1COBA

Crystal structure solution and refinement of the semisynthetic cobalt substituted bovine erythrocyte enzyme superoxide dismutase at 2.0 angstroms resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
151
Chain Sequence
b'ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Crystal structure solution and refinement of the semisynthetic cobalt-substituted bovine erythrocyte superoxide dismutase at 2.0 A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Oxidoreductase
total genus 38
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1992-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1cobA00
1PZSA 1IBDA 1E9OA 4FF9A 4BCYA 4L05A 2R27A 2AQTA 2VR8A 2WYTA 1E9QB 1E9OB 1YSOA 2ZKWA 1OAJA 2AF2A 1PU0A 2WKOF 2E47A 1OEZW 3ECWA 3GZOA 1N19A 1SOSA 1TO4A 1YAIA 3CQQA 2Z7WA 4OJAA 3PU7A 1YAZA 2AQSA 2WZ5A 3GTTA 2Q2LA 4A7GF 4OH2A 2AQPA 1B4TA 2V0AA 3GZPA 1SXBA 1N18A 3HOGA 2Z7YA 5KBKA 1SXNA 3GTVA 1JCVA 1Z9NA 2WKOA 3L9EA 1DO5A 1E9QA 1B4LA 4MCMA 1U3NA 1SDAB 2ZOWA 3ECVA 3HFFA 3HW7A 4A7GA 1TO5A 3T5WA 3CE1A 3MNDA 1JK9A 2GBUA 4A7QA 1ESOA 2ZKXA 4MCNA 1JK9B 1CBJA 5CU9A 2WWOA 4A7UA 1IBFA 3QQDA 1BA9A 2WZ6A 1EJ8A 2AQRA 3QQDB 1HL5A 1FUNA 4A7VA 1F18A 1S4IA 1SDYA 1SPDA 2K4WA 2GBVA 4N3UA 2ZKYA 2WYZA 3LTVA 2VR6A 2GBTA 2Z7ZA 1SXSA 1COBA 2AEOA 2APSA 3KBEA 2Z7UA 3H2PA 3H2QA 1L3NA 1F1DA 1BZOA 1OZUA 3CQPA 1XTMA 1P1VA 3MKGA 2WWNA 4A7TA 1Q0EA 1SRDA 4BCZA 3KBFA 3KM2A 1HL4A 5KBMA 1Z9PA 4N3TA 1OALA 1XTLA 1QUPA 2JCWA 3K91A 1OZTG 2C9UA 2C9SA 3ECUA 1PTZA 1MFMA 1SXAA 2XJLA 2NNXA 1RK7A 1IB5A 1UXMA 3RE0A 3KM1A 2C9VA 4B3EA 3L9YA 2AQQA 3SODB 1UXLA 2SODB 4BD4A 1AZVA 1IBBA 2VR7A 2E46A 3F7KA 3KH4A 1F1GA 1F1AA 2JLPA 3F7LA 3S0PA 1DSWA 1IBHA 4U4IA 2AQNA 1CB4A 2WZ0A 1SXCA 3KH3A 5KBLA 3GQFA 1SXZA 1E9PA 3GZQA 1EQWA 2XJKA 4A7SA 1E9PB 1KMGA 1XSOA 2LU5A
chains in the Genus database with same CATH superfamily
1XGTB 2AKRA 2HT4D 3OJDA 5CP7A 2EH7H 4WHYG 3H42H 3BP7B 2GUYA 2Z93A 2R27A 1PL3A 1QG3A 1TVHA 5KSBA 5E9AA 1L0YA 6PAZA 4EXPX 3WTYA 1UH3A 4UQEA 4KC3B 4NUQA 3A47A 1E4JA 1T89A 2K70A 4FXGA 2VWEC 1B6UA 3DECA 1KTCA 5FF6A 3WLWC 4YL4A 1J8HE 4AK2A 2JI2A 3V0FA 3OKDA 3S5LA 3EFOB 2FATL 4OF8A 1XXFC 3GBDA 4AGMA 4KY1H 1T6VN 1DQVA 1UWFA 3I2CL 5I1KH 3E7JA 1AIFB 2XG4A 1CGWA 3IRZA 3M17B 4JFDB 1HYSC 5F9OL 4HH8A 1CBVH 2QSCH 1ZA3B 2CLVB 4RBPK 4A39A 4AMKL 1JK9B 2R56L 1R5IA 3JYCA 2FD6H 4HJJL 3VW3H 3EO1A 4YGVB 1MLCB 1KT2A 4GB9A 3RY6C 2A9AA 2VLKE 3NCYS 4WU7B 4KKAD 3S34L 4BFOA 3LQAL 1XZ0B 4R4FL 1BF5A 3ULVH 1DLHB 4YDVB 4RMBA 3B7RL 5FUCC 4YX2L 2WLZA 4Z0XB 1JPFB 4Z0BL 3VXSE 2K9UA 5TJWK 3ZKXC 4LBAA 1KN2L 3FFDB 5DZAA 3DX6A 1AMXA 4HSAC 1S5HA 2XWRA 1IGMH 2CIKB 3WKYA 3O6FD 2XN9D 1XDTT 3TZVB 2QSVA 5FYLL 5EUOF 3HE7B 1HKLH 2IPUG 3O6KH 4TLSA 3DUUB 4O2CA 5AW7B 1WZMA 1QLRA 4HKXB 3K8LA 1BQUA 3PREA 4PREA 4BE6A 2V4LA 4QIRA 2NY4B 1I8IA 3PLYA 2YD5A 3P73A 5MERB 4FFVC 1HK6A 2X6CA 1BQHG 3BW9A 1GZQA 4Y1TA 4ZYKB 2BNRA 3NA4A 5FYKD 1MIMH 1MCWW 5EO9B 3O4OC 2PXYB 5LO7A 2BOCA 5ANHA 4H8UA 4PRDA 3K80A 3LPOA 1CTMA 4HK0A 3DKHA 3L95A 4Y2DB 4WNQA 1M4KA 2XKUA 4LSVH 3RFZB 2HN7A 4TLTA 1X5LA 2R1WA 1KCSH 2LT9A 5DFVC 3HG1B 4LLVA 3GXFA 5K59F 3LMJH 1RIVL 1KTJA 2D3LA 2WZAA 3OKEB 3FSVA 5FO7B 5C0EB 2YFNA 4J6IA 2WJ7A 2XVBA 1TSHA 2ZSVA 1E4KC 1PQZA 3OAUH 3VMPA 1QNIA 3O3DB 1TU2B 3OXRB 1QSZA 4PJHE 1UADC 3CDCA 5AW6B 4LB8A 3QNYB 1IVTA 3G6AA 1YLBB 4HUNB 5EU5B 4HX1B 1QBLH 1DVTA 4A04A 2GEQA 2VLKD 3CZFA 3VSTA 3WN5A 1J11A 5I0WA 2YLKA 5GS0D 3PWJB 3DTUB 2W59A 2VB5A 4KTYA 5DJYA 4OI8A 2P7TA 5EOTB 2HTKD 4OCXH 3KPMB 1DQJB 3DVFA 3UG5A 4WO4A 4YDKL 5ENWB 3VXSD 5JPMC 2CD0A 2CM6A 1G9ML 8CGTA 2NY3B 1ZS8B 4KXZI 5IB1A 1KIRA 1V7MH 4GRLD 4KXDA 4UU9B 1INEH 2NYYD 4MA1B 2BZ7A 3CE1A 3ZRFC 4TSAL 4ETQB 4A7QA 4JHBA 5EZLB 2EVFA 3RPIB 5C0ND 3CXDL 3E6FB 4OFVA 5EN3A 1NC2A 4BINA 5I5JA 5JIPA 3EZ8A 3CCHA 3VD4A 3CPUA 2DWEB 1KGJA 4R3SB 1BA9A 3UP6A 4MB5A 2VZSA 2KERA 1AGDA 2A74C 2BVOB 4JREB 1CQYA 4LSRH 4OLZL 3UJJH 4M6AA 5AYTA 2APBA 1ZVHA 5EOCJ 1DE4A 1GGIL 2WZPA 3T4AA 2HVBA 2Z4TA 3B2VH 5T1MB 3M7FB 4AIZA 3GSXB 4FXKC 4QTIL 4LSSH 1F41A 5JQHC 4HWBL 5BRPA 2E9BA 5EUOB 4IRSA 4WTQA 5CN1A 4YDLC 3LY6A 3VQ1C 2WUCH 1AGFA 3WFCL 1YEFL 4QRPA 5E9DA 4JRXA 3U4AA 2D31B 4I3SL 2FUQA 5KG9A 1XH3B 3I50L 2IOMA 2CBMA 3GEFA 1IE4A 2MQ0A 4RA3A 4XWOC 1DBML 1FZOB 2ICWI 1IGCL 3KVDD 2OXHB 4TS6A 3E3QE 1NAKH 4FLOA 3FTGA 5CJXC 5D2LE 2VSDA 3FONB 3NEOA 4Y4FB 3L1GA 4PRPE 4RAUA 4NCDA 3U83A 1U8MB 4IK7A 3ME0A 3MOBL 4YNYA 1TLMA 5PCYA 4KKLD 4F1ZA 2V9TA 1RSFA 1OHZA 5LQBH 3ASWA 3BVVA 3MRNA 3V79C 1J7VR 1J9TA 1XF5A 2DQDH 3CZEA 1GOGA 4GRWE 4ELDA 4WW2F 3EIFA 1DP0A 3V4PA 1DQLL 1EO7A 1OCRB 4RIRA 4FCHA 2XTJE 1E9OB 2D0HA 3OLDA 3C09B 3SPJA 3UOAB 5LWYL 5IFAH 1KB3A 4TUJB 4HPOL 2BY1A 4JQVC 4ATWA 3O3AB 1JZ2A 2YPLE 1KCVH 1CZ8L 2VDOL 2B1AL 3AROA 5IBLC 2MCMA 3DUHA 4N0FA 3ZO0A 3AVEA 3J07A 2MNJB 2AQPA 4L5FE 3C2AH 4LPTA 4D8OA 4Z7NB 5F1IA 4PJXB 3MRLA 5C0FB 1JGDB 3MUGB 4L1SA 1IARB 2RB8A 3PGFL 5GRXG 1N2RA 1UM4H 5L7XH 1QR4A 5C6PB 3WY4A 3QI9C 4KUZH 2GC7C 4KNQA 4RVBA 2R59A 3S3PA 1NCWL 2RR3A 4I18A 4UTAA 2O4EA 1F13A 1W6LA 5IK3A 3OKLA 2Q76A 2EICA 5J13C 3KLAA 5D7EA 3NJJA 2AK4E 1A2YA 5E6ID 1X3DA 4X4ME 4UILH 3EOTL 3ZLQC 2HFFB 1P4LB 1DSYA 3BT2L 1T4KB 1FH2A 4L9LB 1Q1PA 1G9NL 1N4XH 4Z76A 1BECA 3UYPA 2P45B 4N1EA 4ZDHA 1YNKH 4ODSL 2VLJA 3WIFB 2V7NA 2E9GA 4QLWA 1WQVT 4Y5YA 2ZKYA 1FL6A 2WTRB 3V10A 5I8EA 1DJHA 2GSIB 2YBRB 4KAQH 3HE6B 3DURB 1U33A 1CDUA 3V6OA 4PRPD 4V11A 1P7KA 5EZOH 2BVUA 1FP5A 2ARJB 4N0CC 2ESVA 5A16A 4GT0A 4L2LA 1HT6A 1PAZA 1WZ1H 1L9QA 2IFFL 2R1XA 2X28A 3P30L 4XB8A 5EEWA 4GSUA 5LN8A 2ENQA 3EJYD 3V4PH 4JJOA 4X5XA 4FQLH 4U3SB 3DX9B 2XTJD 3CHQA 5BRZA 3SGEH 2YAFA 3RURA 2XJLA 4M61B 2GHZA 1R75A 4PW4A 5EF3A 4KWUA 2R0KL 4WWOA 4XR8C 4TQHA 3QO0A 2WXMA 1CFTA 4PQXA 4WNJA 2Q3AA 2EDYA 2YPLD 2E9IA 1ROCA 1T83A 2P42B 3F7KA 2CO6B 4QRSA 2CIIA 4J3TA 3GSRA 1SXCA 5A2KH 5E8OA 1A64A 4UIMB 2VRQA 5KYYA 5ERWA 3EYUH 1G7IB 4ZUVB 1N64H 2VSKB 2JKTM 4FTVA 4M29A 4JFQA 1FNSL 3V0IA 5A2JH 3APCA 1LQBC 2AKRB 4PS3A 3OJDB 4KTDL 1EWHA 4JO4L 5CJ8A 5CP7B 2IQ9H 3ECBB 2Z93B 3ARED 2DBLH 1GYUA 3MHZA 2NW2A 4NZDA 1CE6B 2VDOB 5HHVH 1JXDA 5KVEL 2ZD0A 4AJWA 4QTFA 4CA4A 5KSBB 3I3EA 5G55A 2O6PA 2AMUA 4PS7A 1DLFL 3QAZB 2AK4D 2BVYA 1IC7L 2WTOA 5FF6B 4D0CB 2R15A 2EAEA 3NIFF 5DEJA 3CFEA 3OSKA 4K8RH 3V4UH 5DR5L 2VXSL 4HFUH 1IRAY 3CFDB 2J57A 3EJJX 4CMHB 4M7LH 4KPHL 3LXUX 2E7LA 1A9EB 4YE4L 3L9BA 3MUZ1 4UINL 4M00A 4XNXH 5E2JA 3ARGD 2E9WA 4KRPC 1UT1A 3G6JF 4HK3N 1SOXA 3BYYA 5DD6B 2EDTA 1GZHA 3K6SB 3LIZA 2TRHA 4JFSA 3EHBB 3EO1B 2ADFH 3QHFH 1KT2B 4ODTL 1DUZA 2Y1ZA 4NAQA 4OGYH 2GTZA 3OHXB 2HJFB 1HEHC 2EDRA 2YN5A 1QI5A 2PTUA 1Z5LA 2D03H 1DJWA 2WXFA 2DS4A 3EXJA 2PWHA 4HXAL 4S1SL 1B4JL 4MHHI 4HYTB 2NXZC 3L3DA 3IPBA 3FTYA 4N0UE 4OLYL 1PKQA 4FQXD 5J3HC 4ELMA 2E76C 3DX6B 3M88A 1S5HB 2H32B 2VNCA 1WFNA 2F1BA 5ITBL 4A38A 1A6TA 2E7DA 3QYMA 4NLAA 4L3EA 5C3IA 1W8EA 2O26U 1ERNA 4FQCL 4PLKD 5EF2A 4Z7WA 4NENA 4HUVA 4HQQL 1TJGL 4O2CB 1SLUA 3MJWA 1QLRB 2X41A 3QZMA 5I18H 2X87A 2BHFA 4D9RE 3HMWL 4PREB 1DSFH 4FQ1H 3ZHFA 4NWTH 3RE0A 3WL9A 3W2DH 1CURA 1I8IB 1BFVL 3P73B 2HKFH 2WYIA 3BEWA 4ZTOH 5BQ7A 3FF8A 1ZTXE 2O6EA 4ZO9A 5D4HA 5ACMA 2WNXA 4BE5A 4KHTH 1NGQH 1Q9OA 3D4YA 3US9A 3FS9A 4KKNA 2BNRB 3T6QC 2WBXA 3L4WA 4FJZA 3Q44A 4Y9CA 4PRDB 3QJRB 1JHKL 2MSPA 4CJ0A 2VLMD 3DVGA 4TYUA 3L95B 2WBJC 4FD0A 1E40A 4WNQB 3IU4H 3NSXA 2FX7L 1D9KC 2B59A 2HN7B 2PN5A 1OTUC 43CAA 1EGJA 1A4AA 2YA2A 3LXBA 4KKCC 5F3HA 4P4KA 1XGZA 3K4AA 4M3KB 1GJWA 1PF3A 5IW1A 3FB6A 4XBGA 1KDIA 5F7UA 2A0LC 3BN9D 4X7FC 1G1CA 1T0NA 1Y7VA 1P5VA 5D4QA 3X12B 2ZSVB 1CLCA 1PQZB 2AANA 4LOEA 3FRPA 5DQJA 3VGFA 3LIZH 4OGAD 5DZJA 3NIFB 2DLFL 3Q1SL 1RJLA 1N59A 3G6AB 4L1BA 5KANG 2FJSA 4XP9H 1WAAE 3JWDC 3IGLA 4NO0B 3CZFB 4MXVE 3WN5B 1LO5A 5B3SB 1YEHL 3ARDD 2FGZA 4NAJA 5DJYB 4UI2A 1B4RA 1XIWD 3GWJA 2CALA 5DK2B 3MSPA 3PXLA 4G7QB 1N9PA 4WO4B 2G60H 4JQIL 3QXWA 5E1QA 3KL5A 5I1CL 4JY6B 5HHQB 2XQBH 5IB1B 1KIRB 3FZUC 3BKYH 5D1ZC 3L17A 4UTAL 4PHXA 3WO4B 4U1GB 4YO0A 2Y6SC 5H35A 1NC2B 4P2OD 1O6VA 3CCHB 4MNHA 2PCPB 2DY2A 4OCYH 2OKMA 5I26A 3VVVA 5DMJB 2VDLH 4M6ML 4Z1PA 1GS8A 5I6XB 1F90L 1AGDB 4D9RD 3LTVA 2PYFA 1F3DH 3CHPA 4GNKB 3LRHA 2M83A 4GW5A 1IVLA 5FYKL 3ZHNA 3H9SE 4M1CD 3T4AB 1NGZA 3IDJA 3SOBH 4QXUL 4AIZB 1I9JH 4G1EA 4KJPC 1MUJA 1IZJA 1LNUA 2XIDA 3L45A 4IRSB 2DQJL 3TT3H 1IAII 3MRKA 3GXPA 1XX9C 4EVNA 4IKJA 2BXYA 4QRPB 5E9DB 5GGTH 3DROA 4JRXB 3MLZH 2I60H 3ZDZE 5KG9B 3B2MA 1EGJH 1BMGA 3AWFA 2H47C 3T2NH 3NSCA 2MPAL 2CK0H 4D2NA 2Q9OA 2OZ4A 2BY0A 3F00A 4G8EA 2EO7A 2B0SL 1QW9A 1JGVL 1WLHA 3M8OL 1GPOH 3FTGB 3EBIA 4YH6A 4B53A 3CN1A 4RAUB 5DF0A 1EHXA 4DSYA 1CGUA 5CILL 2FYVA 3ME0B 2RMNA 4YNYB 5GS0L 3INOA 4NC1E 1IEAA 4I13B 4ZO7A 1AYRA 1XF5B 4PJ9C 4M7KH 5GGSA 2YD8A 5CIPA 5F7LB 3V4PB 4GUOA 1FVDB 3OVUB 1GC1C 2YQGA 4RIRB 5AL8A 5BUPA 4JHAL 5E99H 3A6BH 4HJSA 4L0ZA 5CLWA 4RISL 4LNRA 2NUTB 1YAIA 2KLSA 3B2XA 1QO3A 3MV7A 4M7ZC 2OV0A 4FCAA 4Z23A 4LFHG 4TSBH 4ZFOA 4ZW8A 4A37A 4N0FB 1E90A 3CH8A 12E8L 2H0EA 2XFXB 4HOMA 2CO3A 1G87A 5HGBA 4L8BA 3LB6C 4X9HA 5F1IB 3IJ9A 1EDYA 2ILLA 5F96L 2MEJB 2NCEA 1BXUA 3AB0C 1RZFL 4MRCA 2GB2A 2P5EE 1T1XB 1U36A 1XR8A 2ORBL 4CSZA 3H9SD 1EAQA 4G9FA 1FRGL 1RUAH 3HAEA 3MRMB 4I18B 2YPKA 1CGTA 4JKKA 4LEBA 2BS8A 1L5GA 2ADJA 1IGJA 2VXUH 3AS2A 4N68A 4XO4A 5HGHA 5BZWB 1RZIA 2Y07H 4ZOBA 3X3GL 3KLAB 2C9AA 1I8MB 5KVFH 3RKDC 2XU9A 1AXTL 3BUPA 2HFGH 4FLHA 4Z76B 4IGBA 4HWNA 4AJ0A 3UYPB 5I5MA 4PGZA 1LWRA 4R90L 4ZDHB 1H3XA 1GR7A 5E4AA 3D25A 4PJAA 4Y5YB 1VGEL 3V5DA 4ZMZA 4X6BA 3C6LC 1FL6B 4PJ5E 1F4XH 5I8EB 1FSKB 4CC0A 4CVWA 4ENED 2HKHL 5FW6A 3KPNA 1ILSA 1PG7L 1LE5A 1TQBC 3ARSA 1P7KB 5AWNL 1P6WA 4PJHF 2ESVB 5D7JC 5IV2A 1KFGA 2K8QA 4HWEL 3X3FL 3O2DL 4ZUTB 5IB4A 5E2WH 1DQTA 5I74C 2R1XB 4N22A 1RZPA 3VXUE 4HS3A 5CINH 5T3XL 4PV9A 4YBLB 4M02A 4UTCA 2WSKA 1OP3H 4X5XB 4JG5A 3OZ9L 4G80A 1U3YA 5BRZB 5DVNA 2WUBH 1WC7A 3UBXA 1FV1A 3QO0B 2EYRA 4F2FA 2F7QA 5GGVH 2E46A 1WWBX 5DDHA 4R9HA 3H3KA 1OM9A 3ZKNC 5ESAA 4QRSB 2CIIB 2VRAA 1EHLL 3RL1A 1Y6NR 2DQ6A 3GSRB 4PJFE 3IFOB 4BWUA 2P26A 3M7OA 3HMXA 4KI5C 3OB0K 4MVBC 5E8OB 4PYHA 3SD2A 5KYYB 3JTSB 4BQ8A 3T4YA 5ERWB 4MJIA 3RVUC 1JNHA 3UTZA 5I9QB 4FTVB 4P23D 3E8UH 4JFQB 2P5ED 1FG2A 4GRLB 2CKBH 2EC9T 2DYRB 2BSTA 3NTCL 4GAYA 3HAEH 4C56E 2NW2B 2R29A 3A6CH 3Q1EA 4UWQB 4FULA 4FFZL 3WKMH 1FLRH 3O2WL 3EYQC 2WZ5A 5GRVL 1OV8A 3N43F 4S1RH 4XVJH 4NWUL 4UV4L 2W60A 1IFHH 2XZAL 2EYSA 4J6RH 5BO1L 3RUGE 5BNXD 1AS8A 1MFBH 3HZMB 2XZCH 3BIBX 4UM9A 2O6DA 2C8NA 4PJ5D 2WB1A 4AM0A 4PRBB 1KCRL 3MBEC 5D2LF 4GO8A 15C8L 4JM2D 1NQBA 3FCSA 1ZLVK 4F33B 4LASH 1J1OL 1IAKA 5CU9A 4BUHA 3TONA 1XWVA 2P5PA 5DHVA 5HD8C 2LGNA 3HI1A 5I30L 4GRWF 5MP6H 3VXUD 3X11B 4OF6A 2K78A 4A7VA 3UABA 2MKWA 2AZUA 4M5TA 1DUZB 5DD0H 5MHSD 3CFBA 5I75B 2DEYX 2GTZB 3RHWK 2UZYA 4QXWA 2ZOLB 1LP9A 3OC8A 4GLRH 4Y89A 4JDEB 1T66C 1UACH 1Z5LB 3GDCA 4TF4A 3A4DA 3WE1A 5ECGA 5A40E 3ELQA 3TA3A 2CJSA 4WHCA 3BFOA 5FGBA 4B9FA 3EO9L 1PKQB 4L5FL 3QCVL 4ELMB 2R2BA 4HV8A 3ZTDC 3L3HA 4E41A 5FOJA 1QI3A 1WBXA 1CDGA 4R4BB 3HMXH 1W0YT 1A6TB 4L3EB 1EBPA 2TAAA 1TQTA 2QTEA 4UT7H 4HUVB 1LD9A 1W0VB 4NENB 4Z7WB 1IQDA 3PCYA 1FAIH 4GYBA 4HPHA 3U0WL 1JZ3A 1MAJA 1FGVL 1HH9A 1ZD6A 4WCYH 1YMME 2CLRA 1JXFA 1G7HA 2GQHA 3ZZSA 3KL3A 3WL9B 4C56D 1IBBA 1GMIA 2OZ4L 5H4YA 3BEWB 5BQ7B 4B97A 1RHFA 3F7LA 3TM6A 5BOJA 4FNSA 2YC1B 1EPFA 1Q9OB 2EH8L 1MF2H 5DTFB 3UDWA 1JDDA 2CO2A 1MG2C 1ONQA 4W9CC 3SDYH 3V9EA 3FDWA 3AMLA 3X1EA 2GJ6D 5F6HJ 1OSPL 1ITCA 1KBWA 3C5ZD 4MMZC 2MQ3A 2B59B 4JVWA 1QBBA 43CAB 2OMYA 2ZXAA 5F3HB 3B2UC 2YPVA 4P4KB 4R0LA 1KIPA 1NIDA 3CC5A 2YS4A 1J9SA 2JI3A 3N43B 3ESUF 4L8SC 3FB6B 4UNTA 4XBGB 5IW1B 3P1VA 3WXWL 4CKQA 4LVHB 4YZWA 5E6IB 5CCJA 1DBKH 4RGOL 4WHDA 1AQDB 4IBUA 4P5RA 3C8HA 1KBPA 5DHVH 1B90A 1IC5H 3FRPB 5DQJB 2V37A 3UG3A 1PS3A 2ADGB 4PGEB 4LPWA 3Q6FA 1RJLB 1N59B 3U30B 2P1YA 4GMSL 2HJLB 2Z7YA 1U8JA 2XXMB 4AYEC 4PU2A 5M94B 2WKOA 1LO5B 1MNUL 1DO5A 2DTMH 2JFCA 3P2BA 4JR9L 4MDJA 4X9GA 1P84K 2BHZA 5AYUL 1U3NA 5F44A 3NG5A 5DRXA 2IOOA 1H3TA 1HHGB 3P4OA 4RMUA 2X38A 1HWHB 2XLLA 3T5WA 1EJOL 1DJXA 2VT0A 3KS0H 4JUSA 3QQ4A 3QULA 5ANMA 3JWNE 4HXBL 4GRWB 2YZ1A 1DZ0A 2NYKA 2Y1AA 2A6KA 1JN6A 2BZCA 2D2OA 3O2VH 4YO0B 4P05A 2EE0A 4U33A 4R7NA 4OV5A 4MNHB 3ARFD 3WNKA 4YSAA 2IDSA 35C8L 1P9MC 4QY8B 3GIVB 2CXGA 2GTQA 1YMMD 2PYFB 2V3FA 3FMGH 3V0VA 2V9RA 3FQWA 2OSWA 2VITA 5IQOA 2FBJH 4GW5B 1QUNA 1AS6A 2KHAA 1NGZB 1JNNH 1BQKA 1I3RA 1TIUA 4XAWH 3ARUA 4G1EB 4Z7UA 3Q6GL 1MUJB 1LNUB 2R4SL 1K3IA 3MRKB 3AQDA 2X1PA 3QXAA 3ULUL 3QDJE 1D5XB 4EVNB 4OQTA 4B41A 1KYAA 4F8PA 4R5XA 1V7NL 3DROB 3P2DA 5DK0B 3UYRH 4A68A 5BCAA 3JBG7 1G84A 4FLQA 2QSTA 4WI9A 3QIBC 1TJMA 4DP2X 3HB3B 4RZCA 3VRJA 4OI9A 1SM3L 2EECA 5GS3A 5T5NG 1HU8A 4G8EB 2QKIC 3BIAX 5B1CA 1F1GA 3HG5A 2AK4B 1GGCL 3CVIH 2Q8AL 4NB7A 5JO5B 3WUWG 2RTTA 3HRZC 4G8GE 3NIGB 2IWKA 4KDTC 1E2ZA 4D3CL 5D6DA 1QFWI 3BN3B 3PWPA 2FX8L 3N9GH 3CN3A 3V6ZA 4BFRA 2UWEA 1MAMH 1XH1A 4NJ9H 4RMVA 4PWFA 1SVCP 2N56A 1KPVB 5IROA 4I0KA 1QP1A 1A7QL 5GGSB 3BXNA 5CIPB 5C7XL 3VG0H 4JX0A 4L4TE 2PWGA 3V5HA 2FT7A 4KOBA 3ARGB 4OFQA 2CKNA 2DOCA 4H7VA 3APFA 1H3GA 3UPAA 2J44A 2X9WA 3H55A 3U0TA 4B50A 1LILA 2QPFA 3MV7B 4ETYA 2DMCA 5T1JA 2D0FA 1YEIH 4AVKA 3G08A 3QZPA 2V0AA 3QPXL 1DBJL 2NCMA 3ZRSA 4KKZA 2F0CA 3VFNA 1CYWA 1U0QA 4L8BB 1EHKB 1QSEE 3GTVA 3VD2A 2QADC 1NMCB 3UADA 3BKCL 5EULV 3QNZA 1LO4L 3EDJA 3BSHA 1I7TB 1QOKA 5FA4B 1IT9H 3FQYA 4KQ3L 3W39A 4FA6A 4HLZH 3UIYA 3ZSSA 4NGHL 5BZDA 3IJHA 2ZWKA 4G9FB 5ES4B 3HAEB 3BLBA 4W70A 1VDGA 4CN6A 2EDBA 2F5BH 5B3JE 5J12B 5CZKA 5J1SC 1J1XL 2ADJB 1IGJB 3BO8A 4X9YA 5HGHB 1L9MA 2X7LA 4PWGA 3QDJD 4YEFA 1RZIB 2VO5A 3QUXC 2X10A 3ILQC 4NFCA 4F7MA 3AITA 1FZMA 1Z9OA 3VFGH 4UTBH 1GS7A 3JWNG 5IOKA 4DT2A 3OWRA 1A6PA 2VZ3A 2FAUA 4WI7A 3D25B 3V5DB 4EI5C 1FF5A 2HUEA 4X6BB 4PRHD 1L3NA 3KPNB 4N0YL 1OAUH 2BSEA 4G8GD 5D9SA 2NSMA 4X6DE 4WAFA 1NMAH 2HT3C 4EUPG 5IHUL 1RZKH 1YQVL 4K5MA 3RYMA 4EKXA 5IV2B 3ZL1A 1WAAF 2A9BA 2GYSA 4J23A 4X7EC 4LL4A 4YE0A 1FO0A 3ZQWA 4P04A 4FDWA 3B83A 1L9PA 2ED7A 2GAZA 4I2XE 1FL3B 4HS3B 1M7IA 4NRYA 4PV9B 1T4WA 5I28A 3S36L 1J0KA 3FPYA 1QSFA 1UXWA 3EYSH 4G80B 4L4TD 5GPRA 4B6ZA 1I7ZB 1ZIAA 2Q20A 1E5UI 2E4TA 4XI5C 4XPFL 1P4BH 4Y2LA 4A6YA 4E0RB 5CZXD 1OAYH 1WC7B 4UDUB 4ABUA 4YHZL 1FV1B 2EYRB 3LZPA 3WI9A 4OAWB 5LNEA 1HOCA 4LARH 3UIZA 1IQWL 4PBXA 1Q90A 2ZJSH 5I19L 5ESAB 3AS1A 4Z7NF 2J8UA 5ACLA 2UVEA 1MCSA 3RL1B 2AI0H 5B38A 1JFQL 2D7TH 5KWYC 3SYPA 1QSED 4M4RA 1YJDC 4DKDC 2BH0A 4AE1A 3GMLA 2OBGA 1CDCA 4XOEA 1BQLH 1ZHNB 1I8LC 3FO2A 3BP4A 4MJIB 4BCYA 2AQTA 4BXSV 1JNHB 1TJIL 4BUQA 1NBVL 3HFMH 4UOQA 3RFRA 2FCBA 4DERA 2BSTB 3DRTA 4GAYB 2YPVL 2XX1A 1B9KA 4Y4KA 3AMKA 5HGAB 4DK5A 3IVKB 3SO3B 4NZUH 3VRIA 4OZHE 4OLUH 3RWCA 2NY6C 1VACA 5HJ3A 2R2HB 2QPDB 4UAOC 3HS9A 2C9XA 2MOVA 2W60B 3L7FA 2XWZA 4N8VG 5C6TH 1CI3M 3EZJB 3ZDZF 5IJKC 4P3CH 4UM9B 2ZOWA 3HS0B 2Y5EA 2ZG1A 1HNFA 4AM0B 3IWUA 3TBBA 3W3BA 1RJCA 4O58L 3STZA 2ZNWA 1VEMA 3FCSB 4FTDA 4MNQA 5BW7C 1KB5L 2YN3A 3RNQA 1IAKB 1FO0H 4ALAH 1P6FA 3FCTB 4NXSA 2FATH 4XN8A 4XN5A 3HI1B 5KANI 1U6AH 4P5TC 1L9SA 2DD8L 4UT9A 1HQRB 2E27L 4P2RA 3CFBB 3U36A 5C0AE 4UQBA 3MREA 4A6YH 1LP9B 5F9OH 1UT2A 3I74A 3LRGA 2ZUSA 5I71B 1ADQA 1KLUA 2CHWA 4IJ3B 1A47A 2G75A 3L5WB 4G6KL 4UCFA 3TA3B 1HAUA 8FABA 4WSJA 5IHHA 1S9WA 4UBDC 3RVTD 2O1AA 2RQ8A 3BAIA 2R2BB 4S1QH 3L3HB 1JXGA 4KK9C 3DMMC 4KHXH 4XP6L 2VWEE 5F3BA 1WBXB 5KBMA 1TR7A 2BRQA 2WWKO 3EG9A 5HY9B 4OQTL 1BP3B 1LD9B 2DN7A 4OLEA 1IQDB 4TUOA 1BDYA 5K9JH 5D2NC 1OLLA 4TQ8A 4NPJA 4HIEA 4CN4A 1E5ZA 2QQLH 1HH9B 4QI3A 3OAZH 5ICYA 2CLRB 2ZQKA 4N2GA 1G7HB 4AYDC 1OB0A 1TMCB 1WD8A 3HI5L 4AWJC 3S6CA 1EVTC 3MRDB 4FMKA 4RRPA 2P46B 1XBRA 4Y5XA 4FNLH 4HG4K 1YEWA 4GUPA 2YD7A 1JPST 2EXYD 1IJNA 3CDZB 5FECA 1E6OH 1OGPA 2ZICA 4IOFC 4IIZA 4FZEL 1XSOA 1YN6A 1PZ3A 3KPLA 4K07A 5IEKA 1DL7H 5AAWC 1AQ8A 3NJGA 1TEFA 4N85A 5EEVA 4N24A 2VR8A 1KIUA 1NH6A 1RUPL 1SVZA 3ETSA 1L3WA 4H0HB 4JO3L 4OSUH 4QHNA 5FUCE 5ABAA 4F8NA 2P52A 1BEYH 2J5LB 2OMYB 1AQKL 4XNQA 5J1AB 4BRJA 2KBGA 4R0LB 4X99A 1AR1C 1KIPB 2ATPA 2WNGA 3GSWA 4DFIA 3IEAA 3UTOA 2VDPL 4JM2F 1NC4A 1H8NA 5JXEA 4WI8A 3TPKA 1MREL 4IRZA 1LWJA 4IKIA 4U6TA 2Y0SA 3QUMA 5EWIL 1N18A 5FUOL 4K2UH 1IEBA 4UT9H 4A2EA 3KS0J 4GI8A 1U8JB 3CTTA 4K94L 5LUMA 5CF3A 5C0AD 5GGRB 1RIVH 3PABA 4JFFA 1TLKA 3QFDA 5IVXE 4MDJB 5EZIL 5DUJA 5L88H 5DRXB 3P4OB 4G42A 4LPVA 4YBHA 3NRFA 4Q7DA 3QQ4B 1CR9H 5ANMB 1KB5B 3MJGX 4JKMA 1NEZA 5CBEB 4J28A 1BHGA 4BFBD 3WLWD 1JN6B 2H0PA 2VIRA 2A5UA 5CZVL 2JCCE 2VKWA 1HHHA 1QYGH 4OV5B 3EH4B 5IGXH 1B0IA 1D6EA 3MRPA 4OLWH 1G9MH 4JMNA 3RPKA 4X4YA 3OLIA 1X44A 1LDPL 4GBXA 3B8YA 1HYSD 3V0VB 4GI6A 3FQWB 2JELL 2XWXA 5F88A 2CDFB 2X05A 5IHZA 1QUNB 2ZXDA 2DQEL 4LKXB 1G1KA 1I3RB 3SQBA 4JPWH 3VCLA 4Z7UB 1NBCA 3NZUA 1UKTA 4YC2B 1A14L 1BD2A 2XY1A 1Q0YH 2ODIA 3QXAB 3RUGF 4BZ2L 1XR9A 4OLZH 1SMAA 3K4ZA 2WP3O 2WO4A 3FYIB 3RIAK 2XTSA 4DQOL 5BV7L 1GGIH 4NT6A 3S37L 3EUDA 4QTIH 5GZNC 2ZCLH 1ZANL 2XICA 4HEPA 5C0BD 1MXGA 3BGAA 4RZCB 5AVWB 3AT0A 1NJ9A 1AZUA 3MO1B 1MI5A 4X6CE 1MCOH 3JWOC 2NSXA 3UO1L 2OI9C 1GY1A 1X5ZA 4RGNB 5AVRB 3SKJL 2BIPA 5E1AA 1VESA 1MSPA 4JQXA 1ZCRA 3V8OA 2HYMA 2HCZX 3PWPB 4NP4L 3V6ZB 2UWEB 3GDBA 3NZ8A 1AI1L 4M43H 4OZGE 1DBMH 3UMNA 1WGVA 1YYLL 1DCEA 2OPCA 3BXNB 3UROR 3W57A 4NKOA 1U8HB 1BW8A 4HC1H 3V5HB 4N8PA 5KSUB 2AGJL 4E36A 3TN0A 2XA8H 1HQ4A 3HTLX 1C16A 5FIEA 3FOLA 4L8DA 2ZCKL 3U0TB 3CLFH 2X4NA 5B8CC 3GIZL 2OTWA 3S8GB 3D69A 4QGYA 1DQKA 3FT2B 4FFYH 1H3PL 3G08B 5T5NF 4NQDA 1CL7L 1DQLH 5E0FA 3MX0A 3VFNB 3QB7C 4M3HA 2OMWB 1I1YA 1TSRA 2YRPA 2DTSA 2EDDA 4OJFL 5DFVD 4N8CL 3R7RA 4DP4X 1XSKA 5C09A 3IGUA 1XL6A 3MQIA 3MOQA 4PG2A 2B1AH 3T8MA 4MMXA 3RI5K 3VSQA 1JHTB 2DQIL 2C9RA 2OR8A 3W39B 3R8QA 5IQ9A 2GCYA 1TETL 1NBZB 3GINA 4WIQA 4I77L 5BZDB 4PCYA 3IJHB 1PBYA 3GMPA 1DHKA 3FQTB 5I15L 1IILE 2CWRA 2VXTH 3C5JA 1OWRM 1RZ7H 4RMRA 4LP4A 2VDRL 1P4IH 3BO8B 2N7SA 5DEFA 4JN1L 5F2FA 3UTPE 2J73A 3PGFH 4PS8A 4MX7B 3OB8A 2F58L 4TSCH 2YJLA 3UJTL 4GXVL 1A1MA 1HXMB 1TYJA 3BAKA 2Q7YA 4AMWA 1TQSA 4GP4B 2CUIA 3HHSA 3BRFA 3ZE2E 1TYEB 4XMKH 3D50A 3V7AE 3WMQA 4N2DA 4OZIA 2APSA 4MAZA 3PDOA 3UPCA 1WT5A 2JQMA 1P1VA 1YPZA 3D5OF 4LOFA 4K3EH 1BF8A 3KBFA 3VDAA 3RUGB 2BOBB 4A2LA 5I8OH 4P4RB 2GJ6B 3CFMA 5GIRB 3WEXA 4IIQC 5FO2A 2DQUL 3QGVA 4LEXL 4JGUA 3BD5A 4KX7A 4R8WH 5EIVA 5EO0B 4DEPC 2BC4A 1VCBC 3QQ9C 4NRYB 1F86A 1M7IB 5D93C 1K72A 5BV7B 3V4VA 2IGFH 3FHQA 4W81A 5DWUL 5LGHH 1QSFB 1UXWB 4H8WL 2ZTBA 2YD0A 3PAYA 1WUZA 3GXUB 4MA8H 4A6YB 3RZCA 2JLPA 2APFA 4OY9A 2DI7A 3F12A 3ZZQA 2QGDA 4YFLF 4HIHA 1FNGA 1S9XA 1SHMA 1IAIH 1HOCB 3V5KA 3P30H 1R33A 3P4LA 5CP3H 3QARA 2ICWJ 4WLCA 5B39B 2AZAA 2J8UB 1JZJA 4QR7A 5B38B 4OD1H 1AJ7H 4M4RB 4P2QD 5DA4A 5HVFB 1NGPH 1QRNA 1NM9A 4S0TD 3GMLB 4MNGA 1IE5A 5TDOA 3SDCA 1E9QB 4QRRA 3BP4B 4YXHH 4XWOD 2AF2A 1JTTA 1F02I 3MC0A 4XVSH 4C58B 2FH6A 2ZUWA 2YSTA 3DRTB 4O51B 3NJVA 1ZGLP 3CK0L 3OMZA 4J4PA 1G7LA 4TQEH 5IMOA 2Q2LA 2VL4A 4AGPA 1TNNA 3VRIB 4RWYH 3RWCB 2V5RA 1VACB 2B2XL 3TBSA 3ARBA 3NQKA 3ATAA 3GXIA 2K8MA 1XAUA 3OBAA 4PJBA 3L7FB 1YEKL 3CQFA 4G82A 2G3XA 4TULH 4J3OC 1AKJD 3D8MA 3ROLA 3I6SA 4MZRA 2D4FA 4F92B 4C47A 4M93B 5H2BA 1JYVA 4CGTA 5GZOC 5JW3L 1DLFH 4U1IA 5IBLD 4QAWA 2H9GA 4KMTL 3STZB 5JW5B 4JRLA 4LHQB 3QQDA 5E94B 3TZVC 5F7WC 3HE7C 3U7WL 1DFXA 2GY7B 1ZEAL 1KXVA 4HBCH 4PGBB 5DR5H 3CZSA 1Q72H 3UEZA 4IRJA 3DGGA 2AJ3A 4WHYH 3V4VH 1EEYA 4KPHH 5KVGL 3QI9D 4P2RB 1EUTA 2NY4C 4RFOL 3Q05A 3ZRCC 4DP8X 3MREB 2EO9A 3NSYA 3H2QA 4Y9FA 3SBWC 1E4WL 1KLUB 3DJZA 5C86A 1HEJC 5F7YC 5TE7H 1BQRA 2ZUYA 1NCDL 3II3A 3QFJA 8FABB 5KUKA 2H8PA 4IBTA 3INUL 1X5MA 4KKBC 1BG9A 2PXYC 4JFPA 5EIIG 1PZAA 3TNMB 3U6XA 1N5YL 4OQ1A 1KGCE 1L6ZA 3V7AG 4EF3A 1DJGA 3ULSA 2CJTA 3LVTA 4Y2DC 5DUPL 4AXWA 5I1EL 1DQDH 1DJIA 3RFZC 1MG3C 1GL4B 3HI6H 1B4JH 1JZGA 1AZNA 1TFHA 3I3BA 4TUOB 4XN4A 5HHOB 3MOAH 2LLLA 1FNFA 3SGKC 4ANXA 3ZTNH 1K9TA 4LCCA 4XP4H 2XN9A 4DZ8B 1IGFL 2AJUL 1BXAA 3IDYB 4JO1H 5ICYB 1F1AA 1AZCA 4DPBX 1IGYA 1MZZA 5J8OA 4N0CD 5AKTA 2P49B 5ADOL 1GS6X 4P46A 1UEYA 1XF1A 4DO5A 5B3JF 2OSLA 3IB4A 1WEJH 1TT6A 2NNFA 2PW1B 3NGBB 4Y5XB 5HI5C 4GUPB 1KTLA 2ZOTA 4HCIA 4GXUN 1KJ3H 5FECB 1MFCL 3QQ3A 4H2CA 3VE0A 3KPLB 2F53E 5IEKB 3LCYA 1BFVH 3A24A 1G4RA 1KIUB 4QWWC 1B3IA 3IK2A 1P2CA 2Z31C 5I1IH 2BFVH 5KYWA 4XNQB 2NY3C 1SOSA 2DLEA 2PLTA 2Y06L 5SX5H 4WV1A 5T3ZE 3SE9L 4X99B 3TF7C 4MA1C 1J8HA 3GSWB 3ES6A 1DVXA 2VJXA 3IGAB 1HCFX 4X6DF 5DWPA 1NC4B 4JFZL 2AK1L 3GMRA 4M5ZH 3FYEB 1CL7I 3HOGA 3QUMB 3MLRH 4DAGL 1S78C 1IEBB 2G3MA 4M5YH 1OAXH 4JREC 2X89D 3ILDA 4PRHB 4JG1H 4OLVL 5I16A 1Z7JA 3PABB 3OQRA 1UOLA 3AU0A 4JFFB 3QFDB 1MKFA 3ZOAA 1MVUA 2MTPA 3VH8G 2QGCA 4NQEA 2QVFB 3AZUA 4G42B 4AH2B 5B7MA 1VFAA 4XB3A 4JDTH 3VQMA 2NMSA 2CK2A 1J8KA 1KGCD 5FOBA 1MW2A 2YK1L 4IMKA 4PD4K 4QXGH 1NEZB 1IUZA 5TFSL 3LPWA 1CLZL 5MENE 3T0EA 2VIRB 4K23H 1INQB 1RP9A 1SPDA 2K4WA 1X7TA 5HVHB 4U3XA 1HHHB 1T5XA 2BIHA 4P3DA 4WUUA 3T77A 4M8VA 1D6EB 1T20B 2BMKB 3MRPB 4FJYA 4JQIH 4FQ2H 5DMYA 4PJEA 5ICXA 3NPZB 5I1CH 2DMKA 3S98A 2HLEB 3GUFA 4Y1AA 4GBXB 2WHVA 4P9HL 4Y4FC 3DSFH 5IQLA 2WWNA 3SJVE 5CKGA 5DSCA 1C7TA 5C97A 2Q2EB 1X9UA 4OZHF 3I9PA 2IBZX 3SQBB 3H7LA 3VCLB 4MA3A 4DO6A 4LPYA 3MV8E 1RKRA 4LVNC 2RJMA 4M6MH 3CXHK 2X2UA 3L13A 4AX3A 2F53D 1XR9B 2YXWA 2IH9A 4TTDC 1QLFA 5AYQA 5DZNA 2I9TA 1XH0A 5KVMC 3F85A 3OGCA 4YFLI 1JHLH 3C09C 4PB9L 2NXZD 5CEYA 4D0DA 2HG0A 3MJ9L 1GIGH 5T3ZD 5J3HD 3O6ML 3CFUA 1NLBH 5GGQH 1NJ9B 3LH2H 1MI5B 5FA3A 1BJ1H 5CGYC 1PZCA 5L2KE 1RZQA 2P80D 1UWEH 3E6HA 1BVNP 1UKSA 5E1AB 3WNLA 3SKOA 4EIBA 5I6MA 5TF1L 2F54E 1W2KT 4NQCA 4HUUA 3BZDA 1EZLA 4W9FC 3NZ8B 9CGTA 1MFEH 2V5MA 4U31A 3UACA 4OJEH 1ZMYA 4U6XB 4XGZA 3TVMA 5AD0A 1UM5L 4H8VA 4NKOB 4X6DB 3ALXA 3G5YA 1T0PB 3CN0A 4HT1L 1PD0A 4OKVA 5KTEL 4K3DH 3VX1A 2VC2L 3H54A 3DTXA 3Q2NA 2MQGA 2RALA 3QRGH 1HQ4B 1C16B 2XZZA 3FOLB 4L8DB 2V33A 4LSUL 2X4NB 2OTWB 3D69B 1UUSA 1UT9A 2VW6A 3I6GA 4L9LC 3IGFA 2WBJD 4NQDB 3FB7A 1IBGH 3MX0B 2MKLC 2TRYA 4JHAH 1D9KD 5CLTA 1OTUD 1I1YB 1PY9A 3CXFA 4JVPA 5FC9A 4KKCD 3ZR6A 4XN2A 3STLA 4ONHA 3WDJA 1KJMA 5C09B 3SDXE 4DNLA 1L7IH 3HE6C 1FI8C 1SBSL 4MMXB 1IIIA 2OK0L 2IWGA 4YHIA 3SJVD 1PZDA 3II2A 5IQ9B 5EU6E 5D8JL 2GCYB 1R5WB 3FW6A 1WBYB 2MNWA 2VDMB 3ZUNC 3GMPB 3WXVH 2WXLA 3QBTB 3MUY1 4E9TA 1FQ9C 4CILA 3C5JB 3MV8D 3BESR 4URKA 1MCJA 1S4IA 5G4OA 5F96H 1JYWA 2CXKA 3DETC 4YHMH 1ZJBA 5E2TL 2IDFA 3O4LA 5A6IA 4PJDE 1H3UA 3H0TA 1A1MB 4XTRC 2Q7YB 3EFDH 3HHSB 4OF3A 3ULVC 4G7RB 2ATKA 2QVKA 4HP5A 3OZKA 2EIZA 2R0LH 4LIQL 4JGJA 1T7YA 1UM6H 2EDJA 4WDIB 3U9UA 1P7HL 4WVRA 3PDOB 3MKGA 4GIOA 1FN4A 4XN7A 5DD3L 5EU4A 4F3FB 2J21A 2R0ZH 1YPZB 3L3KB 5D1ZD 2IBGA 1I1RA 2KS0A 1ACYL 4HHAA 2ENJA 4XHQA 3WCYA 3RDJA 3A4AA 2Y6SD 4APQA 2G9HB 1ZVNA 1A21A 2F54D 3WEXB 4ONFL 1NKGA 2A99A 1BLNA 1FFQA 1A02N 5DUBA 2Z8RA 3MXVL 3K4DA 3UGXA 2YD4A 1ZLWH 1IB5A 4PRPA 5FB8A 5IVXF 3RWJA 4ZUUB 3SODB 1S9VA 5L9DL 3RTQA 3HEIB 3NA9L 3EGXA 5AWNH 1E27B 4MJ6A 3BH8A 3RZCB 3GKWH 4PRNB 2EXTA 4MBOA 1KEML 5D7LE 2ZXCA 2I69A 4XPAH 3F12B 2ADYA 4KJPD 1VZHA 3QAZC 1FNGB 4OTXL 5K93A 4HSQA 1T89C 1LEIA 4FXGC 2BCKA 2JTDA 5INCA 5JIIA 1JZEA 2JCCF 4MLSA 3OZ9H 2WCGA 1I9IH 3L48A 3NK3A 2CRZA 2BSDA 4FZ8L 1ZGLM 3ATDA 1QRNB 4LMQI 4JEGB 4MNGB 5TDOB 3SDCB 2YARA 4HLJA 4QRRB 4CC4A 4UQ3A 4CMHC 3FCUB 1TEGA 1CU4H 3FU6A 4YHOH 1IV8A 2VC2B 1OK0A 1QFUH 3LKPA 3MRHA 5EU6D 4KTEH 4J8RB 4H25A 4OM0H 2WYHA 3M1BA 4ANKA 1QVOB 1QFWH 5IMOB 3W0WD 1UCBL 4Z5RA 4X6FA 3U48A 3EHBC 1X5JA 4V2BA 1LO2L 4PJGE 4PJ9D 4NNYA 3TNNA 4H40A 5JW4Q 1ZSHA 1CG9A 3TBSB 2AQ1A 3N40F 3OHXC 3OF6A 4I89A 3KR3H 4PJBB 3F6LA 2VH5H 4NZRL 3NTCH 4GAGL 4E9YA 2DL2A 1A0QH 2N3JA 2A4ZA 5DUMH 3K0WA 4MZIA 5ISZE 4FFZH 4NZFA 4FXLA 4HALA 2NZ1A 4X6CF 5BVPL 1P69B 4U1IB 5L8JB 2H9GB 2ZWSA 3QQDB 2CO7A 1PCSA 3WEMA 3LB6D 4KI5E 1IGTB 4XMTA 4HGMA 2OX5B 1K4CA 3QDHA 1UB5A 2FWOB 3FNKA 3ZKXB 3DGGB 1IU1A 2AJ3B 5C0BB 3TBWA 1EEYB 2XIIA 3P3SA 4PJCA 3FPXA 3HIZA 2VMCA 3DYPA 1ZIBA 3O81A 4FQHA 4K5PA 4WGWB 3U6XS 1RUKL 2PTVA 1SZNA 5D7LD 3AXLB 3VM5A 1AAJA 1WK0A 4H1LG 3F84A 3POCA 2BHYA 4TV3A 4YSDA 2RBLA 3BH9A 4UZSA 1KZQA 5I30H 2H8PB 1RZJL 4ZMNA 1ANUA 3KL0A 4WRLA 4JFPB 3NCJL 4E41E 4G5ZL 1NSNL 4JPVL 3GBLA 1A6UH 3RKDD 3GC3A 1URZA 3CG8A 4OCSH 2H3XC 3KHOA 4XP5H 3ULSB 5IVXB 4AXWB 3DI2B 5LAPA 3K2MC 3KZ8A 1FG9C 3C6LD 1KGIA 4YBQD 5D70H 4BD4A 2X3BA 3EO9H 3FTUA 4L5FH 1GTFA 4LCCB 5GRJL 5DRNA 1L9TA 4DQAA 4FABH 5LGKA 1R3KA 2DRUA 2R23A 1IGYB 4OFKA 2AJVH 4YHKL 5D7JD 5CAYB 5IB3A 4P46B 3VXTA 2HX8A 2XWBB 4OFYA 4XCCL 1JFHA 5E08H 4M48L 1PZBA 1KTLB 4GSDL 1BZ7A 2AXJA 4MAUH 3CLWA 5AB1A 4AYGA 4MAYA 3WN5C 4DVRH 5C0RL 1IGIH 4K3GA 2A6IA 4C4UA 2CA4A 1A5FL 1TZIA 3QQ3B 3VE0B 2X6BA 4UB0L 3ZE2F 2CCLA 3WIIL 1T03H 4WO4C 4ZI8A 3GRWL 4OVUA 5KYWB 5MEOA 2FO4A 5BMFH 2OSXA 2JK5B 1ZV2A 3BLPX 4PRAA 3KGRA 3ZKND 3WO4C 2IG2H 2DQGH 4YL9A 1E7UA 3VGHA 3GMRB 3BVDB 5F0MB 5FKPA 4MVBD 3WE6B 3SE3C 3RGVA 3RVUD 5JPMB 1JD7A 1SFHA 3DHJA 5I6XC 2XHNA 4GIAA 3ML9A 5KBDA 1J1PL 2WMPA 3VWKA 5I16B 3WTWA 1U8QA 2RACA 4PS4H 1U2HA 2W07A 4GP5B 3T4AC 2GBUA 1VERA 1KYDA 4JRYA 4NQEB 5C2BL 3E1F1 1XF2A 1GYWA 3EYQD 3R19A 2CDEA 4IRSC 4N26A 4EPSA 4E41D 4NNPH 3NACL 3T2QA 1A4KA 4U1HB 4Q89A 4O2FA 3NJKA 4JR9H 1TXKA 4AE0A 2EEDA 4JN2A 2JIXA 4PLJC 1WG3A 3T0EB 1KY7A 3E38A 4CW1B 3QWNA 5L4IA 3W37A 4P3DB 4WUUB 1UZGA 4M6OL 2X6VA 1F4AA 4FXKB 2CHZA 5T1KD 3GM0A 1DANU 4AOFA 4PJEB 1ZA6A 3MBED 2ZYRA 2HLAA 1G9HA 4HXBH 1XFPA 4UF7C 4Y1AB 1LO3L 5SWSE 3ZMRA 4JUTA 4H8PA 4Q97A 5DSCB 4PVMA 4P2QB 5HD8D 2EXWC 2DQFA 3MCLH 4LDOB 1OGAE 1EERB 3TWCL 5I66B 3O9WA 4MA3B 2BS9A 2GI7A 3ZDWA 1KN4H 2G0LA 2IPKB 2VDQH 2GPZA 4GKLA 3WIHL 4J5VA 3QT2A 1CDBA 4IYKA 3FH5A 4PB0L 1BJ1J 1T66D 3QSKB 1QLFB 3J2PA 2ED9A 5F7AA 2FEEI 3NUKA 4U3HA 1G9EA 3OGCB 4XPGL 3AWEA 3LVEA 4XBPA 2ZWYA 2XQYK 2GIMA 3D39E 4XRCA 5JHDA 3NAAL 4LBEB 1AQMA 4PY8I 2R4SH 3MN8A 1F6AA 4XCEA 4XAKE 5FA3B 4KKAC 2AEQL 5JNYA 5D55A 5D5ME 2F19L 3E6HB 2PF6A 3SKOB 3L6FB 4QOKA 1R17A 2NZIA 3LZOA 2TSAA 1QPPA 3TEUA 4BKSC 2OJZL 3W9EA 4NQCB 3PWNA 3QDMD 4X8JA 2HAZA 2WOYA 1AOHA 3RBSA 5FWRA 5FGCE 3TVMB 2Q8AH 5AD0B 4KXCA 1GY2A 2IJ0C 3G5YB 4JFYA 4ENZA 4OKVB 1G7PA 1DN2A 3KJ4B 1ZLEA 3DTXB 4I18C 2VR5A 1F4WL 5TGBA 2XC8A 2X2HA 4AIOA 1LK2B 4X4ZA 2XVKA 3SE4C 1F4YH 1YECL 4U6HA 5F8QC 1A7QH 2ENSA 2XPYA 2UZPA 1U3ZA 4WEMB 5A2AA 3FB7B 1CGSL 4E42A 5HYEA 4PVNA 1VKXA 1S3KL 2DQTH 3QORA 4Y5YC 2IWEA 4GQZA 4E5XA 3MMEA 1FSKC 4JFOA 1HILA 3ESPA 4ONHB 5FXCH 1KJMB 5SWSD 5L6YL 2IVFC 3BZEA 1M6UA 3P0GB 2WWOA 4AKQA 5JW4M 2JJSA 3U1SL 4LRIA 2VW7A 3RHWF 4DHLA 1TZHA 1OGAD 2P5WA 5KAQG 4K7PH 4W9LC 4ZAKA 1FNLA 4ONGL 5AW4B 3CVBA 3O3UN 1ZTXH 3GO1L 1S9YA 3OSVA 4IHOA 5JOEA 3O4LB 3HC4L 1I85A 2DWDB 2FGWH 3AU1A 2DEXX 2KZKA 3FQ4A 2ATKB 3C60A 3SZKC 4X7DC 3D39D 4ZZFA 3U9UB 3KYKL 4AYFA 4MJ2A 2B9BA 1J1XH 1T83C 3E9TA 1FN4B 3NCXA 4XAKD 3AJ7A 4ZG1A 4HEME 1AG6A 3NCFB 2R4RL 4HHAB 5HYSA 4YDIL 2Z0BA 4Z9KB 4FI8A 3U46A 4OJYA 1ECYA 4APQB 1E5BA 1KYOK 3KXFE 4ZRGA 3VGEA 2VW4A 1KJ2A 3OKOA 1BLNB 3L08A 1KB9K 1KTRL 5DUBB 1RJYA 1TNMA 4A67A 1WZAA 5I9QC 4C54A 2Z34A 4RMWA 5FB8B 3RWJB 3SE8L 2X4QA 3Q2CA 1S9VB 3RTQB 4WWPA 4QRTA 2H0JA 1X5KA 5IHUH 1HJBC 4MJ6B 3BH8B 3PRZA 2NY0B 5IBTH 1TYRA 4JE0A 4P48A 3OV6A 2V2WA 5DEZA 2VLRE 2VMFA 1LEIB 1YUKB 2WXJA 4NZJA 2BCKB 1HFUA 3T3PE 3WNOA 4R97B 3QHTC 3ZYJA 5KBNC 4IOIB 3QIBD 2A77L 1T1ZA 4FQQA 4UQ3B 2LTQB 4Q0XL 4ZW7A 2E7LC 1B2WL 2LABA 4GIPD 3JV0A 4NC2B 4PJ7E 1XQ4A 3WNIA 5T1LD 5I19H 3MRHB 3PWLA 3NJNA 1QHOA 4H25B 3ZZ1A 3JWDL 3M1BB 3ISRA 4Q14A 3MTRA 1GZHC 5B1AB 1N6QH 1Z32X 3ZL4H 1EZVX 4P3WA 1PNDA 3TNNB 4EN3A 3QRBA 1TJIH 1XGYL 3IPFA 1IM3D 5I75C 4JW3A 1NBVH 3F58L 4ZNCD 4OFIA 2NY5H 1NCAH 3X1GA 4GFTB 1KC5L 1NUFA 2YUXA 4O9HH 3GBML 3SKNA 2J5WA 4AEHL 4MD5B 5EO1A 1B2YA 4XPBH 1D2OA 3U4EA 2AQ3A 1S9KC 2VZ1A 1JMXA 3S3SA 1MLBB 4X8CA 2IO5A 4M8RA 4B9GA 3U1QA 1KULA 4PBDA 2VDKH 3VFSA 3KXFD 3K5SA 1KJ2H 2O6FA 2Y36L 4TKWA 2QADD 2NXZB 3PJSA 1K4CB 4UZUA 1UB5B 2VJ0A 3N1QC 3UPRA 3LEXA 3MZTA 4HMCA 3TBWB 4PJCB 4NKDA 2VABA 4G6ML 1A7OH 3DBSA 4KVCL 3OMAB 3MRQB 3SIKA 1SRDA 4EDXB 5FK9B 2XRAH 3I84A 3GSNA 4WEEA 3IWVA 2CUHA 1MWAA 1DVFA 1VFUA 1I3GH 3BH9B 2VLRD 1CICA 4YAQB 3VU1A 2XBTA 3LPGA 3KMDA 2C9UA 4X4KA 3QUXD 2WLHA 4ABVA 3ILQD 3EJTA 5GRYA 2OL3L 4YWGL 3REVB 4AQEA 1OPOA 4M6NL 4JG0L 2BWQA 1S7TA 3SQOL 5DC0A 4U1MA 2OP4H 1SJVA 2X12A 3SDXF 4LAQL 2AEIT 2YXMA 4P4KC 4JCMA 4QPEA 4TVPE 4BJLA 3S36X 2H1LM 3PYCA 4PJFA 3TBYA 2J1XA 5DRNB 4OIAA 4LVHC 1T0OA 3QUYA 4KMLB 4XP6H 1VLXA 1R3KB 4KNTA 2HT3D 5I5RA 2R23B 2I9LB 1ID5I 5DMKB 4N2EA 3SPIA 4CC1A 3VXTB 2VDNL 2ZOKA 1FORH 3PHAA 1GJUA 1G0XA 3TBVA 3U30C 1SLVA 1GC1L 3B7TA 3H53A 1BZ7B 4LE8A 3D0LA 3GSOB 4PJDF 1U21A 1CLOL 3ARQA 2A6IB 2HPOA 5A2BA 1TZIB 3DXAA 2C3XA 1W80A 3HI5H 3K5RA 2ZP8A 4XI5D 3ZHDA 1AP2A 4ZQKA 2CRYA 5PAZA 4X7SH 4GEJA 4CU8A 1CD0A 3TASA 2BNUA 3HC0A 4IM8A 5MEOB 2FO4B 3D18A 3VRLE 4OGXH 3FHEA 4PRAB 5EC2B 2YD2A 1NFIA 3HUJE 2RA1A 2AJXH 3KCWA 1KLFA 3N1MC 5DHMC 3X1BA 3QZWG 2ICCA 1L6PA 3SKMA 5FKPB 2B39A 32C2A 4NERA 3RGVB 4YXLL 2UUDH 5CJOH 5AZUA 5D2NE 5K1NA 2PO6A 2WMPB 4MBRA 4NN5B 3VWKB 2HH0L 2VDPH 4B5EA 4DVBA 2FRGP 4MJHA 2I5YL 5BVJA 3JTTA 1T04A 3GSNH 4JRYB 3WIAA 4LNVA 2W9EL 5DHEA 5EWIH 4JRWA 4WO0A 3M1CA 2DKUA 3VYOA 3RJQB 2NY6D 3FTVA 1R0AL 3TO4A 5CHNA 2OTPA 1TCRA 5CLXA 1A4KB 1MJ8L 4URTB 3U82B 4O2FB 3ABGA 2WYZA 1H19A 1UCTA 3NFPA 2FEJA 4Q9RL 4LCIH 2JIXB 1S46A 1W8NA 2PPFA 3KPRE 5AOIA 1JCKA 4PV1C 4ES9A 4TVPD 3HB3C 1Y18B 4YUEL 1ZA6B 1I4FA 2HLAB 1BIIA 2QZ5A 1OXYA 1JZDC 2RIKA 2EE6A 3TCTA 3GBEA 3KPSE 4NJAL 5KEZA 3QUZA 3WUWA 5FCUL 5CFHA 1E3FA 1KENH 4U7MA 3MRFA 4HUCA 3SSGA 4QRQB 5KS9E 4BZ1L 4KVNL 3QS3A 4HLEA 2DQFB 3EJPA 4PJGF 1PX8A 1U58A 2O30A 4FQJL 3O9WB 1YMMA 4KJWC 4P5TD 3BHBA 1UJ3A 3CIQA 5ESVA 2IANA 1KCUL 2WXGA 3EO0A 1X9LA 4PFEA 3VSVA 3RA7L 4ZMVA 1O6TA 1AQHA 4N2FA 3VWJA 2QV2A 1ZHKB 5SWQA 1KV3A 1N6VA 4JZNA 3W0WB 4U4IA 4XBPB 2HWZL 1CB4A 1PLGH 4UBDD 4XRCB 5JHDB 4Z8FL 5J11B 4KK9D 4ODHL 3DMMD 1F6AB 2YSSA 1KELH 5AVYB 4GPVA 3OKKA 5JNYB 2ICEA 2JKJA 4H88L 4MQXC 4PJIE 1FVEB 1L9OA 4K5NA 1A65A 4QOKB 1JXJA 1B0RA 5DVPA 3OM3B 3S37H 3W9EB 3X13B 2KDGA 3HS8A 4W9ZA 1JF1A 3PWNB 5JR1H 2YMXH 4C4BA 4R2GB 1FYTE 2IGLA 1UATA 5I1JL 3TYFA 4EI0A 4EBQL 2HG5B 4NP9A 4MJJA 4JFYB 3D07A 1A6ZA 1FAKT 5EOQL 5HHNA 1JAEA 1G7PB 2G3ZA 5CM1A 4JFHE 1CI5A 5J12C 1NDTA 3FQRA 5TGBB 1N0XH 3FKUS 2PNDA 1OOAA 1X5FA 2K7QA 1URIA 3F01A 4O4YL 2DIBA 3NYKA 5IEHB 4GKNA 1CO1A 2UY7A 5CEXB 3FU7A 4IBYA 1WRFA 4OM1L 4U6HB 5I1DA 2CLZA 4NUGL 1YYLH 3EBGA 2WLYA 3TJEL 3B9AA 1INDH 3KPRD 4IGBC 4R83A 3O0RH 4E42B 4YEEA 1VKXB 4FOMA 3SY0A 3QORB 3P11H 2AGJH 5D1ZI 1YEJL 3MMEB 4E5XB 4N2AA 4JFOB 1DQQA 3CX5K 1AR1D 2ZCKH 1MDAA 2V9UA 3PP4H 1CBJA 3AQXA 1IAOA 3GIZH 3KPSD 4UIKL 3LOWA 4U7SA 4F7CA 4AIXA 3F04A 2XTLA 1KG0B 4LXFA 2CGRL 3GSVA 3IDIA 3KVQA 4KO6A 4RBPH 1TZHB 2P5WB 1DVQA 1O5PA 3HNSL 4DEUA 2IQAB 3ULUC 4HKZA 1HX0A 4N3UA 1PY0A 5GJSL 3CVHA 4IEFA 1G6RA 3IS1X 4O5LL 4XP1H 2OW6A 3B37A 2DQIH 3WD5H 3AU1B 1JDAA 4OGAC 4ADJA 1PNCA 4JPIA 5LXGL 3C60B 1BPVA 5I15H 2EE9A 3ZU8A 1UZ6E 3VQLA 2VDRH 1QTYT 2X6UA 3O11A 1PZUB 4L29B 2VM4A 5ABDE 5IW3A 3ZHLA 3D4CA 4IMLA 5HYSB 4Q9CA 1IKNA 3UJTH 4L9DA 3U46B 3RL2A 2H6PA 4DN3H 2E6PA 3WG7B 1A7RH 2VDKB 3IMRA 4HD9A 5A6MA 5JPNA 3AY4A 1AGBB 1NCNA 1V8HA 2J7LA 2Y5QA 3OKOB 4FEIA 3T8XA 5KAQF 4N8UA 4KUCD 1FYTD 2B4CH 1NL0L 4BA0A 2GT9A 2HUHA 1G7JA 3LN9A 2QQKH 3OAWA 2DWTA 2ZOOA 2YMTA 4QRTB 3S37X 3QEUA 3VVWA 2QGBA 4JFHD 3FT1A 3SO3C 4WZ9A 3VYPA 1DZBA 2HKAA 8PAZA 3I75A 2GIXA 1M7DA 5CZRA 3BSZA 4RNRB 3L1OL 1J5IA 4KO5A 1NCTA 3O3BA 1JI1A 4QHKI 1W72A 4AT6B 4QTHA 5IFHH 3MCYA 1TOXA 4AVHA 3BEVB 2N59A 4H8WH 3NZHL 3JWNH 1JVKA 2J1YA 3VXRE 5GZND 3QJHA 1T1ZB 2G4EA 4DIXA 4FQQB 3PL6B 4NZTH 1O6SA 3QJOA 3BUYA 1CK0H 4F58L 4Y19D 4MMYA 4EUPH 2HRPH 3PWLB 3S88L 5F1NB 1PDKA 4YLBA 5B1JA 2DB8A 1MXDA 2I26N 4YOKA 3SYAA 4GRMB 2DQHL 4XVTL 1OP5H 1DVUA 5CO1A 4KX8A 3KBHE 1G6RH 2CUMA 4MZ2A 4EN3B 3SPHA 4KZEL 3BDYL 1KGUA 4YGAB 4F57L 2W8CA 2X4RA 5I71C 2Y7QA 4IJ3C 3SKNB 3TA3C 2ZIDA 2F5AL 3CMGA 2N0MA 5LNGA 5EO1B 4EQ3A 4GINA 1KXHA 5FGBC 4ONOA 3PS6A 4K5OA 3L81A 3N0AA 5C08A 5A2FA 5EBWA 1DDHA 1WF5A 4NOFA 1EO8L 4ZW3A 5JHBA 2F8OA 3K71A 4L4JA 4J39A 5AZEL 1WH0A 3HZYA 3MROA 2WBKA 5D5MF 1UWGH 4N6RA 3VFTB 1MN4A 5FDWA 1HSAA 3LIUA 2H26B 3VFSB 3WKPA 3LHPH 1JGLH 1OTTD 3S3JA 7FABL 3PJSB 1LL1A 4LU5H 2ZX9A 1R3IL 2Y23A 1MQKH 3ATEA 1PVHA 3Q3GB 4OGZA 3UPRB 5JW3H 4X4XA 3LSOA 3CQPA 4XMLH 1ECZA 3ILPA 4NAMA 4NKDB 4JFDE 2VABB 1GGBH 3B7UX 4C8XA 1DQIA 4RQQB 3T65A 2XPGB 3O8XA 3MDJA 4OIIL 5HVGB 4AZ8A 2YWZA 4XPTL 4I2XA 5IMLA 1F58L 1RUMH 4NRZA 3UDWC 1MWAB 1DVFB 3B9EA 3V6BR 1QWHA 1BZ9A 3TJPA 3QDMB 3WUZA 1CICB 1W72H 4BKTC 1NEUA 4NQUA 2WGNB 2EIBA 1T0MA 3KWXA 3LNHA 4DGVH 1PLAA 1BSIA 4AQEB 3KLQA 3KJ6L 3VXRD 3L3JB 2Q10A 2C3WA 1E4WH 2UZIL 2NXYB 1IZKA 2J5LC 3DX7A 1HE7A 3T3ME 3A21A 4LZKA 4R0LC 5B22A 2C7UB 3CZKA 3INUH 3WTVA 1UOVA 2DQCL 3TBYB 5BXFB 2L0DA 4FMFA 1N5YH 3LAFA 3QUYB 1SJEA 1VPOH 3OKYA 2EDOA 2QZQA 4L3CA 1RVFL 2EIMB 1GTNA 1JPSL 1HSBA 2ZOKB 3FUKA 2AITA 5LAXA 4MMZB 4NI6A 3TBVB 2JXMA 3CPLA 3MLYL 4F2ME 3D0LB 1F3RB 5J6HA 3QQ9D 3S4SG 1FNHA 3U0PA 4L8SB 1TCMA 4BHUI 1MJ7H 3DXAB 4PJ8A 2RHEA 5ADOH 2HRHA 2JKSA 1KPRA 1AP2B 1FIGL 4JPQA 4FP8H 4DF9A 2A9CA 3DI3B 2YFOA 2X0VA 2BNUB 3HC0B 1SHSA 3D18B 2Y3AA 1GHFH 3PWVA 4AMXA 1NFIB 4NHCL 2ATAA 2L4OA 2OMZA 2VRKA 5DZLA 5IBUB 3TYGH 1KLFB 1TZOA 1YA5A 1TTAA 1D5IH 4OZFB 3HNVH 3RI5F 3SKMB 1LXMA 4P07A 5H94B 1E7VA 1M3IA 32C2B 5I6LA 3HG1E 4I3RH 4A7GA 2PO6B 3SE9H 3QJUB 4JFDD 5TK2A 3B3IA 4CVXB 4MFHA 4MD0A 4YSTA 5FUZH 4DVBB 1BAFH 2YIHA 4NUMA 5BVJB 3JTTB 1CJYA 2C1OA 2ITDA 1GSMA 2VSMB 3C87A 2X53A 1AO7A 3L3OA 4M03A 5IQ7H 3CX2A 2J88H 5J6GA 2IGTA 4YC2C 5CHNB 3TO4B 1TCRB 5TE6H 2PR4L 4LCYA 4QHLA 4RESB 3T3PF 4JKPL 4J3OD 3NFPB 2FL5B 3GMMB 3CVHL 1NDMA 4LSQH 5D1XA 5FEBA 1VEOA 1M05B 2VR4A 1IAMA 5DJXA 1N7MH 3WSQL 4AJYV 3FO1A 5K9OB 2CBTA 5GZOD 2DLHA 1EVUA 3BLKA 4OZ4A 1HYRC 1I4FB 2WQVA 1BIIB 3LPPA 3O6LL 5ICUA 2CE6A 4RGNC 4TPRL 3RZWA 3MKKA 3QUZB 1IBYA 2W9DL 5C2UB 2JJVA 3CFKA 5A2IH 1MFDL 3MRFB 5I24A 5D6DC 3ZZLA 1S7QA 1AACA 1U8PA 3HE7D 4BFJA 1RZKC 2G5BB 4N9GA 3ATBA 3MUJA 3HC3L 3QIBB 1IEHA 4BEIA 3IMTA 5IROC 3BHBB 2Z9TA 1UJ3B 2GFBA 2P8PA 5ESVB 2QJDA 2IANB 2NY4D 3EO0B 4LAJH 5GSVA 4P9HH 3VWJB 5SWQB 4IBSA 3MV9A 1FFNA 3H9YA 4JZNB 2ICES 1YEGL 4X9FA 1ZHLA 5EUOE 3LEVH 4KKBD 2PXYD 4J3OG 3GNML 5HHXL 1P53A 1CFBA 2GKIA 1YO4A 2RH0A 2W1NA 1S3RA 2YKKA 5FYLE 3VI3A 4RAVA 4NKIL 3OKKB 4PI0A 3BUTA 4Y2DD 3KE0A 3VI4A 4ABWA 3BC9A 4AGLA 1B0RB 2WINB 1E67A 2BVQA 2CH8A 4L2YA 4IK6A 4XNZC 1EEUA 3O6MH 2G4GA 3IMSA 3MA9L 3J7HA 3HR5A 4V1DA 1H8LA 3DO3A 4B9KC 3TYFB 4HU8A 3UMTA 5G4MA 1V05A 5F0LB 1MEXH 5HHNB 1Q1JH 5C0JB 5BS0E 5D7SH 5HI5D 2Z3FA 1ETB1 3FQRB 2VQ4A 1V55B 3IXAB 2RFXA 4GKNB 3RAJH 2UY7B 3BISA 4DUWA 4Z7OF 5KJ4A 2CLZB 4POUB 1PSKL 2PCFA 2IPTH 3ZMEA 4OGQC 4JO2L 3TBCA 1BMZA 3QXDA 1Y1DA 5IM7A 4HIXH 1BBDL 4QWWD 3Q5OA 1OQOA 2LOEA 5LBSA 3THMH 2V3EA 2Z31D 1XCQA 3MNDA 2ZT9C 2NY3D 5FW7A 1DQQB 5DD1H 2HFEA 1ICTA 1U8IA 2X4TA 4UMGA 5ALCL 3AS3A 1KV7A 4N25A 1IAOB 2W65A 5HJDA 1I9RH 2WV3A 2R83A 2YOAA 2Y2WA 2FVNA 3GSVB 2GUOA 2QQQA 3OKMA 3V0WL 3WNMA 4Z7NE 1NPNA 4PJXE 1S78D 1CVRA 5HDOA 5C0CA 3BPCB 5LCVA 3UTSA 2BPBA 2YAPA 3KYMA 3PQYA 1SN5A 5BV7C 3CVHB 4IEFB 1AANA 1HKFA 5CUSH 5T1DL 3TH4T 4H5SA 5KVDL 5FFGA 5JOFA 4AITA 5D8JH 4Y16A 2Y25A 5JLZA 3KLDA 1YN7A 4TL5A 2Y24A 4ZZKA 2B20A 2IH3A 3MLXH 3VRLF 4HF5H 2BCMA 2YD6A 3RX7A 3GI9H 1TUPA 4HCGA 3HUJF 3IT8D 2F08A 5DS8B 1J05A 3DJRA 4NC0B 4FJ6A 3O11B 1IC4L 4OW6A 1QUPA 5D1QA 2VUYA 3ASNB 5E8PA 1AC6A 2XA3A 3GK8H 1YG9A 4WTWA 2H6PB 4HAKA 4E9WA 1EANA 5JPNB 1ZPLA 2P8MA 3T8XB 1N68A 4PWEA 4W6XB 4YK4B 2KMWA 5FHAL 1NIFA 2WXHA 4AW4A 2GT9B 1G7JB 2ZCHH 3KYOA 4Y4FD 3AGVA 4DTGH 2ETWA 2ZYHA 4Y4KC 4M1GH 3BT0A 3JT0A 5BS0D 3AS0A 1K4DA 1WUNT 2WGXA 2GJPA 4KV5E 4OZGA 4MA7H 2CQVA 3BUBA 5ELIA 3I75B 5BJTA 1IIKA 1LDSA 1M7DB 3MXVH 4NN7B 4XWGH 1OP4A 3D2UA 3OX8B 5F7MC 2KLRA 1FFPB 2Y4SA 3L5HA 1W72B 4QTHB 4TTDD 5DCCA 2WLKA 3BQUA 1FGNH 3R4DA 1P5UA 4ZX4A 1I1FA 1OY3B 3ULVE 1ZE3C 1KEMH 1BGXH 4M93C 5DZ9A 4OJAA 3W9DA 4MD4A 4OTXH 1XF3A 3BUYB 2WY3B 5AUMA 2XWTB 5CGYD 2B3IA 5GSRA 1OM3H 4MMYB 3TIDB 4Z7OB 1HHIB 25C8L 4HKBA 2H1XA 5KS9F 4XXDA 2XV2A 2SEBA 1E3XA 1PDKB 1E4XL 1OT4A 3MACL 5LCVH 5E6ZA 4AENB 3LV3A 4E9LA 2AV1B 4H20H 1QTSA 2HVJB 4DFHA 1X4XA 1S5IL 4AG4H 2VQTA 5E8EA 3REWA 2X4RB 1QQDA 3QCTH 3MLWH 2Y7QB 1T5WA 5KSBE 1C5BH 3V0JA 3QUGA 3WDHA 2XQYG 4JDVB 4JY5H 4PRIA 3P02A 4P5TB 3K71B 1O75A 3GHEL 3B5GA 2O61B 3HZYB 4PJIF 5AOMA 3ALPA 1BV8A 3QJSB 2CRIA 4P5MA 5FDWB 3T04D 1HSAB 2ADIB 2BDNL 3P9MB 1ZLSL 1CLVA 3IFLL 4TM9A 4GAGH 1ITBB 3IMBA 3D12B 4ODUB 3HE6D 3ZQ9A 3HUJB 3TT1H 4X4XB 3LSOB 2NW3A 2EJ1A 3ILPB 1PIGA 2Q3ZA 2VZTA 4LHJB 5E8NA 1WIPA 4EDWH 4WEBL 5E1IA 3O8XB 5L2JA 1E8WA 4AZ8B 4Y5XC 3NGBC 1MRDH 2IMMA 2O5YH 4NRZB 3AXIA 3MRBA 4LSDA 4QKXB 4FQPA 2K0RA 4GS7B 1BZ9B 2F2HA 4GQPH 3DETD 1T6WA 1CFVL 4JG9A 1T0MB 2D7OA 4ORGA 1GAFL 3OR7A 3V95A 3CSFA 4XTRD 3DX8A 3BVWA 3ULVD 1NCHA 2I25N 3DX7B 3WEBA 4JKWA 3TTSA 2XCMC 4ZMAT 3N1FC 6CGTA 4G5ZH 2XJKA 5JXEC 2VXVL 4ZMLA 1SJEB 1S7RA 2R69A 2WO2B 2B7DT 1SOQA 2F74A 4ODWB 3QDGA 4L37A 4RMSA 4L3CB 4EJ1C 4YLQT 4JL2A 4EOWL 4YHLL 3DHUA 1EFXA 4MHHG 5JXAL 2XN1A 4BH7A 1IL1A 2JXMB 2A9ML 2AXWA 1VGKA 2XKSA 1FL5A 2Z8SA 5J6HB 3LS5H 1HEZB 1QKZL 3QISA 4UUJA 3P3YA 4F7TB 7PCYA 4IU3A 1XHHA 3VI4F 3GRBA 1P0SE 1UWXK 3CLEL 1SFDA 4PJ8B 4M9PA 3D09A 3E1ZA 5CLYA 4AEIL 1KPRB 4BDVA 1UZ6F 1NANH 1U92A 1UFGA 2BRRL 2NY1D 3W5NA 2BNRE 4UNIA 4JAMA 4ZD3H 1OSZB 4HUWA 1Z3RA 5E5UB 3SDAA 2VTFA 3PWVB 3CJJA 1PLCA 2Z65C 3S35L 5KBKA 4MXQC 3MV01 2OMZB 2QELA 2QHRH 4WK4B 2YXFA 5TPWH 3PG2A 2HXAA 5AQ0A 5HVHC 3EYFB 2FQEA 2J4WH 1A7NL 3OLGA 2J2ZA 3GRWH 4YPJA 4AKOA 2BXZA 5DJ0A 2IC2A 4DP5X 3E0GA 1BOYA 5JHMA 4GBXC 4ZUSA 1X5XA 3L5XH 1II4E 3MODL 5T5FL 3VX0A 2VISA 2WXQA 3B3IB 2J72A 5KVEE 2EDLA 4MD0B 1NLDL 2V17L 1UXSA 1JP5A 2LQRA 2ZUQB 4OB5H 2C1OB 2K45A 2FIKA 2J6EA 3LEYL 3MLTB 3Q5YA 3EHBD 3NIFE 3P77B 1AO7B 3L3OB 5AZ2H 3TEXA 1QHQA 1DBAH 1JUFA 4XPHH 4GQ9H 5I2IB 4LCYB 2HA1A 3NCCB 4QHLB 2AFNA 1ACZA 5GHWL 1DANT 3GS4A 5I1AA 5J1TC 2XN2A 1NDMB 4HIPA 3BVUA 3PPSA 2HTLC 5DJXB 4UNVA 3FO1B 1NFDF 5JHLA 1N10A 1WHOA 5E0QA 2EDHA 4OZ4B 4MSWA 4HDIA 1A25A 5FAAA 3KWUA 3AG2B 2FBRA 5D96C 3HZ3A 4JZJA 4Y2OA 1OANA 4ZT1A 4JQXC 3DLQR 1ZAGA 4N9GB 4PVBA 5IWLA 3V7MA 3CSYA 1UXMA 5HVWA 5JDJA 3JV5A 2CJUH 2X4OA 2ZXWB 4KJYA 3F2LA 3OKNA 3BRGC 2GFBB 1WAEA 2P8PB 2AEWA 4JCLA 2NY7L 2JB5L 1LO3H 1O9ZA 3P9LA 4Y19B 1EJFA 2ZKHL 5GSVB 3BUQA 3TPUA 4F27A 1MIEL 1EV2E 1KNOA 1SYVA 3MV9B 4HMDA 1FFNB 2V6HA 4QMEA 4KMQA 3TN0C 2BNRD 2R0WL 1UA6H 4DP0X 2R7EA 1JJUA 1ZHLB 1A8ZA 1JDCA 3C08L 1JWMA 4FNTA 1JZ6A 4UOW1 2XYCA 4P59H 3M1OA 4I1NB 5GRWA 5F9WB 5HDQH 3VI3B 4RAVB 4XO9A 4B0MM 4QRPE 4PB0H 2YJQA 4UQDA 5E9DE 4JRXE 3UBHA 3RWGA 3VI4B 3OB0H 1CE1L 1EUUA 4KNUA 1A6VL 5I1LB 4XPGH 3VXMA 2AV7A 1JNLH 3F83A 2BVQB 5EZPA 1DQML 5IB2B 2Y1YA 3MXWL 5LJYH 3NAAH 4PG2C 5TQ2L 4MMXC 5B8CB 4S0HA 3ABKB 1ES0A 1NAMA 4BYHA 4V1DB 3GTTA 3WGVB 5EBLA 5CD5C 2AJSL 5F89A 5DJDA 3DX1A 4ZS7L 2J6EH 1TDQA 3UH8A 1FFTB 4DUVA 1SUHA 1Q9LA 1BYOA 3EJCA 2NR6A 3LN4A 5ALBL 1T2QL 4U6VL 2FK9A 3MFFA 2RFXB 1KPUA 2XV3A 2WXPA 4EIUA 1AKPA 4B95C 2DIAA 1RU9L 4J3OF 5BZZA 2X44D 4NNXA 3D1MC 3MLVH 2PCFB 3HFFA 5FV2A 3B2DC 4ZS6C 4LOUC 5IM7B 1XCWA 3QXDB 4WO4D 2XDHA 3P0YL 3T3MF 5DHXB 3RB5A 4KJQC 1XCQB 1WT5C 3A5VA 5FHBL 2HFEB 1TTFA 1U8IB 2X4TB 4Y4HA 5MENA 4K15A 5DLMH 1MCNA 4HZ1A 3EADA 1OIOA 1NC2D 4AEFA 1OCWL 4XE5B 2ZPKL 2GUOB 1ADWA 3OKMB 3VXRB 3MRIA 2OR9L 4GAJH 4NHUA 1RY7B 1PJ9A 3UTSB 1X6LA 5CCKL 3U4BH 1NFDB 3PQYB 4HCRL 5LG1A 2FJUB 3O0LA 4G9DA 3GHBL 5JOFB 2WZPD 1FH5H 3X2QB 4Y16B 3RZCC 3DNKA 5JLZB 5HDBB 3U1SH 2H1PL 5GISL 1D5BA 3BDBA 1JK8A 1CTNA 1R3LA 4HMEA 4IRSD 4N87A 4QDGA 5EOCL 4YFEA 1YRKA 3F5WA 3QH3A 3TX4A 4UT6A 1J05B 3FFCA 5D93B 2Q7AA 5HTSA 2XWJB 4QRPD 5E9DD 1SXAA 5D1QB 1MHCB 3FAWA 3BP5A 4JRXD 5E6YA 5E8PB 5T3ZH 4PLJD 4PJ6A 3NABL 1E6JL 4LLDA 5AW2B 3SDCC 3GLZA 3SEPA 4P57A 4TVSa 1BQSA 4BSJA 3UO8B 1YY8A 4NPKA 5L2KA 5FYKE 1NAMH 3N85L 4FI6A 4HD5A 3A67L 4HFWA 1U91A 5I1HH 1CCZA 1JRHL 3BJLA 3KYOB 2R4RH 3IDXH 1XGUA 1OARL 2ZX5A 4XMVA 1P7BA 1RMFH 3GZQA 4YDIH 4ZMWA 2ESVE 3VXPA 5IHWA 3H3BC 2GK0A 2EXWD 1UD6A 3QO1A 5BJTB 3MVSA 4OCWL 4LCVA 3OAZK 4PGDA 3ARBC 4H0GA 3D2UB 2OSYA 1U8OA 4PY8J 3SE8H 4U1KB 4W1TA 4ZNEA 1FDLL 1ZOXA 5BRZE 5ADPH 3BQUB 1D3CA 5D71L 1P5UB 1I1FB 4W9EC 1KFAL 3GKZA 2H0FA 3TFKC 1NOLA 2YKLH 3LZFH 1QNZL 1JPGA 4XMWA 2MCPL 3W9DB 5E7FA 1XF3B 3EYVA 2FUTA 3FHAA 3NJMA 5AUMB 4ZPTA 5GSRB 3T6VA 3QG7L 3QNFA 1F6LL 4HKBB 2AJZA 4XXDB 3CFCL 4IQHA 4XBEL 4B9CA 2SEBB 4BH8B 4Y0GA 4YSEA 1A7PH 1KXVC 3LV3B 3T3MB 4IRJC 4DZBB 4FTVE 2UYLA 3VJ6A 4XBMA 1BM3H 5IB5A 4G2AA 2KUTA 4X8GA 3N50A 3FQXA 3REWB 5C07A 3JWDH 1QQDB 3WHE1 2ISDA 1T5WB 5EORH 3Q06A 4Z7VA 3N5AA 4PW3A 3O3EA 4UT6H 3FOMB 4EAEA 4F2MB 1CPUA 2F15A 2W0KA 4PRIB 2VN7A 3RVWC 4CUCA 2VCOA 2A9NL 2VSCA 2DLIA 4P2YA 4P5MB 3VFRA 1JGUH 2Z7ZA 1WD9A 1G4MA 4FFTA 1FPTL 1U30A 4M62H 2VLJD 4B5ZA 3D9AL 1KC5H 3L4YA 3QJVB 5DJ6A 3TCLB 4AEHH 2EIKB 3ERXA 3Q8BA 5F21B 1GCYA 4ZMQA 3Q7JA 1XTMA 1YYMH 1C12B 4LCCC 5KYUA 1DFBL 1AHKA 1IKFL 2NW3B 2I27N 3HKZA 2A1WL 5JHLL 3W11C 1LMKA 1H0DA 2ESVD 4P46C 1Z9PA 1MH5B 3V4LA 4Z7AA 5L2JB 1GZPA 4I0PA 1N5AB