX 1;  1DEJ S;  1RGI G;  1HQZ 1;  2FGH A;  3EGX B;  1CNU A;  2MOT A;  4S10 C;  3EH1 A;  1M2V B;  3A5N S;  3DAW B;  5KYU B;  1JHW A;  1Q8X A;  5KYW A;  4KEE A;  3CJC G;  3FFN A;  1M2V A;  1PD1 A;  1KCQ A;  2I2Q A;  3A5M S;  1F7S A;  1M2O A;  1ESV S;  1PCX A;  5DD2 A;  3L50 A;  1M4J A;  2LJ8 A;  5IVU A;  1YVN G;  2W0I A;  1T3Y A;  1QPV A;  2HD7 A;  5KYY A;  1V6F A;  5FAF A;  2VIL A;  1CFY A;  1MDU A;  5HVK B;  1AK6 A;  3Q2B A;  3CI5 G;  2NUT B;  4PKG G;  3TU5 B;  2FH4 A;  3A5L S;  1H1V G;  1WFS A;  4CBX G;  1C0F S;  2LXX A;  4LIZ A;  1T3X A;  3EGD A;  2L72 A;  5KYN A;  4PKH B;  1X67 A;  2FF6 G;  4JD2 H;  1YAG G;  1EQY S;  5L6W C;  3A5O S;  1P8X A;  4Z94 G;  1T2L A;  5KYX A;  2MV2 A;  2MP4 A;  3FFK A;  4CBU G;  2LLF A;  3FG6 A;  2XF1 A;  1Q8G A;  1D0N A;  3EFO B;  1C0G S;  5A1M A;  1WNJ A;  1UDM A;  1NMD G;  1AHQ A;  2QTV A;  2NUP B;  3EGX A;  3FG7 A;  5KYX B;  3CIP G;  1WM4 A;  5KYY B;  3EFO A;  2FF3 A; 
#chains in the Genus database with same CATH homology
 2FH2 A;  1TMW A;  1VFQ A;  1T44 G;  2FH3 A;  1PD0 A;  1AK7 A;  5KYW B;  2NUP A;  1TVJ A;  4CBW G;  1J72 A;  5HVK D;  2FH1 A;  3EGD B;  2VAC A;  4KED A;  3EG9 A;  5FAE A;  2VIK A;  1VKK A;  1NPH A;  1SVY A;  1P8Z G;  1D4X G;  2KVK A;  1NM1 G;  3EH2 A;  5KYU A;  1SVQ A;  3EG9 B;  4PKI G;  1SVR A;  1NLV G;  4KEF A;  2D8B A;  3CJB G;  2XFA A;  3DA7 A;  1COF A;  2NUT A;  4BEX 1;  1DEJ S;  1RGI G;  1HQZ 1;  2FGH A;  3EGX B;  1CNU A;  2MOT A;  4S10 C;  3EH1 A;  1M2V B;  3A5N S;  3DAW B;  5KYU B;  1JHW A;  1Q8X A;  5KYW A;  4KEE A;  3CJC G;  3FFN A;  1M2V A;  1PD1 A;  1KCQ A;  2I2Q A;  3A5M S;  1F7S A;  1M2O A;  1ESV S;  1PCX A;  5DD2 A;  3L50 A;  1M4J A;  2LJ8 A;  5IVU A;  1YVN G;  2W0I A;  1T3Y A;  1QPV A;  2HD7 A;  5KYY A;  1V6F A;  5FAF A;  2VIL A;  1CFY A;  1MDU A;  5HVK B;  1AK6 A;  3Q2B A;  3CI5 G;  2NUT B;  4PKG G;  3TU5 B;  2FH4 A;  3A5L S;  1H1V G;  1WFS A;  4CBX G;  1C0F S;  2LXX A;  4LIZ A;  1T3X A;  3EGD A;  2L72 A;  5KYN A;  4PKH B;  1X67 A;  2FF6 G;  4JD2 H;  1YAG G;  1EQY S;  5L6W C;  3A5O S;  1P8X A;  4Z94 G;  1T2L A;  5KYX A;  2MV2 A;  2MP4 A;  3FFK A;  4CBU G;  2LLF A;  3FG6 A;  2XF1 A;  1Q8G A;  1D0N A;  3EFO B;  1C0G S;  5A1M A;  1WNJ A;  1UDM A;  1NMD G;  1AHQ A;  2QTV A;  2NUP B;  3EGX A;  3FG7 A;  5KYX B;  3CIP G;  1WM4 A;  5KYY B;  3EFO A;  2FF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...