1CO1A

Fold of the cbfa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
115
structure length
115
Chain Sequence
ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CORE BINDING FACTOR ALPHA
publication title The Ig fold of the core binding factor alpha Runt domain is a member of a family of structurally and functionally related Ig-fold DNA-binding domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 15
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 1999-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1co1A00
3VD0A 3US0A 5G4MA 4XR8C 2XWRA 1TSRA 4LOFA 2H1LM 1H9DA 2OCJA 5A7BA 2WGXA 1T4WA 2IOOA 2ADYA 3Q01A 1EANA 2J1XA 1YCSA 3EXLA 1HU8A 4MZIA 1KZYA 3QYNA 1CO1A 4KVPA 5KBDA 4AGPA 2BIPA 1CMOA 1UOLA 5G4NA 2IOIA 3KZ8A 4AGOA 4MZRA 3WTUA 4AGLA 2RMNA 3WTTA 4GUOA 2X0WA 3ZMEA 4IBUA 2J1WA 2BINA 3D05A 4IBWA 2XWCA 5AB9A 1HJCA 1HJBC 1LJMA 2FEJA 2BIOA 1GZHA 2J1YA 5ABAA 3D06A 3VD1A 3TS8A 2X0UA 3WTYA 2MEJB 1GZHC 3IGLA 2BIMA 3D08A 5ECGA 2AHIA 3WTWA 4GUQA 4IBZA 5LAPA 3US1A 3Q05A 2X0VA 5LGYA 2PCXA 2VUKA 3IGKA 1EAQA 1E50A 4AGQA 5BUAA 4G83A 4IBVA 1IO4C 2AC0A 3KMDA 4G82A 1TUPA 5AOLA 4A63A 3WTVA 2J6WA 2J1ZA 4IBQA 5AOJA 5AOKA 4IBYA 4AGMA 2J21A 4HJEA 2P52A 3D09A 3Q06A 2ATAA 4IBTA 3WTSA 4L0YA 3WTXA 5G4OA 4QO1B 3D07A 2BIQA 3QYMA 3EXJA 3D0AA 1EAOA 4IBSA 5AOMA 2J20A 3WU1A 4LO9A 5AOIA 4L18A 2IOMA 4L0ZA 2YBGA 4IJTA 4LOEA 3VD2A 4AGNA 2GEQA
chains in the Genus database with same CATH superfamily
2ZAHA 5EZJA 3C8KB 1G7QB 3U1SL 2Z0UA 3AY4A 3UTSE 3V4VH 5FA4A 2NCEA 5C3TA 3X3FL 2ZAIA 2EXYD 3K6SB 2SEBA 3BWAB 3PV7A 4XP6H 3ULVF 4K2UL 4QHKI 2XWXA 1IEBA 2EDFA 2XBTA 3MAWA 4Y4KB 3RTQC 4DGIH 1XGUA 4UQDA 3LB6C 2GCYA 3F58L 4M6OH 3RX5A 1OZUA 3RDJA 3HE7D 4IJ3B 3S3PA 1EK3A 4YLCA 4KMTL 1UWFA 1B9ZA 2DTML 3VI3E 4CJ0A 5B39B 1SPDA 3B7YA 4WHCA 1KZYA 4ZUTB 2BRRL 3QYNA 1SBSH 4EIGB 2LLLA 4BSWA 2FWOB 2QFRA 2NXZB 1BIIA 1FFRA 2W07B 3CLFL 4X6EB 5GSVA 1S7RA 5GGTL 1NEZB 3OLEA 2XC8A 1DVFD 5ACMA 1QFHA 1E43A 3BZFA 4JY6A 4B41A 1SDAB 3AUWB 2FR4B 2OMUA 4KQ4H 2XWCA 3NPZB 5EU4B 1AS8A 1R0AL 2A9NH 1GGBH 1MHPH 1Q9OA 4L9LB 3JWOC 3MDJA 1CUOA 3DVIA 3GZKA 1OP3K 1QA9A 2ZD0A 3B7UX 5C08E 3AREC 3E6HB 5CGYD 2W0LA 5GIRB 2DRUA 4RFEA 5E1QA 3FSAA 3KPLA 4J2XA 2IH3B 4AQ8C 1NLBH 2K45A 5D6DC 1H8SA 4NQDD 1MUJA 2N0KA 5DK2B 2VERN 1X9RA 3ARVA 3CX5J 2WXNA 1W16A 2VAJA 2W91A 3BP6A 5HVHC 3HE6A 1EO8H 1YY8B 3KYNB 4MAZA 3FN3A 3W2DH 4ZI8A 3KPSE 1AHMA 1ZDQA 2BCKA 2P7TB 2VW6A 4QOKA 1AC0A 2I07A 3ZZLA 2H32B 1WRFA 1NIAA 3CZGA 2AERT 2ZJSL 5AAWA 2BJML 4OCWH 4ZDHA 4OCXL 1QUPA 1AR2A 3IB4A 3E2HC 4QF1B 2BHYA 4OIFA 3U9UB 4M29A 2H6PA 5DJYA 5TE4L 1ZV5A 4K5MA 4E41B 5F1NB 1F3DJ 4PJDB 2V8LA 5J4MA 2EYTB 3D3VA 4LO9A 4R97B 5H37G 1OB1A 3FRPA 3QZWB 1RFDL 3L7FB 2Z1KA 3S34L 2P8PA 4W9KC 3NIGB 4P4KC 2CCVA 3BWUF 4AL8L 1NFDE 5ACZB 1QLEB 2KHAA 4KO7A 3CE1A 2AQRA 3ZE0F 3V6OE 3WNLA 3WFEL 2MJWA 1ED3A 2FZ3A 4GRLC 4WTZA 2TRYA 2VR7A 2W0KA 1XH1A 3NH7L 3QUXD 5F9OL 3GZPA 1TFPA 4QXVA 5HJDA 1W0WA 1TQWA 1YEIL 3G5XB 2X38A 2PPCA 5IJKA 5AWNH 4Q6IB 3D9AL 3DI2B 5I30L 1J86A 2YRPA 2FO8A 1UWXH 1I3RB 3MROB 4B95C 4X8JA 3EFOA 4DGYL 3CHOA 4LLUB 5AENA 1S7WB 2Y5EA 2A0LD 4GLRH 2P5WB 4WHTA 5EU3A 3M46A 2D3JA 5IG7B 1IKNA 1KG0B 4K8RL 4CVZA 35C8H 3INUH 2GFBA 4HWZB 3F7LA 1T7VA 4FZ8L 3EJUA 1JSYA 5HJ3B 3ZK0A 1WSST 3HNSH 1E8WA 3EIFA 5AW3B 1QSFB 3VFSA 3DGGA 1RIVL 5E8NB 5BQ7B 1UM6L 3E9TA 3BUPA 3VFUA 2P48B 4R3SB 1C16A 4LEBA 4FLSA 1AOZA 5IB4A 3V9EA 4N20A 2C4FT 1Q1PA 4IU3A 3V6OC 4LDEB 1ACYL 1QKZH 1S5HB 3HTLX 3T5WA 2P43B 4L3ED 4CU6A 2DI8A 2ZCKH 3HE7B 4KKAD 1EX0A 2UXFA 1R17A 4UDUB 1JF6A 3C8KA 1G7QA 3K8KA 3IETB 2QDWA 4U3XA 4YDMA 1X9QA 1SUJA 2YSTA 4N3UA 5CZVL 1GS8A 4NJAH 1M71B 3K6SA 3BWAA 3LSOB 4JQVC 2V5YA 4OZGA 1AGCB 1HILB 2C9SA 2ED8A 4K5PA 4Y4KA 2YA2A 1QPPA 1P53A 4A2MA 1PG7H 1ET8A 1JP5A 5C0RH 1DVFB 4K4KA 4BM7A 3MA7B 5B39A 4P2QE 5C86A 4ZMZA 3PNWB 1G87A 3ECBB 3FH5A 2DLEA 3LEVH 4A7UA 1C5CH 1IB5A 4O02L 1PIFA 2B7DT 5I15L 3KS0H 2ZG2A 3WY3A 2W07A 1DVZA 4X6EA 3EH1A 3TF7C 1CYWA 1WV7T 4OFYD 1HT6A 1CGWA 3MRLA 4HJ1A 1AZCA 1NEZA 2BMKB 1HDMA 2QHLA 2YFNA 2VLKA 1A0QH 5E0FA 1N6QL 4M93B 1JI2A 1IGML 3NACL 5I0XA 2MTAA 5F3BB 4JS7A 2FR4A 3V10A 2D7TL 4H20L 4NQDB 2AQSA 3O6FC 4L9LA 5D2NB 2R0LL 1QFPA 4Y9BA 1DN2A 4MQXD 5TD4A 4QNPF 4DOHB 3E6HA 1ZT1B 1DQVA 1VZGA 3NZHH 4PRBB 5D1ZB 3B2UC 3EOBB 2GT9B 5E99H 4MQTB 1NCCH 4E9QA 3ESNA 1J9CT 3IBEA 5DK2A 2X4QB 3PQYE 4FOMA 3GSNB 1YY8A 4X8GA 3WSQH 2R2HB 4WRLA 3DXAE 3PNRB 2P7TA 1JGUL 4JM2B 1N5AB 4AGOA 4ANXA 1MH5B 2H32A 1QAWA 1ZSHA 4BQ8A 3QB7C 2WHVA 1RPKA 4M5YH 4PYGA 1AACA 4QF1A 1UXWB 3U9UA 4Z23A 1QZ1A 3GMLA 3OBAA 4YS4A 2ZCLL 4PJGF 2XQBH 4E41A 3IDYB 5F1NA 2XRAL 5DC4B 3HG1D 4Y8DC 1P7BA 2EYTA 2EH7H 3QJUB 4LMQE 1SUHA 1KGIA 3UCRA 1PY4A 3VGFA 1KT2B 3QZWA 4LK4A 3L7FA 1RHHB 3WFCH 2EXWC 1F00I 4PGBB 4R6UA 3QDMD 4UQ3B 3KL0A 5CLWA 5ACZA 5JXAH 4LVEA 5LDSA 1LNUB 1BOGB 5ICYA 4BUGA 5I5JA 3SBQA 3T6XA 3PXHA 4ODWB 1AR1C 2Z4QB 1GGIL 2WMPB 3MODL 2Y6SD 1RQ5A 4YSTA 1XX9C 3UG5A 4XXDA 3BESR 2ZKWA 3V4PL 5HI5D 3QHZH 4CSSA 3G5XA 4R7NA 4DUVA 4R26L 4XP5H 2EADA 2EE3A 1MFEL 4Q6IA 4C4KT 1EZUA 1QRKA 4D8OA 3KVQA 4PGEB 1BM7A 5IK3B 3MROA 3T8XB 3QZNA 3HFFA 1JGLL 1JFHA 5FGBA 2FBJL 1USZA 1HHIB 4LLUA 1KN4H 1S7WA 2FHBA 3V0HA 2BSSB 2DN7A 4PLJC 5I0ZA 1XD1A 3OKEB 4XCNB 5JMOC 1YO4A 2P5WA 1G7JB 3UADA 1TZGH 5IG7A 1KG0A 1JPGB 2W1NA 2D3LA 2XKSA 4HWZA 4FNTA 4FL4C 3ARBB 4XB3A 5D7IE 1OKEA 4BD4A 5HJ3A 2AABL 4MRBA 1CXLA 1QSFA 1WGOA 1SOQA 2D3VA 5CJBA 3TT1H 5E8NA 1M42A 5BQ7A 1O9ZA 4R3SA 5ALCL 2ZWSA 4O4YH 1QLFB 5DU7A 3DPDA 3GPSA 4OZFB 1AFVL 1S5HA 2YRZA 4GRWH 1QHOA 4UDUA 5HD8C 4WTXA 3IETA 3B5TA 4BBWA 4DZBB 4BINA 4M7ZC 2RHEA 4YHLH 4P46C 4TL5A 2R2EB 4XXWA 1N4XL 1M71A 4UYPA 4DVRL 3LSOA 3BH8B 1AGCA 1AO7D 3RVTC 4FZEL 3OHXC 3BLBA 1HNFA 1BVNP 3R0NA 3O81A 2BW5A 3RB5A 1C8PA 3B4NA 2J1KA 1M3JA 1SN0A 3MA7A 1KLUB 3EJCA 3GRBA 1ETB1 3PNWA 3ECBA 5DA0B 4GUPB 4GXVH 4XVJH 3O8XD 2UV3A 4MD0B 4WO4C 3IJ7A 1RK7A 3IFPB 1R3IL 2AEQL 3VI3F 2WK2A 2BMKA 1HK6A 5KBPA 3RNKB 2YMTA 4Q8BA 3AU0A 4RA0C 1MJUL 1FBIH 5F3BA 4OLUL 4G1MB 4E9YA 5C8JB 3ETBJ 1I8LA 1FSKB 1DQMH 3CSBA 4NQDA 4BFRA 4UAOB 3CQQA 5LGJA 4U33A 5D2NA 1I53A 5ACLA 1FQ9C 5BPPA 2NNRA 3NFSH 4OF0A 2ISDA 1AZVA 4A7TA 1ZT1A 2XWJA 3BJ91 1NWOA 4PRBA 2E7MA 2GTWB 3EOBA 5D1ZA 3DPBB 1RU9H 1WAAE 3IDXH 3OSKA 4WWOA 5DJ8B 1I9EA 4UUJB 3D09A 3LKSB 3BGMB 4AYMC 4HT1L 2X4QA 5DLLA 3LH2H 1GJWA 2WPGA 3TJEL 1CK0H 1ETJA 5D4IA 3WEOA 4TQIA 3KD4A 3MRHA 2NY4D 2YD3A 3GSNA 3MZGB 4UZUA 3S37L 5J11B 4K8RC 1WZKA 2R2HA 3TEUA 4Z7AA 4BHUA 4JM2A 1N5AA 4JJHA 4KXZH 1MH5A 5GRXG 2FB4H 4ZODA 4HOZA 2EO9A 2QTVA 3VQMA 2QSVA 2H6OA 4FFZH 5EOTB 1NBYB 3NCFB 1P4LB 5I1GL 1UXWA 2EEBA 2Q8BL 1NL0H 2PCFB 4ZMPA 2CO6B 4M1GH 2HSIA 1KXVC 4OTXL 4PMEA 2E8ZA 2ITEA 5CO1A 5SWQA 4I3GA 1BOYA 3GI8L 3KM1A 4X0KB 1C8QA 4TNWF 1KT2A 2ZKHL 3MOQA 3QIUD 1RHHA 1U91B 5E8DL 4FNRA 1F6FB 1QBMH 4QWWD 1MG3C 2CKNA 4PGBA 3WNPA 4UQ3A 4BIKA 4XXCA 4NRXB 1A1OB 5DJXB 1KYOK 2B9AA 5F70A 1SLVA 2UZYB 1IGCH 3LS5H 4KHXL 4ZSOB 4EN2A 3E6FB 2NYYD 4H0IA 4EN3C 3GLAA 2GUOB 3N40F 4ODWA 3OKOB 4LNVA 2Z4QA 3ME0B 2GJRA 2WMPA 4CN6A 3ZN6A 2YSSB 2R7EB 3M1OA 3QH3B 1S9KC 2VR9A 2MFNA 3ATEA 5B8CC 1ULVA 3AITA 3HZ3A 4GIPD 2HKFL 4IBUA 4HIJB 1NBCA 2I60L 3H54A 1V10A 4F9LC 5GGRY 4PGEA 1JZEA 5IVNA 5IK3A 4IGBC 3T8XA 1A3QA 2LAAA 2VLMD 5M94B 3HAEH 5MEPB 1GC1C 1ZT4B 1HHIA 2BW4A 5E8OB 3Q13A 3ENEA 2BSSA 1U30A 1GZHC 3D5OF 2VQ1B 4MB3A 5TK2A 3OKEA 3GSVB 4MCNA 4XCNA 2WJ7A 1G7JA 3VA6A 5FDWB 3LZPA 3SPCA 4OVUA 1JPGA 1ZLVH 5HGBA 3QC6X 3UPRB 3GYRA 4B0MB 2PCXA 3ARBA 4PJHE 2W9EL 2EUXA 4V2CB 4QRBA 1XT5A 4YSAA 4P5RA 3MBXL 3KXFD 4XP1H 1IAII 3GO1H 1CBVH 5KSUB 5EUKB 1NSNH 1VAHA 1JMXA 2BDNL 2BOCB 2BRQA 3PL6D 3ZDWA 1EQWA 2EIJB 3BAWA 1QLFA 4KV5E 3T08A 4HGMA 5DURB 1AO7B 4OZFA 1NCBH 1NCOA 4K9EC 3SGKA 4AENB 4APQC 8PAZA 4J6RH 5KVGL 1JNNH 4PJAB 4I0PD 3AG4B 3HMXH 4M61B 3GI9H 2VZUA 1YUKB 2JTYA 2X28A 2A83B 4DZBA 2XT1B 3IRCA 5HHVL 1YAZA 2R2EA 3KYKH 1Q72L 5CJ5A 3D2UB 3BH8A 4OFIA 4W68A 1YY9D 1GH7A 2EVGA 2OULB 4MMXC 2NX5D 1T5KA 5G5DB 1DHKA 4OFYA 3PV6B 5T5NG 4HKXB 1KY6A 2OL3H 1O9WA 4OCRL 3NGBC 3BAYA 4FTVD 1TTRA 2WSDA 2XICA 4ONHB 4OBSA 1KLUA 1J0ZA 1QSEE 4CVUA 3C8HA 5FFOA 3DVNB 4L8CB 4NZJA 3O4LE 2R29H 2AJUL 4GUPA 3U46B 3CFBB 3PY9A 5FOBB 2YKKA 3BVWA 4TSBH 4X6FB 1MW2A 2CHNA 2NY6C 4MD0A 3QG7L 4N8UA 2BHZA 5E2JA 3IFPA 4KKCD 4DKEL 2DQTH 1ZSDA 1YEEL 1CXEA 3ALXA 4HXBL 2O5ZH 4Y16D 5GGUB 2IOOA 1HE8A 2J1XA 3UBGA 2YGPA 3EYOB 3P0VL 1MJ8L 4FMFA 3B9DA 4HW6A 1FL6B 2F5AH 1KYFA 4G1MA 4ORZC 4F7PB 4KJWC 5C8JA 3T1WA 2ZOWA 1G1YA 1I3UA 4H8PA 1F02I 4U0QB 1TEGA 4HLZG 1OAJA 3SKOB 3VXUD 2B4CL 4B96A 4GAGH 2NY4B 3K4ZA 2J43A 2ZICA 5EBWB 4ZT1A 5AW1B 1A6PA 2R51A 1KELL 4PWIA 2EIZA 4H88L 1UHVA 1ITBB 2GTWA 5DEFB 3DPBA 1D6VL 4NAJA 5DJ8A 4FEIA 4UUJA 3LKSA 4ZOAA 2WQVA 3BGMA 4Q89A 5CSGA 1QX1A 4JPSA 3P3YA 1MFUA 3H9HB 3DOSB 1HHGB 3P3TA 1SLWA 1E6JL 1GW6A 4PJ6A 3LIZL 1DQIA 2PO6D 3UG3A 4LLWB 1EZSA 1X5AA 3LYRA 4U3SB 1MRCH 2ZXGA 4UT6L 4RDQG 2DL2A 3TEXA 4B9PA 4BCZA 5AAMC 5HPOA 3RX7A 4GQ9H 2IIJA 4N1CA 2BP0B 3PYCA 3HS0C 2YAOA 5EOTA 5KVDL 1NBYA 3GK8H 2X0VA 1P4LA 3QIUB 5GS3A 3OLIA 4F2ME 3ABKB 3CN2A 2PCFA 3LTVA 4M03A 2CO6A 3MLWL 3B2DC 4XP6L 1OF0A 4EQ3A 1HIMH 3EUUA 1J7VR 4TOYL 4BV1A 4DGIL 1HVXA 4X0KA 4M6OL 2BVOB 4WFED 4EUPB 2JK5A 1ZK9A 3VWJB 4LDLB 5DFWH 2P9RA 1A1OA 2QVMA 4G71B 3AROA 4NRXA 1SBSL 2NLJB 5FV1L 5FX3A 1TXKA 2HLFD 5E4OA 2UZYA 3B7SA 4ZSOA 4TYUA 3E6FA 3QRFM 4E9TA 2APSA 4JG0H 2GUOA 3IPBA 3Q1EA 3OKOA 4JFYB 4AJYV 3ME0A 4XMVA 4A68A 3LY6A 2IOMA 5J1AB 1MZZA 4F58H 4JRXB 2DD8H 3Q43A 3IU3B 3QH3A 3ARUA 2OYPA 3WS6C 3FRUB 4ZNCD 5DR5H 4UV7L 1EFXA 2VL5A 5C6TH 4Z7OE 4XHJC 2A9NL 2OZ4L 1CLZL 2IAND 5DK0B 1PLCA 1QMUA 1VKXB 5I8KH 5MEPA 2GSMB 3KXFB 1ZT4A 2QKIC 3IDMB 5E8OA 1CIDA 2XA8L 5D93C 3W5MA 4AIXA 3GSVA 4GBXA 1QATA 1MWAB 4L1BA 5FDWA 4ZXBA 2LU7A 4FHKA 3UPRA 1S46A 2P80D 1T66D 3U36B 3ZT7A 4Y5YB 1NUGA 1P84K 4AITA 3W2DL 4YN3A 3MRDB 3EOYG 3OQRA 5JOFB 1BEYH 2DQEH 5KSUA 5EUKA 2DYPB 3IF1B 3P4OB 3EDDA 3B1UA 2EDDA 4H8WH 4RZCB 1BQKA 4N0CC 5IB3B 4OCWL 2D7QA 2QLYA 5HI3D 3UZEA 4WF7A 1DP0A 3FT2B 1AO7A 1KN2H 4AENA 2NX5B 4PCTA 1I85A 3EF4A 3K4AA 5JR1H 4FKEA 1Z9NA 4PJAA 4TLSA 2P5PA 4U7KA 1SMDA 3AB0C 4JHVA 5JHLL 4M61A 5T33L 2NY1D 4HCRH 2WQ8A 5GPRA 3UTTE 1P69B 3G6DH 2A83A 5FFGA 2XV2A 1VZHA 1GAFH 1FO0L 3CZJA 3ARXA 2XTJE 3D2UA 1DQDH 3LEXB 4JZJC 2HT3C 3N41F 5G5DA 3ABLB 3O3DB 3PV6A 4KI1A 5CEZD 4HKXA 3FCSB 5KN5B 3H56A 3RAJL 5LGYA 4H1LH 4J3OC 4ONHA 1XGPA 2NDFA 4EI0A 4L8CA 3VXME 1M2VB 3ZO9A 2EDQA 3LQAH 3U46A 3CFBA 3VXUB 1RULH 3BEWB 4X6FA 5AB0A 3KPNB 4HSQA 3ESVF 3FTYA 4JE4B 2DMCA 4ERSH 3BH9B 1XMEB 3U1PA 3ARTA 1HX0A 5GGUA 2GK2A 2KZBA 1PKQB 3EYOA 4JN1L 3RUGF 1FL6A 4F7PA 3MRMB 3SE3C 4H8QA 4EIUA 3S3DB 3SKOA 4YZWA 5I1CL 25C8H 3QQDB 5K93A 5T1DH 3WIHH 3H3KA 5EBWA 4GMSH 4MA8H 1GC1H 4MJIE 4MA1B 2QHRH 2MQCA 4L0ZA 5DEFA 4QXWA 3Q3GB 3INUL 5IHZB 3GEWB 3T0BA 4OLEA 4ODXA 4MBOA 2Y5TB 1C5DB 1OGAD 3IPFA 3H9HA 2CUHA 2HKHH 1AYOA 3HNSL 2BWDA 4YPJA 4NO2B 2XTJC 1HHGA 3DOSA 3U0WH 2ZPKH 5EN2B 3BP7A 5CD3B 5FGCB 4LLWA 4GNKB 1TU2B 1FIEA 4FQJH 1AI1L 3ZZSA 4U3SA 4AKPA 1ZV2A 1D3CA 3V95A 1QKZL 4Z3TA 2FGWL 1PCXA 2BP0A 2TSAA 3VXNB 4PJXE 3VA2C 2ZCKL 4CC4C 4EKXA 3QIUA 5T3ZD 2Q3XA 3T8VA 4OCLC 1O9VA 4NOFA 2R1WB 1J10A 1MCSA 3I9GH 2FT6A 4MNQE 4EI5C 5BUPA 1CGSH 1HESA 4X7FC 1JV2B 5AVRB 2UX6A 1PG7L 2BVOA 4EUPA 4ZTPH 4Y7MA 4DAGH 5C0RL 2ADFH 2FX9L 5DWUH 3VWJA 3TWCH 1LEIB 3N43B 4J3WA 3ZL2A 4DJMA 1OTTC 3UROR 1C5CL 1XB8A 4MVBC 4X7TA 1DO5A 4DSYA 2O1AA 2D0GA 2IANB 3ELQA 3BIKB 4YBQD 2VSMB 2X2YA 1RZKC 2QKSA 2XQ0A 3QW9A 2YRLA 3PWPD 4AJVA 3L9EA 3GS0A 4NUQA 4JFYA 3WN5C 1U4EA 4DO5A 1I1FB 5J1AA 5I1DB 4Q0XL 4JRXA 5DFTA 1JZ4A 2W88A 3IU3A 1KEMH 1AZZC 3FRUA 3K91A 4LRNH 1RUKL 3H9SB 4ZFGH 1XZ0B 2QADD 3LH8A 5DK0A 4C55A 4QTIH 1VKXA 1GKOA 4GUCA 4ZTEA 3KXFA 3IDMA 3DETD 2Y2WA 3NZHL 4IOSD 3WMQA 4IBQA 5E99L 1PEWA 1VFAB 2B2XL 4HU2A 4K07A 3RIAF 1MWAA 2G5BB 1IM3B 4RCAA 1JL8A 5D7JB 3MA9L 3IN0A 5FM5O 3NCWA 4RWHA 1VACB 4TLTA 4U05A 2WV3A 3U36A 2NDGA 4M8RA 2ZP9A 4Y5YA 5BO1H 4Y4HD 1QI4A 1ZDSA 5C6PB 4P9HC 3MRDA 4N68A 5JOFA 2G3ZA 2FAUA 3AG2B 5DVOA 5L6YH 3SCMD 1G94A 1HCFX 3MRNB 1QRNB 2L04A 1ETZB 2QVKA 1LO3H 2DYPA 3P4OA 2LHAA 2YN5A 1NOLA 1XIWC 2J8UF 1ZT7B 4RZCA 4HJ0C 5IB3A 2JI1A 5I74C 2ZYIA 3S35L 1NCTA 3FT2A 3WLWC 2NX5A 2WOBA 4N86A 4MX7B 3RZCC 5T3XL 1XCTB 4EZMA 2XQBL 2IJ0C 4F91B 5H37A 2EILB 1WBZB 3FQNB 1UB5B 1OWWA 3NCYS 3NDZE 2AAAA 3LEXA 2UWEF 4XWGH 4N2DA 3O3DA 3WFCL 2YBRB 2AP2A 3FCSA 3GIVA 5KN5A 3F7QA 2NY3D 3F7KA 2VMCA 2X1XR 5D5MB 1BVKB 2OW6A 5HDOA 3ZHFA 5DRNA 2HX8A 1M2VA 4Z0BH 3FSVA 1L7IH 1WFNA 1X5GA 4G8GE 3VXUA 3TURA 5I0DA 3BEWA 1ZOXA 4XVUD 1DQLH 3KPNA 2WZ0A 1PBYA 3BH9A 2OBGA 2EO1A 4N5EC 2VDQL 3LQMA 4WW2B 2UZIH 5JQHC 1PKQA 4PRNB 3BMWA 4NI6A 3RBGA 4JHBA 1E8YA 1K8DB 3DX3A 3ROLB 4YX2H 3MRMA 1ECZA 1TYJA 2F7QA 2GVYA 2IDCA 3QQDA 1F6LL 3FTVA 1HTYA 5LCVA 3GBNH 5EULV 1C08B 4G5AA 2N7BA 4TVPL 3QC5X 4HETA 4YR6B 3KS0J 5EPMB 1TZGL 2ZKYA 5HYQB 1WT5C 3AT9A 3Q3GA 2OJ1A 4C58B 5IHZA 4RSYA 4YNYB 4B9IA 1KWKA 4FG6D 5J8OA 5FCSH 4FFVC 3ERXA 4Z8FH 2Y5TA 1C5DA 3CHQA 1BQLH 1DANT 4NO2A 4TUOB 1K3IA 1UOVA 3DDGA 1TVBB 3TJHD 5EN2A 4LCYB 3TT1L 2ZT9C 5J7CC 3P0YH 5CD3A 2Z4TA 2NYZA 3VM5A 2KYIA 4F57H 1KBPA 4W70A 4O4YL 4AGMA 3BLPX 1ID2A 2AVFA 4BQ9A 3VXNA 1VCBC 4JPIB 4KBPA 4XOAA 1INEL 2CJUH 3C60D 4XCCH 2A38A 3TEWA 4PJCF 4YHLL 3RWFB 1F2XK 5IQNA 1T7WA 2R1WA 4FG2A 4ETYA 4WSGA 2A9AA 2RCSH 1ZLWK 1FORH 4QMEA 1JV2A 3PWPB 3TA3C 1Z9SB 4EJ1C 5DUPH 1T04B 3U48A 4XMUA 1T7XA 2Z31D 1LEIA 2BNUB 4KKBC 1RKRA 2YLHA 4ENED 3QG6B 4GXVL 4J3OH 1OALA 2QADB 2IANA 1ZLDA 3BIKA 4OD3H 4QTFA 4F93B 3LH9A 5D8JL 3K1KC 3UAEA 3KPMB 2VDML 1NEPA 3PP3H 1I1FA 1IGJB 3WS3B 4H0LC 5JQ6H 4XPGL 4QR7A 3FCBA 5FFLA 4AEIL 4EMZA 1BQHG 1UADC 1KDJA 4GI6A 3H9SA 4FQ2H 1XZ0A 2FQDA 3I84A 5DO2D 1MFAH 1FZKB 2EVHA 3NJMA 3M6DA 3UDWA 5EBMB 4Y4HB 5F9WB 3MLPA 4P2OC 1CMOA 1AS7A 1G7LB 3EFFB 5KJRH 3NFSL 1A3RH 1DSFH 1NUNB 5CGBA 4D3CH 1FE8H 1UM4L 4FXKB 1B6DA 1VFAA 3IDXL 4YHZH 5FKPB 1JHLH 4Q74A 3S6CA 3S3SA 4X80L 2G5BA 1IM3A 5IVXE 3K6OA 2WGNB 5D7JA 2CDFA 4DO6A 2PYEB 2GJ6D 1VACA 4J3OF 1MRFL 4AJWA 4JGNA 3GTTA 2IMNA 5GS0C 4ZOBA 1R3HB 3MJ9H 5IROD 4NN5B 3VXRD 3MRNA 1NCHA 1QRNA 2X0UA 5HHMD 2FB4L 1ETZA 1THCA 4WI4A 2YXFA 3N44B 3MUJA 5ECGA 5JIMA 4Z7UB 4FFZL 2YAMA 5DJDB 4GG8B 1NGZB 2HFEB 32C2B 4KAQL 3U6XS 4Y4FB 1UKTA 4XN1A 3QQXA 4MJ4A 4MX7A 4X9YA 4I1RA 2HZHA 2HFFB 1XCTA 5GZOA 4M1GL 4YAQB 3JT2A 1JDAA 3CFNA 4JFDD 1BW8A 1UB5A 2IBGA 4ZJ9A 1UEMA 3MUUA 3U9PH 3RX9A 1CFVL 2ADGB 1U3HD 3MACL 3E1ZA 2YBRA 1NCGA 1WZLA 1QBML 4JKKA 1MLBB 4HD9A 2XYCA 3NG5A 3PGCB 5AKSA 1U0QA 1NIEA 2CGRH 5D5MA 3U6RB 1UT1A 1BVKA 3VXSD 1IGCL 3V4LA 1HE7A 4HFUH 2DAVA 3LN5B 4U1MB 4HJJH 3QPXL 3OL2A 2XCMC 1NC2A 3AT0A 2WXFA 4YWGL 3H4HA 2BSRB 3GXFA 3RG1C 4N1HB 4NKOB 3F7RA 2VRQA 1Z9LA 1RZKH 2DQCH 5FYJD 1F97A 2FCBA 2NY0B 3FT0A 4RZKA 4WW2A 1WZAA 4PRNA 1FA4A 1ERNA 1NPUA 1K8DA 4JPWL 4P5TC 5HI4D 3ROLA 3AMKA 3GJFB 3V6FB 1T2QL 3GDBA 4WEBH 1UYWH 4JFTA 1NMAL 4M6MH 2CE6A 4LL9A 4DK5A 3T3PB 1J1PH 4RGNE 1C08A 4TQHA 2E9JA 5A7BA 3TONA 2AXHA 3SO3B 4RGMC 5EPMA 1CZ8H 2WN2A 3BGFB 1RVFH 4PHXA 3U6XA 5HGHB 5HYQA 4YDVB 4OJCA 1IMHC 4PWEA 1HU8A 4YNYA 3CNKA 3H3PH 4PH8A 3UERA 2WWKO 4POUB 1CO1A 1N18A 3B2VL 4TUOA 3D39B 4XP1L 2HN7B 3GO1L 1TVBA 1Y7VA 3C5XA 4P9HH 4MCMA 1ZPLA 1NSNL 1T4KA 1NQBA 3UO8B 5D7SH 5GGSA 3MNVB 3QUML 5C6WH 1NCBL 2NSQA 2YPLA 3DUUB 2A99A 4Y1AE 1BFSA 3UAJD 3VB8A 1UCBH 4J6RL 4AYID 4GSQA 2J73A 2Z9TA 1JNNL 4I48B 4JPIA 4L29B 3VG9C 1K85A 4TUKL 3S8GB 3IE4A 3SKNB 3GXPA 4LESA 1ZE3H 4D9LH 4KK6C 4XNBA 5BW7A 1XR8B 2E46A 1CURA 2F1AA 3TTSA 2YGVA 3WD5L 4TVPE 4Y2OB 2X4NB 4MXWH 5E9AA 1T03H 3VMPA 2RACA 1EGJA 1HYRC 1CU4H 1Z9SA 2NZIA 1MCFA 1SJMA 4S1QL 1T04A 2VDNH 4HISA 4OSUL 5LAXB 1ADWA 2EXSA 2NNFA 4FNSA 4L8SC 2APTA 1E50A 1KBBA 2BNUA 2W8CA 2R29L 4LPYA 4RGNC 5D71H 5HJGA 3QG6A 5BCAA 1VFMA 1SN2A 1G9HA 3RA7H 2D31B 5F2FA 3HE6C 4HUVB 3AACA 3KPMA 1A6UH 2J21A 3EYQD 1IGJA 1N67A 4IOSA 3GXIA 5MI0B 3LKNB 3WS3A 5GXBB 2VOTA 1MCPH 2OMYB 3N1PC 4N9GB 2CSPA 2CJTA 5AAWC 1UH2A 1YEJH 1KNOB 2GJ6B 3L9RB 6TAAA 1SY6H 3PWUB 4FJ6A 1FZKA 5EBMA 4Y4HA 2WSPA 3AQXA 3ESMA 4LQ1A 4P23B 1QHQA 1G7LA 5FW6A 2E3VA 3EFFA 3OLDA 4TNEA 1QO3B 3NMEA 3VXRB 4TNVF 1L9QA 3HG0A 4FXKA 2F5BH 2ZX9A 3SGDI 3OKMB 3T0WA 1EDYA 1KACB 2LVCA 2PYEA 1ILSA 1KXTB 3TO4D 1BDYA 1R3HA 3NJIA 2HH0L 3DGCR 3KPTA 5E9DD 1MF2H 2CKBB 1OE2A 3Q5YA 4PY8I 1JUFB 4JFQB 4MA7L 1QACA 4FQQB 5CLZA 4ZOEA 1O6SB 2WP3T 3MYJB 2V17H 3OAWA 4JFDB 1MRCL 4QAWA 2JKIS 3BP4B 1UVQB 2C3VA 2GBAA 4GQ9L 3WEBA 4R90L 2CIIB 4XVTH 2G4EA 2YXVA 3LD8C 4G6KL 4Z7UA 2RD0A 2E7HA 1KOAA 4GG8A 1U3HB 2Q5BA 1NGZA 2HFEA 2HX7A 32C2A 1X4XA 3GK8L 4PJBE 4U1HB 4Y4FA 3L3DB 3RX8A 1DFXA 2E9IA 2HFFA 1E28B 1O5DT 2JELL 4YAQA 3VXSB 1P6WA 5TFSH 4K23L 8FABB 4WUUE 2LQRA 1HIML 4XC3H 2QGDA 1HOEA 1NAMH 1MCKA 4PJ9A 1MRDH 4IRJD 3WIAA 5MENB 2DEWX 1KUMA 3BP5B 1AXTL 1QUNB 4KXBA 3PGCA 1BXAA 5C0FB 5AB9A 2C7UB 4UM9A 1DJYA 1DFBH 1IKNC 2N4IA 3U6RA 1ZCRA 3PAUA 3LN5A 1AHKA 4U1MA 4WHDA 1LEKB 3LN4B 4JG0L 1HL8A 2BSRA 3T0XA 5F7EH 4JQIL 4NKOA 3C2SA 5DD1H 2TAAA 4F58L 3O6LH 3DX8A 3QNFA 4HUXB 5D1XB 4V1DD 4YHPB 5E5UB 1OP5H 5DR5L 3EJJX 5BS0E 1WD9A 5D7LB 1FNGB 5C6TL 4HIIB 2D9QB 3V6FA 5I1KH 1CF8H 3GJFA 4JY4B 4LBAA 5LBSL 4MLSA 3ARSA 2UXVA 3L1OH 1X5IA 3L3JB 3D18B 4A04A 1VGEH 4OI8A 1UASA 4DPBX 1P4IH 2QPEB 4LEXL 1LK2B 5A43C 5C1MB 4ZMVA 2K6YA 1OTUD 3QDGD 5ALBH 4E36A 3SBPA 3DJZA 1T89A 2VITB 2AEPL 5HGHA 3WFBH 3MXWH 4YDVA 3FB5B 2AJYL 4NNPH 4Y4KC 5BOPA 3C5ZD 2AJ3A 4TTDC 3D48R 4IJ3C 3D39A 2C7FA 1EAJA 2DQEL 2NOYA 1U3NA 1JZJA 2E56A 2WLJA 4KJQD 4H8WL 3N1MC 4BH7B 4CSTA 3QJSB 3MNVA 4JO2L 3FFCE 4R4ND 1KCUL 5DHVB 3DUUA 2NXZC 3I6LE 4ZO7A 4R84A 1BPVA 4JDTL 4I48A 3IEAA 5E7BA 3GRWA 3SKNA 3O2DH 4HCRL 4KI5E 4Y9GA 1N64L 4PJDE 1UJ3B 2B15A 2Z91B 1AD9B 1XR8A 3IJSA 4PN6A 1GAFL 1NBZB 2HT4D 2Z64C 4A2DA 1DQDL 1S4IA 5L2KD 3RB7A 4Y2OA 2VLJD 1CWVA 2ATKB 2FX7H 2X4NA 2ZX5A 2KL6A 4A7VA 4YXKH 3ASNB 1SVZA 1H15B 2ZCHL 3B9KB 1RP8A 1AJ7H 4W4OC 4WGWB 5LAXA 4GXUM 3DO4A 3GJFK 2FRGP 3LQAL 2VGLM 1TT6A 1CFBA 1RULL 4XCYB 2N0MA 1H19A 2D31A 3DBSA 3U79A 4C56E 2BVTA 1I9IL 1IC7H 1RURH 4HUVA 4ERSL 3ARWA 1AQDB 1ZHBB 3QUHA 4UIKH 1E5AA 2BM3A 2D4DA 3LKNA 2OMYA 3QUZD 2F74A 3QXTA 4G80B 1JXKA 4N9GA 4DTGH 2J56A 3CH8A 4WW1A 5F7AA 4WNSA 3VM7A 1OP3H 1EDHA 2GJ6A 4XNUL 1KNOA 3L9RA 4OJAA 25C8L 2B77A 3PWUA 3QUYD 4HUWB 2COVD 3GHBL 5T1DL 4P23A 4MA8L 3G04B 3TBTA 5IROA 3PGFL 1QO3A 5SWSE 2DQ6A 2E5EA 3CBRA 2W81C 3DKHA 3MNDA 4XC1H 4B97A 3OKMA 1EDQA 1R5WB 4KI5C 4HXAH 1UQSB 5CUSH 2MCG1 1X7QB 2XG5B 1KXTA 4JFUA 4R97C 1FC1A 3S3CB 3T77B 2WUCH 2HKHL 3CDFA 4A2FA 1E9OB 1WIUA 2QPSA 4U6HB 4CL7A 1N5YH 2ZPKL 2CKBA 1LEGB 4C4UA 1JUFA 4JFQA 1KCSH 4FQQA 2WIIA 1O6SA 1BX2B 3MYJA 2HTKC 4JFDA 1ITCA 4AQAB 4B60A 3CUPB 4RFOH 3BP4A 5EOQL 1UVQA 3TBVB 4G6FD 3ZVVA 4RGOH 3DI3B 2FIRT 4UOW0 2VE6B 2CIIA 1F4WL 4QPEA 1V54B 2WNWA 2DV6A 1U3HA 3LRKA 4U1HA 3TT3L 3FNKA 3SDCD 3L3DA 5DQDH 1XB6A 2ZYSA 5I18H 3G5VA 4DK6A 1I8MA 3ZO0A 1X9LA 2LE9A 1E28A 1MCRA 5CJ8A 4Z7VE 4DETA 2CJSA 3VXSA 1RJYB 2GABA 4Q6IC 3I9GL 8FABA 3L2NA 5LJYH 3FYEB 4LHJB 3SDAD 3LKQB 1IBGH 3UCQA 1CGSL 3IGUA 3GUFA 1G5GA 5D7HA 3ULAB 5IFAH 4Z3JA 5FGBC 4AUJA 2RAMA 2FGZA 3BZ4A 2ADFL 4YEEA 5MENA 2FEEL 3BP5A 3QO0A 4V1DB 1YSOA 4Y2DD 3TWCL 4A2EA 1QUNA 3EJQA 4KH9A 4NKIH 5C0FA 2C7UA 4E68A 4DK3A 2C1PB 5IUSA 5J57B 2X87A 2YZ8A 3UBFA 4P2RD 3HVDA 3LN4A 4RLDA 2HAZA 4ATWA 4AVHA 1ZVSB 5CJOH 4WCYL 4ELMB 4I8DA 5I5MA 1WWAX 3BUTA 3LJ3A 4Z9KB 1JPEA 3FB6B 1NCJA 1EMTH 3GSWB 3QDGB 1MSPA 4HUXA 4RX4D 5D1XA 4NQDE 1WD8A 1LK3H 2EXYC 5D7LA 1FNGA 1CDBA 2CBPA 1A22B 3MV7D 4JY4A 5F6HJ 3C5ZB 4DOHE 4P57A 1EHKB 2YS4A 3L3JA 3UYPB 3D18A 3HE7C 1MVUB 4MZRA 4LCIH 3VH8B 1J48A 1H8NA 1LK2A 3N85L 1IE4A 4HLJA 3N1QC 3R19A 4XXWC 1E4XL 2VITA 2LOEA 3RVVC 5I26A 3UAJA 3WJJA 3FB5A 4NQED 1WWBX 1H3GA 2CUIA 3FSOA 3IWUA 3RGBA 3S3BB 5IQOA 4XO8A 1MCQA 3OJVC 2Z8RA 1BJ1H 4PU2A 3SZKC 2IDUA 4N2IA 4YK4B 1G9EA 2X6BA 1DVFC 4HUMB 5L6YL 1J8HD 3CXDL 3CN1A 3P69A 1YYMH 1XV8A 4X4XB 4WUKH 3LMJL 4BH7A 3GINA 4V33A 3IWVA 2RA1A 5FYKU 4D0CB 5L2KB 4OFDA 2B1AH 3FHAA 4XO3A 5DHVA 1H3PL 1GTFA 5DEGB 4Z7NE 4JRFA 7PAZA 5AVUB 5EDSA 5CGYC 1A6ZB 4AGQA 4X98B 1UJ3A 1A02N 1U8IB 1ZJAA 2Z91A 1JPSL 5EIVA 1AD9A 2IWEA 5KBNC 4JGJA 1RSFA 2ITCA 4QHNB 4N2EA 2HB0A 5K69A 2O6CA 2XWZA 4PLNC 4IKNA 5D2NC 3NSDA 5EEYA 4PGZA 1NC4D 1HKLL 3VFPA 2XTSA 4PRHD 1H15A 3T9WA 3B9KA 2EDYA 4JQXA 3QUZB 1KB3A 2OCFD 2XFXB 2VTFA 3U7YH 1OGSA 2A6IB 2Q2LA 2IDQA 4BFEA 3C6LD 4H26B 2CWRA 1L7IL 1EAOA 5ICUA 2H0JA 1ZLSH 4XCYA 3QUYB 5J56B 3CMOH 3CV5A 4NM4H 2ZWNA 2H41A 2PABA 4B9GA 5LNGA 1JTTA 4AVKA 3ARQA 3VW3L 1AQDA 1EJ8A 1MZYA 1PQZB 1R3JA 1XGTB 1GR7A 2E7BA 3NEXA 2P24B 4JM2C 4EDXB 4G80A 2E9BA 4Q6YA 5IZ7A 3EGDB 3PAVA 3FONB 4ZUUB 4FI8A 2DIEA 2IVFC 1KY7A 4GAAA 2JJSA 2FEDC 4HUWA 4XNDA 5JTWA 2DM3A 3MGAA 4P06A 4KZEL 2W9DH 2ESVD 4LVNB 3G04A 3FQUB 3LN9A 4BZ1L 5B38G 4UQIM 4NIKB 5M95B 4A2LA 4MJHA 2CCLA 3IDYC 1VGKB 1JXFA 2VM9A 2R1YB 3ATAA 4JFOB 4PJ5D 1EANA 5JHBA 1QBLH 4L3EE 3EYFA 1R5WA 3VMNA 1UQSA 3PPSA 4G6FB 4W9LC 1GGYA 2FJHB 2XG5A 3T77A 3GMMB 1E9OA 3SB3A 2IV9A 4ABUA 4U6HA 3SDCB 4ZX4A 1MCIA 2VZ3A 4M6NL 2MQ3A 1LEGA 5C0EB 4MQ7B 4F57L 2DW5A 3H55A 1BX2A 2W60B 4AQAA 2Y2TA 3CUPA 2EIMB 5C09B 3NCEB 3SDAB 3WFZA 3TBVA 2BSED 3ULUH 2VE6A 3VNZA 3LS4H 2CJUL 4XCCL 2HCZX 4NUGL 4UQAA 1RSYA 2A0LC 2D4FA 1WISA 3PXJA 1JNLH 3LNIA 4GQZA 4H4NA 2XFGB 1YECL 3GMPB 2Z0BA 1RJYA 3N5AA 4V2BA 1PJ9A 2YEQA 4XAKD 1JPST 2E7DA 3DECA 3LKQA 4P2RB 4OLZH 1IGFH 4HSAC 4P05A 3OG4B 3ULSA 5DUPL 3D12B 2UXTA 4N24A 3RPKA 2F9BT 1QNIA 4V1DA 4ALAL 5SX4H 1JGIA 3TX4A 4BYHA 5F0MB 2WIMA 1IKFH 2C1PA 3L4CA 3HBQA 1ZS8B 2CGYA 1IJNA 2V33A 3ARBC 2WXJA 4GP4B 3EYSH 2WZPD 1S5IH 3CFEB 4FG0A 1B0IA 1ZVSA 1BQHB 4ELMA 3L3HB 4F2FA 7FABH 2AQ2A 5HDQL 1UT2A 3FB6A 1AQMA 3QDGA 2WNGA 4PIBA 4UOZA 3WHXA 1JTPA 4LAQH 2OXHB 2CRYA 3F04A 4FQ2L 2H32H 3WIFB 3SGKC 5SX5H 2LVEA 4NQEB 3QISA 1MFAL 2X9WA 2JSFA 2PR9A 3C5ZA 3AM8A 5KAQG 2Y7LA 3UYPA 3MLSL 5KJRL 1MVUA 1GKEA 5HDBE 2EDTA 1A3RL 1DSFL 1QD0A 3NCBB 1J8HB 4ODSL 3MFGB 1FE8L 4AYFB 1K2DB 2CBMA 3PJSB 1JHLL 3NK3A 1ZGLB 4IM8A 3V7MA 4BRJA 1TCMA 1BLNB 1CFSB 2XY2A 2UY6B 1IBDA 1EVUA 4NPJA 1ZEAL 1D9KD 1LD9B 1MHCB 1I8KB 2H3NB 3MJ9L 3SJVD 1U2CA 3SYPA 1YMMD 5JORB 1UD6A 3BFQG 3HG1E 4HWUA 4RRPG 4B5ZA 3TIDB 2YAPA 5ISZD 4X4XA 4UOQA 3BRGC 1NGWB 4JVWA 4APXB 4D0CA 4MYPA 1JK9B 4OCYH 4PR5B 3BKMH 15C8H 2FH6A 4HUUB 4EOWL 3QDME 1F2QA 1WTLA 1NC4B 3FCGA 5DEGA 1E4JA 4J3SA 5EFIB 2HG5B 2RB8A 1A6ZA 4KDTA 3TNMB 4X98A 2NUPB 3QRGH 5FO9B 1U8IA 1R6VA 2C26A 1JK8B 3KZ8A 1JVOA 4QHNA 1SXAA 4L5FL 1FSKC 1HEHC 1V7NH 2OAAA 1X5FA 3B9EA 4KI5F 1GRWA 4PJDF 1YHPA 2ZKMX 1UD5A 3BIAX 4M7KL 4ZSOE 2H2SD 1JNJA 5F7UA 4DKFH 4N2OA 2XFXA 4CKVX 2A6IA 4HFUL 1U8PA 3NIGF 1ZV9A 1I82A 4H26A 4HJJL 5E2TH 5F93C 5IBTH 1E9QB 3QUYA 2VDOB 3PLYA 2JQMA 2J6EA 5CSZB 5J11C 2DQCL 2BIMA 4PHZA 1PQZA 1XGTA 1ASPA 3BT2H 4ADIA 2P24A 1IAMA 3KHOA 4PJ7B 5E70A 1ROCA 4M5SA 1UWGH 4PJ5B 4PREB 5ITBH 3UTSB 3IBOA 3FONA 4ZUUA 4M6ML 3RVWD 4IDJL 3MV01 1GZQB 4P2YA 2AK1L 3DC0A 2PPFA 1Q38A 2D03L 3FQUA 2DWSA 4IBYA 2GI7A 1VGKA 3MRQA 1RVFL 4JFOA 2NRDA 1CD9B 4KGJA 3H3PL 2FJHA 4XMLL 2A73B 3O3BB 3GMMA 4LP8A 2Y6SC 4HGWA 5EA0L 4K3GA 4NQVB 3SDCA 1QR4A 3IJ8A 4WJ5B 1TQBB 5K39B 5J06A 1UGNA 1AO7E 4YZFE 5D7SL 2NSMA 5FHBH 5IQ7H 1QQDB 2VDPL 1CFNB 1VF5C 2W60A 5C09A 4XP9L 1UCBL 5HYEA 1WLHA 3OX8B 4DN3H 5J1SC 3HBZA 5J3HD 3HLAB 3DYOA 1K4DB 3QWQB 4YIQB 1FGVH 3D8MA 1R5IB 5C07D 4F7TB 1BWWA 4CBZA 3N3EA 4ZUWB 4JFZH 3VQ2C 2V8MA 4LSTH 4GO6B 4M8QB 4Z5RB 1L7TL 2YMXH 3GLZA 4KTEH 5F7KC 2X05A 2Y2YA 1MXDA 5CP3A 4BKLB 3GMPA 4JK0D 5F96H 2GJPA 5C08B 1URIA 4MXWL 1BFVL 2BNQD 4P2RA 1IT9L 2X2HA 3HPLB 4Q9RH 1KCVH 2VDNL 4GAYB 2DQIH 3OKYA 5IQ9B 4KVCH 4RX4A 5I8CB 4EKJA 2KMWA 4KKQA 4L3CB 2H0PA 3VDAA 2JKTM 5D71L 1TZOA 2WQXA 2BXYA 1IBZA 3KPSB 3L4XA 2JQZA 1HXYB 3RA7L 1ZS8A 3OR6B 4LSUL 5D70H 1KTBA 4OFKA 4OBRA 3CFEA 3QORD 1BQHA 1A6UL 1BQUA 1FH5H 2D3NA 3L3HA 2XACC 1FV1B 4PS8A 4KROB 2E4TA 4FLHA 1MCPL 3GSNH 4OF6A 2NXYD 4GUOA 2QQLH 2R9HD 2X89A 3H0TB 2CR3A 1J1XH 2OXHA 1RERA 3WIFA 1SY6L 1QWHA 5FIEA 1UH4A 1YYLH 4NQEA 3DNKA 1I85C 3NA9H 4BDVB 4OF5A 5IB1B 1JF1B 1GYVA 3RIFK 3SJVB 4TULH 1YMMB 3GSOB 4NENB 1J8HA 4AYFA 1NINA 1K2DA 3PJSA 2X5PA 3BAIA 4G7RB 5CJQL 5DZOA 5I1EL 5ISZB 1ZGLA 2YK1H 4DGUA 3Q05A 2IBBA 3MJ8B 1BLNA 1MFMA 1NFDB 2UY6A 3O8XC 2F1EA 2ZXEB 4IQHA 5L2JB 3IJYB 1YEWA 1LD9A 1MHCA 1MF2L 4KPHL 4G6AD 1L9RA 1I8KA 2H3NA 1QHPA 3FT4B 5JORA 4YSQA 5E03A 3OMZA 4QCIB 2YXWA 3TIDA 4WEUD 1URZA 2LTQB 1KYUA 1RZ7H 5A16B 4ODBD 3TZVD 4GSDL 1IC5H 4JM2F 4XN2A 1NGWA 4APXA 4MD4B 1JK9A 4PR5A 3WNKA 4HUUA 2ZUUA 2DS4A 1NC4A 1CDCA 1R34A 4JUTA 3VJ6B 2X10A 5G4OA 2QSQA 2HG5A 4U6VH 5EFIA 4OV5B 3TNMA 1NBVL 3GHEH 3NTCH 2NZ1A 3EYVB 2NUPA 3M1CA 1DL7H 5FO9A 3QDJA 3D0AA 4RISH 3UZVB 4K3EH 5DD3L 5DUJA 4ZFZB 2X4UA 1JK8A 4LGRB 1RD6A 2O5XL 4Z7NF 2XZCH 1MRDL 2NY4C 3B2PA 4FMKA 4XRCB 4CBPA 2RJMA 4K3DL 4P2AA 1LTXA 5D4JA 3GSQB 1E8XA 1HI6B 2VLME 3HN8A 2YQ2A 4LSSH 3SHSA 3WG7B 2XIDA 5KBLA 1DBKH 4HEMA 1E9QA 1UFUA 3UAFA 3VGBA 4PY7B 4JRXE 1DQQB 3QCVL 4A67A 5DD1L 1DCLA 1ZGLM 5CSZA 3O6LL 3W11D 3DA0A 4BFGA 5KVEL 3QEGH 2EP6A 4PJ7A 4TQPA 5TDNB 2LGNA 5CEZL 4WWPA 1YC8A 3FH8A 4PREA 1BF5A 4OIIH 4NNXB 3ZHKA 5I1KL 1CF8L 4JPKH 1WBXB 3WXVH 1KCWA 3UTSA 3KXFE 2ARWA 2YD7A 1AH1A 4AQ8A 4U3HA 3V52H 3N9GH 1PDKB 4L5FE 3DO7B 3L9YA 3QIUC 5F3HB 1GZQA 5KYXB 1CLVA 1HL4A 4QWWC 5E51A 1AYRA 1KTDB 2BS8A 3A5VA 1N7MH 3Q2NA 1Y07A 4JHAH 2KQMA 2Y7OA 4KRMB 2H2PD 1G9MC 2BO0A 3WFBL 4ZZKA 2JIXA 3RGVD 2NYYC 3I02B 2FSEB 1URLA 5DZAA 2A73A 3IMBA 3O3BA 3UBXI 1REIA 4NQVA 5BVPH 4P2CG 1OL0A 3Q0HA 2JKJA 4WJ5A 1P5UB 4J3VA 3VWJC 5K39A 1XF1A 4PS4L 2NX5E 1QQDA 1R9FA 3D08A 3V5KB 1CFNA 2KZ1B 1CD8A 2HUEA 3EF7A 2BNQB 3IDIB 1JNHB 4AIEA 3D52A 3OX8A 5JW4Q 2WAHA 1IC0A 2Y07L 2WKOA 3HLAA 4FTVE 2LU5A 4MD5B 4UBDD 4YIQA 1R5IA 5EBLB 4M4PA 2AJVH 3IDGA 1IJ9A 4HIEB 3O2DL 4ZUWA 4M8QA 4QRSB 4Z5RA 4JM4H 4NNYA 5CCKH 3OR7B 1IO4C 5B7EA 4BKLA 1HXMA 3IS0X 1GSMA 3LQZB 1IM9D 1E8ZA 2C4XA 4Z77A 5C08A 4K3JL 4O58H 2ARJB 2KT6A 4PTUB 3SPHA 3A4EA 4WU5B 3JXAA 4YXKL 2W5PA 3HPLA 2CHDA 5AW7B 4GAYA 5I8OH 1AJ7L 1A6VH 2EC9U 5IQ9A 3MLZL 1EHNA 5I8CA 4W4NA 4L3CA 3VXUE 4LIQL 5A6MA 3F5WB 4TMPA 3EH4B 3E8UH 3KPSA 1XGYH 4BSVB 4OZ4B 1JYNA 4TTGA 1WHPA 4GG6B 1HXYA 5DS8B 1U3YA 2PLTA 1OXYA 3OR6A 1J5IA 4Y5YC 1IC7L 1NCIA 1RURL 3FQXB 1G6RH 1V5JA 4JKLA 1PKQE 1PF3A 1HCVA 4UIKL 5FYKH 1FV1A 5IBUB 3GHPA 4XPAH 4AYEC 3K6IA 3NK4A 1HH6B 3DIFB 3H0TA 1M7IB 4HMEA 3BO8B 1FFTB 1HAUA 1YY9C 5E6UB 2GEEA 3FF7A 1IGTB 4L4TD 4FL4B 4MAUH 4BDVA 4PP2B 3L81A 5IB1A 3ZKQD 1LILA 4LOFA 3SJVA 5CP7A 3RKDD 1U58B 1EEUA 1IIKA 4NENA 5AZEH 3W38A 2CHZA 1M6OB 4XC1L 1MIEH 1UWEL 2GI0A 3L2MA 1GXEA 3WL9B 5ISZA 4I5BB 5CUSL 3BQUD 3TZVB 3QJRB 4M8VA 5C0AB 3MJ8A 1NFDA 1WICA 2WUCL 5L2JA 3IJYA 1N5YL 5FGCE 5CR1A 4KKCC 5FW8A 1ZVHA 5CCHE 4DEWA 1KCSL 2LAGB 4Y16C 3FT4A 1KBGH 2UXGA 4G6JL 4QCIA 3SYAA 2WCGA 3ZGHA 4P46B 4PD4J 1VADB 3DJ9A 4WFEE 5A16A 3ILPA 2CG9X 3SGEH 4JQVA 5IVZA 4GQQA 2H6UA 4MD4A 1D5RA 2F6AA 3BUQA 5T1JA 3OHXB 5DQDL 4ZX6A 1R47A 2GBUA 4OV5A 4UT9L 4PEEA 2ZUSA 3EYVA 4OGQC 5ABAA 1J5OH 4ZFZA 4FQLH 1IBGL 5EUOB 2FWSA 4UTAL 2ZCZA 1PY9A 3JVFC 3LXUX 1TQCB 4B9KC 1A14H 3BISA 3DLQR 5IFAL 4A7GF 5KVFL 2OTUB 5CSBA 4XRCA 2C9RA 3QIWB 4OCSH 3ILDA 1MFCL 1DBML 2XOTA 5D7IB 3GSQA 4UQBA 4MA1C 1HI6A 2FJUB 2IANE 3MRIB 4A39A 4N2MA 1MCEA 3D0VB 3QHFH 1U8MA 5J12B 1OSYA 3DYPA 4UMSA 4M7JH 5AB1A 4PY7A 4WJG3 4YPGB 5C7ZA 1DQQA 2BY3A 3B8YA 1LO0L 3QWRD 4NQQA 5HY9A 5GRJL 2I9LA 3B8SA 5EZOL 4XH2B 3P30H 4UTBH 5TDNA 1HQRB 3GSRB 1A5FL 4N2KA 5C0IB 2VDKL 5IB5B 5E1IA 4NNXA 4FI7A 1WBXA 3QEHB 1KENH 1PDKA 3DO7A 2WC7A 5F3HA 4GMTH 3WKMH 2XBDA 1KTDA 1GOHA 2Q3AA 1CDJA 4IOFD 3ROOB 1EJOH 3ZSTA 2B14A 2HLFC 2ZXCA 1SEQL 1YQVH 1X6LA 4NQUA 5E23A 2RFXA 2GSIB 3I02A 3ZT5A 2WOYA 2FSEA 1SHXA 3I74A 1BMGA 3DROB 1L9NA 4DEPC 5KYNA 5JDSB 4ZFOL 1P5UA 4P5SA 1YYML 4J3UA 4A6YA 3BJLA 1IM9B 4UT7H 3B7TA 1KGJA 3B83A 3V5KA 2P49B 2BNQA 4JFSA 3IDIA 4U1NB 5ILTH 2XX0A 3GSXB 4MD5A 5E2UH 4JFED 3HG3A 4HIEA 4X5PA 2CR0A 5L4FA 2CLVB 4QRSA 2PKDA 2YWZA 3MCLH 3OR7A 4XMWA 3VI4B 2FATH 4PJAF 1LLAA 3UJIH 3LQZA 4BXSV 3PJLA 2FDBP 1M2OA 1T0MB 1T66C 2ICWI 2ARJA 4NT6B 4I4WB 4EN3B 4PTUA 4WU5A 2BZ7A 3NCCB 4J3BA 5A2JH 3FT9A 4O02B 1LP9B 4UWQB 4BELD 2OFQA 2WVTA 3KBFA 5D7JC 3F5WA 3LZFH 3LHPH 4GRMA 5HI3C 2YQGA 4JZNB 4BSVA 2TRHA 4OZ4A 2YGQA 1PX3A 3IMSA 5DS8A 1F18A 3TP4A 3WENA 1ZIAA 3CZNA 4WZ9A 3CMOL 4NM4L 5IHHA 4HF5L 3FQXA 1WQVT 1Z3GL 2JJTA 4FNUA 2NY1C 4QJ5B 2F58H 3QRBA 1T21B 5EWIH 1GY1A 4PJ8B 1HH6A 1OGAE 2G0LA 1M7IA 3DIFA 4GO9A 3BO8A 5B38B 5HJBA 1DJGA 2Y7QB 1IGTA 2X40A 1BXUA 3WHE0 4PP2A 1S9WB 2YQ3A 5GRVK 2W9DL 1MOEA 4POYA 4RAUB 1CLYH 1U58A 5GZOC 1BSIA 1GCYA 2XIBA 2QFPA 1TLKA 1M6OA 1E5CA 2R56H 4TF4A 4YO0B 1QBLL 4K0OA 3WL9A 4Q7DA 4I5BA 5C0AA 4RAVB 2CM6A 3C6SB 4LIQE 5T3ZE 3QQ4B 2X6MA 1JN6B 3D25B 1G9NH 3II3A 5GS1B 3GTNA 3PREA 4NCC2 1YN7B 2Q76B 2AQPA 4KNSA 3V0JA 1NWPA 4PW9A 4DP5X 2VDRB 3QNYB 1OV8A 4ZS6D 4GSUA 4P46A 3QEUB 1VADA 4W9GC 1N0LB 4HS8L 3ULUL 3LS4L 1R4XA 4C57C 4POZC 3O3AB 5DJZB 1A9VA 5JIPA 2PPDA 3OHXA 4NGHL 3L48A 2YXMA 2WWNA 1JNLL 4D94A 1HOCB 4WW2C 5KOMC 3X13B 1TCRB 1FGNL 2NY2D 5EU7E 3PUUA 4AV0A 3PWPE 1BJ1J 4QJ3B 5E94B 2QVIA 4KO5A 1Z66A 2X3CA 5LQBH 3S2CA 2GPZA 2OTUA 3PHQB 3QIWA 4WI2A 2GY5A 4JG1H 4JDVB 1IILE 4PJHB 5D7IA 3HS9A 4HEPA 3F83A 4CMHC 1IKFL 3MRIA 1RK0B 2ENYA 3EDJA 1TIUA 5AW8B 4ZS7L 3D0VA 3JV5A 1MWAH 3UTQB 5MEOB 1S5IL 3HZVB 2YAEA 4RMTA 4D0DA 4HU8A 3OAYK 4YPGA 1VDGA 4HIQA 2QVFB 3QPKA 3V4PB 3TESA 3MLVH 4G8IB 3HEIB 3V0DA 3W39B 2WTOA 3FO0H 4XH2A 4OQ1A 1HQRA 3GSRA 2JWYA 4FXLA 5C0IA 4H0GA 2FQGA 5IB5A 4RDBA 1JZ2A 5CWSB 4F8LA 3F6JA 4JFXA 4NP9A 3QEHA 3X1NA 2YJLA 3NSJA 2EDNA 2G2PA 4J27A 2J1YA 5E5MB 3WMSA 4XPFH 1U8LB 1NMBH 2N7AA 3K81A 4M00A 5KVFE 6CGTA 5BW7C 5DLMH 3ROOA 3ZSSA 1BGXH 3VXOA 1BQ5A 2DLHA 5FYJL 5H37H 3QAZB 1E65A 3CTTA 4YBQC 3EG9B 1ZY9A 3WDJA 1TKWB 3O4LB 3DROA 4FC3E 4NBXB 1TJXA 1VJSA 4OJFH 2FQFA 4QHPA 3VD7A 5ADPL 1OPGH 4C4BA 4QRRD 4Z7UE 5F0PB 4Y19D 2JXMB 1XSIA 5AYTA 4PS7A 4TSAH 4OCYL 5CZXD 2QADC 1V3KA 3BKML 3H1ZA 3HNVL 4NUJB 4U1NA 3B3IB 3GSXA 5GS2H 1UATA 3DETC 5TPWH 1KCKA 2CLVA 1E3FA 4P0DA 1NM4A 5HPMB 3QRGL 2VL4A 3S2AA 2MPVA 4JO4H 1CFQB 2V5TA 3VI4A 2BIIA 4JY5H 2FEEI 4WI0A 2O6PA 4XVSL 1BLIA 5HTSA 4OH2A 1T0MA 4JO3L 2VXSH 2XSKA 4NT6A 1WAAA 3LCYA 4I4WA 4Y4HC 5F9WC 4EN3A 2A1WH 5GGVL 3NJHA 3AQYA 3HMWH 1FG2B 4JB9H 1DJXA 1JZGA 1FPTL 4S10A 4O02A 3FHQA 1LP9A 4AMKH 4P4RA 4DKFL 4HD5A 5DYOB 4JRYD 3L54A 1MFBL 5E2TL 2R69A 2XWRA 2XWDA 4HK0B 4JZNA 4KC3B 5IBTL 4F9LA 3IRPX 3JQOB 1G0YR 1WFJA 2VYRE 1BAGA 4HSCX 4XO4A 1ZK5A 1T21A 5F7YC 1UWGL 2A9CA 3MJ6A 3ZHLA 1KFAH 2OMWB 4PJ8A 1HNGA 5F7DB 4PRPD 5B38A 1U8JB 3EOTH 3GSUB 3AQZA 1ZJBA 2D73A 2Y7QA 3S5YA 1A4KB 1E4XI 2H9GB 5JZ7C 4UDTB 4XI5C 1S9WA 5KYUB 1CDHA 1EZLA 4RAUA 1K8IB 1ZTMA 2BX5A 1WFIA 1TYRA 2JKWA 3QIBB 1F4HA 4R7XA 5DEZA 1SLUA 9PCYA 4HIHA 1FFPB 3FU7B 3I6KB 2XWEA 4RAVA 2XN9D 2FECL 1NKOA 3C6SA 3D39E 3FO9B 3OPZH 3QQ4A 1JN6A 3D25A 1F4YH 5GS1A 3UYOD 4RSVA 1CC3A 2W92A 3ULVD 4QTHB 2GJZB 2KS0A 3E80A 1A47A 3THML 2Q76A 1KBVA 2O61B 5IQ7L 2NY2B 1OSPL 1PNCA 3BCDA 1JGVH 3QNYA 3TH2T 4Y9EA 3QEUA 2CQVA 5DMIL 5CLXA 4DN3L 5HYSB 3M1BA 5AVZB 3UBXG 3WNNA 2WQSA 1CG9B 1V3LA 4JZJB 3RZWA 1AZRA 4U3CA 3O3AA 1BG9A 1J8RA 2FO4B 5DJZA 4Z7OB 4JFZL 3KLQA 4KU1A 4LSTL 3DGDA 2EVIA 3P9LB 3KBPA 3VXPB 2NY0C 2YMXL 4KTEL 3POCA 1HOCA 3FTGB 4S0SD 3HB3D 3X13A 1TCRA 3KVDD 3KE0A 3OF6A 5SWZD 5E94A 4FG6C 4NFBA 3LRLA 4ONGL 3PUCA 3MRKB 3BSHA 3BVNB 5ABDE 1P7KB 4Q9RL 4GPVA 1KCVL 3PHQA 4WQOA 5EC1B 2EICA 4JDVA 4I3RH 1YPZE 4PJHA 3SO3C 4XNXL 1T89C 4M56A 3BGFC 1NZRA 1RK0A 3MLRH 3DK2A 4JBSA 4XB8A 5L8LB 1OHQA 3UTQA 1XEUA 3N43F 2W0PA 4LEOB 5D70L 3NJLA 4ZUVB 5MEOA 3HZVA 4X5LA 3BDYH 3C60C 3V4PA 2JI3A 4AH2B 2CK0H 1F1AA 3P02A 1JFQH 2GJ6E 4KGLA 4F5CE 1J1XL 5CZRA 4KJPD 5TF0A 3BH4A 3EHBB 4PLKC 4M7LH 1I7RB 5F0LB 3VXRE 5HHME 2PTUA 2X44D 4TULL 5E5MA 5IJVB 1U8LA 2PCYA 1S9XB 3DSFH 5C70A 2EVJA 5C9KA 4LVHB 4QRRB 3UC0L 1A6TB 4ENEC 1AY1H 3NSXA 1I3GH 2J4WH 1G84A 4FYQA 4J5VA 1Q1JH 3EG9A 4RRPA 4S11A 4KKLD 2ALWA 5KJ4A 1RIHL 1TKWA 1GIGL 3O4LA 3HS0A 4JFDE 3MGOB 1L0YA 3IAQA 1SDYA 1IX2A 3KJ4B 4PJIB 1ZLUK 2JXMA 3HNTH 3QWOB 5FLVA 1FI8C 3RI5K 1IC5L 3JWNE 4EI5B 3FK3A 3MRCB 5DO2C 4C59B 3B34A 2HRPL 1DEEB 4H2CA 3NIDE 3B3IA 1ESOA 2AGJH 1WA0X 1VHPA 4U6VL 1KV3A 3VXSE 5FDYA 1FAIH 3GHEL 5MI0C 3NTCL 1HEZA 3D2TA 3RVUD 4RISL 4K3EL 4JL2A 4OJYA 1CDIA 1CFQA 1TJHH 3U2SB 3ZTJG 2BWIA 3FT3B 5JDJA 4X50A 1FVDB 4MJIB 3VTMA 1OGTB 5FYJE 3RWIB 2CM5A 5F8RC 2XZCL 2KZKA 3IKKA 4P23C 1D6EB 1TTAA 2L7EA 4OLXH 5CN1A 5IROC 3P73B 4UINL 4ODHL 5DYOA 4LSSL 3DJRA 2H1PH 3WS6A 4M1DH 3GM0A 4PRPB 4M43H 1DBKL 4QXTB 3ZT6A 4HK0A 3TPKA 5I1IL 5D5MF 4U0RC 4N4YB 5CINL 5D1XE 1IC1A 1UJTA 4ABQA 1MCWM 2N01B 2XG4B 3CK0H 5D7LE 4HJEA 3A67L 3K0YA 1F8TH 4RRPM 4PJXB 2DQDH 1JS4A 3HN3A 5EO1B 4M5ZL 2OMWA 4JPKL 3WXVL 2JQAA 1HN1A 3D6GA 4RH4A 1SOSA 3L4WA 3ZPDA 1U8JA 2B3RA 3V52L 4WW2F 3GSUA 3N9GL 1Z1WA 4P5MB 4DGVH 1U3HC 2H9GA 3D0LA 3JWNC 5ANME 5TTRA 1GSKA 3CHRA 5KYUA 3WO4B 4DP8X 1N7ML 1K8IA 3ARGB 4OQTA 4LDCA 2IMMA 2DMGA 3HHSB 3ABZA 3QIBA 5I75B 2AF2A 3A23A 1FFPA 4BGDA 2MWCA 3FU7A 3I6KA 5AD0B 4W9HC 3FO9A 4X4YB 2DKMA 2VNCA 3LEYH 4HH9B 4J12A 2P45B 4MRCA 4QTHA 1EGJH 2AXFB 2GJZA 2V2WB 3BZDA 1AGBB 3GKZA 4R83A 4BA0A 3HB3B 1DDHB 2O61A 1MCBA 2ZXDA 4YHYB 5SWZB 1ORQA 2ZYHA 5HI4C 3MJGX 5CM1A 2D2OA 3D33A 4IRZA 4K55A 4Q9CA 5HYSA 4DP6X 1CG9A 4JZJA 4JR9L 2FO4A 2OMXB 3NJXA 4LL4A 3P9LA 1Q90A 4CA4A 2PWHA 2OW7A 5D1XC 3VXPA 5CCKL 3GMQB 3G6AA 4HKZB 1CS6A 1OD9A 2CJ3A 1A7PH 3OZLA 4EVNB 4F33B 4KKZA 4X6CB 3MRKA 3U0TB 3BVNA 4YDZA 1SVBA 3A6BH 1P7KA 3X3GH 3HG5A 1VENA 2X4SB 4N0YH 4OCMC 5I8OL 5EC1A 1A6VL 4D8PB 5IP4A 3AAZB 4XCEB 3BOVA 1KULA 1OAQH 4N8VG 3REVB 2X6CA 5F6IB 3E8UL 5JO5B 1SXZA 3IFNH 5HYJD 2QELA 4QRQB 3UAJC 4XBPB 3K3QA 2VZVA 4LEOA 3TF4A 3K2UH 1WIOA 1SYVB 4ZUVA 1G6RL 2AI0H 4QXUH 5C0CD 4UAHA 4OLYH 1H6TA 4XMXA 4AH2A 3NT0A 3SEPA 1DZBA 4IU2B 4QRTB 5DJAB 1RJZB 1KB5L 1NFAA 1TOXA 4JG9A 3SE6A 2XU9A 4RIRA 4I77H 1YEHH 1SMAA 1L3NA 5E9DE 3OHMB 1I7RA 4MAUL 3QCTL 1W72H 4KOCA 5IJVA 1V3MA 3X1EA 1S9XA 1J9RA 1CDGA 1UJ3C 1MIEL 3ARYA 4QRRA 4KDVA 3FTZA 1A6TA 1C9SA 1SOXA 2O4EA 4X6BB 4ETQB 4G2AA 3GXUB 4JPQA 3BWSA 4OIBA 3KWWB 2BNRB 2B16A 3NFNB 1UA3A 3VXMA 4NKQB 2VXQL 4CC4A 2BIQA 4PCSA 4A37A 2ZKXA 3MGOA 3EYQC 3B9KC 4IRSB 3RFZB 3FTUA 4PJIA 4X42A 2PXYB 2E9GA 3P4NB 3KWTA 3QWOA 4FYRA 3QFJD 1ES0B 3WEAA 4JFWA 4EI5A 3MRCA 2B20A 3ML9A 4NHCL 2VM3A 1DEEA 3ECQA 3N44F 4RAHA 1YNKH 7PCYA 4Z7UF 1FO0B 3NYKA 4NB7A 2D7PA 4P04A 4O00A 1KTRL 3KLKA 5GHWL 1LHZA 4TUUA 4BH8B 2ATPB 4YC2B 3A4AA 4AQ1C 3FT3A 1KDIA 7FABL 1FVDA 1D5IH 4MJIA 3TO4C 1OGTA 2VABB 3UYRH 4ODVH 4WU7B 3S5ZA 1BP3B 3RWIA 5T3XD 3ZE2B 2JJSC 4V1DE 3ZX1A 2VQTA 1G0DA 4OCSL 1D6EA 4XPHH 2HFGL 4ES8A 1NGXB 3P73A 4YQXL 3AWFA 4WHYH 4ACPA 3CFQA 5GJTH 4OF7A 1BG1A 1S78D 4JLRB 2XY1A 4UQ9A 1AGFB 4PRPA 4ELME 4QXTA 5EZPA 5B1JC 1PZ5A 1RP9A 3RTQD 4FADA 2BZCA 2QMJA 5DJ2B 2R0WH 1CLCA 3QDGE 3OXRB 5AL8A 3LPWA 4KK5C 2XG4A 4B27A 4F7KA 1IAOA 4FHBD 3P30L 4UTBL 3F85A 4MHHI 4PJXA 4MXQC 3CVHL 5EO1A 2WVUA 1S9VB 3S98A 2WJ5A 2I32A 3T0ED 3WLBB 3NPSB 1IEAB 1UUSA 4HWBL 2O26U 4P5MA 5IR1B 1QSVA 3I85A 4IRJC 4MXVE 5LGHL 2R4SL 5B21A 4ABVA 4GMTL 4PUBH 2FWUA 4MB5A 1EJOL 3ARGA 2MQ0A 1MFDH 4YHKH 3T3ME 4JHWL 1YQVL 2VC2H 3B56A 3T3PF 1GOFA 3A0OA 1VSCA 2YAHA 1OOAA 3SD2A 4NZTH 5AD0A 1EEQA 5JIHA 4DP1X 2WXOA 3LIZA 4X4YA 4G83A 4MSWB 4HH9A 3MUHL 3ARED 2DBLH 3CLEH 3QJOA 4G70B 2AXFA 2HXAA 2V2WA 1AGBA 4UT6A 2GJJA 5L2KE 4XOCA 1DDHA 3T2LA 1ZA3B 1GJIA 2G4GA 1AC6A 3J8F7 4FA8A 5IHUH 2Y1YA 4ZBJA 4LSRL 5D2LE 4NP4L 1FNLA 1C5BH 4IBTA 3PAYA 5E2UL 2ZAGA 3O2VL 3V0AC 3PWLB 5A6IA 2OMXA 2UZXB 1P84J 6PCYA 4QO1B 1UD8A 1B2WH 4OLVL 4ZW3A 4OF3A 2F8OA 1MY7A 4HLZH 3UJIL 4HKZA 5DO8A 4WDIB 5GRUH 4EVNA 2AAVA 3AZUA 1EBPA 3C5ZC 3AM8C 5C0CB 4X6CA 5T5NF 1KJ2L 5IVXB 2RR3A 3U0TA 5JIQA 2FE0A 5EF1A 2B1HL 3FFOA 2X4SA 3Q8EA 1CVSC 4D8PA 5FYLH 3AAZA 4XCEA 2WXGA 4FNQA 4HIXH 3REVA 1MNUH 5JO5A 3MJ7B 4R4NC 4H44C 4QRQA 4XBPA 3IXAB 1SYVA 1TMCB 3DK0A 3SE9H 5CJXA 4P4KD 4M4RB 4YK4C 4RMRA 1RL1A 2KLTA 1TJGL 4IU2A 4QRTA 1NM9A 5DJAA 1RJZA 2CKBH 3R4RA 2OZ4A 3PHSA 4RGMB 5IOPB 2HT4C 4YSRA 5E2WH 4CN1A 1W8OA 5I23A 2KLRA 2G9HB 3JWDH 3M88A 4Y7OC 3T2NL 4LASL 1LWJA 3ESPA 5EF0A 2VUYA 2V2XB 2DOCA 1DJZA 1UM5H 5EIQA 2IDFA 5DMJB 1RUPH 3LNFA 4KDTC 5BXFB 4TQ8A 2IALB 2R56L 5HHPB 3QFJB 4X6BA 4ETQA 3UXFA 3KPOB 5E9NA 1E4HA 1RPQA 5L7XH 2HRGA 3UBHA 3OM3B 3KWWA 3N91A 2BNRA 5AEAA 3NCJL 3HC4L 2P42B 3MKKA 1EV2E 3U0PB 3ZYOA 3VG9B 3VYNA 2F8XC 4IRSA 1N10A 4RETB 3DO3A 4N2FA 4YDIH 1NGQH 3QUZC 4PVMA 2PXYA 4PW3A 3P4NA 1OCWH 4RDQF 1FFOB 1TLMA 3OWRA 1ES0A 4CAGA 1YNLL 1AXIB 2OPCA 2V9QA 3QUYC 3T6WA 5JHLA 1QBAA 5PCYA 2F54D 3MI6A 2AJXH 3LXAA 3EZJB 1FO0A 3KG5A 1OT1A 4P2RE 1P7HL 1D5ZB 4LGPB 4PB0H 1JWSB 4NWUL 4BH8A 2ATPA 2BHFA 5TJWK 4G7VL 3IJHB 2KDYA 3UJTL 1CDUA 4Y9FA 2WXKA 2VABA 4PS3A 4N5UA 4YE0A 4C54A 5LQBL 3QQNA 4RMQA 1IAKB 1M3IA 2DBJA 2GTZB 1QWUA 1N3NA 4LVNC 2VN4A 4JO5A 2EUWA 5HBBA 1NGXA 2OLDA 4MCYB 3MV7E 1UOKA 2FBRA 3U1QA 2KUTA 1AAJA 1MCJA 3D07A 5E4IA 4J4PD 3N0PB 3RY6A 4JLRA 3T0EB 1AGFA 3MLUH 1KPVB 2WBJD 2PW2B 3JVGC 3R06B 3H2PA 5DJ2A 5T1LD 4AM0B 2VDQB 3MLVL 4S1SL 3OXRA 3SDCC 2AANA 1F90L 1NDMB 1E3XA 4EBQL 3V0EA 4PV9B 5IGXH 4NQEE 4I13B 4ANWA 4IHOB 1S9VA 2G9KA 2FLMA 3SDAC 3WLBA 4GSRA 2Y36H 1IEAA 1U6AH 3WUZA 1J8HE 3MBWB 1A8ZA 3OJMB 5DHVH 1AXSB 2JB5H 3BCFA 5IR1A 2F2HA 1NMBL 2K70A 1B0RB 2C9QA 2DQFB 3NP3A 3S3JA 1JZIA 4Y2DC 5DLML 3Q8CA 1TTBA 3SO5A 1KGCD 3SOBL 1A21A 1O5PA 3SPIA 5IJBC 2V2TB 3KPPB 1KSRA 1RZIB 3Q01A 4ESKA 2Z7UA 2P4AB 4S0TD 1VRSA 5FB8B 5TDPB 1A25A 3WFDH 4DAGL 4MSWA 4FXTA 1OAZH 1G5AA 4OJFL 4AEHH 1OPGL 4UNUA 2CMRH 1JYWA 2P28B 2DKUA 3SDDB 1ZA3A 5B1KA 1Y1DA 3DHPA 4TSAL 4GRWB 3SQBB 1H0DB 5LKNA 1V8HA 1WO2A 2MH4A 4PG9B 4KUZH 3K2MC 4IBWA 1R3LB 1GYAA 2UZXA 3LNGA 3I9AA 4W6XB 5TPWL 1HJBC 2MPAH 4BKTC 4QO1A 4ISVB 4DT2A 4ZMQA 1ZTXH 2VISB 5D4HA 3KGUA 3MXVH 1R24B 3RWCB 4LQFH 4WDIA 1DQTA 2VXSL 2FWLB 3X14B 5C0BD 4X4MA 4D9QD 4L9DA 1JF5A 1UWXK 4K94C 1ETA1 1FVCB 5IVXA 4GYBA 4JB9L 4IBZA 1ZHLB 3VTAA 4L23A 2PTTB 3AWEA 2VR3A 2VUKA 4HEME 4LVOB 4NKDB 4NX0A 2VZSA 1PZ3A 2B5IB 3CZSA 3MJ7A 4OGXH 2VDMB 2ESVE 3HJ0A 3DIVA 5DI8B 3H7BB 3KJ6H 4IW4C 1I3VA 5AOKA 4KNUA 6PAZA 1A7BA 4PJ5E 3R7QA 1B2YA 2C34A 1U41A 3HCVB 3I2CL 4PJBB 1KFAL 1LMIA 3CIQA 4HPYH 5IOPA 3SY0B 4ZQTA 4WI3A 4I18B 4HAKA 4HLEA 2IGTA 5F9JB 5J6HB 2G9HA 3AGWA 3MJWA 1KB9J 5A2LH 4WUUB 4NQCD 2V2XA 3RWHB 3QFDB 3SD5A 3DTXB 3TCTA 2J20A 4M3KB 2CO3A 5BXFA 1OD7A 2IALA 4R5VA 5HHPA 1KTKE 2WCPA 3QFJA 4EUPG 3KPOA 5JHMA 4F8OA 2I24N 2YA1A 3BIBX 4FS0A 1F4YL 3NABH 2YIHA 1A7QL 1SN5A 2F54B 1RZQA 3NQKA 1IC4H 2N3JA 2BIHA 3U0PA 4GW1B 4PLJD 4XNYH 2PCPA 3BW9B 4XAKE 3UBXB 5BMFH 2R8SL 1KLGB 4L2LA 3BSGA 1FC2D 3ZQWA 2GITB 1ACXA 3T1FB 5TQ2H 5AZUA 4M62H 5SV3A 1JCKA 4BJLA 5AALA 4S2SB 5BS0B 3V0WH 5FUOH 4XX1E 1UT9A 1XBDA 4ZO6A 3SYOA 4Y88A 1OO2A 4KUCF 1Y18B 3RDTD 1TJIL 1YEKH 3SKUD 1D5ZA 4AW7A 4L8SA 4BFKA 1S7TA 5MERB 1JWSA 1TFHA 5I16B 2ZIDA 2D7NA 5GGSY 1KIRB 3IJHA 2WBJB 2XZAH 4N2CA 4WO0A 5JOEA 2GIYA 1KIPB 2DEYX 1IAKA 2GTZA 3VX1A 4N2LA 3A6CL 3L3IB 1LGVA 4I3RL 4LPTA 5DJCB 3UG4A 3CG8A 4N8CL 4PM1A 1HINH 4MCYA 3KNBB 4L37B 2WINB 4NZDA 5FK9B 1WS7A 2YPVL 3AC0A 3RVTD 3ISWA 1KPVA 2ED7A 4GFTB 2PW2A 3R06A 4MGXA 4ZW8A 3BDYL 5EHFA 2LW3A 2JLLA 4AM0A 2CK0L 3FFCB 4OGZA 4Y1AA 2JF1A 1JFQL 4ONFH 1TQBC 4L1LA 3REWA 1NDMA 2DWDB 1RUML 4PV9A 4ELMF 2DM2A 4CDGC 3MC0A 4IHOA 4IS6A 4MCZB 3GIZH 3TV8A 4R2GB 1SGKA 4IMKA 3SJVE 5IT2H 1A4CA 4PBXA 2V7HB 1NOAA 1NFIB 1YMME 4WO4D 4HG4J 4GSXA 3MBWA 1AXSA 1T83A 1F58H 1T5WA 5ISZE 3BRFA 1B0RA 2DQFA 1NDGB 4MS6A 4FYSA 4H25B 3FL7A 3Q6GL 3HUJE 3ZGIA 1LO4H 1TETH 2V2TA 1I3GL 2J4WL 1RZIA 3KPPA 4G5ZL 4YHOH 1NANH 4LPWA 4JFPB 1UXSB 5DS2A 2IPTH 3KGTA 2HWZL 2ICCA 4PTTA 4L0YA 4MXVF 3QO1B 4KMQA 5FB8A 3B9AA 4QXGH 4S1RH 5TDPA 3L3OB 1AVAA 5AL0A 1PD0A 4K9JA 4AZUA 3QUMB 5BRZD 3T3MF 1JPFB 3EJZD 1E5ZA 2X1WL 4C56B 1FG9C 3HNTL 2NT1A 2A6JB 4ZRGA 2CPCA 2VR4A 3AXHA 3CFDB 3SDDA 2OQJB 1T2XA 3UP1A 1O6VA 3SQBA 1HEJC 1H0DA 5DUML 4JDEB 4YE4H 3EO9L 2AJSL 2AGJL 4PG9A 3CC1A 1LQBC 2NNXA 1R3LA 2DJUA 3VD0A 2J6EH 4KROC 5HYFA 2OMBA 4ISVA 3QGVA 4B3EA 1F1GA 3WCYA 1YZZA 2VISA 3I3BA 1KCBA 1R24A 2P44B 5SWSB 3K0WA 1IL1B 4OT1H 3RWCA 4CKQA 1JD7A 3X14A 4FHJA 3SODB 2EUVA 2OR8A 2WLZA 1FVCA 3AFLA 5JW4M 1NCAL 5TQ0H 5DZPA 5ERWB 1ZHLA 5AFAA 1PG7W 4QRFA 2PTTA 3T4YB 2JKRM 4BCXA 2NT0A 2X4TB 1COBA 4GI9A 4X7DC 1QW8A 2H1PL 4NKDA 3VMOA 3H53A 1TZAA 3BN9D 2FBOJ 4CGTA 2R83A 5DC2A 5JIKA 3LPPA 1WEJH 1F4AA 2I69A 4X6DB 3PIQB 1YEGH 3L5XL 2G0KA 1U95A 4DVBB 3CK0L 4HZ1A 4WVRA 1HC1A 1WVZA 3HCVA 4DPAX 3TBBA 1S6NA 4PJBA 6FABH 5I66B 1XQ4A 2PWFA 1IVLA 2LTQC 2XVKA 4XAWH 3SY0A 4I18A 2BXZA 4YLQT 4Y5XC 5F9JA 1AGEB 2BERA 5FW7A 1RUAH 2F19L 1M7XA 4Z7VB 3U2IA 3VYOA 4A38A 4WUUA 4AIZB 2Y6TE 3RWHA 2WKGA 4XOEA 3QFDA 3WTYA 3DTXA 3KLHC 4MHHG 3ARRA 4PSPA 3BX7C 1YEFH 2H2SC 4GEJA 2ITFA 5FHAL 4ZUTA 1TZIB 3FJTA 1UC6A 5CP3H 4IGBD 2FWOA 3L45A 2OJZH 3QZMA 2F54A 2EC9T 2A9MH 4FN0A 5F3FA 2OMTB 4IBVA 2OK0H 2EEDA 2UYLB 1YLBB 3K2KA 3F12B 5SV4A 4GW1A 5E6ID 4WI6A 3ZYJA 4O9H