1COBA

Crystal structure solution and refinement of the semisynthetic cobalt substituted bovine erythrocyte enzyme superoxide dismutase at 2.0 angstroms resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure solution and refinement of the semisynthetic cobalt-substituted bovine erythrocyte superoxide dismutase at 2.0 A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
total genus 38
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1992-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1cobA00
1SXBA 1IBHA 4L05A 1PTZA 1CBJA 3T5WA 1XTLA 2SODB 4N3UA 3GTTA 1SRDA 2GBVA 2ZKWA 4OH2A 1CB4A 2NNXA 2VR6A 1E9QA 1OALA 5KBMA 1FUNA 1HL4A 1E9PA 1QUPA 5KBLA 2AF2A 2AEOA 2ZOWA 4BCYA 2JLPA 3GZQA 3F7KA 1BA9A 3MKGA 1B4LA 1SXAA 1IBDA 2APSA 4A7QA 2GBTA 2GBUA 3KBFA 2XJLA 2WWOA 3HOGA 1L3NA 2AQSA 3QQDB 4A7VA 3CQQA 1ESOA 1TO5A 2AQPA 2E47A 4A7TA 3ECVA 1SOSA 3ECUA 1JK9B 4A7GF 1AZVA 1Z9NA 2LU5A 1U3NA 1E9OA 1SXNA 2K4WA 1COBA 1JCVA 2Z7UA 3K91A 1DO5A 1JK9A 2XJKA 1TO4A 1F18A 5KBKA 1N18A 1OEZW 3MNDA 3ECWA 2C9VA 2AQQA 2Z7ZA 1OZTG 1PU0A 2WYTA 1MFMA 4MCNA 2WKOA 3GQFA 2WZ0A 2C9SA 1KMGA 1P1VA 1SXSA 2Z7YA 3QQDA 1IBFA 1S4IA 4N3TA 2VR7A 1BZOA 1PZSA 2AQNA 3CE1A 1F1AA 1N19A 2WKOF 3S0PA 4B3EA 2Q2LA 1OAJA 2WZ6A 2WYZA 3HFFA 2AQRA 1Q0EA 3KH3A 1UXMA 1E9QB 3GZOA 3KBEA 3CQPA 4MCMA 3F7LA 1F1DA 2JCWA 3PU7A 4BD4A 4A7GA 1SPDA 3H2PA 1XSOA 1EQWA 3KM1A 4FF9A 1Z9PA 1IB5A 1UXLA 4A7SA 3H2QA 1SDAB 2R27A 3RE0A 3L9YA 2C9UA 2Z7WA 1B4TA 4BCZA 1YAZA 1YAIA 1SXZA 3SODB 2WWNA 1SXCA 4OJAA 2AQTA 1RK7A 3KM2A 3L9EA 2WZ5A 1XTMA 1E9PB 1HL5A 3KH4A 2V0AA 1IBBA 1OZUA 3GZPA 1F1GA 4U4IA 2E46A 2VR8A 3LTVA 3HW7A 1E9OB 2ZKYA 1SDYA 5CU9A 3GTVA 2ZKXA 4A7UA 1YSOA 1DSWA 1EJ8A
chains in the Genus database with same CATH superfamily
4Z5RA 1CXEA 1PZCA 2YAFA 2HAZA 2JB5L 4IOSA 4S1SH 5DHYB 5KZCD 3RDTB 4H8HA 3LXAA 3VGAB 3WEOA 1QFUL 4ODTL 1U8CA 1A14H 3VTAA 1O9ZA 5C0NC 3QORB 1M9SA 2EE9A 2VXTL 5IB5B 1A7NH 1UWEL 5HGDB 1RH8A 4XVJL 4NZJA 3FQRA 4F2MA 4JREC 3OKYA 1JNNH 3TJHD 3ORJA 4HIEB 1PGRB 4ANWA 2ZUYA 4I9XA 3O2WL 3DVNA 3MJ8B 2E7LC 2N56A 4HFUH 1AAJA 2CKBB 4AV0A 4QY8B 3UBXB 2P8LB 4JK0D 1MJ7L 2LLGA 2PXYA 3HLAB 1VKXA 2ZYIA 1JVOA 1G1KA 1BFOA 5AVXB 3G9VA 4A6YA 5L0QB 4QOKE 3DSNB 4JM2A 4FXKC 5D5ME 1U3JA 1BJ8A 4H44C 1SOSA 4YHML 1OPGH 4NIKB 3AS3A 5LQBH 3CBRA 3V5KA 5F7FA 3RWEA 2ITCA 4U6VH 4ZUVA 4YR6B 1ZVSB 1YMHB 1N18A 3D25A 1ZLEA 1QRKA 3EFFB 4P3CL 5FF6B 4AKQA 1OGAD 5ALCH 2VL4A 3UTTD 2HVBA 3MUGB 1ZA6A 5SWSD 3S88L 5B7MA 1E67A 2WVVB 1ZSHA 4OQTH 2EDQA 1EAPB 3DRQB 3EOTL 4GKSA 3K72A 1JV2B 5CJXC 4YBQD 3VXPB 2GKIA 2WXFA 3QA3B 1I7TB 4XNQB 1QPPA 4JHBA 1L4IA 1P0SE 2FJUB 3UAFA 3CPLA 1ED3A 1NUFA 1W8EA 4E0RB 5C0ND 1BYPA 3CVIH 1WIUA 3RPIB 3IDNB 4JJOA 3ZO9A 2LR4A 3SBPA 1YDPB 4FLQA 4HKBA 1X5YA 4UDTB 2OR9H 4PVNA 2VTFA 3NIGE 1QLRB 1JGIA 2X70B 4X4KA 3RA7H 4BXVA 4DN4L 4IJ3C 4OLVL 3MOBH 4K3EH 3PL6D 4OFYA 4OM0L 2WYHA 3O2WH 4TNVK 1YAZA 1E27A 4FQXD 2C9PA 2CO7B 4MX7B 3IFOA 2H2SC 3WAKA 3CVHH 1KELL 3PPSA 4DGWC 3UPAA 3QQ3A 2AGJL 3QYMA 3HB3B 1DVFD 3SYCA 1WK0A 3V5DB 5IMLA 3ILDA 1LO2H 1TSRA 3EO1A 4GXUM 1K8IA 5KVFH 5D1ZB 1FZOA 4F7MA 2FO1A 1M7DB 2R29A 2R83A 3EGDA 3PNWA 2F18A 2V2TB 1MFEL 4J3SA 1EGJH 1OM3H 3INUH 1D5MB 4KJWD 1CK0H 2BNRB 2V2XB 1TCRB 2IJ0C 4LSQL 4PU2A 1RK1B 4XPAH 1JPST 4LP8A 4MJIA 2DS4A 1RHFA 4BM7A 1CDUA 2BW5A 2LGNA 4ACTA 1R5IA 1IC5L 4OFPA 4F24A 4ZYKA 4HX1B 4F5CA 2JJUA 5KYWA 1YMMD 3U7YL 2ICWA 1T22B 2WQWA 1ZHBB 3QULB 4QOKA 1E6OL 2NXZC 2ZE0A 3TYGL 4F2FA 2FBJH 4F1SA 4CU8A 4PG2C 5I1IL 2A3TA 2G4GA 2V3EA 4GKNB 4FP8L 1MI5D 4N20A 2HPTA 1LO5A 1AXTH 5DFAA 5DFWH 5DRWB 4J3OG 3CDCA 1BQSA 2GIXA 1IIKA 4GQ9H 2QZQA 4K7FB 4ZJ9A 5IF0A 4JFTA 2FATH 1U3NA 3QUYB 1EFXA 1TR7A 4ONOA 1BQLH 3K91A 5DURD 4Y4HB 2HN7B 3QZWG 4CN6A 1TMQA 3KCPB 1T1XB 5KBKA 5TJWK 1XGYL 4HW6A 1UJ3B 1NAMB 5JPMA 1INDL 4UQ2A 3TIDA 1F5WA 5DRNB 2Q20A 2WCSA 5FYJU 1G5AA 1JZJA 3ILPA 5AW4B 2EDRA 2JKSA 1MFAH 4DUWA 1BLNA 1CFQA 2PCFB 2I25N 3QDJD 1I1RA 3EIFA 1J0YA 1ASPA 1VPOL 3H4HA 5FUZL 3TA4D 1CVSC 4DH2A 1NL0H 4QXWA 5DJ0A 2BJMH 2RAMA 3IAGC 1S7WA 3IPBA 3KYAA 4XPHH 3N44F 1IM3B 1T20B 2JKIS 4LOFA 4LSPH 3KPRA 3EH4B 4DP6X 5FFLA 4MAYA 1J1OL 3CBJB 3IBEA 3D4GA 4KI1A 1TPXB 1XSOA 5AZUA 4C56B 2MRYA 1EEZA 1EHAA 1U8HA 4GRWB 2CO1A 4YXHL 2C9UA 3OSVA 3QDJA 5IVXA 2EVFA 4QHNB 4G1MB 3OBAA 3K4DA 1KJVB 2H8PB 2PCYA 3LHPH 4OZFG 2ZX8A 3FO0L 1NCCL 3WN6A 1PX8A 3RWDB 3EOAA 1O6SB 3L9EA 4YJZL 3DO7B 2X4QB 3B6SB 5MEPA 3RWCB 4ZSOA 5FPIA 4X8XA 1L6XA 4ZUVB 2ZG1A 4Z7NB 1IAOA 1UD2A 2AV1A 4PWIA 4XN1A 4H5SB 4LCCC 4PLJD 1EDYA 2WY3B 4ZFQA 3RWEB 5I8CA 4K3JH 3CQFA 3WUWB 3V5KB 1YEKL 1VZHA 1FYTE 5CBAA 1WHPA 1T5KA 2VDLB 3UJJH 2FH6A 2H9GA 5F89A 1NBZA 1LILA 5IZ7A 4M6AA 1FH5H 2Z8RA 4ZFFA 4XCYB 1OGAB 3QZPA 1E3XA 1G7IB 3DX7A 3ROOB 1SRDA 1UZ6F 2XLLA 3ZKMC 2XIDA 1FNEB 3QQXA 3I9PA 2AK4A 3MMEB 2B1HL 1XCTB 3B2XA 1DJIA 4F91B 3IDUA 1TETH 4H1LB 2YUVA 1AI1L 4YL4A 2A4CA 1HHHB 5ABZA 1UB5B 5D7LD 2YBGA 1A8ZA 1XEUA 4CW1A 1MCIA 1A9VA 4H0LC 4DKTA 4LPUA 3UEQA 1AG6A 4MRCA 2UY6B 4JEGB 3GSRA 1INQB 3O6FB 3FN3A 5DO2C 3D51A 1KPVB 4WSGA 1E2ZA 4MA8L 2B0SL 4ZFZA 1J8HA 3HHRB 3ULVF 3HE7C 3MA9L 1Q0XH 3SDDB 4X9YA 5D2NB 2XTJD 4F7CB 3H85A 4PJIF 3BPLC 5JDSA 1QSFE 1PBYA 2DBLH 3D4CA 1WZKA 1ZHKB 1D5ZA 2MPAH 2VZ3A 3FT2B 4NO0A 1JERA 5EB9A 3US1A 2J72A 4JM2F 5E4AA 3HZYB 4I3GA 3VYNA 1J8KA 2I9LB 3K2IA 3QIWA 1U8JA 3G6AB 4LIQH 5EU5A 3UG4A 2V2XA 4MD4A 2HB0A 4BKSC 4JFFD 1MCEA 4WHYG 4AL8L 2HFGH 3CN3A 9PCYA 3BAWA 3PL6A 4O02H 4OFYD 3WO3B 1EVUA 3D69A 1M05A 3FO1A 1HYSD 5F93C 3UZQB 4BKLB 4Z77A 4KQ0A 1RVFL 1PIGA 1SUJA 2Y6SD 4LCUB 3F7LA 2ICEC 4N8VA 1PG7L 4ELMB 5JQ6L 2HUEA 1CF8H 2H1LM 2F19L 2VDPL 1ADQL 1DYZA 5EIIG 5IVXB 2DQUH 2G9HB 4UOJA 1BQUA 5CGYD 4P57A 4YFLF 5IMKA 1UZ8B 3ZR6A 3H2QA 3TO4B 1HI6B 3G08A 3KBHE 3LNFA 1HSBA 4HF5H 4LL1A 4Y88A 1ZVNA 2E7CA 1T21A 3P4MA 4JVWA 5L88H 1IM9D 4G9DA 3SB3A 3DKHA 3QG7H 4HKBB 5HHVL 4MLSA 3SKUD 4KXBA 1YN7B 1V27A 3J8F7 4GOSA 3SY0A 5CEZE 1FVCB 4L3CA 4LKXA 4XX1E 1BMZA 5E9DB 4HPHA 5GGVY 2CCWA 3L3DB 4XX1G 2OQJA 3NCXA 1QTYT 3WFEH 3L7EA 3O9WB 1DFBH 5DMIH 1UXSA 3QUXD 3AZUA 4AXWB 3M6DA 1PKQE 1G1CA 4P2QA 1YYLH 1TG8A 2R7EB 1LEGB 4ADGA 2C3WA 3P11H 2R2EA 5BVJA 1GTFA 1T2XA 2H41A 3U82B 2QHRL 2BNRE 3SPJA 1GOFA 4KDVA 1OE1A 1E4XH 4UQAA 4PCSA 3GSQA 5DDHA 5DMGD 5D1QD 4PHXA 1IU1A 2JTYA 3MNWA 1CT8B 2XI9A 2JLPA 1G1YA 1HEZA 3N3EA 3C5ZD 1MFBL 3TO2A 1J8HE 1NMAH 5DRWA 4PWEA 4DEUA 5EDXA 1I9JH 1XIWA 4NKMB 2Z3FA 4DETA 2WVUA 1VPOH 4UDUA 1I3GL 4Y19B 3MRKA 4JZJC 3SDCA 5CP7B 4BZ1L 4XGZA 1A9BA 1HDMB 3MODH 3TBWB 3WIAA 1JZ3A 4ZPTA 4H8UA 1AHMA 2VN4A 2QADD 1MY7A 4E2OA 2NXZD 1HL8A 1AZZC 4LCYA 1A6WL 3KVQA 2AVFA 4PBDA 2W60B 3WKQA 4KY2A 2ZXAA 3D7PA 5SWZE 2NNAA 4PCYA 4C54A 1BPVA 2QLVB 1FN4A 3D18A 1MLBA 2ED8A 5F1KC 2R29L 5CXPA 5ICUA 3X1NA 1DVZA 4F9LA 1D5MA 3FO2A 5CILL 4ZDHA 4HJEA 4DFIA 2ORBH 4OLWL 4LBEB 1FJ1A 3PE9A 1G7QB 3DROA 3VXRA 3WGUB 2ATPB 2BSTA 1T0OA 25C8L 2AXHA 3HEIB 3U9PH 5HHPA 2QPEB 2ZSVA 2ADYA 5JIMA 2DTSA 4P9HC 5HI4D 4A37A 1WA0X 3O9WA 4TM9A 4K7PX 2Z1KA 5C0GB 1FNGB 3MGOA 3DSFL 3GBML 3S96B 1ZE3H 2XVLA 4AUUA 3NACH 3NJHA 3UTSE 5GS0L 1KC5L 3ULUE 4K3DL 5J06A 1QG3A 2ITFA 1NMCB 6TAAA 4XPGH 4KZDH 4U3SB 2DQDL 1Q94B 2B15A 4G42B 5F96L 3OAUL 3SYQA 4RAUB 1T21B 4FI8A 5ADOL 1RZJC 2BCKA 3KYOA 2R9HD 4J8RA 1Q94A 3JYBA 1JPGA 4PW3A 2BIHA 1UG9A 1KF9B 5GXBB 5GZOC 1TPXC 3SJVE 1R0AH 1MW1A 1XHHA 3BVVA 4PJAA 4ZUWA 3QNZA 2PCPB 4R96A 2FWLB 3GMQB 5TQ0L 3QCUL 5BCAA 1BMGA 3ROLB 3V52H 3ZE1B 4MAYC 1JMXA 3QARA 1Z3RA 4Z95L 1MWAL 1WLHA 3JWNG 4YIQA 1TFPA 5JMRA 4AQ8C 3UAEA 1MAMH 1MRCL 3V9CA 4JZOB 2HT3D 1R5VA 5CZRA 1BP3B 1DO6A 5K9KB 2AKRA 3LOWA 4PMFA 4WENB 4E9YA 5HYFA 2XA3A 3FSZA 1OP4A 4N28A 1GS8A 4OM0H 5I18H 4XO3A 2WP3T 4OT1L 1FZKB 5E9DD 1A2YB 5AD0A 4G6FB 3W9DA 1FVEA 4WK4B 1BA9A 1CGXA 4KAQH 5CZVL 3UTSD 1FLTX 3HJ0A 4YPGB 3SDCB 3ZKNC 4ZFZB 4UOW0 1DLFL 3MBEC 5F72S 1L3NA 1FG2A 3S8GB 2UUDH 4OZIB 3HZKA 3QEGL 2VLJE 2XKSA 1V7NL 4P2YA 4RIRB 1MIML 1NUGA 4JFDD 3MZTA 4AQZA 3A67H 3QUMA 4KHTH 3GHPA 1V3LA 1NCUA 2Y36H 3MAWA 4N8PA 4OSUH 5JORB 4JUTA 4WUUD 2BNQE 4WGKA 4LLWA 4I5BB 1W0WA 2X09A 4XB3A 5I0WA 2CXKA 1RZPA 1T6VN 4OFDA 5SWZD 5DD3L 1GOHA 4PJ8B 3LKNA 3QUZD 1IGJA 4FYSA 2AK4D 2HFFA 4YAQB 3OPUA 3ISRA 4GW1B 4HKJA 4KKRA 4M5ZH 3ESNA 2H6PB 4OLEA 2BNUA 2QQLL 2J1YA 1Q4NX 3BUBA 1CICB 2QADB 1ACCA 4PJXB 5KSBB 1OV8A 2CLVA 2OR7A 4GW4A 2CHDA 5CFAA 3IAPA 1P4IH 4UILH 2XV2A 3EW3B 5T5FL 4MCYA 1M6OA 1AGEB 5DDHB 1S78C 4KJYB 1OAXH 4ZSOB 3ABZA 2A9DA 4IM8A 2CIIA 3O6ML 3SDYH 3CFBA 3N40F 2K8MA 5BRZE 2V5MA 1AACA 4XVJH 5JR1H 2NY5C 2XG5A 1BAFL 1OGTB 4RSVA 5JLZA 3Q01A 2MSPA 4DK3A 4PRPA 4LLVB 5E8EA 1XD1A 3QJFA 1FAKT 3ZE2E 4JFZL 2FQDA 2LTQC 2ZOLB 1HZHH 3ZE2F 1NCOA 3KYKL 4JM4L 5EEYA 1ADQA 3PQYE 1P4IL 3PCYA 3QFGA 5AOJA 3CCHA 3NK4A 1NAMH 3OKNA 2VMDA 3CFJA 4U4IA 2VMEA 5D71H 3TV3H 2IOMA 3MNZA 3O3AA 4BWUA 3DXAB 1EX0A 5D55A 4WI3A 1WS7A 3N41B 2FZ3B 1VEPA 5AAWC 4TF4A 3AITA 1DJXA 4DP2X 5AYUL 1GGCH 3GI9H 1X5FA 1N12A 2DLGA 4HWEL 3RVWD 5E8DL 5B38A 5BXFB 1I53A 1JFHA 3Q2WA 2WXQA 3ZU8A 1R4XA 2P7TA 2YLHA 5EZLA 4ZTPL 3VWJD 1E7UA 3ASWA 3L4WA 4CJ0A 1XQ4A 2JB6A 2OCCB 3ESOA 3K3QA 1NAMA 5G4NA 5HGHA 5IFHL 1X5KA 5JPMB 1AOZA 1SY6H 5IEHA 1T1XA 5BUPA 1ECZA 2EXSA 5BUGA 1PZBA 2NY2C 3OAWA 3KXFA 3MKGA 5LAXA 1VFAB 4OZ4A 3UOAB 1NGWB 2MNUA 2QL1A 4BA8A 2KS0A 2YXVA 2BNQA 1LTXA 2QR0A 3QHTC 2FJGB 4ZMYA 2OMXA 1YLBB 4X6DE 3JSSA 4YHZL 1U8JB 1KXQA 3G6AA 4KDWA 5DZNA 1TJIH 2D3LA 2EKSA 4OLWH 4ZAKD 3IVKB 2B14A 4NHUA 2GT9B 4MS6A 4TVPD 1WV7T 2R0WL 1AKJB 5E2UH 3OD3A 5FCUH 5J6GA 4N22A 4XVSH 5HBBA 3BRDA 1QSFD 3CDGA 1KOAA 1KG0B 1Z3GH 3ARFA 4WDIB 4HC1H 5F3FA 2F53E 2JKTM 4ZXBB 5E6RB 2J5LC 2VISA 4U1HA 4OY9A 3D39B 4QXTA 5I5RA 5GGRA 4NNYA 1H3GA 2GAZB 2BNQB 2HVJA 2X6BA 2XQBL 3NIDF 4Z8FH 3ML8A 2BSDA 5CSBA 3PNWB 4B50A 5K9KA 3WV0A 2W9DH 2GHWB 5FW8A 3TIEB 4AM0A 4AW7A 1QNIA 4N2FA 5DURB 4DF9A 5KOVC 2A2QT 2H3NA 2OLDA 3NFNA 1MCPL 3L5JA 3H3KA 4ZO8A 4Y4FC 4XPTH 4MNQD 3MFFB 1IBZA 3EDJA 2W65B 4F1ZA 15C8H 2DKSA 1UWFA 2F58H 4LLDA 2WXGA 4KQ3H 4PRIE 5ADOH 3T6XA 1Z9PA 2D31B 1HHIA 5GJTH 5CEXA 3ZKSD 4ZOAA 1RPUA 2X89D 3N9GH 2VMCA 5E00A 2J1WA 3OG6B 3AS1A 4P06A 4U1MA 1T89C 4J3OH 5KTEL 4GG6B 4OCRH 3WS6A 3BWZA 5ACZA 4NNXA 1IL1A 3DGGB 5E99H 1IBBA 1UKQA 2DLHA 2WKGA 4KX7A 4Y2OA 2WSDA 3BE1H 3FQTA 4BK8A 4Q9RL 2G5RA 1DN0B 5DRXA 2FCBA 4IU3B 4PY8I 3PAYA 4RX4A 1UFUA 1ID5I 3GTVA 2OXGA 3D85B 4GW1A 4HKJB 4LNVA 1SXBA 3ZHNA 1HOEA 3IDGB 5D70L 4LVOC 3HAEH 3CFEA 5HDBB 4Q9QL 1R33A 4X6FA 1Z0MA 1U30A 2GJ6E 2QPSA 3BT0A 2J88L 3GKWL 5IQ7L 5SWSA 3ARPA 5HI5C 1N8ZB 4MDIA 2X6CA 3VD2A 4IYKA 4HHAA 4URTB 5IJCC 4AMKH 1ND0B 4NKOA 4NC2B 2QDWA 4WO4D 3H3PL 5C0AB 1MDTA 3C5ZB 3D4YA 2WM0A 1UXWB 4RIRA 1L7TL 4AM0Q 3E38A 2KC0A 5GSRB 1VCBC 5LAPA 2BMKB 3KPRD 3UO8B 4QRSA 5I8OH 4PJIB 3SOBL 3X13A 1FFRA 3KPSD 4KRNA 4HUUA 3U7WL 3LKNB 2HRHA 3QHFL 4J8QA 4WTWA 5I1CL 1KCKA 5FB8A 1IAII 4MHHI 5AOLA 1S7SA 1YECH 3MLVH 4LKCB 2WXLA 3U30C 5FYJE 1G6RL 2FJSA 3BH9B 2GSGA 2PF6A 4LOUC 3OHXC 1RIVL 4RDQF 2CO2A 4RZCB 1MW2A 5ECJE 5GGQL 4NFDA 2YRZA 4NN6B 1FC2D 1T83A 3GMLB 4BRVA 2HCZX 1NMCC 1CFBA 5T3XH 2Z7YA 5DHYA 3LRHA 4X99A 3BUTA 3OJMB 4LL4A 3FUKA 3BP5A 5GGVL 4JFEE 1HAUA 3US9A 4ABUA 4HIXL 1K4DA 4LDLB 4MJ5B 2PYEB 3A4FA 2WIIA 4KKAC 3TBTB 1QSEE 3CC5B 4N2DA 3NQKA 1NC4D 2BSBA 5JXEC 1PLBA 2AJYL 4N0UB 4M5TA 4GMTL 1F11B 4U31A 1AI1H 5IJKA 4N6RB 3FTZA 4PIRF 1AXSA 2AJVH 3GJFK 2NYZA 1E27B 2F9BT 3VVWA 4BRJA 2YHGA 1SPDA 4ODVH 2CNYA 2GTQA 5BZZA 3AB0C 1GY2A 1OCZB 3O6LL 3KZ8A 4QTIH 5DLML 1Z32X 2XYBA 4HJJH 2J6WA 3OMAB 4E9XA 4WWNA 3QK0A 1KGUA 2PNDA 3IDNA 5IVNA 3MVSA 4Y19D 1KIQB 1XCXA 5TH2B 5FO7A 2HJFA 1XR8A 3KH4A 4YDZA 1TOXA 1W15A 5IB2A 5ID1B 1XH2A 4WY7H 5CWSB 4LAQH 2MHAB 3E8UL 5EU4A 2F61A 3QJFB 4M7LH 2DLEA 4OJYA 4YLCA 1HSAA 1QATA 2CZNA 1OARH 2J7LA 3IFOB 3R4RA 3VI3B 3DOSB 1QYGH 35C8L 4HV8A 2XWXA 5J11C 4OM1H 1UA3A 4XCNB 3ME0B 3CDZA 3I6SA 4X8GA 1FE8L 2MOVA 5IJKC 4RMBA 5BZWA 1JG9A 3RBGA 5ADPL 4H1LG 1UB6B 1A6VH 5E5LA 4KC3B 4DAGH 4U6YB 5TQ2H 4W9KC 1CIDA 1GSKA 4U1NA 3VRLF 1YQ2A 5HYQA 2DQDH 5F96H 1NDMB 2V17L 4HIIB 2R9HC 2YJLA 3LDBB 5LGJA 5I6LA 2QGCA 5D5MA 5HYSA 5CO1A 5B3JE 3IDJB 1BGXL 4HFWB 4PEEA 3FFDA 1FO0H 1RHHA 4XBEH 3ZT6A 4WW1B 1C9SA 2BZDA 3BFOA 3H3PH 4KKBD 4FA6A 4X4ZA 4ZMTA 2HMIC 2HP4A 3AS0A 4FQ2H 3PWJB 4M6OH 1D5IH 3F7PC 3FH7A 4ES8A 3EYSH 5I71B 3CBKB 1DVSA 4H88L 3B9KC 1THCA 4MKTA 3ZZSA 1JWSA 3SDXE 4WF7A 2Z7UA 3BVNA 4PIBA 1XGYH 4Q6KA 2QADC 4ZO6A 1BFVH 2XJKA 4P4KD 2VDNL 2JLLA 2TSBA 4XVTL 1CU4L 4UTBA 5AW7B 2VXVH 1DJGA 5C70A 3HG5A 1HL9A 4IRSC 1FH5L 2GY7B 2YQ3A 4JFEA 5B1CA 2X3CA 3UP1A 3CHOA 5I30L 4NQCE 1A4JB 4X8JB 1OGAA 4YK4B 5KVMC 4Q9RH 3H2WA 3AG4B 1BJ1J 1W91A 2XQYK 5BQ7B 1U6AL 1BEYH 1CC3A 1UWYA 4O9HH 4L0YA 2FBJL 3QISA 5F0PB 1URLA 1BQRA 4B3EA 4E9SA 3CMGA 1TJMA 4N90E 1DDHA 1AGCB 4JO1L 5DC2A 4XNUL 3G5VB 3LD8C 1KV3A 4PS8A 5TDNA 2DLIA 3MLZL 7PAZA 3O8XB 1YO4A 2FQEA 4BDVB 2A0LC 3CQPA 5EG6C 1N8ZA 1AP2B 4MDIB 1N0XL 4UM8B 5E94A 12E8L 3DUUB 5T5NG 2DRUA 3LRGA 1HJBC 3CX5K 1U8CB 1CDYA 1NCDL 5IBTL 1ZGLA 3L45A 4YGVA 1M7UA 4Y4FB 3C8KB 3WU1A 1TLKA 3NN8B 5AOKA 1USZA 3V5HB 4AY0A 8FABA 2WZPD 4APQA 3QO1B 4PRIB 1JFQL 1R3LB 3LHAA 4DGYL 4DHLA 5JZ7D 3ALPA 3IS1X 4WUKH 2R0LL 5CM1A 2E9GA 3OAYK 4LZKA 5KVDH 4FQHA 5E51A 3PDDA 2B7DT 3NIFE 3HBQA 2H7WA 4UNVA 3P3RA 2P43B 5D7LB 5T1KD 1BEYL 3FTXA 5EOCL 1ZAGA 4EO5A 2BIQA 3BUYB 4OAWB 4P4KB 5L2JA 4N0FA 1KDJA 4CVXA 3HLKA 3MREB 4CADA 2SODB 4Y1AE 1MPAL 1NEUA 4KO5A 2LVEA 4I89A 3VDCA 4IK7A 3ZMRA 1TVBB 4FHKA 4MQ7B 2CDGB 1RZGB 4RGOL 1JWUB 1F6FB 5C0FA 5F7WC 3VFVB 2C1OB 1DQDH 4Y4HA 3GZKA 4EZJA 5EEWA 3CVCA 1MCBA 3BKJH 1HHKA 1SJHA 2E4FA 2FLBT 2EIDA 3L3HA 2UWEF 2XVKA 4AYFA 4P5TA 5D1XC 5D2LA 3L5WA 3GYRA 1S9WB 3R4DA 1CE1H 2J8HA 3IJHA 4ZNEE 4NDMA 3NCFB 1BGXH 1VA9A 3R18A 4FFYH 4TULL 5MENA 4P5MA 4ZXBA 3CSTA 4QNPF 4OGXH 5KJ4A 2L7JA 3GSOB 1F56A 1JGVL 4KBPA 4WEUD 4K3GA 5FGBA 2DQHL 1M7XA 3TA3C 3U2SA 2DN7A 5F7DB 1UYWH 4E9QA 4GS7C 3GI9L 4MS8C 3SE6A 3IVKA 3S7GA 1EGJL 2O5XH 1OM3L 3LV3B 1QYGL 2WKOA 1MAKA 3WELA 3A5VA 2DI8A 4QYAA 1JXGA 3MA9H 2H45A 4JKPH 3AFLA 4E5XB 4N3TA 3DJTA 1PZSA 1TTUA 1G9EA 1H5BA 4X50A 3TF7C 1SN2A 5E6UB 2YK1L 2HLEB 2VDML 4HHAB 3CFJB 5CN2A 5C92A 2VC2H 4KGJA 4R4NC 3F05A 4OJCA 4ZQKB 2BHFA 3OMZA 4MA1C 2QVIA 2X2IA 3PREA 4BFOA 5JQIB 3F12B 1LP9E 1FORL 1WBYA 2P5WA 1BWWA 2ILLA 2W8CA 4DCQA 3HE6D 2EYTA 1XB3A 5HHQA 4H8WC 2CLRA 3AXLA 3WKNA 4R2GB 3DA0A 1S7UA 4H7VA 1AHKA 3QZMA 4TLKA 2OL3A 3F7YA 2X9XA 4AQ1A 3G04A 5JOPE 1WS8A 3L9RB 1OCRB 3BUYA 4OAWA 1E8WA 1IFHH 4NPYA 4DGIH 1EEQA 1LM8V 5A6MA 5J3HD 2Y1VA 3C60B 1D7DA 4U1MB 2Y06H 2E6PA 1XF1A 1BXAA 4L2YA 3D07A 2B4CL 3DXAD 3OKEA 4GRLA 5K59F 1CG9A 2NX5D 5ITFA 5CD5D 2PW2A 1D9KC 2IGFH 4HS8L 3SPVA 3VJ6B 5CSGA 1UVQA 1CG9B 1HNFA 3AG1B 4U2YA 3KPSB 1WZMA 2BOLA 3ZE2B 1TEGA 2KL6A 1WITA 3GRGA 3M46A 4G6KL 4W9FC 2A83A 3G7TA 3WIFB 4QAWA 3APFA 5HDQL 5AW0B 4XPTL 2HT3C 5J56B 5ILTH 1M9WA 5DK0A 5TFSL 4A55A 5AW8B 4ZFOL 4XZUB 1MQ8A 4GRLC 1BCIA 1TYRA 1KGWA 3ZDZB 5KSBA 1CFMA 2Y3NA 2LU4A 1X9UA 1MFDH 4M6ML 4WTZG 2D7OA 5DXWA 5DJ2B 3RX5A 4AGMA 2OZNA 1NKGA 3B56A 4M61A 4OZFH 1VACA 1WT5A 1U91B 2JI2A 3MRLA 1WBYB 2P5WB 3RIAF 5F7DA 4M1CD 5HSFA 5JIQA 3PIQB 4RFNC 4L9LC 4NB7A 2BSSB 4X6EA 5AD0B 3RAJL 4CGUB 3OLEA 1R5IB 5CSZA 5JYMA 3B9KB 4C47A 3LH9A 1RUAL 1U93A 1Y7VA 1FFNB 4GUCA 5D9SA 3VXME 3KLKA 4XC1L 2KLSA 5AEAA 2WAQA 1G4MA 4CA4A 3WMPA 4PJCB 4U1JB 3VX1A 3I84A 2JE8A 1GY1A 2VZOA 4BWTA 4OD1H 4OQTA 1GJUA 3K0WA 4AK1A 4A2EA 5HYSG 1ORQA 4YHPA 3RY4A 4DQOL 5FGCE 5B3SB 2WXHA 1MI5B 5CLTA 2NZIA 5GRWA 2XIIA 1QWNA 1ZTMA 1XF2B 5ESQB 4LHQB 4BHUI 4XMWA 2DZEA 5I1IH 3HC4L 4GP8B 1BWMA 4OFIA 2YS4A 4XNYH 1P53A 2E6QA 1RJLB 1P5UC 1WFMA 3FSVA 5CKAA 5HJ3A 3BSZH 4FLHA 2DH2A 4JFOA 1G0XA 4OVUA 2BFVL 2OJZH 5E1HB 4WHCA 5CCKH 1GZQA 1YPZB 3NJLA 4UQCA 3C6SB 4NM8H 4D9RE 1KYUA 4ZTPH 3ARBC 1HAWA 3CHPA 4FA7B 4G1EA 3JV5A 5DJAB 4NSKB 3W37A 2IDCA 1J5OL 3FN0L 2J6EH 1WAPA 3HN5A 1M7DA 1GGBH 3HS0B 2XVGA 1NMBL 3KL0A 4I48A 3HG1B 1CVRA 3GS4A 2QVTA 1GS6X 1OZUA 4KNTA 4Y5VC 1UKSA 4LPWA 1MRDH 4M4PA 4QXGL 1RUAH 4LDEB 2R29H 4G8AC 1JTOA 4XMLH 1TVHA 2OXHA 1I1YA 4P5KA 2OFQA 4AE0A 1TEYA 2HYMA 4ZDHB 3C08H 4P5TC 5D1XA 5EF0A 4NC0B 3L4CA 3RWGA 1MRFH 4APXB 2Y72A 3SJVB 3SYAA 5ANMA 1I8MA 1D5RA 5G4MA 2E74C 3PUCA 4LLYA 2I7OA 5J6HA 4H8WH 4NHCH 4UM9D 1KJMB 2X40A 4WI0A 3FB6A 3EGXB 1B2YA 8CGTA 1E43A 1INEL 2CLZB 4GW4B 3H42H 1G7PB 3GIVA 4A6YL 1OK8A 4GKZA 2IH9A 4HWBH 1K5NB 1Y07A 4L8CB 4DVRL 4A2FA 4A7QA 2QBWA 4Y19E 2G2NA 2HJKA 2Y5TA 4JFXA 3MJGX 5JQHC 3BESR 3P30H 2EIMB 3MJ8A 2KLTA 5FYKH 1M2VA 4WEMB 3PAVA 3ZKND 3CUPA 1JGUH 3U9WA 1Q9OB 5EU6D 2FEDD 3IFNL 1FQ9C 3NZ8A 4OZHF 2AHIA 4B0MB 1ETZA 4F8OA 2ESVD 3R06B 4MAUH 2IAND 4MHHG 2WXPA 1MH5B 2AJXL 3DVIA 4J4PC 5GRJH 5TE4L 2O6DA 3LD8B 4B96A 5HYJA 4K71B 4M7KL 5C6TL 3E2HB 2Z8VC 4I0PB 2V37A 1FIGL 2Q7YB 1OPGL 4ONGL 4I0PA 1DBMH 3KHQA 1F4WH 5CAYB 3TV3L 3DV4B 3GMRB 5E2VL 2IBBA 3RX8A 1YYMH 4ZMAT 5SWQA 5IG7A 2EH7L 4UT6A 1MCWM 2OMZA 5JO5A 4NQQA 1X7TA 3ARDA 3MLPA 2A38A 3KYKH 3ZBMA 2L7UA 3RI5F 1A3ZA 3GNMH 1ETZB 3PJSA 4BQ6A 5F7KC 3SJVA 1YN6B 3WJJC 4Z3JA 4MNGA 4GP4B 3HZVA 4XCNA 3DDFA 4K4KA 4L3AA 2CIKA 3VQ2C 2ODIA 1BQHG 4FNRA 3OXSB 1QR4A 4DP5X 4L3FA 2H1PL 4H40A 2Y7OA 2R1WB 4BXSV 1HWHB 5IROA 5T5FH 1QLEB 4IJ3B 2ZP9A 4WU5B 4JKMA 4JFWA 4OR1A 3LH2L 4PRBA 5E9AA 5BS0E 5JHMA 3EXJA 1LO3L 3KS0H 3U25A 1HNGA 2GHZA 5GJSL 3QZOA 3LIZL 4TQIA 1UYWL 1AYRA 5ESAA 3WUWG 2EQDA 2XBDA 2FL5B 3ARBD 3C8DA 3BGMA 3ARDC 3QUXC 4M5YH 1I75A 4G82A 3STLB 1SDDB 2ARJB 2FL5A 3V7MA 4EZMA 1U8IA 2CDFA 4L2LA 1EXGA 1C5BL 4PJHF 2IPUG 5LXVA 5DJ6B 1W0VB 1WIPA 1PD6A 2G9HA 2ZWYA 3ES6A 3IE4A 5F6HJ 3BVDB 5JHLL 1DQIA 2EC8A 1B2WH 5I73C 1MHPH 1HNYA 4X6CB 5T3ZH 1KB5H 4OCSL 2C3GA 5CWSA 3IDMA 1P6FA 1IEAA 5ESQA 4Q9CA 5CD5C 1Q1JH 5E23A 4PJEB 1MIMH 1CE1L 3H55A 1P6AB 2P3YA 4WFFE 4ELMF 1D6VL 2HKHH 2ENQA 1ERNA 4NENA 1OSPH 2WWOA 4MLIA 5DQDH 4JR9H 4B9IA 3CZLA 2BY2A 1OGSA 3LZLA 1TU2B 3DGCR 4HD9A 1ZCRA 1EDHA 3G5VA 5HYJE 1AHWA 4P23C 4N9GA 3LKSA 3X14B 1RZKC 3RUGB 4MD0B 3QRFM 2Q87A 3DV4A 3GMRA 4LO9A 4JM2B 2GT9A 2HKFL 1IC1A 4UNTA 5KANG 3U2IA 1OLZA 1OW0C 4JUSA 4LOEA 3MLSL 4LMQI 2F54D 1KCUL 4OQ1A 1L7IH 2MWCA 3G9AB 3TN0A 1ZJAA 2Y1YA 1HU8A 3DVNB 3I75B 1MWAH 2CD0A 3SYOA 2AQNA 1JFQH 2APBA 1P5VA 4XP5L 5DEFA 1T4KB 1M7IA 3VMNA 4OCWH 43CAB 2YMOA 4BZYA 4OCXL 4UT7H 3VSUA 4QCIA 2D0FA 3NG5A 5D7EA 5I9QB 1EHKB 1Q72L 3L4XA 1LQSR 3FRPB 2QKIB 2RGSA 4LOVA 2VIRB 1CFNA 4AW4A 3PQYA 4Y5VA 1A3QA 4RCAA 4C83B 3L1OH 3GSNH 4PJGB 3OTTA 5E6IB 3E6HB 2E7DA 1GH7A 3MRDB 3FFDB 3QR0A 3GSXA 5GZOA 1YAIA 2YA1A 3RHWF 4X4XB 1KC5H 5I5JA 4AQAA 1R24B 2F74A 3QNYB 3GBMH 4LAJH 4W9LC 5CJBA 5IB4A 3U7AA 1G87A 4OFQA 3UGXA 5CEZL 4XWGL 2IQAB 3IPEA 2DMHA 4HCFA 2ATKA 1Q9WB 4OCNC 3UTSB 4Y8DC 5TE7H 5I1JH 1T3FB 2GI0A 3E3QC 4JKLA 4NC1C 2XRAL 4V1DE 3RHWK 1HKLH 3BP7B 2XWRA 4APXA 2P5EA 1X5XA 3EFDL 2EEDA 1OTTD 4Z7NF 1JZ7A 2FSDA 2UXGA 4WO4C 2EDKA 4RQQA 5GS3A 1PLCA 1T1ZA 5INDB 3RPKA 3CHQA 3LN9A 4GRLB 4HF5L 5EEUA 4P46A 2OXGB 3D85A 5I1JL 1QO3A 3KLHC 3LB6C 3AJ7A 1GC1H 1E0OB 5ID1A 1QSEA 3K6OA 3U4KA 4JLRB 3PL6C 4KTEL 4ZUSB 3Q5TA 1MQKL 4Y1AD 3V9FA 4XBPA 4E5XA 1OANA 1XF4A 1IKFL 2WK2A 2F7OA 5H4YA 5EOQH 4F15B 2V9RA 4U1HB 1DUZA 4B41A 2DIEA 1DSYA 4YSOA 2DV6A 1T22A 2PPAA 2WCGA 2X5PA 1ET8A 2H32B 2SEBA 2ZZUT 5HHXH 3TFKC 3O2VL 3QR1A 3FH5A 1VADB 1Y0LA 3F12A 5J13B 5MERB 4ODWB 3QO0B 4XCFH 4AIOA 5D93C 5DC4B 1YUHA 4GXVH 1E42A 4EZKA 4QRUB 5IVZB 2GSIA 4MJIB 3VCLA 4LNRA 4X99B 1M7IB 1T7YA 1XSKA 1N64L 2OS7A 1QFPA 4P59H 5JIHA 3SKJL 3V4UL 1P5UB 3P0YH 2AFNA 3UAJA 1S5HB 3IJEB 1DSFH 2EVIA 5FUOH 4BUGA 2DEWX 1V7ML 1OHZA 1WQVT 4QXUL 2X4NA 2APWA 4IOSD 4ANVA 4DT2A 3EBHA 1EAQA 3MRBB 3QXAA 3FSOA 2NLJB 4IRZL 1O7VA 5IFJB 3BYYA 4POUB 4PB0L 4D9LL 5IB1A 4F9PC 2JKRM 3GJFH 1X4XA 4QRPA 1U4EA 3F5WB 5EOTB 3GZOA 3WO4C 3ULUL 3JUYA 5ANHA 3QG6B 2D7MA 2PYEE 1RSFA 32C2A 1DANU 5EMYA 4GMTH 1L9QA 2A6DA 1PAMA 5EA0L 4NUJA 3GMPA 1OP3K 4OZFB 5C0JB 4YDKL 3L1GA 1BVNP 2QGDA 1LP9F 2E8YA 5EH1A 4E9LA 3D3VB 2YPKB 1J18A 4Y1TA 2BHZA 3F62A 3VG0H 3V4VB 3GBNL 1HE7A 2JKNA 4P5TB 5JYLA 3KXFB 2EUXA 2IAMD 5FCSH 1FP5A 1D7FA 3SE8L 3OKOB 2YPLE 3EOTH 4FXKA 1KLFB 3N41F 4P46B 1JDCA 1X5LA 1HXYB 1NPUA 2BDNL 1HILA 4QR7A 1MXGA 1FFTB 2H32A 2SEBB 5DUBA 1Z5LA 3KYMB 2KDGA 5LN4A 5SWSE 5I5MA 4AQEA 4PP2B 3CSFA 2XG5B 2GUOA 5AYQA 1OGAE 1IMHC 5KW9L 1S7TA 3PJNA 1QBLL 4TUJB 3O9WC 3G5YA 3X2QB 3VNZA 3LYRA 1W72H 2Z31D 4YXHH 2WUCH 3P9LB 1DQLH 3MBXL 5D6CA 1A1NB 1NGQH 1N67A 4FQXB 1FUNA 4FYTA 4NRXB 1FSKC 2PPFA 4HWBL 2JCCF 4JCMA 3T4YB 2WOBA 1RZKH 1PX4A 5AOZA 2JTDA 1PNCA 3S96A 4BZ1A 4NBXB 4WGVB 1H15A 1D7CA 2CWRA 5E4EB 5F6IC 5JNYA 5KBPA 4IBWA 3FTSA 4MJ2A 1BLIA 4XNZC 3GUFA 3LRSB 2GJ6B 5FDWB 3GSUB 3WS6C 4PJEE 3QNXA 2BC4A 3OXSA 4G7VL 4AQEB 3HRZB 3ZX1A 3MBWB 3ZL4H 5G2NA 3S35H 3K5SA 1ZGLB 1SVBA 1DCLA 1C08B 3S8WA 4UBDC 1WJ3A 2ZWLT 2IH1B 3EJQA 5IQ7H 1SJMA 2HN7A 1DLHB 5EIQA 3T6ZA 3PFUA 4FYRA 3C09B 3VRJB 3DX8B 5H37H 2VLLA 2EP6A 1MCLA 1GGUA 2DQFB 5T1KB 3I6KB 3PY9A 4PG2A 2RR3A 4WNQB 1WHOA 4P48A 3UPRA 3H9SB 2JCCB 2OMYA 3OC5A 2N7SA 2QFPA 4NN5B 4H26A 4J4PD 2VR7A 4NLAA 3LS4H 4X5XA 2HFEB 3WFZA 4WJ5A 4BFIA 3X1BA 4LK4A 3NRFA 4K07A 4NM8L 4GS7B 5EC1A 4ZMVA 2XXCB 1OAQL 1MUJA 5C0BB 2A9MH 4ZODA 3M1CA 1AKJA 4JKWA 5E8PB 2WB7A 4PRAB 4P99A 3FO0H 2GCYB 3MHZA 2BS71 4PB9H 1ZHNB 5C3TA 4F3FB 1OB1B 3D39D 3S3CB 4FADA 1LD9A 1NJ9A 4K5OA 1IC5H 3KPMB 1KBKA 1CIUA 3GXPA 3ARUA 4FRWA 5DGRA 1I3VA 3GJEA 5IV2B 4P3DA 4FMKA 3DO3A 2YPLA 1VIWA 4NZFA 4QGYA 3RNKB 5IB3A 4GH7B 2W9DL 3QIBC 3HMXL 4GNKB 1ZLVK 4GRWE 1P2CB 2AAVA 1A7PL 4FHBD 4ZK8A 3TVMA 1HCFX 1AGBB 1T0MA 2YZ8A 1YYCA 4P9ML 2RD0A 4LSRH 2A4EA 4MDJB 1Y6NR 4L1BA 5CINL 4EXPX 5F9JA 3HS8A 5D96B 2Z35B 2YRPA 2VOTA 1NDMA 2YPVH 1ZLSH 4YHOL 4UB0H 4KUCD 1U8KA 1EJFA 4G9DB 5J9PB 1OP3H 6CGTA 3WHE1 2GK0A 1CPUA 4CL7A 2J73A 2BSRA 4XWOC 4Z7AA 5IESH 1CBJA 3CZFB 1HXMA 4J3VA 1QNZH 4GBXB 1M6UA 4FE9A 4K3EL 4OD3H 3VD0A 1BZEA 4JHVA 1JNLL 4LSRL 3S3JA 3UC0H 4EPSA 2J1XA 1VHPA 4FQQB 4IRJC 1ZSDA 1NAKL 1GW6A 2WTRB 2FEJA 4FKHA 3AM8A 3A4DA 3CPLB 2MQCA 2GJ6D 4X7SH 4PMEA 2WANA 5IW1A 2FYYA 2OW6A 1OKEA 2ADGA 3KS0J 3L3JA 2UZIH 4DTGH 1BD2A 3IXAA 2XZAL 4XOAA 3U1SH 1TQTA 4N2AA 3QRLA 4NJAH 1XGQB 4WHTA 4F27A 5CLXA 2EUVA 5EZOH 4PJCE 4PGJA 2UX6A 5J1TC 2XHNA 1OB1A 2XTLA 1E2WA 2OMNA 3N42B 2ZCHH 4NERA 2LLNA 2VLJB 4HMCA 1GPOL 4PGEB 3O6KL 5EZPA 3C2AH 1XO8A 1A0QH 2JF1A 2WBJC 2VJ8A 3D2UA 4PJCF 2HFEA 2IC2A 3IN0A 2VLRD 4XE0A 4FX5A 3HNTH 1WA2X 4P04A 2NY5H 2DWEB 4PTTB 3KR3H 4RDBA 3TF4A 1JNHA 2YGQA 1RZIA 4MYWB 4X7DC 3BWAB 3S36L 1INQA 1U92A 4DP0X 1EZLA 1XH3A 5KYXB 3NDYE 4TQEL 1S7QA 4JJ5B 4P2RD 5ESVA 4EBQH 3L4TA 3QXVA 3ZTJH 4NQDD 4X5QA 4PJ9D 1WBZA 5B3NA 2QGBA 1A9EA 1KCWA 3WIHA 3C6LD 3WY4A 1S7SB 3CUPB 3O6MH 5CZXD 3SDYL 3TC9A 3JWDL 5T1LD 2Z34A 3O0RH 1EJOH 3PU7A 5MHSE 4M6MH 3M17B 5HTSA 4ODXA 4DN4H 5KBDA 3IGKA 2DH3A 5I1AA 1IBGL 5MHSD 1WT5C 5DJ2A 3GSUA 1AKPA 4AVKA 3O3UN 1ONQB 4LVHC 5FO2A 5T33H 5I0DA 2CCVA 1L9RA 3SO3C 2XN9D 2NY5L 4IBUA 2NY6C 3DXAE 5C6TH 4U1NB 2QQLH 3TYFB 5B8CC 3KNBB 5KOMC 3B7RL 2PTUA 1CLZH 3Q0HA 4ZUUB 3G5YB 5D4HA 2EC9U 4S1RH 2LW3A 1LWJA 1MWAB 4WRLA 5EWIL 5BVJB 5I16A 5ISZD 2EXYC 3IEAA 1K2DA 1N59B 4AX3A 3IMTA 2VRKA 2ED6A 2BWIA 4KHTL 2VWEC 1CLZL 4H2AA 1KLFA 5EN3A 1KJ3H 3QWOA 1ETJA 3R0NA 5FA3B 3RZCA 2X2JA 3PJLA 5JNYB 5BJTB 2D9QB 3L2NA 5IB2B 5FO7B 5KUKA 1I3RB 2QZ5A 4DVBB 2KMWA 3MI6A 1MOEA 4PJAB 4ZUWB 4FNQA 3ZMNA 1AY1H 5KJRL 3GSNB 5F7LB 4FFZA 1I9IH 1DEEA 4Y1AB 5IJVB 2L8AA 2AI0L 2Q7AA 5DVOA 5I74C 4R3SB 4RFNB 4JGMA 5LWYH 3QUYC 3WJLA 3CDGB 4WHYH 3FUJA 1MRFL 2B2XL 4XMPH 4MMZC 4ELDA 4A7GF 1A7NL 1E9OA 1UWEH 1P7KA 4UTBH 3JXAA 2AMGA 5KYYA 1KDIA 2X42A 3DIDA 4MDJA 3QS3A 2NLJA 5HHMD 4WU5A 1HWGB 1DJHA 2APVA 2OKMA 3ARYA 4IHBA 2P8MA 2X2HA 1R3IH 1IQDB 2JB5H 4K7FA 1OSZB 3JVFC 3ZGIA 4PJEF 1BM3L 2F8XC 3VFPB 1YEFH 1UGKA 2C9SA 3WKMH 4YDNA 5BRZD 1XGTA 5BV7C 2P1YA 4FXGC 5D4IA 1P7BA 4LVNB 5FW7A 3QNFA 1G1OA 2P26A 1FFNA 2P5WE 1GKOA 3CSYB 4V2CB 4GSQA 4HWBA 3C5SB 5KYWB 3LQMA 1RPQA 1XCTA 2BS8A 2BCMA 3FB8B 1OK0A 4MJJA 4GRWF 2BERA 4AIXA 5IB1B 4RBPK 1KBPA 5IW6B 2XTSA 2X4PB 1KIUB 3GSOA 3BWUF 4NJAL 3L7FA 3OKKB 3AQXA 5H4ZA 1GGIL 2R2BB 4U1IB 2XQ0A 4HKZA 4Q58C 4OI7A 1FO0B 3T0ED 1FI8C 4OF0A 2UY6A 3NA9H 3TO2B 3OWRA 1AR1B 3LCYA 1TVDA 1F3DJ 3MLYH 5EBMA 3V6OA 4N2OA 2EEXA 2J12B 1BEXA 3VRJA 2VUKA 4L18A 2ORBL 3O45A 1PSKH 1PDKA 4YLQT 4M02A 5CZXC 3TEZA 3AADB 3V4VL 1T0NA 3D2TA 2WYIA 4YHIB 4WI6A 2NW3B 4BQ8A 5F7NC 1B6DA 1DVFB 2XN0A 3CHRA 5IESL 2AEIT 4WTXA 4G6JL 5KVGL 1QRNB 1H6FA 1NA8A 3CN1A 1AQMA 4OUUB 3QORD 3NK3A 3U9UA 4BQCA 1DUZB 4IMKC 1GIGH 1D5IL 4L5FL 1EZVX 3CTTA 1A6WH 3BQUC 1GZPA 3HVDA 3DJRA 4GG8A 1SUHA 2AJSH 5CBAB 1SQ2N 2WQAA 3BH8A 4U0RB 3QDME 2EIZB 1IAIH 4H0IA 1XH0A 1UWGH 3BZDA 3IDYB 3VFNB 5CU5A 1KTDA 1MCDA 1J5CA 1RXLA 3UBHA 5HDWA 1QOKA 1MFBH 4QHNA 3K72B 5E56A 3C60D 3CXDL 3K2UH 4YDLC 3VWKD 2DQIH 4JPWL 12E8H 2VIRA 1E6JL 1JGLH 4LP5A 3K80A 4NEHB 3VXMA 1KB9J 3VXOB 2LVCA 5CHNA 2TRHA 1XZ0A 2D3VA 2NDGA 4MASA 1GZHA 2WXMA 4YR6A 1AGEA 2B4CH 2YD6A 4IKJA 3A0OA 3LPOA 4D3CH 1DFBL 3PXJA 1AGDB 2OP4L 4FKEA 1OTSC 4KZCA 3VI4F 3U4EA 3FN9A 1FIEA 3IE9A 5JIKA 1DQJB 5J8OA 3OLGA 3PAUA 1XB8A 2IALB 1JF6A 4OZFA 4R0LC 4DGIL 5C0JA 3FTYA 2NQ3A 1J05A 3A6BH 1WEJL 3VXNB 5I0YA 5ALBL 3ILPB 4Q74A 3MV01 2CMRL 3UBXA 4L1DA 1JWMB 3LZFL 3VYPA 3F58H 1DBKH 2G2RA 3UTTE 1BG9A 5D2NE 2BSCA 2F15A 5KYUA 4PPTA 1I7RA 1YEGH 1YNKL 3D9AL 1NC2D 3C2SA 3MRJB 1KGYE 2XV3A 2AJYH 4B3VA 5JQ6H 1TTCA 4KTYA 3SYPA 4J28A 1WZ1L 3ZL4L 2XY1A 3GLEA 1QHPA 1BOGA 4G7VH 4HXAL 4Z7NE 1BIIA 5CN3A 1U3HC 3RVTC 4BFNA 3GHBH 2EADA 4L9LA 1V7MH 4PGBA 4NYLA 4YSDA 4F33B 2X6VA 4BCZA 4G3YH 4PD4K 4JRLA 1XF5A 3MRIA 2GITB 5HI5D 1G43A 2W9EL 5K39B 1KTBA 3V4UH 3M88A 1QW8A 1F8TH 3KVPA 4QHPA 5KYYB 3QQ4B 5HVHC 2MEJB 4OV5B 1DQLL 3T2PA 3PP4L 3X14A 5I15H 1A6VL 3AVEA 5DMKB 3QUXB 5H94A 4NO5A 3EBAA 2DBLL 4XNMB 3CXHK 3NJNA 3VXSE 3TZVB 4DGVH 1Y18B 4CU7A 3DI3B 2X6AA 2BHUA 3GTTA 2EDTA 2PN5A 1OT1A 3VFPA 2ZUWA 5CS7A 3F01A 3RY6A 2O5YH 3CU7A 4DK5A 4CVZB 2F7PA 3LZRA 4J6IA 4LCIH 5C2BH 4IBQA 2Z31C 4I4WB 2COVD 5JMOC 1WDAA 4OTXH 4J3XA 1F3DH 3AQDA 1RERA 3HG1A 1A4BA 2QVFB 5IMMB 1XH1A 1DQDL 1R5WB 1JZFA 1V5JA 5JIIA 2ZWKA 3HS9A 3V79C 4PRNA 4YHLL 3QC5X 5FEBA 3S5YA 2RTTA 3PV7A 2R8SH 1L3WA 2Y25A 4KV5E 3AQZA 4ICWA 1QLRA 2APXA 2X53A 4P9HH 1RZ8B 1MPAH 4HHWA 4NQEA 1SOXA 1S46A 1T5XB 4BE5A 1Z66A 3ECQA 4PB0H 5DJ0B 1J0JA 3MJ7A 1IVTA 2OMZB 5JO5B 3UJJL 4HYTB 1BFSA 3QNYA 5TE7L 2XX0A 1KLGA 3G6JF 5I2IA 1GMEA 1IEBA 1CICA 1O5DT 4DN3L 1XF3B 1XR9B 2NTFA 2AQQA 1VFOA 5DYOA 3T2NH 1YVLA 2VLRB 3TH2T 1U3HA 5K69A 1P2CA 1Z9SB 2X44D 4JFHE 2MTPA 4V1DD 3LAFA 5ICYA 2EDYA 3FSWA 1B3IA 2G30A 3WOVA 1T1WA 2CR0A 1JGLL 1N0LB 2NY3B 4LCWA 2VSDA 5AAMC 5DUPH 2APFA 1JGUL 1OAKL 3D18B 1ZV5A 1YEDA 2D0GA 4LP4A 1TZHA 2FT7A 2QKIC 3ZZQA 3KYNA 4FEIA 3CFQA 1JUFA 1YEDB 5CSZB 4DP9X 5AL8A 2XXFA 4KNUA 5E6IC 3ZKXC 3I75A 5HHOB 4UV4L 2V3DA 4L0ZA 5FYKU 5GGSA 2DMGA 3U0WL 2V5TA 1I1AA 1XL6A 3BPNC 5LNEA 2Q86B 1BFOB 4OI8A 4FL4B 2XDHA 4X5WB 3RI5K 1INEH 4N2KA 1UWGL 1XFPA 5IR1B 2P4AB 4Y16A 4Q52A 3RDJA 1JXDA 2QEJA 3O4LB 4ZTOL 1G7PA 3H56A 3WO4B 5J11B 4MBOA 1KJ2H 5LBVA 3QIUA 3EGXA 3I3EA 2ZJSL 3DLQR 4TVSa 2OJEB 3SDAA 3PGDA 3H1ZA 2XZQH 1DLHA 4NBZB 4XXDA 4BK4A 4JAMB 1JYNA 1OL0A 3BFQG 1BFVL 1W8NA 2AV7A 4KKNA 3BUDA 3PABB 4LHUA 5AW9B 1BQLL 3WLWD 2GIYA 3SQOH 1ZK5A 4BA0A 4L4JA 4ZFGH 4XMVA 4EUPG 5KG9B 3QEHB 1FLRL 3V0VB 1IC4H 1PSKL 4N8VB 1CBVL 3PS6A 5FO8B 1KPUA 2DLTA 5IY5B 2A74A 3W0WA 3HNVL 4PRID 4HULB 5AG8A 1FNSL 2R4RH 3CLWA 1AGFA 1AIFB 3DURA 5FHBL 4MNQE 1SY6L 3FT4B 2IPTL 1B4LA 5JUEL 2XG4A 1CLVA 2P46B 1JRHI 2FB4H 3V4LA 1PZAA 1C1EL 1SM3L 4HAGA 2XN9E 2NNRA 4PJAF 3WD5L 4FG2A 5EO1A 2NY6D 4KQ3L 4YE4H 1KFAL 4HK3J 5D1XB 5JPMC 4AEIH 1J5HA 2CLRB 3AXLB 2K6ZA 1OQXA 2E47A 4WEBH 4LL9A 4PJ7A 5I1EH 4C4UA 3ZXAC 4OCXH 4UT7L 2VQUA 2XTJC 4CBPA 4O2CA 4YHKL 5C07E 4YHIA 4FQHB 4FXKB 2QPDB 5D71L 1MJ8H 1T89A 2FWSA 2Q3AA 2PWFA 1YEFL 3WKML 3UADA 1G7LA 3VXPA 4FA8A 3Q5OA 2NCEA 2P45B 1TITA 4JM4H 3GQFA 4U2ZA 1FYHB 1ICTA 4YGVB 3MV9B 1MNUH 4AITA 1NZRA 1IC7L 4BSVA 5BS0D 3FO9B 2GK0B 1BAFH 4Z0BH 3UBFA 3E1ZA 2GC7C 1SVCP 5HP5A 1NPJA 3MTXA 1E28A 2PPEA 2J71A 1QW9A 3CIQA 1NWOA 3N85L 4KQ4H 1E4WH 4HUWA 1EEYA 3WS3B 1DZBA 2A9NH 3F83A 1IBYA 4QO1A 4MCMA 1DJSA 3O4LA 3B43A 5GGUB 2D7PA 5B1JC 2AI0H 3DX7B 1BQ5A 2FIRT 2OZ4A 2YBRB 5F6HI 3IETB 1M1XB 1AFVH 4EUPA 1BQHB 3NPZB 3GO1H 3H9SA 1NPNA 2B77A 3L9YA 1DBML 4HIXH 2XFXA 4NDMB 3GMLA 3NAAH 5FR3A 2VW6A 3P4OB 5J12B 4L4VE 4BH7A 3QFJA 4KROD 5J5EA 3WY1A 5F44A 5GS2D 1DHKA 1HL5A 3NCMA 2HLAA 4RETB 4BGDA 1B2WL 5HDBE 3S88H 4K5LA 1FVDB 2EZ0D 2NR6D 1N4XL 2IH1A 3BN3B 4UINL 4L3ED 4U0RC 4P3CH 2H3KA 3JTTA 4XP9L 3Q5YA 2XACC 5AYUH 4NQCA 2UY7B 2WINB 1YEJL 4CBZA 2VLKD 4L5FE 3E3QE 4NC1E 4R7NA 5HVWA 2M26A 1YMME 4L8CA 2X4SB 3MRRB 3ZQ9A 2ERJB 4I1PA 2CLZA 1ZKAA 4EIBA 2AP2A 4KAQL 1I85A 4U6HB 4QRQB 4YWGL 5MEOA 4JDEA 1TJGH 2J20A 2H1PH 2C9XA 1RCYA 5H8DA 3RJQB 4Y7MA 4LASH 3MQIA 1N3NB 3IKCA 5D72H 3C9NA 5LCVA 2ZCLH 2X4OA 4LB8A 4O2FB 4XNAA 5E8EB 5C07A 3DOSA 4MVBC 3FB7B 1YNTB 3W81A 1A1OB 3DTUB 1EXUB 2C3HA 3C08L 1ILUA 3AY4A 5C0CB 2NT0A 4Q9QH 3RB7A 2VDMH 1TNMA 1S2EA 3PG2A 6PCYA 1FL6B 3SHSA 3H6JA 1MAML 1F4YL 4QXGH 2JK5B 3O8XA 4AE1A 5HGBA 3KDMA 3HPJB 3QC6X 4QRQA 3T0BA 2D7NA 3DGGA 5IGXL 4F7TB 4YHKH 3QRGL 1KNOA 1R19A 1D6EA 4M5ZL 1FGVH 4LPCA 4FQJL 5EPMB 5LXGH 4Q6IB 1PZUB 1GGBL 4HKZB 4U1IA 3A24A 3EADA 3JT0A 3OPZL 4JVUA 4PFEA 4OZHB 4OVVA 4MZRA 5KSAB 5GRJL 4R7LA 4XP9H 5DQJA 1SEQH 2AJXH 4LXFA 4OF7A 2JELH 1C8QA 4O58L 5CIPB 3G5ZA 1QTSA 3ECBB 1PQZA 4ZX6A 1QVOB 2UYLB 4F7CA 3ISWA 1Z9LA 2BOCA 2XZCL 3ETTA 5FHBH 4JO5A 2YEQA 1UM4L 3SSGA 3U1SL 3QIWC 3COOA 3RWFA 2PABA 4L4VA 4R26H 1SJEB 2YGOA 5GGTL 5B8CA 3M1OA 3UG3A 2X0VA 2ZT9C 2V2TA 5CJOH 3BMWA 25C8H 3ARTA 5D1QC 1NANH 4LNRB 2C9AA 4PWGA 1CQKA 2ZOKA 3VM5A 4WK2B 4HSAC 5KSUB 1V54B 4MQTB 5E1GA 1P7HL 1NIAA 3GRWH 2VMJA 4FQLL 3VFVA 5JW3H 2V0AA 1SF5A 3NSCA 2IWKA 1PF3A 4JANB 2ZJSH 1PY0A 3OLDA 3PP3H 5FYLL 4PGEA 3V0JA 4TYUA 3ILQC 1G7IA 3ROOA 4I1NB 1MNUL 2B1AL 4PJDB 2ZG2A 4C59B 2J1KA 4OF3A 1MIEH 2NNFA 4FQLH 3QJRB 3FCSA 3Q3GA 1LE5A 1EERB 1JHKL 2HTLD 3MGAA 4XVOA 2EYSA 1OAUH 3Q2VA 3WUWA 3SIKA 4A67A 3WFCL 4NP9A 3VRIA 2P8MB 4Y5XA 4H20L 4PJEA 4U7MA 4K9EH 3WBDA 2MPVA 1NM4A 4WSKA 2CJSA 4DO5A 4QHUB 2ITDA 4XBMA 5C09B 2CGRL 1E2VA 4U3XA 2JJTC 3F6JA 4X6FB 5GISL 1C12B 1T2JA 1BFTA 2IDFA 5AW5B 1A1OA 2HLFD 2XZCH 3DARA 2GYSA 5ITBL 3PF2A 2OJZL 4KXZI 1YEEL 3OKMA 2ODHA 3APNA 2PYFB 1N6VA 1OT4A 5GRYA 1VEMA 1IT9H 2EE2A 5E8DH 4B9CA 3PLYA 4UI2A 2EIJB 1UT1A 3FFOA 3WTYA 3BCFA 1CI3M 3BVXA 1IGYA 1F00I 4JLRA 4LRIA 4M9PA 3IM1A 4ZS6D 4H25B 4WFGE 3PYCA 4OGQC 2VGLM 2ZPKH 1L9SA 4PJBB 5FFGA 5I74B 1MHHA 4H8VA 3WXVH 3C6LC 4R7XA 5E8NA 3LPFA 4LLVA 1N59A 3EYQC 4PRHD 2RQEA 3ILEA 3CFIC 2FYVA 3QUMH 4DKDC 2IEPA 3AS2A 4MDRA 4MRBA 1SBBA 4I0PC 5FFOA 1I1CA 4D0BB 2NMSA 1HH6A 4G9FD 4LLAA 2CRYA 2V5SA 2CO4A 2X1OA 2GJPA 4F2ME 2WLJA 1M2OA 3VXUB 4A39A 4N0RA 1S7QB 4YOKA 5F3BA 5LJYH 1R24A 3ZHFA 2XWEA 1FO0L 4XBEL 2YAPA 1J9CT 3EJJX 2X1PA 4YWGH 1AQKL 2GG1A 4LSUH 1PKQB 1DBAL 2WWMD 1KTKE 4JFPB 4PI2A 4E42B 4YPGA 2OSLB 5TFSH 4YAQA 1K3IA 4KK6C 2WLYA 4POZD 2O5XL 3Q2CA 3JTTB 5EIVA 4RWYL 2OK0H 1R9FA 1MH5A 3ELQA 2GABA 4K2UH 4JRWA 4I3SL 2H32H 5D7SH 1I7ZB 2YPVA 3ULUF 5EU7E 2X3BA 5FM4A 2OMUA 2J8UE 2ZUQC 1CFSA 5JORA 3QXUA 4KWUA 2YA2A 1FZMB 4NUGH 1C08A 2R69A 2CUMA 2W9EH 2QELA 3I74A 1Z5YD 3T8VA 4FQIL 1BHGA 3UZVB 3F64A 4FFYL 1RZIB 4ZAKC 2VZUA 4RRPA 1CLYL 4G6FD 5HHMB 1UXSB 5IBUB 5EU4B 1BD2E 2VR6A 3LZQA 2YWZA 5T1DH 1XF3A 1XR9A 2NTFB 4N26A 3F6IA 1KLGB 1FAIH 4HISA 4Q8BA 1NANI 1L6PA 3HC3L 4PV1C 4Q2ZA 4IIQB 3WSQH 3DWTA 5ISZE 5K9QG 3BQUB 4ONHB 2BCKB 4J8RB 3OHXA 3QXTA 4WWPA 3JZYA 4Z0BL 2FT6A 4GYBA 4QXUH 5GRZA 4LCCA 1ZTXH 4GPVA 4NENB 1ZHLB 1BX2A 5GRVL 1P4BH 4KVNH 1CYWA 1CZ8L 2AITA 2VC2L 4JN2B 3UROR 1EVTC 4HBCL 4ZMQA 4UQ9A 1FG9C 5T3XL 1OD9A 3L16A 1HVXA 5FUCC 4O2CB 1NLBH 3TEYA 5AYTA 4TS6A 4FI7A 4CMHB 5KVDL 1ZK9A 4GXVL 1OE2A 4N4YB 2ZX6A 4XCFL 2VDKL 1JXKA 5IV2A 2HVJB 1P7QD 4G1EB 3VTMA 3CVHA 1N2RB 3O11A 3MLWL 4HLZG 3CXDH 3GF8A 1EIBA 2LAGB 3K2UL 4Q6IC 4WEBL 4ZTEA 2KKQA 3CE1A 3ARQA 1OAYH 2OJEA 1MXDA 4U3CA 1I9EA 4JS7A 1U8KB 3Q9PA 1TZIB 5HJ3B 1UXMA 4UIKH 3UTTB 3W11C 1H6TA 2WTPA 2MCG1 4W9IC 5JUEH 2OMWB 1WCQA 1MCWW 1UWXH 1YEHL 2MTAA 1N68A 2GW5A 5EOQL 3WUZA 5IEKB 4YO0B 4TSAL 3BP5B 3NZUA 1F45A 1JTTA 2WO4A 1KYDA 1NCWH 2AJSL 3HE7A 3L3KA 3CSBA 1UXLA 1IZKA 2BY1A 3FPXA 1UZ6E 2P8LA 3VB8A 3QEHA 1TJXA 2VDPB 4EVNB 4MAZA 2XWJA 2H6OA 3ZTCC 2YEZB 3RL1A 4NAMA 4YHNA 3VDAA 3WJMB 5JIPA 1NCGA 4BSJA 3UYOD 5I30H 4IRSD 4CW1B 3BVNB 4I87A 1DVFC 4J2QA 2ZAIA 3PRZA 1FYTD 3VGBA 2Y0SA 2BXZA 1HKLL 5IKCB 3BAXA 4LBAA 1MUJB 3VXSB 1ZXKA 5D7JB 4TN9A 2WWMC 1N7MH 2HJKB 2Y5TB 3QB7C 4ETQB 3G6JA 2K6YA 3SGJA 5JW4N 3EYSL 2JJTA 4PJIA 3MRKB 1RHHB 4XBGA 4JDZA 1SYVA 1N26A 2NY0B 3FONA 1K4CB 1VGEL 5F71A 1IEBB 3K0YA 1G6VK 3HVNA 5AVWB 3KE0A 4YFDB 1EBPA 3BVUA 3UAAA 4WLCA 3VXUA 2WBJD 1IAOB 4IDLA 4JQVC 1K3ZA 5A2CA 4XN7A 3QVAA 4UIKL 2FHBA 2X4QA 3B6SA 4PJ5D 4DGYH 4YDLB 3IF1B 2PYFA 4W9HC 1DCEA 3UJTL 3HAEB 4LCWB 4Z1PA 1KIRA 4G8GB 3S5LA 4HK3N 4B9JA 5E1IA 3RGVD 1TVHB 3QDJE 2YAMA 4KJWC 3LQAH 4O2FA 4OCWL 5KSAC 4XO4A 5F1NB 4AG4L 4M7LL 1H15B 3TX4A 4F7KA 2GJRA 1DO5A 1ZSDB 3T8MA 5B4MD 3EZJB 5E0FA 4M8RA 2BP3A 5H35A 1NCTA 2HH0L 4D7BA 3RWJB 1IL1B 1PNDA 4PJHA 4AL8C 4DWHA 1P4BL 4IRZA 1KENH 4PREB 4B7IA 3KLLA 4Y2DA 5KVGH 3ARVA 1SLVA 1TZGH 1U8OB 3QFDB 4RAUA 2ZAHA 1A8JH 2NOYA 2DKMA 2H0FA 5E6IA 3QQDA 3TBSA 3W2DH 4XAKD 1HK6A 2KERA 4NZUL 4FG4A 4JFOB 2HFFB 4XI5C 2P9RA 3PDOA 5LBGA 3CMOL 2X9WA 4ZUTB 4CDHA 1V8HA 5C09A 1LO4H 3SGDI 4LLQA 4O51B 2L4OA 2DIJA 5B39B 5EIIB 3MRBA 4KMLB 2JCWA 1NOFA 4M6OL 2ZTBA 4C58B 4XPFL 5J0BA 2IVFC 3NJXA 5DF0A 3UG5A 1P5VB 1H5BB 5IB3B 3O3DB 5IQOA 5GGVH 4NZDA 3PV6A 4NSKA 2E75C 3VQLA 4LCIL 3OQRA 2VDMB 4NNYB 4JZNB 3PP3K 3KGSA 3ULAB 1JCKA 4GKNA 1MLBB 4PY8J 5F7UA 4Q6YA 5A2FA 1M56B 1NGYA 3UDWC 1RK7A 1WFUA 4FNPA 1IGTA 4WU7A 2J43A 4LIQL 4O58H 3VXSD 3PIQA 2PR9A 2Q0ZX 3TWYA 4B95C 5JW4R 1X3DA 4HUUB 4PJGE 4TNVF 2ZUVA 4I3SH 4MTMA 3O81A 3SDDA 1XBDA 2DW5A 1UUSA 1XT5A 2XXGA 2JKJA 2WLMA 2DYRB 3CSYA 3FF8A 2GTZB 5I1CH 2AERT 5KSUA 3ZVVA 4ZPVA 5A7EA 4ZX4A 5CIPH 4V11A 5KSVB 3FU7A 2R56H 2WLIA 1IKOP 1DVTA 3ZE0E 3FUEA 4MA8H 1DJZA 3UJIL 4BBWA 3IGFA 3LKQA 3LH2H 4F15C 3TV8A 1AQKH 4LSUL 2VDRH 4H5SA 4WY7L 4FQCH 4O2EA 5HGBB 2UZXB 4TLSA 3S5ZA 2YRLA 1MG3C 4Q89A 1YUHB 4K7PL 4LCWD 5KYUB 4KO9A 5KJ7E 3JV4B 3CLEH 1JHLL 4WFEE 3B5GA 2G3XA 1CGSH 4ZMPA 2NSXA 4UCFA 4AXWA 1EEZB 3CQQA 4ZMXA 2UVEA 4ENED 2AJVL 3STLA 3T6WA 4E36A 1GAFH 3LH8A 4FOMA 4NKDB 5EFIA 1D7BA 1YYML 4XBPB 5FGSA 3WTXA 4WWKA 4Y2OB 3HR6A 1D5BB 4DPAX 1CMOA 4FXTA 4MXQC 2CJUL 1YEKH 2R2HB 5BJTA 4YEEA 2BZCA 2VCOA 4NQSA 4AH2B 2FEEI 1QO3B 4FTVD 5GIRA 1S8DB 3T65B 5FO9A 1LEKA 1EHLH 1I8KA 4Z7VE 4RBPH 3EFOB 3T0EC 8FABB 4LEXL 4OCMC 1BZ8A 5CCGE 1F86A 1YEIH 3BPLB 3OXRB 3C9NB 2ZNWA 5C0CE 3P30L 5ITBH 2DWTA 2XYCA 2DQIL 5C0BD 1JF5A 2Y36L 3DRTB 4JDVA 2XIBA 1J1PH 4NN5C 4M3JA 4JO4L 5LCVH 4BDVA 4FI6A 3QUZB 3DV6B 1UWXK 3TPKA 4NPYB 3I6LE 2XWDA 1ZOXA 3FTVA 4HSQA 5I8OL 2ED9A 2JJSA 3GSVB 1GZPB 2O4EA 1I1FB 5JHDB 4ALAH 2EINB 4ZNCD 1QBBA 4LU5H 3P73B 1HIMH 1WWAX 4FQ1H 4PJGA 2CH8A 4UOQA 4AJVA 2ZYSA 4NKMA 2VUYA 4FJZA 2AQTA 1MIEL 1F90H 1BXUA 1T03H 4NO3A 5HHOA 4XO9A 3VXSA 3P3UA 4YHOH 2IBZY 1PL3A 3GKWH 3RL2B 3CFCH 4FD0A 4ACPA 3QXAB 1EDQA 1TU2A 2VKXA 3JV6A 2F5AL 3EGSB 3RJOA 2F53D 1RJCA 3WNIA 3QUMB 4TUKL 3KR3L 3MV9A 3S36X 2WNXA 1IBHA 2ZOUA 2ZWNA 3GMMA 1C16B 4IBTA 4YHZH 4OZ4B 1JNHB 3UBXI 4GQ9L 5EDSA 2R51A 4M1DL 5DK2A 4Z3FA 2RIKA 2R2BA 4IRJA 4U1KB 2O6EA 3BC9A 2MFNA 1THAA 1T66D 1UJTA 3NVQA 2EECA 3FPYA 2C1OA 4LARH 1NEZB 3PFQA 3F8UB 4ZUTA 1OE3A 2LHAA 2IV8A 3ECBA 3WHE0 4ELKB 5KTEH 1NLDL 1RKRA 3MV7B 4MX7A 2NUPB 1UT9A 1URZA 4OLYL 2K45A 4Y2LA 2F68X 3S3BB 4F20A 5CCKL 5DJYA 3OGCA 3WFHB 3ZMEA 3NSDA 5AAWA 1HH9B 1A3RH 2X7LB 3P3SA 2G60L 5D1ZD 5EEZA 3HFMH 3O3EA 1ZV9A 2XG4B 3GMOA 4LESA 4ORZC 4X6CF 4DESA 3D0LA 4ONFL 4Q2ZB 4QAMB 4JFQB 3B34A 1RD6A 3ARGB 3MRPA 2VL5A 2LU5A 2J2ZB 1DTUA 1U41A 3JWOL 4Y4KC 3RWCA 1UHVA 1FPTL 4PRBB 3LKRA 1JNLH 1F18A 4ZFGL 3PDGA 4PGCA 4Z7WA 2CDGA 4CC0A 3D69B 3LB6D 3VWKA 5KVDE 2ZQKA 1UACL 4AKOA 2XNAB 4PJ7B 1HT6A 3VQ1C 4GT0A 4JX0A 4PS4L 3ZSTA 3L95A 1OGTA 3RTLA 5JLZB 3H4FA 3S37X 3EBGA 4XN4A 4X0KA 4G7SB 3BYTA 5CBEA 3N1PC 3ZL1A 3NDZE 4K5PA 3CZEA 5K33A 4WW2A 1ZA3B 3Q2NA 5IUCA 1MLCA 1AANA 1B0WA 4U1GC 1JN6B 4QTHA 4AT6A 3S2AA 4XNDA 3FS9A 4NM4H 1Z2KA 4MD5B 1AXSB 5BPPA 2OZ4H 1MKFA 4LASL 3OSKA 4HOZA 1XV8A 1UCTA 3IJSA 3GEFA 2F8OA 4M93B 2FX7H 3L3IA 4B6ZA 2AEQH 5ERWB 3S3PA 4GAAA 3FU5A 3HMXH 1MCHA 2APTA 1S3KH 4MJ5A 4A2GA 2JXMA 5DD6B 3DHJA 3GLAA 1XDTT 3E6HA 4HJIA 2R0ZL 4ZOEA 4EN3D 5ENWA 5MI0C 5DHMC 3K6DA 3UZVA 1QFHA 5KG9A 3JWDC 3KJ6L 2DM2A 5AZ2H 4RAVB 2CGYA 4M48H 4R5TA 1QI4A 1JF1B 5DUPL 4E9TA 3MRQB 3ZDWA 2DOCA 3W57A 1KWGA 3D0VA 5B22A 3STBA 3PXLA 5L8JB 2NY3D 4GIAA 1CFVL 2N0KA 3SBQA 2WIMA 4L4TE 1EHLL 2AANA 1HESA 2NY6B 3AU0A 3RL1B 4XODA 1IV8A 2OMBA 4I7ZC 5ICYB 1P1ZA 5JXAL 5KVGE 2FNWA 1IJ9A 2NQDA 4PBVC 4PW9A 4W9ZA 4D0DA 3MXWH 2CRMA 1DBJL 5ETUA 4PUBL 2GBVA 1XIWB 5LGJB 2XOTA 5AW6B 2CUHA 5C1MB 4AYGA 3B7UX 4S2SB 4ALAC 1QSZA 4FCAA 2GPZA 4P49A 5DUJA 3X11A 3VB9A 1O9VA 4LFHG 4BCYA 1UB6A 4LCVA 1CDHA 3DO7A 1CGSL 1QZNA 2VDPH 2ZICA 5BO1H 3GM8A 1JRHL 4KKZA 3UDWA 1TQCB 1WTLA 1ZLUK 2WQVA 2FJFA 1L9NA 2RCSL 2X4TB 5J3HC 1KTCA 4GEJA 3G6DL 5CJ8A 5DSCA 1BREA 2FYYB 4Z7WE 4ODTH 3DJSA 1MCCA 1SFHA 4IEFB 4CSZA 4JRYD 4GBXD 4M7LT 3W38A 3LKRB 3QEQD 4RMQA 4KDTC 4IU3A 1GW0A 1A7QH 1G7JA 2Y9RT 4AYID 2VLRE 2X12A 3CFUA 1UH3A 2E3VA 4QF1B 2Q8AL 4B60A 3QZLA 1MFUA 2UWEE 2EDDA 2J1ZA 4GG6A 2ARJA 1A6UH 1ZT7A 4LEOA 3ZE1F 1SXSA 5C0CD 5E00B 4JQIH 1DUYB 1F3JB 4KK9D 4AEIL 4K5NA 4HLEA 4MA7H 3UGUA 2QTVA 3O4LE 4WO0A 5I9QC 1Z9MA 2Y6TE 2YC1B 3LKPB 2E5EA 3Q9QA 4GSUA 4NXSA 3N43F 3IMRA 1TTBA 2Z35A 4Y4KD 4YDIL 4E41B 2B0SH 3CVBA 3US0A 3CHSA 3LN5B 4K3DH 3NIGF 3BEVB 1H8OA 3NAAL 3RKPA 2GITA 4E9WA 3VFRA 3WL9B 3DYPA 1XGPA 2X10A 5A16A 4GKSB 2K0RA 2YPLB 5EBWA 1WC7B 3NIFF 3D3VA 5DWPA 4BSWA 3VSVA 3NOIA 3BKJL 3QAZC 4BFKA 5A43C 1YNKH 1QASA 4PJCA 2ZXGA 1E8YA 5F9OH 1F4HA 1HHGA 1QNZL 3PWVB 4XNMA 3HZYA 1WWWX 5CILH 4X5LA 2K4AA 4LIQE 2OW7A 2VE6B 4OGYL 1A6AB 2LV4A 1E40A 1ZE3C 2PKDA 2W9LA 1E90A 4NNPL 4QYOA 2D3JA 3HW7A 2FDBP 5I66B 4JJHA 2VDLL 5JOFA 1Y1UA 4CN1A 1II4E 3H2PA 5HPMA 5D6DA 4Z7UB 1CDCA 1B0GA 3ATDA 2Q86A 1XTLA 4AZ8A 2P47B 1XGTB 3CZJA 1A7PH 4P3DB 1LWHA 4M56A 2Z93B 4N3UA 4JGUA 4MA3B 1FNLA 2FWOB 3V52L 3BZFB 1BVOA 3EYVB 3HG2A 4HEPA 3PNRB 3BH9A 4TUUA 4AYFB 3GGWA 3V6ZA 4IKLA 4OBSA 5B7FA 1BAWA 4QRRE 2HTLC 5C7ZA 3ZE1E 2BOCB 2BVQA 4QMEA 1V05A 4MJIE 3VXQA 4MQ7A 3WXWH 4YHYB 1PCSA 4JO3H 4ODHL 2GBTA 4JFXB 3DI2B 5ENWB 4XPBH 1IKFH 2VABA 2F7QA 3QQDB 5EN2B 2RFXB 3TBSB 2VSKB 5FA4A 1YYLL 1WUNT 3CH8A 2KZ1B 4ODSH 3L7EB 3X12B 4KK8C 2HLFC 3I6KA 4H25A 1AD9B 4MMXC 4PYGA 5BV7B 2BNRD 4TSBL 4HIHB 3CSPA 1AQDB 3NBNA 3GB7A 1IE5A 1NCAH 2H6UA 4NQDB 5DYFA 3BW9A 4JHUA 2VLMD 1NM9A 3KBPA 2VQ1A 2NXYB 4Z78A 4TMPA 5EO9B 5FA3A 3RZCB 2C34A 4YC2B 1J0ZA 4PVLA 1SEBB 2YD2A 1QRNA 3A47A 4O4YH 3UFIA 3VJ6A 1KBVA 2VDRB 3PHAA 4XAKE 1Z5LB 1KSRA 1JK8A 5FOJA 3HHSB 3BX7C 5IT2H 4IIZA 4C56A 1NFKA 4XWGH 4A2DA 4EMZA 2P8PB 4C4BA 5B7EA 1JYWA 2YGVA 4N68A 5DFVC 1IM3A 1T20A 4AYDC 2L04A 1M05B 1AR1D 3FO1B 1QR1A 5C9JA 1DQMH 3QYCA 2DD8H 3T4YA 4PLNC 4MA3A 2EYRA 4PLOB 4P2OC 3EOBA 4IJTA 3TYGH 5E24E 1K4CA 4OIAA 2QQNL 3GT6A 4X8CA 3SQBA 4UV4H 4JPQA 2V17H 2VAAB 4XP4H 3RQ3A 2ZUSA 4OJFL 4HK0A 1UOLA 3SODB 3UP6A 5HI3D 5I66A 3N1FC 2OTPA 3JT2A 3IBOA 4JPIB 3MNVA 5E1AA 5BS0B 1BOYA 4JCLA 4B97A 5ADPH 4GKLA 2OPCA 4AC4A 3SKNB 1FFOB 4XP5H 3ZKQD 3IJ9A 4C55A 3Q06A 5FYLD 3QUYA 2M8XA 2VDKH 3QEQB 3OX8B 4HWNA 1BDYA 5DEFB 3V0AC 4KI5C 4I1RA 4QRRB 3IJEA 1X9RA 5L2KD 5E70A 4I77H 4HDIA 2ZF8A 4YS4A 3BVWA 3LRLA 4YSUA 1ZWIB 4QRRA 6PAZA 1QLEH 3D39A 4QDGA 5FM5O 3RWFB 3FFCE 4P8QA 1DQQB 3DJ9A 3TZVC 3ZO0A 1M1XA 4EUPB 3O4OC 5D1ZA 2KLRA 1SJVA 3L7FB 3MRJA 3OF6A 1UEMA 2B2XH 3L2MA 4XMPL 3VYOA 3CFKB 3H7BB 3KAAA 1JZIA 2BIPA 5D7JC 2K70A 3RUGA 4E41A 5DHEA 3D9AH 3MTRA 3HI5H 4J3OC 1QQDA 1DL7L 4N8CH 3HRZC 4OF8A 4ZMLA 1OF2A 3MV7D 2EH7H 3FU9A 4GBXC 4XCYA 2Z92B 5D8JL 1CYXA 2ZCZA 4ZW7A 4YDMA 1CD0A 2IALA 4YE0A 5I76A 3CDZB 1XF4B 4N5EC 2WMPB 1GJWA 2YARA 3F7VB 1SFDA 1WC7A 3SDXB 1FNAA 2CBQA 2VO8A 4B9FA 2IMMA 1RVFH 3RTQD 3O8XD 4OCSH 4XHJD 4ZQTA 1GSMA 4GP5B 4YIQB 2CNZA 1KFGA 2PMZA 4I77L 5F9WB 1G9NC 1KY7A 4LHUD 1K8IB 3CCHB 5MEPB 1CGWA 1LDPL 1N64H 2VRQA 3EOAB 3QJSB 1X6LA 2R1YA 5CMAA 2HJFB 3A6OA 2VM9A 1TVBA 3HA0A 1R3LA 2FX8H 4X4YB 5BO0D 4PBXA 5JZ7C 3CZKA 4WI9A 2DM3A 4Y4FA 2BSEA 1J12A 3KEDA 1X7QB 3ESUF 1Z0NA 1NIFA 3IWVA 4FTDA 5ELIA 3RVWC 4NQVA 1WFOA 2X70A 2FO4B 5FF6A 4ZS7L 1F1AA 1XMWA 2WKLA 4NQXB 3VFMA 4YHMH 4K8RH 2BO0A 3EUDA 5B39G 2JQAA 1S3KL 2KDYA 2MQGA 3CJJA 4HKXB 3QUYD 2HRGA 2NY3C 3MGOB 1WBXA 3QJHA 3W39A 5F7HA 3M07A 2O26U 1I7UA 3AAZA 4NHCL 1L7TH 4HGWB 4MWFA 3U9UB 4Z23A 3ULVH 2I24N 2G5UA 5EZJA 3HE6B 4N2LA 5DHVH 5I24A 2EUZA 1P1ZB 3IU4L 3PWLA 1FJ1B 1PYWA 3E7JA 3Q2LA 5JW4M 1IGJB 1DE4A 2DWDB 2J8UA 3VXUD 5A3ID 4N5ED 2I60L 4PSPA 5D70H 4HUCA 3R0MA 4V1DB 1XCWA 1T3FA 4TSCL 3VE0A 3ISYA 4FLRA