1CNUA

Phosphorylated actophorin from acantamoeba polyphaga
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
GIAVSDDCVQKFNELKLGHQHRYVTFKMNASNTEVVVEHVGGPNATYEDFKSQLPERDCRYAIFDYEFQVDGGQRNKITFILWAPDSAPIKSKMMYTSTKDSIKKKLVGIQVEVQATDAAEISEDAVSERAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of actin monomers with Acanthamoeba actophorin (ADF/cofilin) and profilin.
pubmed doi rcsb
source organism Acanthamoeba polyphaga
molecule tags Contractile
molecule keywords ACTOPHORIN
total genus 39
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 1999-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1cnuA00
3FG7A 5KYXB 2L72A 1J72A 5KYWB 2XFAA 4CBWG 1T3XA 5HVKB 3EGXB 5KYUA 2FH4A 1ESVS 5L6WC 1COFA 1H1VG 1AHQA 1NM1G 1C0FS 2LJ8A 3EGDA 3A5LS 2MV2A 3EFOB 3CJBG 2LLFA 4CBXG 1SVYA 1AK6A 3CI5G 2FH1A 1M4JA 1T44G 3A5NS 1P8XA 4JD2H 2FF6G 3A5MS 2NUTA 5KYYB 3L50A 4PKGG 5IVUA 1PCXA 2VIKA 2FF3A 5KYXA 1M2OA 1D4XG 5DD2A 1AK7A 1M2VB 5KYWA 5FAFA 4PKIG 4S10C 1DEJS 2LXXA 1C0GS 1QPVA 2FH2A 1SVRA 1JHWA 5FAEA 3FG6A 3EG9A 3CJCG 3EH1A 2HD7A 1SVQA 3EGDB 3EH2A 5HVKD 3TU5B 3Q2BA 2XF1A 1TMWA 1P8ZG 1TVJA 1V6FA 1PD1A 4PKHB 1YAGG 1YVNG 5KYYA 2MOTA 1F7SA 2FGHA 4KEEA 1WNJA 1EQYS 2I2QA 1KCQA 1Q8XA 1WM4A 3A5OS 5KYNA 1RGIG 2MP4A 1M2VA 1NLVG 4Z94G 1NMDG 5KYUB 4BEX1 1NPHA 1T2LA 2QTVA 1X67A 2VILA 2NUPA 4KEFA 3EG9B 1PD0A 3EFOA 5A1MA 2KVKA 1UDMA 2VACA 2W0IA 4LIZA 1T3YA 3FFKA 4KEDA 1D0NA 1VKKA 1WFSA 3FFNA 3CIPG 1CNUA 1VFQA 3EGXA 2NUTB 3DAWB 1MDUA 2NUPB 1HQZ1 1Q8GA 2FH3A 2D8BA 1CFYA 4CBUG
chains in the Genus database with same CATH superfamily
3FG7A 5KYXB 2L72A 1J72A 5KYWB 2XFAA 4CBWG 1T3XA 5HVKB 3EGXB 5KYUA 2FH4A 1ESVS 5L6WC 1COFA 1H1VG 1AHQA 1NM1G 1C0FS 2LJ8A 3EGDA 3A5LS 2MV2A 3EFOB 3CJBG 2LLFA 4CBXG 1SVYA 1AK6A 3CI5G 2FH1A 1M4JA 1T44G 3A5NS 1P8XA 4JD2H 2FF6G 3A5MS 2NUTA 5KYYB 3L50A 4PKGG 5IVUA 1PCXA 2VIKA 2FF3A 3DA7A 5KYXA 1M2OA 1D4XG 5DD2A 1AK7A 1M2VB 5KYWA 5FAFA 4PKIG 4S10C 1DEJS 2LXXA 1C0GS 1QPVA 2FH2A 1SVRA 1JHWA 5FAEA 3FG6A 3EG9A 3CJCG 3EH1A 2HD7A 1SVQA 3EGDB 3EH2A 5HVKD 3TU5B 3Q2BA 2XF1A 1TMWA 1P8ZG 1TVJA 1V6FA 1PD1A 4PKHB 1YAGG 1YVNG 5KYYA 2MOTA 1F7SA 2FGHA 4KEEA 1WNJA 1EQYS 2I2QA 1KCQA 1Q8XA 1WM4A 3A5OS 5KYNA 1RGIG 2MP4A 1M2VA 1NLVG 4Z94G 1NMDG 5KYUB 4BEX1 1NPHA 1T2LA 2QTVA 1X67A 2VILA 2NUPA 4KEFA 3EG9B 1PD0A 3EFOA 5A1MA 2KVKA 1UDMA 2VACA 2W0IA 4LIZA 1T3YA 3FFKA 4KEDA 1D0NA 1VKKA 1WFSA 3FFNA 3CIPG 1CNUA 1VFQA 3EGXA 2NUTB 3DAWB 1MDUA 2NUPB 1HQZ1 1Q8GA 2FH3A 2D8BA 1CFYA 4CBUG
chains in the Genus database with same CATH topology
3FG7A 5KYXB 2L72A 1J72A 5KYWB 2XFAA 4CBWG 1T3XA 5HVKB 3EGXB 5KYUA 2FH4A 1ESVS 5L6WC 1COFA 1H1VG 1AHQA 1NM1G 1C0FS 2LJ8A 3EGDA 3A5LS 2MV2A 3EFOB 3CJBG 2LLFA 4CBXG 1SVYA 1AK6A 3CI5G 2FH1A 1M4JA 1T44G 3A5NS 1P8XA 4JD2H 2FF6G 3A5MS 2NUTA 5KYYB 3L50A 4PKGG 5IVUA 1PCXA 2VIKA 2FF3A 3DA7A 5KYXA 1M2OA 1D4XG 5DD2A 1AK7A 1M2VB 5KYWA 5FAFA 4PKIG 4S10C 1DEJS 2LXXA 1C0GS 1QPVA 2FH2A 1SVRA 1JHWA 5FAEA 3FG6A 3EG9A 3CJCG 3EH1A 2HD7A 1SVQA 3EGDB 3EH2A 5HVKD 3TU5B 3Q2BA 2XF1A 1TMWA 1P8ZG 1TVJA 1V6FA 1PD1A 4PKHB 1YAGG 1YVNG 5KYYA 2MOTA 1F7SA 2FGHA 4KEEA 1WNJA 1EQYS 2I2QA 1KCQA 1Q8XA 1WM4A 3A5OS 5KYNA 1RGIG 2MP4A 1M2VA 1NLVG 4Z94G 1NMDG 5KYUB 4BEX1 1NPHA 1T2LA 2QTVA 1X67A 2VILA 2NUPA 4KEFA 3EG9B 1PD0A 3EFOA 5A1MA 2KVKA 1UDMA 2VACA 2W0IA 4LIZA 1T3YA 3FFKA 4KEDA 1D0NA 1VKKA 1WFSA 3FFNA 3CIPG 1CNUA 1VFQA 3EGXA 2NUTB 3DAWB 1MDUA 2NUPB 1HQZ1 1Q8GA 2FH3A 2D8BA 1CFYA 4CBUG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FG7 A;  5KYX B;  2L72 A;  1J72 A;  5KYW B;  2XFA A;  4CBW G;  1T3X A;  5HVK B;  3EGX B;  5KYU A;  2FH4 A;  1ESV S;  5L6W C;  1COF A;  1H1V G;  1AHQ A;  1NM1 G;  1C0F S;  2LJ8 A;  3EGD A;  3A5L S;  2MV2 A;  3EFO B;  3CJB G;  2LLF A;  4CBX G;  1SVY A;  1AK6 A;  3CI5 G;  2FH1 A;  1M4J A;  1T44 G;  3A5N S;  1P8X A;  4JD2 H;  2FF6 G;  3A5M S;  2NUT A;  5KYY B;  3L50 A;  4PKG G;  5IVU A;  1PCX A;  2VIK A;  2FF3 A;  5KYX A;  1M2O A;  1D4X G;  5DD2 A;  1AK7 A;  1M2V B;  5KYW A;  5FAF A;  4PKI G;  4S10 C;  1DEJ S;  2LXX A;  1C0G S;  1QPV A;  2FH2 A;  1SVR A;  1JHW A;  5FAE A;  3FG6 A;  3EG9 A;  3CJC G;  3EH1 A;  2HD7 A;  1SVQ A;  3EGD B;  3EH2 A;  5HVK D;  3TU5 B;  3Q2B A;  2XF1 A;  1TMW A;  1P8Z G;  1TVJ A;  1V6F A;  1PD1 A;  4PKH B;  1YAG G;  1YVN G;  5KYY A;  2MOT A;  1F7S A;  2FGH A;  4KEE A;  1WNJ A;  1EQY S;  2I2Q A;  1KCQ A;  1Q8X A;  1WM4 A;  3A5O S;  5KYN A;  1RGI G;  2MP4 A;  1M2V A;  1NLV G;  4Z94 G;  1NMD G;  5KYU B;  4BEX 1;  1NPH A;  1T2L A;  2QTV A;  1X67 A;  2VIL A;  2NUP A;  4KEF A;  3EG9 B;  1PD0 A;  3EFO A;  5A1M A;  2KVK A;  1UDM A;  2VAC A;  2W0I A;  4LIZ A;  1T3Y A;  3FFK A;  4KED A;  1D0N A;  1VKK A;  1WFS A;  3FFN A;  3CIP G;  1CNU A;  1VFQ A;  3EGX A;  2NUT B;  3DAW B;  1MDU A;  2NUP B;  1HQZ 1;  1Q8G A;  2FH3 A;  2D8B A;  1CFY A;  4CBU G; 
#chains in the Genus database with same CATH topology
 3FG7 A;  5KYX B;  2L72 A;  1J72 A;  5KYW B;  2XFA A;  4CBW G;  1T3X A;  5HVK B;  3EGX B;  5KYU A;  2FH4 A;  1ESV S;  5L6W C;  1COF A;  1H1V G;  1AHQ A;  1NM1 G;  1C0F S;  2LJ8 A;  3EGD A;  3A5L S;  2MV2 A;  3EFO B;  3CJB G;  2LLF A;  4CBX G;  1SVY A;  1AK6 A;  3CI5 G;  2FH1 A;  1M4J A;  1T44 G;  3A5N S;  1P8X A;  4JD2 H;  2FF6 G;  3A5M S;  2NUT A;  5KYY B;  3L50 A;  4PKG G;  5IVU A;  1PCX A;  2VIK A;  2FF3 A;  3DA7 A;  5KYX A;  1M2O A;  1D4X G;  5DD2 A;  1AK7 A;  1M2V B;  5KYW A;  5FAF A;  4PKI G;  4S10 C;  1DEJ S;  2LXX A;  1C0G S;  1QPV A;  2FH2 A;  1SVR A;  1JHW A;  5FAE A;  3FG6 A;  3EG9 A;  3CJC G;  3EH1 A;  2HD7 A;  1SVQ A;  3EGD B;  3EH2 A;  5HVK D;  3TU5 B;  3Q2B A;  2XF1 A;  1TMW A;  1P8Z G;  1TVJ A;  1V6F A;  1PD1 A;  4PKH B;  1YAG G;  1YVN G;  5KYY A;  2MOT A;  1F7S A;  2FGH A;  4KEE A;  1WNJ A;  1EQY S;  2I2Q A;  1KCQ A;  1Q8X A;  1WM4 A;  3A5O S;  5KYN A;  1RGI G;  2MP4 A;  1M2V A;  1NLV G;  4Z94 G;  1NMD G;  5KYU B;  4BEX 1;  1NPH A;  1T2L A;  2QTV A;  1X67 A;  2VIL A;  2NUP A;  4KEF A;  3EG9 B;  1PD0 A;  3EFO A;  5A1M A;  2KVK A;  1UDM A;  2VAC A;  2W0I A;  4LIZ A;  1T3Y A;  3FFK A;  4KED A;  1D0N A;  1VKK A;  1WFS A;  3FFN A;  3CIP G;  1CNU A;  1VFQ A;  3EGX A;  2NUT B;  3DAW B;  1MDU A;  2NUP B;  1HQZ 1;  1Q8G A;  2FH3 A;  2D8B A;  1CFY A;  4CBU G; 
#chains in the Genus database with same CATH homology
 3FG7 A;  5KYX B;  2L72 A;  1J72 A;  5KYW B;  2XFA A;  4CBW G;  1T3X A;  5HVK B;  3EGX B;  5KYU A;  2FH4 A;  1ESV S;  5L6W C;  1COF A;  1H1V G;  1AHQ A;  1NM1 G;  1C0F S;  2LJ8 A;  3EGD A;  3A5L S;  2MV2 A;  3EFO B;  3CJB G;  2LLF A;  4CBX G;  1SVY A;  1AK6 A;  3CI5 G;  2FH1 A;  1M4J A;  1T44 G;  3A5N S;  1P8X A;  4JD2 H;  2FF6 G;  3A5M S;  2NUT A;  5KYY B;  3L50 A;  4PKG G;  5IVU A;  1PCX A;  2VIK A;  2FF3 A;  3DA7 A;  5KYX A;  1M2O A;  1D4X G;  5DD2 A;  1AK7 A;  1M2V B;  5KYW A;  5FAF A;  4PKI G;  4S10 C;  1DEJ S;  2LXX A;  1C0G S;  1QPV A;  2FH2 A;  1SVR A;  1JHW A;  5FAE A;  3FG6 A;  3EG9 A;  3CJC G;  3EH1 A;  2HD7 A;  1SVQ A;  3EGD B;  3EH2 A;  5HVK D;  3TU5 B;  3Q2B A;  2XF1 A;  1TMW A;  1P8Z G;  1TVJ A;  1V6F A;  1PD1 A;  4PKH B;  1YAG G;  1YVN G;  5KYY A;  2MOT A;  1F7S A;  2FGH A;  4KEE A;  1WNJ A;  1EQY S;  2I2Q A;  1KCQ A;  1Q8X A;  1WM4 A;  3A5O S;  5KYN A;  1RGI G;  2MP4 A;  1M2V A;  1NLV G;  4Z94 G;  1NMD G;  5KYU B;  4BEX 1;  1NPH A;  1T2L A;  2QTV A;  1X67 A;  2VIL A;  2NUP A;  4KEF A;  3EG9 B;  1PD0 A;  3EFO A;  5A1M A;  2KVK A;  1UDM A;  2VAC A;  2W0I A;  4LIZ A;  1T3Y A;  3FFK A;  4KED A;  1D0N A;  1VKK A;  1WFS A;  3FFN A;  3CIP G;  1CNU A;  1VFQ A;  3EGX A;  2NUT B;  3DAW B;  1MDU A;  2NUP B;  1HQZ 1;  1Q8G A;  2FH3 A;  2D8B A;  1CFY A;  4CBU G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...