1CO1A

Fold of the cbfa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
115
structure length
115
Chain Sequence
ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CORE BINDING FACTOR ALPHA
publication title The Ig fold of the core binding factor alpha Runt domain is a member of a family of structurally and functionally related Ig-fold DNA-binding domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 15
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 1999-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1co1A00
4XR8C 2RMNA 1EAQA 2X0UA 3WTSA 3D08A 3WTXA 1CMOA 2IOOA 3D0AA 5LGYA 3VD0A 2BINA 2J1ZA 3WTTA 3US1A 2X0WA 2J21A 3ZMEA 4IBZA 4GUOA 2ADYA 2GEQA 3IGKA 2XWCA 5G4NA 4HJEA 1TUPA 2P52A 2XWRA 4LO9A 2MEJB 2OCJA 2BIOA 3D05A 5ECGA 2J20A 4IJTA 2ATAA 3WTYA 2BIMA 4IBQA 1EAOA 4A63A 2H1LM 4QO1B 5G4MA 5AB9A 3VD1A 5AOIA 4AGNA 2J1XA 4GUQA 2J1YA 3TS8A 1HJBC 2J6WA 1UOLA 4AGPA 1IO4C 3D09A 3VD2A 4IBVA 4KVPA 4IBYA 1LJMA 5AOMA 4L18A 4G82A 4IBUA 1CO1A 2X0VA 5AOJA 1T4WA 2BIQA 4IBTA 3IGLA 3Q06A 3D06A 1GZHA 4MZIA 4AGOA 1HU8A 2YBGA 5ABAA 4LOEA 1GZHC 4AGLA 3KMDA 5AOKA 5AOLA 2IOIA 4AGMA 4AGQA 4IBSA 4LOFA 5A7BA 3EXLA 3Q05A 1HJCA 2BIPA 2J1WA 1TSRA 4L0ZA 1KZYA 3QYNA 2IOMA 3D07A 1EANA 5G4OA 2PCXA 2AC0A 3WU1A 5KBDA 4MZRA 3EXJA 3WTUA 3WTVA 1YCSA 4L0YA 2FEJA 2AHIA 3WTWA 1E50A 3US0A 2WGXA 5BUAA 2VUKA 3Q01A 5LAPA 3KZ8A 1H9DA 4G83A 4IBWA 3QYMA
chains in the Genus database with same CATH superfamily
2EDNA 4XTRD 1OTUC 4OIBA 5JXAH 4G8GE 2ZYSA 1XCQB 4U2ZA 3QEQE 3DLQR 3KH3A 5BRPA 5D4QA 2VKWA 1GCYA 3VFUB 1O6SB 1IM3A 1UTDA 4GUOA 4Y1AD 4Y2DC 4Y2NA 4IDLA 3TO4A 4X9BA 3PREA 3D85D 1DJWA 1NAKL 3V7AE 3T6QC 3IGKA 3AY4C 1GJIA 4L3FA 4Y5VC 4URTB 3SDCA 2JJSA 3FRPB 4W9JC 4RZCB 3ESNA 4PEEA 3PWPD 3DIVA 3MRQB 5T3XL 2XQ0A 4L4VA 4D9LH 2XPGB 1YZZA 2WINB 4XTRC 2CSPA 4JRYE 1U95A 2ZAIA 1EV2E 3ZTJH 5BQDA 1K4DB 5FGCB 4NNYB 4OTXH 5FFOA 5C0CD 3PHSA 1GPOH 4I88A 1AFVH 5J9PB 4XMXA 5JW4R 3OKMB 2ZXCA 2NY5L 2KLRA 2X4QA 4JFXB 4KMLB 2R69H 4YHLH 1OT2A 4APQB 1FYTB 4PJAA 4A7SA 5F7EH 4RLDA 2EH7H 3CC5A 1NCWH 1MFCH 4PRID 4ORZC 2E4TA 3IGAA 3FHQA 5KVDL 1XIWD 4FHJA 5MI0B 1I8KA 2X4NA 5T1MA 4ODVL 5DQJA 1BIIA 5CM1A 3T04D 3FAXA 4Q74A 3D4GA 3V52H 1FNFA 1YEDB 5I30L 2XZQH 1JGVL 5LAXB 3RUGA 4FAAB 4Q9RH 3TWCH 5DVOA 4HFUH 5E0FA 3NOIA 4MXQC 5GS1B 5E24E 3SBWC 5HP5A 4YDVA 2UXVA 4Z7VF 2VDQL 3DUUA 1XAKA 1JS4A 2XVGA 1J12A 5E8PA 2HG0A 3BPNC 4MAUH 1WA2X 3ARGC 1S9VB 4Y19E 3VI4B 1SVBA 3BKMH 4KY2A 1V05A 3ABZA 5CUSL 1F58H 3O6KH 3ARRA 3RFZB 4R2GD 4V2CB 3UTTB 1BLNA 3I3BA 3LOWA 3EJQA 5LDUA 2A9NH 4CSSA 1HJCA 1FYTE 2CO3A 5CEZE 1YA5A 3QRGH 5F7WC 5LLIC 1G43A 2WJ7A 3K6SB 1I85A 2NW3A 1KIRB 2NOYA 3EBGA 4NDMA 3UTSA 4M7JH 2ITFA 3HLAB 4TOYL 3NK4A 3SODB 3COOA 3IJHA 3FCGA 2IDCA 3S35L 2XZZA 4GW4A 1FNSH 4U6XA 2GABA 4C54A 3VFMA 1JVLA 4HC1H 4X5LA 3ZKMD 3ZQXA 4DGVL 1A6UH 5E5UB 4YSSA 2EYTB 2B1HH 2CD0A 2DDQH 4R2GC 4EUPH 2A0LC 2UY6B 2Z3FA 4UNIA 1K3IA 4TL5A 5EEZA 1IE4A 1CL7I 4JO1H 1C5DB 1FC2D 5MERB 1KIQA 3PWVB 1GAFH 4M5YH 3QJVB 2CNZA 1WISA 4XCYA 1BX2A 3ULSA 1PU0A 5IWLC 1J18A 4AQ8A 1E9QA 3U83A 1IKFL 2FEEL 3L1GA 3GBNH 4R7XA 3ZKMC 5LJYH 4QLWA 4P46B 4OUOA 3O9WD 1TJGL 1A1MA 1UA6H 4G1MA 3SYAA 3WJLC 4OAWB 2WUCH 2AW2A 2FL5B 2EDOA 2WQVA 5ICZB 1LM8V 1OSZA 1A14H 3S3PA 5IK3A 3V6BR 5IKCA 1DBAL 2ITDB 3NTCH 1SNRA 2OBGA 5TDOA 5JTWA 3DX7A 1PZBA 4XC1L 5I24A 5LN4A 1CFBA 3JTTA 1DJIA 1IEBA 1C5CL 2PR9A 5EUOB 3D52A 4N8UA 1H3PH 5MEOB 1F4XL 3SDXB 2BERA 2DN7A 4Y5XA 1A22B 3CQPA 4O02H 4NO2A 2R39A 3AS3A 4Y4FB 1JBJA 3M1OA 5F1SA 3W0WD 4Z78A 3C9NB 1ZGLB 3O9WC 3QI9A 2YPLB 4NLHA 4F33A 1LMIA 2JCCA 5DJ6B 4GQ9L 3FU8A 1MJ8L 3H1ZA 2VTFA 1ZHKA 5T1DH 4P2QE 2WNWA 2JB5H 1A9EB 3PXHA 4PQXA 3LKRA 5DZNA 3VVWA 1N64H 3QCTH 1OP3K 1A6AB 5D7JC 1NQBA 1RIHL 2WXHA 3Q8EA 4LEOA 4KQ0A 3PWJA 4HS3B 3PNWB 2VQ1B 3PIQA 3EO0B 1UCBH 4FYSA 3UIZA 3FMGH 3DRQA 4I3RH 5AVWB 4R84A 4WUUB 1MRFH 3SDXE 5DJDB 5I5JA 2CCVA 4TSCL 3U2SA 4ZPTB 4MMXA 1YC7A 5CCKH 2OZNA 2XZCH 4LLYB 1HSBA 4QY8B 2FTAA 5DK2A 1NKGA 2OMZA 2YPLE 2AF2A 3OAZK 4YLBA 5ESAA 5ALBH 1R5IB 5ES4B 3TT3H 4M7LT 4JG5A 1UWEH 3M6DA 1Y6KR 5FYKU 2BC4A 1NMCC 3R7RA 3MV7A 3QXTA 2HH0H 3FB6B 1HH9B 2OW7A 1U30A 3QDHA 4Q7DA 4NP4H 5EORL 5JOPE 4MJID 4PR5A 2QKIA 3IFPA 2C9UA 3MGOA 4G83A 4MQXC 1Q1PA 3MMEA 4IOFC 3VH8B 4UV7L 2DWDA 1BVNP 4IIQB 1IARB 4BK8A 1BFSA 4QRRB 4PRBA 1X7SA 1JF1B 4HKZB 3QQDA 3BVTA 2DMKA 5EA0L 4I1PA 3QW9A 1JGEB 1QFOA 1T6VN 4ONGL 4CN4A 1NGPH 4NFBA 4JAMA 5HDBB 1ZT7A 3QIWC 4WUUE 2V2WB 4IBZA 3CBRA 3SKMB 4XNZC 1YYLH 4AQ1B 4YDIL 2HX9A 3FC8A 3FQ4A 4AEHL 5DJXB 5F7LB 1NBZB 5I1CL 2EEXA 3GSUA 3WV0A 2V9TA 4P2OB 1T2QL 1RCYA 2GK0A 1MWAB 2OW6A 1YMMB 2F7RA 2D7NA 4MA3A 1JIBA 2PNDA 3RTQA 2GK2A 4MHHG 4LEEA 2ADGB 4JY5H 3BZEA 1KSRA 4CGTA 4F2MA 3KGUA 1UWXH 4WO0A 5KYWA 4K2UL 1DBJL 4QRRE 1FN4B 2CALA 4PGZA 3ZHKA 1FSKC 4U6TA 4HSCX 2FIRT 3DV4B 4GAYB 4LSUH 3HI1A 4LESA 32C2A 2YUZA 4OZIF 5HDBE 3HAEH 3HC3H 1NCIA 1IFHH 3JXAA 3UGXA 1QTYT 4JCLA 4OT1L 3UAJA 4U6HB 1XMEB 2FJSA 4PIBA 5A2KH 3A5VA 4E5XB 3LIZL 1WRFA 2OULB 4J5VA 2XWBB 5DWPA 4XO9A 2KPWA 1CD0A 1NAMB 2WXKA 5K9QG 2IMMA 2P4AB 5GQBA 1YMME 3HNTH 2JSFA 2F61A 3O81A 4QMEA 5DJ0B 5F9AC 3U36B 4WTZA 4FLQA 1RUAL 1E4XH 5BZDB 1CI3M 1QFWI 4GH7B 4BKSC 3IJYA 4LCCA 2WYHA 4K5NA 4AUUA 3QZBA 4NQTA 1TETL 3LIUA 4FQHB 4WI0A 3MLYL 4H8PA 1JYXA 5E8NB 1UATA 4N8VB 2K8QA 3AJ7A 4P2RD 4PSRA 4Q6KA 3WU1A 4OZHB 4HS8H 3DO7A 1JZ3A 4YPJA 3I74A 1CFNA 3NEEA 2WMPB 4YBHA 4O2FA 2OI9B 1ZANL 3F12B 3IFLH 1U4EA 1NCDH 4UQIM 4CW1B 4F3FA 1N10A 1Q94B 2A4ZA 2CU9A 4I18C 2EP6A 3KZ8A 5L0QB 3SDAB 3T9WA 1QTPA 3LQMA 4K7PX 1I1AB 3NG5A 1RZFL 3AQYA 3D2TA 3KLHD 5HHNA 1MVYA 4EBQL 2L7QA 3C75A 3QJTB 4N22A 4ZFOA 1A3RH 4LHUD 4HIHB 1NGYA 2IOOA 3SD5A 5I2IB 5D7IF 2CRMA 5DMKB 3HMXH 1KLFA 4UILL 4ODHL 4M9OA 5HJ3B 5SWSD 2ZXGA 3EYQC 5GS2H 1JZDC 5FYLD 4KKQA 3QA3A 3QULB 4QF1B 4D0BA 1J7VR 5TPWH 3FQXB 3TVMB 1SHMA 3JVFC 3CFBA 5GRJH 1LEKA 5CR1A 2IQ9H 1A4AA 5J1AB 3O2WH 5EDXA 5DWUH 2BIMA 3W9EB 1UFGA 3KBFA 1DFBL 3KLHC 1DQVA 2AJ3B 3OPUA 1T1YA 1EAJA 3HMWL 5EV7A 3B2PA 1A6ZB 3JYBA 4KY1H 1MLBA 1OSPL 2AI0L 1CFQA 3DC0A 4OIAA 5F1NA 4FFWD 1Q38A 4CBPA 3LZFH 4L8SB 4LEXL 2ENSA 2F5BH 3G5YB 1JF6A 4LEBA 1VESA 1I1RA 3NN8B 4S0SD 1HNFA 5D93B 2BCKB 2HFFB 3ES6B 3PV6B 1MCSA 5D4JA 4YXLH 4NZDA 1R4XA 4G8GD 4NFCA 4KVPA 4CVXA 3QEQD 1ZHLB 4IBYA 1Q9KB 2XQBH 1U36A 1A21A 2OX5B 4JO2L 1RK1B 2KT6A 5ANMA 1YNKL 3TL5A 4DF9A 3BX7C 5IHZB 4OI9A 4PY7A 4UWQB 2AEOA 1FG2A 5I0VA 3GRWH 2LHAA 2WVSA 4FTDA 1I7RA 4KV5E 4X4KA 4FFWC 3TTYA 1QBMH 1XBRA 3B2XA 1UQSA 3WDIA 2EIZB 5BXFB 4JR9L 5CMAB 3CFTA 1HKLL 1LXMA 3K1DA 2G2RB 4XT1C 3T4AB 1IRAY 3MODH 1B9ZA 1P7QD 1TCRA 3O4LE 4JRYD 3MCLH 1KN2H 5I1JL 1BFVL 1NEZB 5DDHB 3V0GA 1Q4NX 1P9MA 3P73B 4Q89A 2BJML 5TF0A 4FQCL 1T1WA 5D96C 4R8WH 5GGRA 3U6XS 5AYQA 5BS0A 2OL3B 3QIUD 3U7YL 1HQRB 3OVUB 4XMVA 4NZUH 3SE4C 3GIVB 5J7CC 2QV4A 4KXCA 4PG2A 5IMOA 3VU2A 4HBQA 3VYPA 5IB4B 1JTTA 5GGVH 1OOWA 2YEZB 2EXSA 3NIGB 1J5OL 1FL3A 4ZUTA 5ID0B 1FL5A 1BQRA 3AXHA 2OPCA 1MFAL 4QCIA 4FL4C 3U7AA 5DJCA 1ASOA 2FYYB 1F86A 3FUFA 1OGTA 5J3HD 4WNQA 3ZHDA 5BRQA 4MCZA 2QSCH 2K45A 2VDMB 2Y7QA 3BH8A 4PJGB 5HHVH 1EHNA 2AVFA 4FEMA 4Y19D 2X0WA 1H6UA 4M61A 1ORQA 2APVA 1MNUH 4FTVE 2XN2A 1QUPA 2LLGA 2AK4E 5DZVA 1FAIH 3JTSA 4KX7A 5G4NA 4H2AA 4APQD 2BVQB 1FYTD 3BXNA 4QJ4B 5CEZD 4LO9A 1WFUA 5L6YH 2WIMA 3OR7A 3ULUL 1IGCL 1B0GB 3L4UA 4GMTH 1CIDA 4JKWA 2MNUA 4PPTA 4IBQA 4M5ZH 4L1BA 4HEMA 4LBEB 1ACZA 5K9KA 4P5RA 5J3HC 1L0PA 1FNLA 1MQ8A 1BCIA 3NIGE 1M9SA 4AXWB 1QHOA 3FUDA 3SPIA 2IWFA 2VGLM 2D2OA 5IQOA 1RUKL 1OW0C 3PF2A 2NX5B 2NTFB 5CILH 1R3IL 2WNKA 5JXED 4XPHH 5IB3A 3PP4H 4PJGE 4H0IA 1Z5LB 4APQC 2VZSA 4KOBA 2EDLA 3AXLA 4K3EH 4YSAA 1M7XA 1FL6B 5TK4A 5ABZA 4WFHE 3TBWB 4XNXH 4ADJA 1QKZL 2GG1A 5MI0C 3O2DL 3D87B 3VE0A 4GXUN 1SF3A 5BOZG 1GCFA 4NKDB 3DSFL 2IALB 3CUPA 3QORA 4XPTH 5D71H 1M71A 5DJAA 4EZKA 2IXQA 2YSSA 3WEXB 2OMNA 5FA4A 1EHKB 1JPST 5FCSH 1ZGLM 3TPUA 5GS1C 2X4SA 4PJ8A 1EUTA 2H2PD 4AYFB 4I77H 5D2LA 1UENA 4HIXL 5CJXA 3HPJA 3MYJA 4IIZA 4E9VA 4XX5A 1KT2B 1SJMA 3X11B 4ESKA 2W65B 3BMWA 4ZW5A 1CG9A 5T1LB 4N9GA 1P84K 2D3NA 2XIDA 3RFZC 3SQRA 3X12B 3N1FC 3F83A 3IXAA 1CYGA 2ZPKL 2A99A 1G84A 2X4UB 4JPWL 1GYUA 4X4MA 2DBLH 5ACMA 5HBBA 4NPYB 3WTUA 2H2PC 1QWHA 1I7UA 3MCYA 2X7LA 1FIEA 1VACA 2APTA 5BRZE 4HCGA 2CUMA 4KI5F 4YR6A 4JQXC 5J4MA 4M6NL 3KR3H 4P2QD 5IHWA 3ZU8A 1YEHL 4XVJH 3IMUA 3DX9B 2JJWA 4P46D 5LO7A 2X6BA 3W81A 4K8RD 3Q6FA 4PJDB 4DKEL 4JY6B 1Q9WA 5JPMB 3EOTH 5D7IA 4FZ8H 5IQ9A 3WO3B 1ACYL 4FGMA 3UBXG 3EUDA 1N59B 1OHZA 4GRMA 3VFNA 4R7LA 4GFXA 2WTRA 2V5RA 2VLKA 5G5DA 4X4XB 4HH8A 3ARYA 4FG0A 2Z35B 5H37A 2BNUB 4JFYB 5SV4A 2ADIA 4LU5H 5CJ5A 5IHLB 1J1PL 5MP6L 1DDTA 2XQYG 4QHUB 4F58H 1OGAE 1WICA 2IDQA 2YAQA 1MNNA 2PW2B 4ELKB 2Z92B 4OQTA 4HAKA 4LARL 4P46C 2HPTA 2YPLD 4N6RB 4QYAA 4U1NA 3ETBF 3M8OL 5KBPA 2AEQH 5DK0B 3KXFB 3AG2B 3OKOA 3O3DB 1F6AB 1I8IB 1OL0A 4ZRGA 1CE1H 4BGLA 1ES0B 1G0YR 4HUVB 4UM9B 1CFMA 3L54A 5JOPD 3ABMB 3QFGA 4P3CL 2VLRE 1QPPA 4R26H 3RWFA 2UX7A 4QHKJ 5D4HA 8FABB 4WI5A 1F11A 3L5XH 4GRLA 1ZLUH 4PJXB 4Y4FC 2IVFC 1Z6JT 5JIMA 1TYJA 3WDJA 4HWNA 1XCWA 4NQXB 1Z66A 3QIBA 4YHPA 4U7KA 4WUUD 3CDFA 3IF1B 3VSVA 3NACH 3LSOA 3FTVA 4KVCH 4I0KA 4I9XA 3IGLA 3OKDB 4M6ML 2CBMA 3LRKA 4EAEA 2OJZH 1YO4A 5EIVA 1ZV2A 5F88A 3KXFE 3TF7C 2OMWB 2GJ6A 2LV4A 1D5XA 4PGCB 2BZCA 4FNLH 1IQWH 2JLPA 3ESMA 2E7LC 3MRCA 1JYNA 1RSFA 2VLJB 4HIQA 1T83A 2Q6WB 3ZUCA 3DHPA 4MJ6B 5LXGH 1NDMA 4L3EB 2QZ5A 1NINA 4ETQA 2Z8WC 4ZYKB 4DZ8A 4MD5B 3RA7L 5DFWH 3G5ZA 4QRRD 2O26U 4ZUUB 3NCFB 3ZRSA 4PJXE 3QQ3B 2BS9A 1IAKB 1TITA 1F4AA 4DCQB 2Y36H 3ZDZF 3Q2LA 4JFEA 3ATBA 4W6YB 4NENB 4AIEA 1PLCA 3F6JA 3CZUB 4Y16D 1IT9H 3EIFA 4Z0XA 3W57A 4HLEA 4K15A 1CBVL 4I3SL 3GSXB 1DYZA 2WNXA 2XT1B 2A83A 3GIZH 4FHKA 4KK5C 4OCSL 4WO4D 2GFBB 4N8CH 1XGUA 1SYVB 3GNML 2P5EB 4S1RL 4C55A 5DLMH 3EYUH 2ADYA 1RZGB 4HULB 4ZMQA 2YZ8A 3HUJB 2QSQA 3ESOA 4IIQC 3QWOA 4GIAA 4L29A 1IGTB 1YMMD 2H0JA 3APCA 1AS7A 1YNTB 2VLJE 1LNUA 3RY6A 1DJSA 1ID5I 4GJTB 2XV6B 4L3EE 5DJ8B 1I8AA 3F7VA 3L08A 1ED3A 4MD0A 4P9ML 4X80H 4X9HA 1RK0A 4PJ6A 4EPSA 4NBYB 1WP6A 4LPCA 2C3XA 3VDCA 4TNEA 1S9XB 1LO3L 1P7BA 3X1GA 3OWEA 1G6RB 4UQ2B 4AQ1C 3QZWG 1NEUA 1NFAA 1NCCL 1TF4A 5EBWA 4AMKH 1EDYA 2FBRA 4OIIH 2EDEA 3MLSH 1BF5A 4N1EA 4J6IA 1XHHA 1B2WL 2EDKA 3CX5J 3MXWL 4HLZG 4P2OC 1BM3L 1EIBA 5ENWB 1JE6A 1NGWA 2XWJA 4K7FB 4P07A 2B1AH 4HAFA 5E2WH 4NUMA 4P57A 4X4YB 4YHML 2AV1A 3HUJE 1MCCA 3NSJA 4O02B 4IRJB 2FSEB 4N2EA 2VDKB 3L7EA 4NRXB 4YOKA 4TTGA 1ZWIB 2I9TA 1BJMA 1INQA 1N12A 4OFQA 2Z93B 5I8KL 3L95B 4A6YL 4K5MA 2G0LA 3CPLA 2A9ML 5IVOA 4FQIL 5JLZB 2NW2A 3MV01 3C12A 5A2CA 1KNOA 3QFJA 2YPKB 1H3XA 1UXWB 3MLXH 4FFZL 3R06A 4KXDA 2OXHA 2EINB 2AV7A 1FDLH 5GS0L 2WXNA 5JIDA 5IR1B 4KXAA 4QRQB 1B4JL 3GI9L 1VEPA 3FSZA 4OCNC 4LLQA 3ARWA 3OG6B 5HYJB 2LFGA 1TTUA 3VG0L 5HGHB 2V5TA 1ZJBA 2PN5A 4FABH 3WKNA 1P6WA 3SDAD 3V8OA 1S46A 5EBMB 3OX8A 5I76B 3MX0B 4QRBA 3S37L 3IJEB 4CDGC 5FKAB 2JXMB 3CTTA 2PXYA 4Y2LA 3GMNB 2VIRA 4CSZA 5IEHA 1FZKA 3IVKB 1DQIA 2YK1H 3T4YA 2VAAB 1ZV5A 3KPRA 3NIFB 3Q2CA 3C5XA 4JGUA 2NUTA 4PJIF 3OLEA 5IB5B 4JKPL 1P0SE 1CDHA 3TBBA 2D9QB 4AEIH 5FB8B 2OI9C 4KUZL 2G2PA 3FW6A 1UASA 5KSUA 2DF3A 2AABH 3X3FL 3APNA 4Y4KA 5I16B 2GHWB 5L0QC 3SDAC 2VDOB 3JV0A 3U2IA 2Q7NA 1IKNC 3L3JA 1I1AC 5B3NA 3WXWH 2RMNA 5JMOC 4JK0D 1YECH 3GMPA 3OD3A 3DRTA 5H2BA 3CIAA 1NC2A 1BOYA 3GBML 4XH2B 1IZKA 4L2YA 5HVGB 5FIEA 1BGXL 3O4LD 4ODXB 4AKOA 5E9DA 1G7IA 2WNGA 3B2UD 5E4OA 1NEPA 2EEDA 2FQDA 3O6ML 2PWDA 2HP4A 3NIFE 3DSNA 3TVMC 4Q97A 2CDGB 4L8BA 3IGFA 2XICA 1W16A 5IMMB 4OD2A 3LXCA 2P5PA 2DMCA 4GLRH 3I9GL 2C3VB 3VXQB 1I53A 3VWJA 1ZK9A 3FU6A 5JW5A 1PVHA 2R1YB 5JZ7D 1RH8A 1WFJA 5I82A 5JIHA 1X44A 5I8CA 3CDCA 4PSPA 2H3NB 2VW4A 1E9PA 4B41A 1CGVA 1BP3B 5JPNB 4L8SC 4PW3A 4AV0A 4OW6A 3G6JB 5D93C 2ZG3A 1VGEL 3HAEB 5ITBL 3I6SA 3B2UC 3DV6A 1M53A 3OJDB 2FH8A 3CE1A 2ICWI 4X99A 1SXAA 1XCXA 1FYHB 4MXVE 3WD5H 2FT7A 4PV9B 1T5XA 5DD3H 1MH5B 2WKGA 4FTVD 4ZDHA 4KKCD 3ULAB 1KEGH 2H32B 4QRPE 2AK4D 2ADFL 4JM0A 1UA3A 3APDA 4B9KC 3DJZA 3VGDA 4K9EC 5EO9A 4X8CA 5J56B 5E1QA 4UCFA 1QR1B 1SYSB 4YAQA 4LQFH 2CIIB 1EFXD 1S9WB 3NSFA 1QLEL 4HIEA 5FF6B 5IESH 4R90L 4NC0B 3T4AC 2Z91A 3GMLB 1DL7H 1S9YB 5TH2B 3NH7H 1DJZA 1T80A 4PW4A 2GI7A 4UTBA 3TH3T 1YAZA 2IAAC 5F7HA 2VL5A 1UYWH 2C9VA 1JPFB 2HVKA 4NYLA 3UROR 1S2EA 4ELMB 3MRBA 3N1GC 3DUHA 3RAJH 2APFA 4XPAL 3W1ZA 4L8CB 4H0HB 4MJ5B 4HOZA 4PRAA 5E2UL 1Z5YD 5KZCB 2V8LA 4GUPB 3RIAK 3NABH 4RFOL 1A6WH 1U8CA 3OZ9H 4WF7A 4MAYD 1ZIAA 1OB0A 3ECBA 4K71B 2CO6A 4WFHD 4KUCF 4X6FB 2WGXA 5EH1A 4YX2L 4YHKH 1E67A 3KYNA 2NYKA 4OF8A 2XYCA 5B3JF 1C16B 4BXVA 4HH9A 3K6IA 3P3SA 4IRSB 1YY8B 1XZ0A 2ZOKB 1ITBB 1T22B 3FTZA 1OPGL 1OVZA 2E9JA 5IIEB 2OTUB 1AYRA 3FO2A 1NANH 1H5BB 2E9IA 3X14A 2X88A 2O5XH 4ENED 4Z3HA 1UKQA 2UX6A 1F8TL 3UTPE 2D3LA 2JV6A 5JW3L 1JP5A 5CCHE 3LQAH 2DL2A 4XVSL 2CPUA 3DOIA 2Y3AA 4JO3H 5LN8A 4UAHA 3NAAL 1TQCB 2DIAA 2E8ZA 4R7NB 4ZQKB 1HYRC 3GB7B 1KGCE 3MBXH 4HF5L 4CVWA 4WENB 3KLAB 1GIGL 3FN3A 4EZMA 1NUFA 3N40F 4UQDA 2WWOA 1OAZH 4JLRB 4LKXA 1JZHA 3FPXA 1JD7A 5DQ9B 5DD6A 4K5LA 5BRZD 3T0EA 3LKQB 4JMNA 1HQ4A 1FP5A 5D1ZA 3LXUX 3QUXA 4G5ZH 1XF4A 3N9GL 1A7RL 3M46A 3BUDA 3NJXA 1CGSL 2B3IA 4JRXB 1NH6A 2QJDA 4X98A 3QJZA 2A7BA 3VQ2C 1OT4A 2E56A 5FHAL 3OPZH 2WGNB 4AV5A 4UIKL 2CDFB 2KC0A 2N56A 3BT2H 5INDB 3AVEA 4JGMA 2P8PB 4ZFZB 5T1LD 4E68A 1MFDL 1BZ7A 4GKZA 5K9OB 2E8YA 2ZWLT 1AD9A 1EBAA 4LLDA 1GW6A 3AFLA 5IF0A 4NKIL 3OJ2C 4LMQE 4K23H 4FP8H 4JG0H 4KAQL 1UACL 3BVXA 3DUSB 3H9SB 1OGAD 1RUPH 4X4ZA 1CFSB 3MR9A 4MSWA 5ESVA 2QVMA 5FOJA 5CS7A 4CGUB 1HL4A 1Q0YL 4GW5A 3U46B 5HHQB 3H55A 3DIFA 2J73A 2WSPA 5TDPB 3MRMB 4F9PA 1S5HA 1JZIA 3FFDB 4AJYV 3U1SH 2XIBA 5DUMH 4H44C 3BDYH 5KS9A 1HIML 4HZ1A 3JWOC 1TSRA 2ZKHL 3L3DA 1FVEA 1PMYA 2VLRD 3SPGA 2FRGP 1AE6H 1KG0A 2ZXAA 4PJIA 1D6EA 1RZJH 5D7KE 4D0DB 3ARFB 3D6GA 4HKJA 3VW3L 3ECUA 3F7QA 3EGDB 3I02B 1U8HA 3VSTA 2EDDA 3WIFB 1PZ2A 5DMIH 1VKXB 3NIDF 1DBKH 2Z31D 3FCTA 1N6QH 4P9HH 3VO0A 1WZMA 1X9RA 3MXVL 5BJTA 1F90L 3H9SE 2V5SA 3MROB 1BPVA 4JKNA 5LCVL 1XX9C 3UMNA 1OCWL 5KN5B 1UA7A 1PZAA 3RL2A 5JPMC 3KXFD 5FHBH 2VNCA 4YHYB 2BP5M 5EOCL 3BZ4B 1DQDL 1KEML 1NBYB 1L7TH 5CZVL 2IV8A 4K94H 1ZLSL 3LRMA 4ILDA 5F70A 4QEGA 2BNQA 3D12B 1TEGA 4R7DA 3CHXA 2R2BB 1VGKB 1JFQH 2R2HB 3V0EA 1X9UA 3V10A 1REIA 5JO5B 1GGCH 1WG3A 4QO1A 4U1KA 4FRWA 1N3NA 1EDHA 2CKBL 2O30A 3VGBA 2QQKL 3VFPB 4MLSA 5MEPB 1AGFB 1JFHA 1W8OA 3MUJA 4DGYH 1GTFA 1UB5A 2YD4A 1V8HA 5D7LA 3GJFA 4A2DA 3VQLA 1U8PA 3GK8H 4NQEE 3GJEA 3TV8A 2CK2A 4R96A 2ICEB 3EO9H 4QXTA 2BSRA 1QSFE 1VFAA 2WZ6A 3VFVA 3WLBA 3M86A 1NCAL 4N2AA 1O6TA 2VLJD 1OCOB 4MB3A 2GT9B 4L3ED 3ALWA 3HCVB 1UVQB 1AQKH 4R3SA 3FO0H 2CAKA 2Z8RA 3VX1A 4IOIB 4ZX4A 2AK1L 3ZT5A 1ZDSA 1V7MH 5T1KB 1G4MA 3BW9A 4LOEA 2AJZB 4D7BA 4ZMYA 4ZMOA 5FO2A 2DQEL 4U7MA 4G6KL 1P4BL 3WJJC 5JW4M 3GS4A 3K71B 4TVPL 1LDPH 4AL8L 5TQ2L 4WU7B 3JWDL 1F2QA 3AMLA 4YZFE 4JFFB 2ESVB 3V6OA 2W0LA 2IFGA 3CZJA 5IT2H 2Q3ZA 2MIZA 4N86A 5FYKL 3CZFA 1NCJA 1QRNE 2LU7A 2GSGA 3VACA 4BK5C 4YBLB 5C0RL 5I15L 4KI1A 4S11A 5EWIL 4L0ZA 2ZOLA 5CSZA 5HYQB 4DN4L 25C8H 2X38A 3L9RB 4LVOB 2WQXA 4LDLB 5F7UA 3RL1B 4JQIL 3PABB 2VISA 1NUGA 4IGBB 1MLCB 2AMGA 1PFCA 3CHSA 1WDAA 2VR7A 1CYXA 1CS6A 2ATPA 2XWTB 4OJDH 4WU5A 2OTWA 5DEFB 2DOCA 4M8UA 3HZMA 3ZK0A 5J0BA 1PY0A 2C4XA 4P04A 2IMNA 4JQVA 2I07B 5GGUA 4XP1H 2LQRA 4IOSD 4RIRA 3KWWA 1X5GA 3NFPA 3RRQA 4PTUB 3QXAA 2O93L 1EDQA 4KJPC 3APFA 1WWBX 4ZW7A 5L7XH 4KNTA 4L1DA 5BOJA 4JFFE 2ESVE 5F8RC 1GZQB 4ZAKB 1LO5A 4TLKA 1F4YH 3IJSA 4O2CA 2F74A 2QPSA 3BKJH 4CDHA 3U25A 3LCYA 5GS3A 4N25A 4ZX6A 3U4EB 2OJEB 3WL9A 1HHHA 3MTRA 3QDAA 1PAMA 3WFDH 5FO8B 2NQCA 5E99L 3HC0A 5EZIL 2AJSH 5D1XB 2VXSL 3DBSA 2MPAH 4WWKB 4F24A 4F7TB 1CLYH 2YEQA 5F9OH 4GXFA 2H8PB 4J3OG 2WLMA 3W39B 1AZZC 5KVEE 3LN9A 2FATH 4AZ8A 5DHVA 5HJGA 3A4FA 4QHMA 5E1AA 1S3KH 2ARJQ 1TTBA 3OMZA 4FE9A 2FBOJ 1AANA 1J0YA 3MUGA 1HHJA 4IRJC 3DA0A 2J1KA 4K3JH 4FQXA 4ZOBA 3CIQA 4DTGH 4JHZA 1U58A 2XWZA 5J13B 5H37H 4PTTA 3PUUA 2PYEA 1BSIA 4OZ4A 1DBBL 5CAYB 4X5RA 3BE1L 3TC9A 4OBRA 5DRZB 1PPIA 2X2IA 3RU8H 4I48A 1XGYL 4LRIA 1P7HL 1AGCA 1AZCA 1HK6A 5LUMA 5DMGD 4N2KA 1ZVHA 4OQTH 2CHDA 2GJZA 1JDAA 5D1XE 3QVAA 4NM8H 4B3VA 3HS0A 2EILB 2R9HD 4UM8B 3NQKA 1M7IB 4N24A 1BHGA 1MI5B 4W81A 1G0DA 4FKHA 1R6VA 5K39B 2R0LL 3GUTB 4F5CE 1DBML 4KROB 3UJJH 1QYGL 3CC5B 4KRMB 1KTBA 3OAYK 1DQQA 1E40A 2BSSA 4UF7C 5HDQH 1D7BA 1C8QA 1ZXQA 2BMKB 2YBRB 3FQNB 2VM9A 3PHAA 4H1LB 4PRNA 3T08A 3C8KA 1XQ4A 2DH3A 1QQDB 1BIIB 2DLGA 1MW3A 5DMGC 2NCEA 2D3VA 4MDJA 3QGVA 4UUJA 2K1MA 3RUGB 4N2NA 5A40E 4UYPA 1M4KA 2X4PA 2R9HC 3EOAA 3QR0A 4M9PA 2Y3NA 4YDVB 5F6HJ 2BY3A 2X2JA 2DY2A 2X9XA 4WQOA 3QRBA 3DUUB 5IQNA 4M3KB 5LBSA 3OR6A 3HE7B 4HJGA 4QRPD 3FYIB 1ND0A 2DW5A 1YEFH 4Y2OA 5B39A 1H9VA 2L4OA 3VXSA 1WFMA 3EFOB 1DO6A 4U7SA 1MI5E 4XR8C 5I6OA 3GMQB 1A5FL 1QFWL 5DZAA 4LDOB 3CN1A 5I1KL 4OLWH 1HDMB 3IM1A 1G9ML 4A04A 4ABQA 1W72B 5E1GA 4MNQA 4NDMB 5LQBH 2ZP0T 4IKJA 1SQMA 4V1DA 4TQ8A 3K80A 3CV5A 3IJHB 4FJZA 3WFEH 4XB7A 2YXMA 4U6XB 4BSVA 1H19A 2XWDA 3QAZB 2EXWD 2CBTA 3QUMA 1KB5A 3ULUF 4QNPE 3KHQA 4N0CD 3T2LA 2WVUA 3DBXB 3WSQH 4K9JA 4GLRI 4PJFA 5CZXD 3FBKA 3QO0A 2CE6A 2XC8A 4FQLH 3V0WL 1NDTA 4UDTB 5JPNC 4XCYB 5MENE 4I0PA 4OCXH 4XNAA 2Q10A 5AAMA 3CFEA 4U3HA 1EHXA 4D8OA 1E9QB 4FI7A 3D25A 3MBWB 2YSTA 3KLSA 2EXWC 2QQNH 5DHYA 1GOFA 5TE6L 3DX6B 3H9YA 4CC4A 1GYVA 1ZJAA 1ZT4A 2DKMA 2PWHA 3UYPA 3KL5A 1QVOA 4UNVA 3UTPD 1NLBL 4N0CC 5E2TH 3ZE0F 5IK3B 5A16B 5TGBA 2VSDA 5CZXC 3S4SG 3PG2A 4AGOA 5KZCD 5IKCB 1TT6A 3BDBA 2NY7H 4ZD3H 1X6NA 2VERN 5CNHA 3W9DA 3RWJB 1YN7A 1KGCD 2TRHA 3O2VH 5GSVA 3JTTB 4MMZA 1IEBB 1JCKA 4WV1A 3NFSH 4WI4A 4BQ8A 4U3CA 2FDBP 5EOTA 2CG9X 4NO2B 1HL8A 2H1PH 3BSZA 2APXA 1CF8L 1NCGA 3K5SA 1ZA3A 2V9RA 4FC3E 4LSSL 4IRSD 4YIQB 3QZNA 2BVPB 4Z78B 5B3SB 4X7SL 1NIAA 5FYJE 5H4YA 5L4JA 4F33B 2OP4H 3CFJB 1NGXB 2NXZB 2YQBA 4AT6A 2FHCA 3GXUB 1N0LB 2FX9L 4ALAC 1OO2A 1PEZA 4LSPL 1NCUA 2DTMH 4PI2A 3WTWA 2OYLA 3LKRB 1KFAL 3US0A 4E9LA 1KXQE 4K71C 1ILUA 4NKMA 1PY9A 1KCUH 1WWWX 3V9CA 4ETYA 3DOSA 4NM4H 1WFNA 2XXGA 4LEOB 3DECA 1XR9A 4X0KA 5F0LB 3RZWA 3PWJB 5GGSY 1JXFA 1WUNT 1BQUA 2YN3A 4XNUH 1EO8L 4IRSC 1NM4A 3DRQB 5C97A 1JZGA 5IW1B 4XI5D 4M6OL 3TCXA 5FEBA 4ORGA 1NC4B 2JJTA 5HDLA 5T5NG 4MMXB 4DAGL 2WWKT 1P2CA 1MW0A 3MRNA 3NRQA 4HIJB 1IGML 1H5BC 3MBEA 4B96A 1P4IH 2DQHH 3N42B 2W60A 1BXAA 1NANI 2W0FB 2F58L 1URIA 5DHMC 4I4WA 1E4KA 2BC4B 4P4KA 5DJYB 5I0YA 3MV7B 1HL9A 2XCMC 5BZWA 3WEAA 3WN6A 1TQCC 5E1IA 1T7ZA 1QFUL 4HW6A 5D7KD 3WN5A 2QKIB 3IFPB 2DQGL 1HILA 1SDYA 2IANA 5CJBA 5G4MA 1J88A 1FH5L 2NNFA 1LYQA 4MRCA 3IMVA 3OAUH 4XI5C 4NN6B 4FA7B 2IH3A 5C9KA 4OFVA 2HG5B 3L3OB 3TBTB 5L2KA 4P59L 2IBZX 3H9SD 1LLAA 2WKOA 4XMKH 4QR7A 1L9PA 2WOYA 4JAMB 1ZT7B 3RWCA 5JXAL 1T6BX 3T0WA 1KCSH 2ZCLH 3SE9H 2QLVB 2JI2A 1H8LA 1K5NB 1S7RA 4XN7A 5DUBA 5HHOA 2CRZA 3QYCA 2XFXA 3NCJH 2XBTA 4IQHA 1QATA 4FF9A 5FK9B 3MRJB 2DLFL 4CC1A 3MA9L 2J6EL 3QG7L 4AIZB 4HIPA 2OMUB 4ELDA 3OMAB 3ARFD 5JIQA 1KF9B 5FFLA 2AJXH 4U1HB 1RURL 4D9LL 4HGMA 1HI6A 3BGMB 4F2MB 3NCYP 3WFZA 1OEZW 5I1GH 5KW9H 1KOAA 4KRPD 3VTAA 3IDUA 1R24A 4AVJA 3LN5B 2P47B 4HD5A 1GGYA 4E9TA 2HPOA 3EGSA 4NQED 4UOJA 3X3GH 4YHLL 3JV4A 1CU4H 1ONQA 2EH7L 1XEUA 1X7QA 2HT4D 1MFCL 1QSFD 4Z7VB 2ZXDA 3ARFC 1A7OH 3S3SA 4X7TA 3QDGB 4NT6A 2IBBA 5AZEL 2NZ9D 3H7BB 4JO8A 3V4VL 2EDRA 3TWCL 5L9DL 1XSKA 4HFUL 2J12B 3A3YB 3EGXB 2B59B 1IILE 1RFDH 2W9EH 1GSMA 3L3HB 2TSBA 2VMDA 2QPUA 5LNDA 3K8MA 3G04A 3IJYB 4LCCB 3L17A 2JQZA 4UTBH 4YHYC 2KI6A 2HT4C 4JG1L 1Q0EA 3BKML 3C6LB 3HG1B 3IDXL 4W9HC 4XN2A 3LVTA 1OLZA 1G7LB 3CLEH 3QS3A 2J88H 2HTLC 1MIEL 2LVEA 3DGCR 4BFGA 5KTEH 2DQJH 1CFNB 4K7PY 5TE7L 1QRND 3ARDA 2CK0L 4O2FB 3UOAB 2NZ9C 5AAPA 2BLFA 1A6PA 3NCXA 1PZ5A 4U6YA 4Z7VE 3MLZH 5LG1A 2JMRA 3D39A 4NHUA 1VRSA 4BFOA 1IB5A 1ZHNB 3H4HA 3QDGE 1GMEA 3U9UA 2Q8BL 3QH3B 4XXCC 5HHNB 4LSRL 2MCMA 5CD5C 4PV1C 4HC1L 3MV9A 1NMAH 3RB7A 1C12B 1HINH 3VTTA 1A6UL 2J1YA 3P9MA 1JD9A 1NBCA 1NGYB 5DC4B 3FTYA 3DURA 4G9FA 4JZOA 2DDQL 1KTJA 5I1DA 4EKJA 5KYUB 1UURA 1QLFA 2R2CA 3TJPA 2UWEE 4RX4D 4DK5A 2ICEC 3NJNA 5AZ2H 5B1JC 4WFFE 4TQIA 1AG0A 1H8OA 3HG1E 4IBVA 4M5YL 4QKXB 3F7PC 4D0BB 5I75B 1XEDA 3KCPA 4HEPG 1U92A 4HIIB 1JGUL 1LEKB 1MVUB 4Z8FL 4HKXB 4JFFD 2ESVD 4WCYL 2PWEA 1BBJA 1D9KB 1NWPA 2X6AA 4DP4X 3RZCA 4RRPM 3JWNH 5ACZA 2V9QA 4H0LC 1ZHBA 1F97A 3WEOA 3PHQA 4M7KH 2ZKXA 1U8NB 1XR8A 4IGBD 1UA6L 1J1XL 3GS7A 5HGDA 5F1IA 2BSED 2WUCL 4FKEA 1A14L 2D31A 5I5MA 3CZKA 1WBYA 4GI8A 3RVVD 2OR9H 2QHLA 3OGCA 1X6LA 3L4ZA 4OLUH 4EVNA 4BEIA 4FMKA 2Q87A 1H3PL 4DJMA 4K7PL 4YBLC 1LQSR 3F7YA 2FAUA 5LNEA 1XB3A 3LN4A 4KJWD 4D0CA 4N0FA 5ANMB 5C2UB 4P06A 1CICA 3GSRB 4LVOC 4W4OA 3IS0X 2P45B 1FG2B 2BNRA 5EEYA 2JIXB 4IGBC 4EZLA 2FEJA 4C4BA 1EEYA 1DFXA 5AW3B 4HUMB 1ETB1 3LB6C 1BXXA 2MRYA 1V54B 2C1PB 1UQSB 3W2DL 1A9VA 4ONHA 3TIEA 4NO5B 1CGXA 5T1DL 5LAPA 2FH6A 3SYQA 1JNHA 1SHSA 2JB5L 4NQSB 3G6AA 2F68X 1LWHA 1OARL 3GKZA 5D1XD 5D72H 1N64L 3QCTL 1YHPA 1J0ZA 1DJYA 2D03H 1KV7A 2AXGA 3WUWB 1T1WB 4KJWC 5H94A 3VX0A 3VD0A 3QRFM 5K59E 4LKCB 5AKRA 4FQQB 4YDNA 4QXWA 1WIPA 3MCKA 3FMGL 3T0XA 3AWEA 5HHXH 1A65A 4I3RL 4ZAKC 3GO1L 5IMOB 2UVFA 5CGMA 1MDAA 1CD8A 4JM2D 1PKQA 1RIUH 4OGYH 5CCKL 3Q5OA 2XZCL 3TO2B 2C3HA 4GO9A 1KTDB 4ODBD 2ENJA 5HTSA 1G7PA 4ZUTB 1FL5B 3VMOA 4JDEB 5ALBL 1YJDL 5D1XC 4GG6F 3TT3L 1A7PH 4GY4A 1UWEL 2EDBA 2WXPA 4WWKC 2IF7A 5BV7H 3WIAA 3K8KA 1J05A 2HH0L 3AGVA 4WNQB 3UTQA 3WS3B 1FQ9C 1NUNB 1Z0MA 3K2UH 4JUTA 2GYSA 2XKSA 2NSQA 4QWWD 1KLUB 4U3SB 1MI5D 4XC3H 2B77A 1NCBL 5EU6A 3JTSB 4YSCA 3FZUD 3O8XB 1TQWA 5J13C 2P8MB 3ENEA 5D6CA 3V0DA 1LJMA 4KROD 4EOWL 2FNBA 4LLWA 1NAKH 2VKXA 4IRZL 1ZA6B 4R0LA 2JJSC 3VYNA 2R51A 3NGBB 2NNAB 3L2LA 4G6FD 2IWGA 5T3XH 2WXRA 4TUUA 4EDXA 5HPOA 1CGWA 4P3WA 4RNRB 2OMXB 1FVDB 1BD2B 3LH2L 4QWWC 3MRDA 2EYRA 3LEYH 1ZLWH 3GKWL 3KBHE 2V6HA 3HRPA 1RI8A 4YVUA 3DTXB 3VCLA 3FN0L 4OZIB 3EJYD 1AQDB 3GJFH 3HE7D 3FZUC 4ERSL 5EZOH 1AGDA 2ZIDA 4QRFA 4KROC 1IC5L 1UG9A 4JY5L 5E5LA 4R6UA 3WNJA 3G6DL 2VERA 4OZGF 5DYOA 4E9WA 3BVVA 5HI4C 5MEND 5KVDH 1VFUA 3QJXA 4YHIA 5FS5A 4G71B 5KVFH 4BFRA 4ODVH 3WNLA 2APWA 2PCXA 2YJQA 1TG8A 3CUPB 3RVUD 4J27A 1GGTA 1Z9OA 2PP8A 4NWUL 3VSQA 2DWTA 4U1IA 1JGVH 5D5MF 5I30H 5FA4B 2GIMA 1KLGA 3TPUB 5SWQA 1OKEA 4PJ8B 1QPKA 3B9KB 4MYWB 1TEFA 2NNRA 4N2MA 1B0RB 5E5MA 3EJJX 3ZX1A 3C5ZB 2VDQH 3EJYC 4RDQG 2X89A 3HE7C 3HPJB 4EN3A 4F37F 3LPFA 1BD2E 5F7NC 3ARBB 3NJFA 1ZRUA 5J6SA 1PJWA 2W38A 1WT5C 3QHTC 4A2HA 2L8AA 3HNTL 3VTMA 4OZIE 4CVZA 4U31A 5L2JA 2J3SA 3GI8L 4TUOA 4JFQB 1I85C 3ZN6A 3FFCA 4F7CA 1BAFH 4HWUA 1FVCB 2O61A 4H8HA 2A73A 3DYOA 3IEAA 2N59A 5EC2B 3WDHA 1X5JA 5FYJD 5GZNA 1I7UB 1XCTA 2VC2L 3AUVA 3S35H 2F8VA 3QJHA 2VR8A 4AJWA 1MZYA 1EZUA 2J72A 4YDMA 3U82B 4EIBA 1EK3A 2YC1A 4ZUVA 1G1OA 3R4DA 4LHUG 3A6CH 3DI3B 3QAZC 4KZCA 1V3KA 3D34A 3LV3A 4QGTA 2OAAA 3PQYA 3ESVF 4DGVH 3Q6FB 1WYJA 3NZSA 2L0DA 4HMCA 5KSAA 4N90E 4OD1L 4QLRA 4ES9A 3PGCB 4GRMB 3VFNB 3KGSA 4P3DB 4WWOA 3V7MA 1N6UA 1KJMB 3MUHL 3SN6N 5CWSA 1K72A 2Y7OA 4OM0H 4Z5RA 4DP5X 2N0KA 3DJTA 5K33A 1OPOA 5I0WA 2HSIA 4BWUA 4MFHA 5JOFA 2ED8A 2EDTA 3FTWA 4XGZA 4A6YA 3HMXL 1IKFH 3B2MA 3DVGA 1C7TA 4JY4A 5FKPB 2XSKA 3T1FA 4HOXA 5IOPB 2YLHA 4FFZA 4U1NB 3FB5B 1TJGH 4TV3A 4NJ9L 3C6SA 2QPEB 3DX2A 3FOLA 4OM1L 2IQ9L 3EOBA 3H3KA 2YOAA 2JCWA 1DBAH 5FFGA 1GZHC 2JTYA 4RESB 5JNYB 4XP5H 3WO4B 1NCNA 2ZYHA 2OLDA 5GGVY 5DHVH 2Y5TA 4XC1H 4JFOA 1GYCA 3KPLA 2L7JA 6CGTA 3MOAH 1H8NA 2AXFB 1CLCA 2XPZA 3MRFB 3EG9A 1F4XH 4GRLB 5AVQB 3V7AG 2X3AA 3FO1B 3LZFL 3BP4A 2ZJSL 3UG3A 1MCEA 4JE4B 5FA3A 2EKSA 3QIBB 2VYRE 4OVUA 1IM9D 3GMRA 5C9JA 4Z3EA 3OSKA 3LH9A 2NXZC 1NC4D 3UEQA 4Y1SA 3VJ6A 1TKWB 1XH1A 4ZUSA 1XB8A 2XQBL 3EF7A 2EZ0D 3P9LA 3RWGB 2XXFA 5F88B 4PJ7A 1OAJA 2BO0A 5D6DC 5KBLA 4G6MH 5AVZB 1RIHH 3VM7A 1W2KT 1QBML 4PRHA 1D6VH 2JJUA 3II1A 2VITA 1E0OB 2NDFA 1DEEA 3IBEA 4ETQB 4AKPA 3MODL 4PJ7E 1CJYA 3MCLL 1MREH 1SJXA 4MMXC 2HRGA 1P84J 1F6FB 1SOSA 1AY1L 4JFEB 5LDSA 1XF2B 1GC1L 3HKFA 4R8WL 6FABH 3FRPG 2R15A 2UZYA 4GEIA 2HJFA 2XQYA 4NZUL 5E4AA 4EI5A 5T33L 1HT6A 2X70A 4YWGH 2APBA 5HYIA 4RISL 2A83B 3K6FA 5LBSH 1E30A 3O11A 4L0PB 2LABA 2QKIC 5GGVL 5C0JB 4OFYA 4B97A 1PZ3A 3ET9F 1ML0A 1T20B 3K6DA 4JPKL 1CUOA 3H4FA 4NN6C 3EHBB 4M8VA 4UZSA 2PR4H 3TCTA 2LU4A 4DSYA 4FXGB 3L3OC 2WXGA 1LNUB 2YRLA 5EA0H 2BW4A 3MLTB 4NRYA 5DVMA 3K4DA 1I3UA 1L3WA 2QSCL 2R56L 3CG8A 3FT0A 1KC5H 3IDNB 1KCWA 1U8MA 3EKCA 5HHVL 3CD4A 1KYDA 2F9BT 2O6FA 2XA8H 1F1AA 4MA8L 3MJ9A 3LRSB 2J8UE 1MNUL 1C9SA 4X6EA 1YDPB 3SZKC 2GITA 4G8AC 5HYSB 2BIQA 2DIJA 1AS6A 3QUMH 5ECJE 5I1CH 1KB5H 3IETB 4KU1A 1JGDA 1IGFL 4JDZA 5CLYA 2R0ZL 1U93A 4KTEH 2XWJB 4HV8B 4M5ZL 1XF3A 4G1EB 4P57B 3KG5A 2BP8B 4RGOH 3TBVA 1LD9A 2V3FA 4Q8BA 3GWJA 3QDGD 1D7DA 4MNHB 2Y69B 4NKOB 3LKNA 2I9TB 1CN4A 4XMWA 1INQB 2XETA 1RIVH 1OSYA 2XI9A 3S35X 1XD1A 4XPHL 3S3BB 3STLB 2VRQA 2IOMA 1H3TA 5D5MA 1KNOB 2YGVA 3D2UA 4WFFD 3QFJB 3HG1D 3DOHA 1E42A 2GAZB 2V7HA 3NZ8A 2OXHB 2A74A 4DEWA 4XNXL 4D9QE 2GUOA 2YA1A 1M1SA 4I2XA 1Z9SA 5AVSB 3GYRA 4XPTL 1CQKA 1FPTH 1AMXA 1ZTXH 4LLQB 4WEEA 1U3YA 3HE6B 3CCHA 2JH2A 2PTUA 4PFEA 3EFDL 3QUKB 3NJIA 3TZVA 3GDCA 2NR6D 3V55A 1WTLA 4LCCC 4NFDA 1I3RA 3BSZH 2OR7A 1TETH 1RQ5A 1AP2B 3QARA 3C6LC 2OM5A 2UXFA 3T4YB 1T0OA 3KYOA 3ISYA 3L3IA 3KVQA 3VXPA 2YD6A 1TQTA 4P4RA 1DVYA 3AU1A 2FWOB 2PCYA 4ZXBA 1YEIH 1J8HB 3VFSB 4NZRL 3BH9B 2D4DA 2UY7A 3QZWA 3D9AL 3UPAA 2BXYA 2DBLL 3D8MA 1ZANH 5F89A 5A2AA 1PSKL 5KSUB 5AW7B 3H2PA 4PCTA 3UGEA 2HX8A 4XO3A 4KNUA 3RKPA 2D2CC 3GTNA 1KY7A 2EUWA 3L3JB 1JNLL 1D9KD 5FYLL 3QPQD 1JV2B 4HP5A 5AYTA 5H2BB 1NC2B 3DX0A 2WXQA 4XVJL 3VFWB 4EBQH 4FA6A 1P5UB 1IKOP 2VZVA 1XO8A 4B9CA 4KK8D 4FZ8L 1ZXKA 4HS6A 4UILH 3O45A 2A1WH 4ODHH 4WFEE 5AWNH 3ZRFC 5HYFA 2XX0A 3F3HA 2EVGA 2ZE0A 1OAUL 5I75C 1PEWA 4EI0A 3DSNB 1X5FA 3I6GB 4FEIA 1LDSA 4LU5L 3KDPB 5HYEA 3FU5A 4OD2B 1AKJB 1J8HE 3AITA 3C5SB 4WJ5B 3WS6A 4IBTA 4DUXA 1D9KC 4AVKA 1DFBH 4ZZKA 3QPQC 4MBOA 5ICUA 3SJVE 4F58L 4KPHH 1KTRL 2CJSA 2JIXD 4YEEA 1E9PB 4HXAL 2AI0H 1OSPH 4H5SA 4M7ZB 5CP7A 1FFTB 5B1KA 3UP6A 4PV8A 4LCIL 1DQLH 4AY0A 2G9HA 1TVDA 4BWWA 5TQ0L 4XE5B 1MUJB 1ZKAA 1QLRA 2B15A 3CMGA 3OHXB 4G7QB 2BOBB 4YSTA 5D1ZI 3RGVB 4HSQA 2OMTA 4FQJL 2FO4B 5C0BB 1ZLVH 3VXTA 1PF3A 2LR4A 4ZDHB 4JO2H 1KBGH 1YNKH 4YXHL 2EDFA 3GD1C 2ZCHL 3NCYS 4FLRA 4QTIH 1RD6A 5B8CB 1UD4A 2CA4A 1HEZB 3MGTA 1CF1A 4YAQB 2XHNA 5BPPA 3VH8G 4JR9H 4DP2X 3HRZA 4HIEB 3J27A 3B83A 1HKLH 4NQDA 4W70A 1VA9A 2Z91B 2OJZL 4KTYA 2JKTM 5IGXH 4CUCA 4F37K 1MKFA 4ZNEE 2F7PA 2Y23A 2VL5B 1K4CB 4NYLB 4CMMB 3VXMA 4LRNL 3P4OA 4YBQC 3MRBB 2BJMH 5C09A 4NX0A 4DP8X 4Z7UE 5E8OB 2K6YA 4WAFA 3ZDZB 4ZTEA 4NQCA 4OH2A 5CN2A 3I6LE 4PRAB 4FNSA 4UB0H 3U7YH 3V0IA 3VWKD 1JK9B 1MPAH 3PDDA 5C0BE 4R83A 4PS7A 4MNGB 1OB1A 3E7JA 5I6NA 3O8XD 2VZ1A 3KYNB 2Y36L 1Q9OA 5J6GB 2CKBA 1J5OH 4F8TA 4XPFH 4WWNA 3BIAX 1YC8A 3RI5K 3M07A 2V9UA 4U3XA 4U1JA 3KVPA 5CEXA 3GIZL 3GRBA 1RZ7H 4Y1TA 3RBGA 3EYUL 1BD2D 1KIUA 5KYYA 3LTVA 4AEFA 1R3KA 3ZDZE 5AKTA 1L4IA 3ILDA 2JKLA 1I8LA 1KIPB 2YRBA 3O8XC 1S7VA 1T1ZA 4E5XG 5DZOA 3HB3D 3J07A 4PJ9A 3WNKA 4TMPA 3ULUH 4E9XA 4MNGE 4NRZA 1SJHB 1RZ8B 5HGBB 4J2XA 4NGHL 3DETD 4DUVA 3NGBC 1FGNH 4KO5A 4LKXB 1ETZA 2HAZA 1KBKA 2VRAA 4MD4A 3FTXA 4ACTA 5KYNA 4AMKL 3T0EB 4OIIL 5DD5H 4J28A 5EU5A 4LLAA 3QUXB 5C0GA 1DVQA 1XF4B 5E8EA 3ZMNA 1A4BA 1FFPA 4Q4IA 4TSBL 2FECI 3B9KD 3BKCL 3T71A 4AGMA 4BINA 1WBZA 2MQGA 4GIPD 2VR5A 3C5ZD 4NPJA 4MBRA 4X98B 3I3EA 4N90D 2I9LA 1CD1B 4BKLA 3ARBD 1JF5A 1UZ6F 2K6ZA 4M1CC 4AUYA 1X3DA 5AAWA 2G4EA 3GDBA 3DETC 1MF2H 4GKZB 5EC1B 2ICCA 1QKZH 2CGRH 4JQIA 3OKNB 4U0QB 5D1QB 5IB1A 1MW2A 7TAAA 2WANA 3LNDA 3BQVA 1E4HA 2NLJB 4ISVB 1JN6A 1A6VH 3DSFH 4JFPA 4TF4A 5MEQA 3MR9B 4PJ8C 2VSMB 5ESVB 2NYZA 3B9KC 2WD0A 4XN8A 3MLXL 4GW5B 1FFOA 3MLWH 4GKLA 2XG5A 3C5ZC 3G08B 5IFAH 1JXJA 3BZFA 4ZO6A 3DIFB 2F54A 2PP9A 4N0YH 3ARBC 1WZAA 3ZYZA 1XMWA 1S5HB 4UU9A 2DTSA 4ZT1A 3WNNA 4HUXA 3OGOE 5FW6A 5CEYB 4JZJA 1FVEB 2P5WB 4Z7NE 1QSVA 1XH3B 3V4UH 4PHXA 4FN0A 1OALA 1COBA 4IBLT 6PCYA 4PJIB 1UH2A 3VVVA 4E42B 5BO1L 4S10A 2X4RA 5GRYA 4D3CL 4ZMNA 1J8KA 4JPWH 1N8ZB 3ZKXB 4KZEH 5IJCC 1FO0B 3CLFH 3FUKA 3QZMA 4U05A 4ZSOA 1SXNA 2EXTA 4BELD 5D1QE 4K8RL 4F7PA 1N7ML 2F53E 2VLLB 3R0MA 3KPOA 4I9WE 5BV7B 2QR0B 4XAKE 2EE3A 2YA0A 3C87A 5EZJA 3FO9B 3IU3A 4LE8A 4M6NH 5FO7A 2ZWZA 3AAZB 2EC8A 3P77B 4AGNA 4Z0BL 1LK3H 2CNYA 4LGRB 3IDMB 3MO1B 5FO9A 4DKEH 3ZT6A 1FNAA 4K07A 3KPPA 4KZDL 3H9HB 1NBVH 1CTMA 2DBJA 3WXWL 5ACLA 5TF1L 1YECL 1R3HB 2P5WE 1MCFA 1OOAA 1TYRA 2NY0B 2WUBH 3W11D 1L5GA 2GTWA 4P5MA 4YMPA 1D3CA 4YL4A 4BRVA 1MY5A 1SLXA 3HJ0A 2B3RA 5DTFA 3QK0A 4U1KB 2R29H 4FLOA 2FEEI 4I5BB 4WHTA 3BPOB 4DETA 1NFIA 1JUFA 4IHOA 4O00A 3M8OH 5EO0A 2WHVA 1B90A 1T4KA 3W5MA 1UB5B 3WJMB 3CHPA 2BVTA 5KYXA 1NEZG 1WAAF 3GJEB 3WO4C 1ZIBA 3ILQD 2DWYA 3ETBJ 4NO0A 1HC1A 1ZK5A 1LP9A 1MCNA 4XAWL 2BSRB 1T0NA 2B4CH 4ZMWA 5J6HB 2MOGA 1Y1UA 4APXA 1T04B 4GRLC 1LE9A 2D0FA 1AXIB 5PAZA 3K8LA 2Y7MA 4J4PD 5HPMA 4XWOD 3PP3K 4P23A 1H3UA 2XLLA 2A5UA 1JHKL 2WLKA 3E8UH 3QG6A 1VADB 1UJ3A 2B5IB 2PCFA 3QIBC 3BUBA 2BP3A 2LOEA 2WO2B 5EBLB 5F93C 1UCTA 4TQEL 4ZTOH 3W82A 2WZPA 2E6PA 3HJEA 5DD3L 2VDQB 4KO6A 2Q7AA 2XY1A 4WJKB 1V5JA 4DP1X 4X50A 5I6MA 1AC6A 4M6MH 2C26A 3EH2A 3SPHA 2Y2WA 4M4RA 2UZPA 2DYPA 2QVKA 1DVUA 4WTXA 3CSGA 1U8QB 2BX5A 1NBQA 1SN5A 1KMGA 3Q0HA 4J4PC 4LQFL 5CBAB 5ABDE 1BBDL 5L2JB 3D0AA 5FUOH 1MSPA 2IBGA 2VUYA 3AG4B 2J21A 4OGXH 1DL7L 3NH7L 5HHMB 4XWGL 2VISB 1UYWL 3KL3A 4FNQA 1KJ2L 3K0YA 3T2OA 5DHDA 4G9DA 3RAJL 3L3GB 4HWZA 4QT5A 4WU5B 2OTWB 1HH6A 3HZMB 2EYSA 1IIKA 2FLRT 4IK6A 1CBVH 3OZ9L 2ED6A 4I3SH 5DD0H 2BS8A 4FLHA 3UJTL 4OCSH 5ILTH 4PLJD 3DIDA 4J8RA 4F7EA 4D9QD 1KGUA 3GNMH 3DX1A 4S1RH 3NFPB 2CRYA 4HKBB 4RBPK 5I1LA 3JUYA 2FSDA 3QXAB 4QPEA 3EHBC 5BO0D 2B2XL 1KENH 4FXGC 1RZQA 4N20A 4IU3A 3RY6C 3FONA 2KHAA 2H26A 4N5ED 3MRGB 4BZ2L 1X5IA 4EJ1C 2F74B 4DW2H 2HJKB 1G9NC 1R3JA 4P9MH 5E6IA 5HHME 3WL9B 5B1AB 5F7MC 1LO3H 3UZEA 4I85A 2O5XL 2GBAA 3QXDA 3RWHA 4ZPVB 2QPFA 4PLJC 5D7HA 3INOA 3LQAL 3RG1C 1CDUA 1NDGA 1NAML 4GRWE 3DX4A 4JO3L 4YUEH 1H6TA 1B2WH 1IC0A 5D2NA 4AZ8B 3MXWH 4M8RA 4XNMB 5JDSB 3OKLB 4E9QA 5DZPA 5HVWA 4X9FA 3KMDA 3TCLA 3MZGB 1E4WL 4N5EC 4RMUA 1KDIA 4HWBL 4AE1A 3GZOA 4G7RB 1MAKA 3LZLA 4YHMH 1CK0L 3LQZB 4O9HL 4MMYB 3FU7A 3HZVB 4IMLB 3TN0A 2O6CA 5EIIB 3FUNA 3HE6D 2BOLA 1QMUA 2WYZA 1EAPA 2YD3A 4LVNB 3QUYA 2DWXA 4OZ4B 4ANKA 4ZFOL 1IEAA 5F7YC 3V5KB 1S7TA 1S7QA 1MCLA 4A6YH 4TUKL 3GSWA 1MAMH 4WFED 1JZEA 3OPZL 3EJPA 3GSOA 3E0GA 5DLLA 2RCSL 4TLUA 2GJZB 5GGRY 4EI6B 2AZUA 4FFZH 1KCBA 2ZSVB 3VXOA 3ZPDA 5L4FA 3Q01A 2XN9B 3QJSB 4NUGH 2BVOA 1M2OA 4HMDA 5DS8B 1J8HD 3UC0H 4GSQA 3QDME 1CFTA 1DUYA 4K23L 2Q1EA 4PJHE 4YPGA 9PCYA 3SJVD 3HE6C 4WKZA 2EIMB 1P6AB 3T2NL 1Y18A 3F84A 1GOGA 2WLLB 1BQLL 5HY9B 4BH7B 1ASPA 2ENQA 4PRNB 4EIGB 1Y0LB 3SZ6A 3CH1A 4ADIA 2CRIA 4YNYA 5DYFA 2XVBA 4HXBH 3PWNB 4LF3A 4GXUM 1ODAA 2F7OA 1CD9B 4MDJB 3U1SL 3BDYL 3MRLB 4OGZA 3MREB 3NIDB 2X4PB 3QC5X 3H6AA 1KV3A 1CXLA 1IAIM 2QTVA 2WJ5A 3OR6B 4OQ1A 5EF0A 2R23A 4KUZH 5B39B 4G8EB 2AKRA 2WQSA 2XN9E 4TPRL 3X3FH 2MTPA 3TA3D 1AKJD 1DBKL 4F1ZA 1I3GL 4P9HL 1L6ZA 4G7YL 3VMPA 1HTYA 4GKOA 1CXHA 5C0FB 1NGZB 2Q8AL 2Z4QB 4JL1A 3BLPX 1IJ9A 1P5UC 2DQMA 3UAAA 5AD0B 4RFEA 2PO6B 3EJCA 4NBZB 1JHTB 1HEHC 3GBMH 3WY3A 5ICXA 1NIFA 5I1IL 2VE6A 2O4EA 5DT1L 1LWRA 3ZE2F 2QHRL 3G9AB 2DKUA 5H35B 1G1YA 4WSKA 4YHZL 5EB9A 4LCUB 5IVXF 1TZHA 4BCXA 4K94L 1U8JA 3RURA 3SDYL 2RH0A 3O6MH 3I6LD 1U3HB 2KH2B 3RGVD 1KPRB 1XBDA 4DIXA 2HMID 2Y6SD 1FJ1A 4L3CB 5C0BD 2J6EA 2HTKC 2R1WB 1YEKL 3I9GH 3NSYA 4HDIA 2JB6A 2EEAA 2GTZA 4X6CF 4F7MB 3S2CA 1O7DE 2DIEA 3FF7A 4M8QA 4WDIB 2EC9T 1Q9LB 4M7ZC 2WKLA 2XBDA 2XXMB 2HVJB 5ETUA 1QNZL 1TLKA 4GPVA 1MCJA 3I75A 3OHXC 2PLTA 2EQDA 5DHYB 3RGVC 4M03A 5F97E 4I3GA 4DP0X 2Y6SC 4X0NA 2HMIC 1QP1A 1J5IA 1QVOB 2CR6A 4TTDD 4L37A 5DU7A 5FM4A 3MJ9H 2CLRA 2NQDA 1AD0A 2ALAA 3QJOA 2ICES 4HK0B 5TGBB 3SY0B 3X1BA 2ADFH 3AC0A 1Z9PA 5B8CC 4RVBA 3PE9A 3REWA 3W9DB 3V4VA 1S3RA 3FO0L 4WK0B 1PLAA 5GSVB 3NQIA 5GSRA 2QMJA 2ZF9A 3O3EA 4XNBA 1V7ML 5DHXB 1QLEH 5FGBC 5C08A 4CADB 1WD9A 4GG8A 1JGLH 3SD2A 3CN3A 2YARA 5KSBF 3GPEA 2DM2A 3OXSA 5C07A 3O6FA 3T3PF 4TTDC 1LDPL 3OF6D 1LO2H 2DWEB 3DHMA 3NJKA 3L4TA 4XPBH 4XPAH 4W9FC 1BFOB 4IKLA 3WE6A 3FQUB 2B14A 5IT2L 1BYNA 4OSUL 4AENA 5DMYA 4JFHE 3STBA 1OCZB 2EE9A 4BUHA 1H3VA 5FGSA 1QHQA 1PYWA 4HJUA 3KE0A 4F8PA 1KXVC 3K46A 3MFFA 4YX2H 1H6FA 2DM4A 4OLYL 1KYFA 1XR9B 3R4RA 4Y0GA 5DO8A 4C56E 1W0VA 4AYEC 2ZX8A 1B6UA 5AB2A 1XGQB 1N0XH 4KMQA 1RJLA 1AGBA 1C1EL 3IWUA 3NCEB 3WG7B 5IJVA 1E5YA 4UOW1 3QE5A 1JWUB 3WGVB 1LK2A 1KDJA 1JXGA 3MRNB 7FABL 4YXKH 2FE0A 2MHAB 2W60B 3DDGA 1UJTA 3LKPB 4W9DC 5L7XL 2VDNH 4P4KB 3U2JA 2VZOA 1SBSH 1O0VA 2GTQA 2K4WA 4FXKA 3EJZD 3PL6B 1F4YL 3MRIA 3VB9A 5FM5M 3S36L 4Z6AT 5CCGE 5DEGA 4HF5H 4AVHA 1ZVYA 4MCNA 2PTVA 3KPNB 4N2HA 3S4SA 5D1QD 2F53D 3C8HA 4RMRA 3T0EC 4I9WD 4HLZH 4Q6IB 4XAKD 1YUHB 2D9CA 3GSQB 1YMHA 3QUXC 1JWMB 5TE4L 3ULVE 1A4JA 5F9OL 2CBPA 3RWCB 2FATL 4L5FE 5FCUL 2BHFA 3N9GH 2XNAA 3QO1B 1CGSH 1J1OL 4DEUA 5DFVD 4MHHI 5AW0B 4X8GA 4RAVA 5SWZB 5DUBB 3NJJA 5FHAH 5HHOB 2XFXB 2NUPB 4K3JL 4S1QH 5HI3D 1J9CT 1TVHA 1R46A 4DTGL 3QYNA 3BQUA 5KJ4A 1JI2A 3BAXA 4JANB 4AH2A 2G75B 1I7TA 1MFDH 1YEJH 5D1QC 1RHHB 1U8IB 3RILA 4XMZA 3TYFA 2YAEA 4NKIH 3RU8L 1RP9A 4KAQH 2X44D 1RPKA 1UACH 2XZAL 3QHZH 3ZE1F 2DQFB 1WAEA 3B43A 3PWLA 3Q8AA 4A2FA 1BZ9A 1Q0YH 1RERA 4NM8L 5FDWA 5A43C 4M62L 3ATEA 2ARWA 4R9HA 5K9QI 3GMOA 4Y2DA 5HI3C 3EGSB 3SGDH 1VSCA 5F3BA 1HIMH 4L4TB 2PPAA 3AY4A 2ZKHH 5SWZE 4E41E 5HDQL 4Y5VA 4Z3JA 1MRDL 2FJUB 5SX4H 3ZKXC 5DRXA 1R9FA 3UX9B 4WUKL 2EEFA 2JK5A 4ZMLA 4CMHB 1RLBA 3EH4B 5C0AE 2DQUL 3TJEH 3BFWA 4QXVA 2NY0D 2DL9A 3DJRA 4NLAA 1ZS2A 5IHUL 2XPYA 4UI2A 4G8IB 5BV7C 1PX4A 3J8F7 5I28A 3G5WA 1TDQA 4OFDA 4IS6B 5AOIA 3ZUNC 1I1CA 1I9RL 3KPMA 4Y1AA 3RWEA 1E8XA 4E2OA 5HJBA 2L7UA 5C6PB 1GXEA 5AL8A 1OCWH 3D85A 4PGDA 1YEFL 4ZS7H 2NY1B 4A67A 4XVOA 1ET7A 3LEXB 2WXMA 3K81A 2FJHB 3PWPA 4ABVA 1E7UA 2X9ZA 1M6OA 4L4TE 4OLWL 1RL1A 2KPNA 1CDCA 4S1SH 1BVKA 2NY0C 4H8WH 4OF0A 2FX8H 1QA9A 3V9FA 4IRZA 4L18A 5LQBL 5ESQB 1ROCA 1PZ5B 5CIPB 2XV2A 5C0CA 1EXUA 4QOKB 3D39B 4WKXA 1D5ZA 3F5WA 1SXBA 4DP9X 1QNIA 4PJBF 2C9XA 5KG9A 4X6CA 2N1KA 3DGGA 3QUZB 1KULA 3BPOC 1B4LA 2CKBH 5EU4B 4GSDH 2H4EA 3MV9B 3VFTA 5E08L 4PRIA 3P9MB 5I1DB 3DURB 3M45A 4G9FB 4KKLD 4ZMAT 3B7TA 1XIWA 2NY5C 15C8H 3T1WA 3OB8A 3AM8C 4BD4A 2C9QA 3SSGA 4PJ5E 3DYPA 3BJLA 2I5YL 2HRLA 4FQLL 2EDWA 3FTSA 3SPJA 1JAEA 1XXDC 3DK0A 5CU5A 4MCYA 2Y1ZA 3IS1X 4NZ8A 5EUKB 4B9ZA 3CXFA 2AITA 3ZE0B 3O41B 2B5IC 2FT6A 1NCOA 2ZAHA 1BBJB 3FL7A 4P5SA 4PRDB 3V79C 1PCSA 3TNMB 3IDJA 3CZEA 4QOKE 5HHMD 4OKVB 4RGNB 3PHQB 2R1XA 1E50A 1Z9NA 2Q2EB 5AUMA 5CN3A 5K69A 4MWFA 4QDGA 3V4PL 3T0AA 3C2SA 4X6DB 3LZOA 5EFIB 3FT9A 3ZO9A 4AK2A 5E2TL 4OF5A 2RHEA 5EN2B 4GKSB 2P26A 1PGRB 5IJKA 5KSBA 2DQEH 2NY7L 4BSWA 4G6KH 4DKTA 4TVPH 4AL8H 3MJ8B 1FZMA 5TQ2H 3O2VL 3JWDH 1WITA 2NY2B 2W07A 2FR4B 4MJHA 4F57L 5IWLA 2CLVA 4JDVB 3UG5A 2H9GA 4PGJA 1RV6X 1V3LA 5IHBA 1X9QA 2MFNA 5C0RH 2G3XA 3LN4B 3X1NA 3NP3A 1MCPL 1TZIA 5EWIH 3K5RA 4DN4H 1G6RL 1I9EA 2BNRB 3MJ7A 1J0JA 2F15A 4JQIH 2OP4L 4ADGA 5C3TA 3TIEB 5F7BA 4TN9A 3UZQA 4DZBA 1A1OA 1FE8L 3TN0D 1JSYA 2DQCH 4PBDA 3ZDYF 2ZUQB 4X6DE 2MCAA 4OGAD 3QUYD 5I8EB 4XNQA 2Q76B 5HDOA 2IH8A 3QDMD 3KYMA 1DCEA 4WW2B 3MRRB 1IO4C 1AO7B 3MCKB 3T65B 3O9WA 2X09A 4UYQA 4JFUA 2EVIA 2BP0A 1HZHL 2YAFA 4MB5A 3C60B 5IMLB 1WVZA 1PKQB 4HEPA 4B53A 1S78C 2ODHA 1G7PB 5DCCA 3FSVA 2K70A 4HOMA 4CSPA 5E99H 5EZIH 1JVKA 4R4BA 5IW6B 4WW1B 2V3EA 1T6WA 4ZO8A 3UP1A 2HLAB 1NFDF 5EZLA 1K8DA 5SX5H 4Z76A 3V8CA 3LNGA 3PWUA 3AW5A 4UZGA 2V17H 3MUUA 2EXYD 3W0WA 2BCMA 2PMZA 2R7EA 2XN9D 2IOIA 4OV5A 1IUZA 1ESOA 1R34A 4NQVB 4UOQA 2A3TA 1ZT1A 5EU6B 1DSWA 4JJ5A 1AO7E 3EZ8A 4LVNC 2KDGA 2WIIB 5IEKA 3LNEA 4LLWB 1K3ZA 4OD3H 1KZYA 2ZXWB 4DOHE 3BAEL 3B5HA 4R0LB 1DBBH 3Q9PA 4MKMA 1L9TA 2CHNA 3ATFA 2GJJA 1UWXK 2EO1A 2XWXA 1F5WA 2Y5EA 4X5WB 1XGYH 4QAWA 3SE9L 3LS5H 3SKOA 2DD8L 2VN6A 3AZUA 1HKFA 5FUCE 1PLGL 2EXYC 3KGTA 1T21A 4ZNCD 3OC8A 5JIKA 2HN7B 1NOLA 3S8WA 2HLEB 1YPZE 2MSPA 1TXKA 3B37A 4H40A 4NEHB 4X5XA 1S7UB 1WV7T 5DVLA 1ZDQA 2R0LH 3D08A 1Z7JA 2WVVB 4EQ2A 1A9BB 1DBMH 3KM1A 1QYGH 5DYOB 5LGHH 4LCWE 5KW9L 4YSDA 4ODUA 4YHIB 4GKNB 2E7DA 2AQPA 4P2YA 5IB2A 3ZDXB 4MJIA 4UBDD 2E27H 2P52A 2PO6D 2YPVL 4JE0A 4U1IB 3X3GL 4PJAF 1KLGB 2NXYB 5BVPL 4PJEA 1CU4L 2VW7A 2P44B 3F6IA 1Z5HA 2P80D 3AT9A 3QJFA 1I8MA 4L1LA 1EAOA 1GKEA 1EUUA 1A7OL 1U3HD 1O7DC 3AS0A 3P4MB 3RIFK 5KVGE 3VRIA 1SVCP 5FLVA 4O5LH 3VGAB 1E5AA 3N5AA 4DP6X 4NXKA 2EH8L 3RX7A 1WQVT 1CR9L 1ZSDA 1RFDL 2W9EL 3C09B 3ATDA 4UBDC 5FV2A 2PO6C 4NZTL 5HGAB 3KPSE 1G9MH 4XN9A 2IG2H 3K72A 3TEYA 4F7KA 4MA7H 2Y06H 4UTBL 3UBXI 3RPIA 2V8MA 4UOZA 4M93B 4IKKA 3ZDXE 1XF1A 3FH7A 4PJBA 4ZUVB 3ZIYA 4MZ2A 3SKNB 2VH5L 1U3HC 3WHXA 3LV3B 1CXEA 4JFHD 1FZJA 3CVHA 1WAPA 1HXKA 1ANUA 5FWQA 1QI4A 1OHQA 3ZMRA 1USQA 4XP9H 1V27A 3FQWA 4QHNB 1KY6A 1OTSC 4KK9D 4YFDB 4C56D 3V0WH 4K5OA 5TDNA 1Y1DA 2HRHA 4RQQA 1GW0A 3T0BA 35C8H 3FDWA 2F5AH 3RVTD 4AYDC 5D4IA 4A6YB 1J0IA 4CSTA 4KKNA 3VI3A 3BEWA 4B7IA 2W80C 3DVGB 1IJNA 3F58H 3HS9A 4HHAA 3D4CA 5AZ2L 3CFDA 4XPGH 2MJWA 3DMMB 2RFXA 4IM8A 3MV8E 4AYID 1IX2A 3N3EA 4MZRA 3EXJA 2XIIA 1FV1A 1I4FA 2OMBA 3M1BA 3VXRE 1FBIH 3FOLB 4YSOA 1NLBH 4I18A 3EOBB 1YEGH 3PJLA 4Z7WA 2OMYA 4NKQB 2R2EB 3O4OB 5IBTH 3MHZA 2HWZL 3FCSA 4KK9C 2ZUVA 3ARSA 3ARPA 1EEZA 1PQZA 1M2VB 2Y5TB 3PXJA 3QYMA 3KPLB 3GF8A 5DFAA 2YMOA 4QTHA 3RVTC 4P2RA 4QGYA 4MX7A 3EG9B 1R47A 4DN3L 4MS8D 5E1HB 5GRVK 3GSNA 3IDGA 3Q6GL 3ULVD 1E2VA 2P24B 5FA3B 4KDTA 4X7SH 3U4AA 4A68A 2C9RA 3KS0H 4ZW6A 4L48A 3VJ6B 4CU6A 4GAAA 4GQPH 2G3NA 5ISZE 4ZUWA 2VZUA 5A3IC 2WQRA 2UZIH 1OAYL 3P9LB 2XKUA 4N87A 4LP4A 4ZTPH 2WZAA 2FX9H 3L3KA 4LSPH 5B22A 1KFAH 4LHUA 2IAMB 3IFNH 4H25A 1FI8C 5FGRA 3PL6D 2JCCF 1VLXA 2VRKA 4PRHB 1SXSA 1G7HB 5SWSA 5C2BL 1MAJA 3P30L 2BIIA 5ERWB 4YHNA 4HJ0C 1DSFL 1EO8H 3HN8A 4PJCA 1AGEB 4M6OH 5DJ2B 1MN4A 2J6WA 1TQBB 2JJTC 4RRPG 2UZXA 3OMIB 5D72L 3UTOA 1SEBB 3X13A 4DAGH 5L88H 1PZDA 1UZGA 2D03L 4GSRA 3B4NA 3L9YA 4XCEA 5BOPA 4N68A 1E9OB 3JZ7A 4XOEA 4EXKA 4GG6B 4C4KT 5HHXL 2X70B 4P4KC 3E1F1 5SWZD 4MDIB 4UIMA 3L5WA 3PL6C 4G11A 4E41D 3B6SB 3LEVH 3O0LA 2EJ1A 3KDMB 3O11B 2CLZB 4OGYL 1RIUL 4ZFFA 1NJ9A 1QFUH 1Z3RA 1F3DH 2DQGH 5C0AD 2VN5A 1ZPUA 1HAUA 4G8GA 1I9JL 1G7QB 4G6AD 2ERJB 4MA1B 4J3OH 3C5JA 3QEQA 1HXYB 1A7PL 4JFDB 4Q6IC 4H7VA 3LKOA 3HI5H 4P59H 2YAMA 1ZE3C 2ZF8A 4H1LG 1E6OH 4RWYH 4UTAA 1RZKL 4LXFA 3S34H 3GM8A 3WFHA 1X5LA 2YGQA 4YGVA 1U8MB 5E56A 4S0HA 1MCDA 2G5BA 4X7FC 5PCYA 1BPLB 1M6UA 1XXFC 3CDGA 2EIDA 1FZOA 2YZ1A 1FNEB 3LHPL 4XC3L 2LAGB 2GITB 3D69A 4RAUA 1QG3A 4O4YL 4GG6E 2XVKA 3HHSA 1P7QA 2DMBA 4JRYA 1QI3A 1JGDB 4G6AC 2DLFH 3A67H 4IJ3B 1MCWW 3MA9H 2J6EH 3QG7H 3KEDA 4KKAD 5FOBB 1XF3B 3RNKB 3ASNB 1HWHB 2G0KA 1B88A 1QLEB 4LLUA 4Z3TA 1HCFX 2I26N 2CGYA 4XZ4A 3TBVB 1LD9B 1RURH 3QIUA 3FYEB 1QUNB 4DKFL 4YSQA 2OSYA 2UYLB 3HR5A 5ADOL 2FECL 4JFDE 3MNZA 2B7DT 3BUIA 4JRFA 4OZGB 3LEYL 3VNYA 1JZ4A 1J9TA 5AW5B 5JDJA 4MXQD 3S5LB 3N1QC 3OJMB 4HUKB 1GGIL 1IC4L 1HHIA 5EZOL 1PD0A 5D5MB 4PJ5D 5HDBF 2WCGA 3D2UB 3ARGD 3NJLA 3P11H 2NY1D 4DGIL 2E0PA 3SGDI 4OJYA 2P9RA 3GHPA 4KKAC 5FV1L 4DVRL 3FRPA 2JWYA 1D7FA 4RZCA 5JHDB 3MRQA 5KVFL 2XPGA 4CMHC 2WINA 3ISWA 4XO8A 3AG1B 5SX4I 3N43F 2AZAA 5AZEH 4LK4A 4JUSA 4Y19A 4NNYA 4A66A 1OW0A 3V4VH 3E38A 5HI5D 4QOKD 5L9DH 1L6XA 4TKWA 1NCTA 5J9PA 5AKVA 3VGHA 3OKMA 1P4LB 4KJYB 1JWSA 3TZVB 3KJ6H 4JFXA 4XCCH 3QUZD 4APQA 1FYTA 3CMOH 3N55A 5T3ZH 4OZGE 3EJTA 5HHPB 3INUH 4UAOB 4RZKA 3V95A 2NY1C 5FGCE 3KYOB 1T0PB 1QEWA 4JG1H 3P54A 4PCSA 3IDXH 5JOEA 3GTTA 3PU7A 3B8SA 3AU1B 2A0LD 1GH7A 3QWQB 2BHZA 3L2MA 4LPWA 1YEDA 2FZ3B 1MIEH 3C08L 3RWIA 5F1OB 4HUNB 1CO1A 2UY7B 5TE7H 5IFJA 2CJUH 2CK0H 4FQ2H 1BAFL 5EHFA 5HI5C 3RYMA 5GS1A 4AVIA 1VZHA 3QEGL 5JHDE 2W5PA 3NK3A 2IGFL 3ZZ1A 4ANWA 4XHJC 2CA3A 2BXZA 1FAKT 3P3RA 3PV7A 1A7BA 3TEXA 4EKXA 5JXEA 4KKBD 3QUZC 3DVFA 2Q8BH 2QFRA 1S9VA 2J55A 3A6CL 2GIYA 2X6CA 4LSRH 3L48A 3L4VA 4NCDA 2CM6A 1R19A 4NB7A 4HS6B 3CVIL 4C58B 5CF3A 3C8DA 2YKLL 3LNIA 1KIRA 3K6SA 3IB4A 1MCKA 5AYUH 3VI4E 5GHWL 3HLAA 3PGFH 2BZDA 2JELL 4P48A 3IKCB 4OM0L 3UTTE 1JGUH 1KWGA 4Z8FH 2PF6A 1FLRL 1U8LA 1RP8A 4KKBC 2YMTA 4WCYH 5D8JL 4G6JL 4MKTA 2AP2A 2ZTBA 1J86A 3ROLA 3SGEH 3ULVH 1UD8A 2ZX5A 4HJIA 4RGNC 2QGDA 4QRSB 1DLFL 1WEJL 1ZLUK 2EYTA 2GY5A 4L5FH 3TBSB 4F2FA 1BWMA 1EQWA 4GAGH 3MRKA 4XBGB 5CP7B 1J1XH 3EOYG 1U8OB 1BF8A 3MZTA 5A2LH 5MERA 2G9HB 2IADB 3SE3A 2ZX6A 1XL6A 1EVTC 1WE5A 3AXIA 3D48R 4G8FB 1QLRB 3TFKD 4XP5L 5KVMC 2RD0A 4KKRA 2QV2A 4ZMPA 1K6QH 3K4AA 2DI8A 1WLHA 3CSFA 2NY2C 2YFOA 2X4OB 4FNUA 5E51A 3MOAL 5D7JD 1N8OE 4K7PH 2X6UA 4P2QA 3W37A 4AQAB 1AO7D 4P46A 1QSEB 4CNIA 1QR4A 4FJ6A 3H6JA 1DANU 4OAWA 5G2NA 5E6UB 3C60D 3ZL4L 3QWRD 5ICZA 2XXCB 2A2QT 3PHOB 4KV5F 3W2DH 3HRZB 3LHAA 3QEHB 2ITDA 1HXMA 3TFKC 1RPUA 1KYUA 2ZUQC 1E27B 4NPKA 1GGUA 1OARH 1YEEL 1ROWA 2VDRB 5HDWA 4G6ML 3VXMB 4YK4B 5MEOA 3GHEL 3SDXA 1UXSA 3CFUA 1KWKA 5A1AA 2XBZA 2WQ8A 4NQCB 1D6VL 4WW2C 3CSYB 2MKLC 3VQ1C 3C9NA 1CFV