1COBA

Crystal structure solution and refinement of the semisynthetic cobalt substituted bovine erythrocyte enzyme superoxide dismutase at 2.0 angstroms resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Crystal structure solution and refinement of the semisynthetic cobalt-substituted bovine erythrocyte superoxide dismutase at 2.0 A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Oxidoreductase
total genus 38
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1992-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1cobA00
1N18A 2AQSA 4OH2A 2JCWA 1P1VA 3KH3A 5CU9A 1L3NA 2AEOA 3GTTA 1CB4A 1SPDA 1IBDA 3QQDA 1JK9A 1FUNA 1UXLA 1OAJA 1PTZA 2WWOA 1BA9A 1E9OA 2R27A 4A7GA 1YAZA 3HFFA 1RK7A 1OEZW 3ECUA 3GQFA 1SXCA 2AQPA 4BCYA 2GBTA 1E9PB 1TO5A 4A7QA 1F18A 2AQTA 4N3TA 2WYZA 1EJ8A 1U3NA 4N3UA 1JK9B 1COBA 2WZ6A 2ZKXA 3LTVA 2NNXA 1E9OB 3H2PA 4A7TA 1XTMA 2WKOF 2XJKA 2E46A 2WZ0A 1F1AA 3KH4A 3GZOA 2JLPA 3KM1A 2ZKYA 1F1GA 3K91A 3HOGA 3F7KA 2VR8A 1TO4A 3CQQA 2VR7A 1E9QA 1AZVA 1S4IA 2XJLA 4A7VA 5KBLA 1SXBA 1YAIA 2V0AA 2WYTA 4A7SA 1IB5A 4BD4A 1IBFA 2LU5A 1EQWA 2E47A 4A7GF 4MCMA 1KMGA 1SOSA 1QUPA 2GBUA 1SXSA 3QQDB 3RE0A 4BCZA 2C9VA 4U4IA 1UXMA 3CQPA 2AF2A 3F7LA 3GZPA 3GZQA 3MNDA 1DSWA 3KBFA 1HL5A 2AQQA 1B4LA 2ZOWA 1HL4A 1YSOA 1F1DA 1CBJA 1PZSA 1DO5A 2ZKWA 3ECWA 1SXZA 3ECVA 2AQRA 1Z9PA 1PU0A 5KBMA 2Q2LA 1N19A 2APSA 1JCVA 3GTVA 3H2QA 3KBEA 1MFMA 3S0PA 3T5WA 2AQNA 3MKGA 1ESOA 1Z9NA 2K4WA 1E9PA 3PU7A 4B3EA 4A7UA 2C9UA 2Z7YA 2SODB 3L9EA 1IBBA 3KM2A 1OALA 1E9QB 4FF9A 2VR6A 2WWNA 1SRDA 2C9SA 4L05A 3CE1A 3HW7A 4OJAA 5KBKA 2Z7UA 2Z7ZA 1IBHA 1B4TA 1SXAA 4MCNA 3SODB 2Z7WA 3L9YA 1Q0EA 1SDYA 1XSOA 2GBVA 1SDAB 2WZ5A 2WKOA 1XTLA 1SXNA 1BZOA 1OZTG 1OZUA
chains in the Genus database with same CATH superfamily
2FUQA 5IIEB 4LSDA 1IGIL 6FABL 3WFHA 5HHVH 4EI5A 1KBVA 3SY6A 3WMQA 4H0GA 2N7AA 5I8KH 1RK0A 3SEPA 4AIZA 4LRIA 4EN3D 5F7EH 2QSVA 2P5EA 1EFXB 3IMUA 3MLXH 1P7BA 1VERA 3OHXA 2XSKA 1WBYA 3NIGE 3MV7A 3GSWB 4G9DB 4K0OA 3RUGB 4Y1AA 4NZJA 5FPIA 3JWDL 5EUKA 1RUML 2JNZA 2YLKA 4Z7IA 1JZ6A 4I1PA 3ZDYF 4LARH 4M93B 5E6ZA 4RGND 5DRNB 4AW7A 3GSOA 2VLRB 5IOPB 4GSRA 1HFUA 1AS6A 2AXWA 2F7PA 2VO8A 2N7BA 3EOBB 4JFQA 3C2SA 4A2LA 1MWOA 3APFA 2Z8WC 2IWEA 4EUPG 2E8ZA 3FMGL 4G8GE 5B1KA 3EFOB 2NUPB 3O2WH 3RKDD 4L4TA 3IPFA 3K5SA 5IEKB 2AITA 3X11A 3FFCD 3VFUA 5C0BA 3P73B 3ZGIA 5AD0B 3P40A 1JAEA 4WU5B 2IDTA 4RFEB 1UFUA 1OHQA 4HDIB 1ED3B 3O6MH 4H4NA 3CDCA 4S0SD 3T4YB 4ERSH 1H6FA 4P9ML 2GSIA 4NNYA 3C60C 3DBSA 3H85A 2EDQA 4ZW3A 2P9RA 3U30B 4NEHB 1IT9H 4YE4H 4OTXH 2YSSA 1PLGH 3UTOA 1AS8A 1PD1A 3C5ZB 2FR4A 2PYEE 3EF4A 3O4LA 4G1EB 4QTIH 5TJWK 1J1XH 3GKWL 2PN5A 1UG9A 1V3MA 3MOBL 4JE4B 3P0VL 1HKFA 4G1MA 1HSAB 4HIHB 3BVNB 1BQHG 3FCBA 4E9YA 3FHAA 5E2JA 1G7MA 4M62L 4YLCA 3DSFL 3IGKA 4K8RD 5M95B 3KEHA 2MQGA 3DPDA 5CKGA 3ETBF 3B9AA 2PTVA 4EO5A 4K23L 4AQAA 1AE6H 2XQYK 1QLEL 2BPBA 2R51A 1T1ZB 3U4BL 1A47A 5E8OA 3BH8B 3KMDA 2I32A 5HHOA 3SPCA 3F00A 3SQBA 5K9QI 4D0DB 2FEDD 4Y9FA 1TEGA 5IW1A 1CDGA 1VGKB 3LNFA 3NFNA 1KV3A 3S4SA 5GS0H 2IXQA 1U4EA 1B0WA 4DVBB 3BIKA 4OLUL 5HY9B 2AK4E 4PGJA 2OP4H 3HC4H 4IKLA 4PJBB 1R3JA 4ZUUB 1KNOB 2HG0A 1PGRB 4KGLA 1PYWA 4F7CA 3QZLA 3ROLA 4X99A 5GGRY 4YR6B 4KH9A 4MDIA 5ERWB 3T2QA 4ADJA 1P84J 2P8PA 2P3YA 4HPOH 5CCKH 1TTAA 2VLJA 1OARH 4B95C 1N64H 4K5PA 5I5JA 5GSRA 4QAWA 5FGBA 5AAMA 4WK0B 4NQDA 2IPKA 2X4SA 3DJTA 3VRJB 1UZ6F 3LNDA 1QQDB 3HMXL 3HS0A 1ZHLA 3V0AC 3GNMH 1P1ZB 3GEWB 3RI5F 2EDNA 3MV9E 5LGHH 5GS2D 3VAEA 1CICB 2HZHA 5DQDL 3OLGA 4ZXBD 5B8CA 1K2DA 2OMVA 3G6JA 2XI9A 1A4JA 1WFJA 2FWLB 3ULVH 4RWHA 3B9DA 3CQQA 4JZNB 5D2LF 3RX5A 1LXMA 4JJ5B 1I8KB 2QHRL 4I2XB 3P30H 4NYLA 1E4XI 2DN7A 2A1WH 2FWSA 4Y5YA 3VXME 4KITB 2V5MA 5K5YA 12E8L 4G80B 3Q9QA 4C4KT 5B3JF 3F7VA 3CN0A 1DBBH 1I85A 2GEQA 5K9OA 1T2JA 1D7CA 3WJLA 1J5OH 1FFOA 5AG8A 2VXUH 1EUUA 4JFFE 1NH6A 3CAFA 2H4EA 4WWKB 1E50A 1LD9A 2K6ZA 5HDBB 3A6BL 3ETSA 4FRWA 4QAMB 2VCOA 1ZHNA 1ODUA 5CINL 1GJWA 1HAWA 1ORSB 2A74B 4L1DA 4OZGE 1LDPL 2R2HA 2VLKB 1C8QA 2I07A 2EO1A 2V7NA 3TU6A 3UTQA 4AUJA 5JHLL 2WLJA 1N6UA 1AACA 4WW2B 1E90A 4FQLH 4NKMB 1ZIBA 3CSBA 4V1DE 4ANVA 1EGJH 4JN2B 5C09D 3VXPB 1FPTH 4YDVB 2UZIL 1XEDA 4QHNB 3RKPA 4G9FA 1BECA 2WINA 5HD8D 4H8PA 1CYXA 5K59E 1F2QA 1HCYA 2HTKC 2W07A 5BMFH 1R3IL 1A7PL 2G3NA 4KI5D 5CEYB 1YA5A 3F83A 1PIGA 1ZEAH 2OKMA 3G7TA 4Y4HD 1N9PA 3QB7C 1IFHL 4N2CA 2J8UE 2CH8A 4JKMA 1VEMA 4YXKL 4Q9CA 3NJIA 3ARXA 1WFMA 1F90L 4JM0A 1OB0A 2EDBA 1RUAL 1BYPA 3PQYA 5FCUL 1OAYL 2VXSH 3HB3D 3PWNB 2AEOA 4TUKH 4QXUH 4WV1C 3U25A 1U95B 1SBSH 4JM2D 1IM9B 3QZWG 4FMKA 3RPIB 2E5EA 1KCLA 1EEZB 4FYQA 2ED9A 3L5JA 3OMZA 5F7UA 1I9RH 1E9PB 1JHKL 1H3PH 1GC1H 1T6WA 3HZ3A 3C5SA 2ESVB 5DZJA 4FNSA 5B1AB 1P6FA 2NY7H 3NA9L 4NKIL 1FYTE 3ATAA 5EFIB 4KTYA 4RH4A 3HHSA 3HPJB 3IKCB 4RNRA 1G4MA 5KJ7E 1R46A 1UZ8B 4IRSC 2DF3A 4X6DE 3RL2B 3IMBA 2IMNA 4G6AD 4DPAX 3UTSE 3NIFB 4OR1A 4FA6A 2V2WA 5LG6A 1T4KA 4HJEA 2FL5B 3N1MC 1JZ3A 2AMGA 4L9LA 1XGPA 1YEDA 2NR6C 1U8OA 1M7IB 5JHDD 2CU9A 2HWZL 2WBJB 4H8WL 4F2ME 1VCAA 4KK8D 3RE0A 4P0DA 4F33A 1ZT4B 1EEQA 3IS0X 4PRIB 4IKNA 4LVOC 3PCYA 5DZOA 1HL5A 5F72S 1D5IL 3U6XA 5E2VL 3WBDA 3PF2A 2B1AH 3IDYB 5IROC 3ZBMA 2R7EB 2TRHA 5AAPA 1UB5A 4OFPA 1A65A 2FLMA 5KVEL 2P5WD 3OKDB 3CDYA 2A6DA 1TQBC 1SYVB 4J39A 2ZWZA 1CLOH 4J27A 2A9NL 3FW6A 5K9KB 2C3WA 1UADC 1R5VA 1ZT7B 3W0WD 1NKRA 1X4YA 1E30A 1TNNA 1U8JA 1WFTA 2YRPA 3L3DA 4JDTL 3RWHB 2VDKH 4OGYH 4BE6A 1CBVL 4M6NL 4NP4L 5GGQH 4LU5H 3SDDB 4ELMA 4EZKA 1CT8B 1E6OH 5IVZB 3V0EA 3VW3H 2OMWA 1Z5LA 2ZSVA 5DD1L 2HTLD 5H94A 3V5KB 4HS6A 1TIUA 4DSYA 3DTXB 5GGRA 4MS6A 2YEQA 2ZCHL 4HFWA 3IJYB 3TONA 2EADA 3O11A 4DGYH 3RTLA 3QARA 1CGUA 5EU5A 3IJEB 3QUGA 4WUUA 5IJVB 3LRSA 4QO1B 2YAOA 1T7VA 4YO0A 4B9KC 5IF0A 4MFHA 4EI0A 4P4KD 3ZDYE 4YHNA 3GSXA 3V9EA 3LKOB 3P9WB 2C7UB 1MY7A 5CJ8A 4XN9A 1KJ2A 4XXWA 5F96L 5CCHE 5TE6H 1D6VH 5EC1A 4RZCB 2C4FT 5DYOA 1UXLA 1G1CA 5CD3B 5AVZB 2IV9A 2PPCA 4OZ4A 1U36A 2KS0A 4HK0A 1NA8A 4Y19E 1VZIA 4DEPB 4FZ8L 3VFOB 1E8YA 5DD3L 1XL4A 4J3TA 1JVOA 4Y5VA 3AWGA 2PW2B 3DX9B 2PWDA 3MA9H 4MMYA 5T5FA 3J07A 5FEBA 3NSXA 1RIUL 3WFCL 1ZD6A 3OKLA 1COBA 4OF7A 1RJZB 1KG0B 1T1XA 3F01A 4GLRI 3HBPA 5IVXF 1X5KA 5I6XC 3NFSL 4G5AA 5E9AA 3VWKC 1KELH 3KNBB 3QJVB 2QL1A 1MUJA 1JPGA 1KGCE 3AGWA 5IJKC 1INEH 3DX2A 3CVCA 2EIKB 3N41B 5B21A 1YMMA 5D5ME 3K91A 5TPWL 1X5MA 4U6XA 4TOYL 1PNCA 3JVGA 3TPUA 4OUUB 4LPXA 4NHUA 3KPMA 5C0JA 2XWJB 4TL5A 1GGUA 3K6SA 4KI1A 1GW0A 3Q44A 3REWA 1FSKC 5BS0B 3OKEA 2C9PA 3OHMB 3SJVD 4E9VA 4FQ2H 2ED7A 4EZMA 2NZ1A 1ROCA 2J6WA 2ZKHL 4FXGA 2FO4B 4JO1L 1DJSA 2EDFA 3ZE1F 1DVFA 2Y7QB 3HN3A 2HG5A 3VQ1C 4WEBL 1SF5A 4HJSA 1RZ8B 3RWIA 4KKAD 4LIQH 3L3JA 1BDYA 3MC0A 4UUJA 1NDTA 4KZEL 2UZYB 1AQMA 3TNNB 2E9JA 3LRKA 4KJQC 5E8DL 3UIZA 5A2LH 4MD4B 4D8OA 2YXFA 2QKIA 1ZHBB 2G5UA 3WUZA 2A4EA 2ZX8A 4Z78A 4N9GA 4PUBL 1ZPUA 1X7SA 4JFDB 1JSYA 4RA0C 1MREL 4UM9B 2HVJB 1RFDH 3CFDB 3U1PA 2YPLA 1HCZA 3EUUA 5HHMB 1MW1A 1ACYH 4OD3H 1ZTMA 3GMMB 1D7FA 4LQFL 3UROR 4ZUWA 1VGEH 3QIWB 3TA3D 3T08A 3CZSA 3QDGB 4AMXA 4NO5A 1UTDA 2HX9A 3OB8A 3IFPA 4FZEH 5TDOB 4TTGA 1F3JB 4CMMB 5T3ZE 3NJGA 1NIAA 4JX0A 5FM4A 3X2QB 3WL9B 3FS9A 4MMXA 4KOCA 1FYHB 2GY7B 2HT3C 3TYFA 4QRSB 1DL7H 1QNZH 3FDWA 1KTLB 2OMTA 1UZ6E 3AITA 4NUGL 3IJHB 3ARUA 3QQNA 5JZ7C 3V4PA 5J13C 3AB0B 3V6OC 1SJMA 4GS7C 2LTQC 2YR3A 4NQXA 3QUYB 1I1YA 1G7QA 3Q6GH 3R0NA 1EA9C 3UJJH 2SEBA 4R7VA 1DVUA 4D9QE 4K94L 2UWEB 5CLWA 1W15A 2Z3FA 4LSVH 1A8ZA 2VGLM 4GAGL 4ZFQA 4MAYA 3UX9B 2AGJL 1LO2L 2PXYA 3EUDA 3S3JA 2BINA 4JGNA 4JJHA 1WZAA 1MVFA 4FI8A 4M7KL 4R97C 1L0XA 3F85A 5B3JE 1ZTXH 4JM2A 1ILSA 4HIEA 3P77B 3HZYB 1SHXA 5FYKE 5DCCA 1CIUA 4MBRA 3RZCD 2ROXA 3BH9A 1TTGA 4LVHC 3FRPG 2JLPA 3ZT6A 4N2FA 1F1GA 1I1AC 1T66C 4WHTA 1QBLL 1URIA 3FN9A 4EE2A 2V5SA 5EA0L 3OR6A 2RB8A 3UYPB 1J8KA 2L4OA 3KLKA 4GI6A 4MA3A 4C54A 3ZE2F 2AKRB 5BZDB 3LQAC 3MRHB 3II2A 2WLIA 2DLTA 3TVMB 4DVRH 1MG3C 5IJDC 3D18A 2HVKA 4RQQA 5CO1A 3P4NB 1MJ7L 1HHHA 1FZJA 3T0AA 3S34L 4YDKL 5FA3A 4CA4A 5C6TL 2CDGA 1EZVY 2N7SA 3CUPA 3L7FA 4BGLA 2F8IA 4PMEA 4XCEB 1JFQH 1YDPB 2HKAA 3QG7L 5C07E 2X1PA 4AIEA 4GAJH 4YEFA 1JCKA 4FEMA 1AR1B 5KSAA 3JV5A 3OPZL 1GCFA 4WFGD 3FUFA 5JHDA 4XTRC 3PWJB 4Z5RA 2EH8L 3PAVA 5EZIH 4Z3GA 1OAKH 2CPUA 5BOJA 1PX8A 3V10A 5D71L 4ZMOA 4F1ZA 5LG1A 3K8KA 3TO2B 2ZP9A 4KJWD 2JIXD 4V33A 3BPOB 3FCUB 3PABB 2P7TA 4P2YA 5EU6E 4PG9A 5DS8A 2OV0A 4L2YA 1JZ2A 1D9KD 3VXTA 3B2XA 2PW1B 3KM2A 2J72A 3K71B 2BY0A 2YN5A 3MLXL 2P5WA 1ZV5A 3BE1L 3QJFB 3MBEB 4IBQA 1IIKA 3FTUA 3LIZA 4PW9A 3LZQA 4M1GH 2FSEB 1E5UI 1JWMA 1MHCB 4LARL 3W0WA 2N1KA 3D69B 2KQNA 2MTAA 2CNZA 4WO4D 3ZYJA 4LLMB 5JXAL 1WE5A 1F4YL 1OZTG 3MFFB 5I1DB 4XBPA 1HU8A 3QCUH 2W60A 4QRUB 4B5EA 2CGZA 4FX5A 1HT6A 3RQ3A 3KH3A 4MJJA 5BVPL 3CX5K 2V2XB 4FQHA 4WENB 4LCVA 2A6JB 2F7OA 2F54D 3L5XH 3K2UH 3QEGL 2F5BH 4L5FH 5SV4A 1KTDA 4LLYA 3O6ML 4DKAA 3IDJA 3RLSA 3F3HA 4XGZA 4ERSL 4P4KA 4ZG1A 1FG2A 3GIZL 5I16B 2Z65C 4JR9H 4UILL 3N91A 2V8MA 4PJEB 2VO5A 5E2TL 8CGTA 1BQ5A 4YE4L 1AZRA 4OTXL 4GRWF 1DQKA 3SE3C 2V4LA 3TWYA 5KZCB 2WUBH 1PLGL 3UG4A 4XHJD 4E41B 2L7EA 1MCWM 1QVOB 4R0LC 5JPMB 2DQTL 3HZMB 4FHKA 1YC7A 4HG4J 3QA3B 1JDDA 1JRHH 5DMYA 4DTGH 1AD9B 4URTB 3QDMA 3TXAA 4OCRH 4HKBA 1BM7A 3LH9A 1MG2C 3BAIA 3ZTDC 5EZLA 4ZJ9A 3RX9A 4W9LC 5BXFB 1FVDA 5GS1A 5JQ6H 2FH6A 5BO0D 5D7LB 4IOFC 5I30H 1QSFB 3E6FA 2BW5A 1I9JL 3SGJA 1AE6L 3FQXB 1A14L 4M6ML 2V7HB 1WAAF 4HMCA 3SE9L 3RFZC 4OZIB 4PBVC 3S2CA 4AZ8B 1GMIA 4MS8D 5E1IA 4PGCA 1ZA3B 3LDBC 4P04A 4ZYKB 3FPYA 3PP4H 5ANMB 1W0VB 3QJZA 2DM4A 4K4KA 3ZZSA 4JFOA 5E6YA 2XBDA 3GRGA 2NT1A 4HUXB 2OP4L 1I8IB 3SKNA 1FI8C 1BQKA 3MUHL 2CLZA 4YGAB 1IEHA 1FN4A 5KYWB 1INQB 3CDGA 3OSKA 3S3BB 2ADYA 3QFJB 5DFWH 1YN7A 1PKQA 1XGUB 4ONHB 2FX7H 2IWKA 2B77A 3TEXA 4HPOL 3W39B 4PGBB 5CCKL 4TNVK 1S7QB 5IW6B 3PNWA 1OARL 5AOLA 4OF5A 2CHZA 3TM6A 5T5FH 2C3HA 3OQ3B 3I6LD 3GDCA 4BWWA 1P5UA 4XP1L 4Z8FH 4MMZA 1E8WA 2L04A 1S3RA 4DN4H 2TSBA 3GNML 4PJCB 4GKZB 1S7WB 2GJ6D 2JJTA 4FTDA 1H0DA 5E8NB 2ZYSA 2AXHA 2DLFH 2WOBA 3OXRB 3BN9D 4YDIH 5LGHL 5JPNB 2XCMC 1LP9A 1A2YB 1SF3A 3FTYA 2C7FA 2Z4QB 4X6EB 1B2YA 5IVXE 5EUOF 3MCYA 1L9MA 3ULVL 1IBDA 2P43B 1PNDA 3IGAA 3LB6C 1OWRM 4K3DL 4Z77A 2Y4SA 4W70A 1ITCA 3SBWA 5AL8A 3VGFA 4AJWA 1RK7A 3H42H 5D7EA 5CZKA 4JGJA 2Y1AA 2Y23A 3BX7C 4JN1L 5AW6B 4EI5B 2Y2YA 3UTTD 2Y36H 3A4DA 2XTJD 1QG3A 1J5OL 1RK0B 4DKDC 3SDYH 4AIZB 2YAFA 2VZSA 3DOHA 3NZHH 3Q3GA 4GQ9H 2R2EA 2WXNA 4KKPA 2VXUL 2P5EB 2DM3A 2FNWA 4Y2DA 1BYNA 4EOWH 1JHLH 4ZO8A 4F7TA 3MV7B 2HKHL 4AC4A 1UACL 4Y1AB 5C0ND 3ZE1E 3QR0A 1Q0XL 1UWXH 5EUKB 1DSFL 2E86A 4QXWA 1MW2A 5LKNA 1QPXA 3BCFA 3GKZA 4TVPE 5FUOH 3OZLA 1T6BX 2QVMA 1WLHA 3GSOB 1CI3M 3K81A 3V6BR 1Y07A 3EHBC 4QXGL 2JJUA 2AQ1A 1RZKC 1E5YA 1K5NA 1RZJC 4XCCL 5IM7A 4JFQB 4FQLL 2EIJB 5JMOC 3DROA 4N68A 5IQ9A 4YXLL 3OL2A 4A2GA 4Q7DA 2GUOA 4J4PC 1EGJL 4N1CA 1T89C 3RZCA 2Y9RT 4L4TB 3SPJA 4Q9QH 4NENB 1JGUH 1ZT1A 2OXGA 3X11B 3FSWA 3VFUB 5C0BB 1HEJC 4U3SA 3FOMB 4DCQB 5BMFL 4CU8A 2BVQA 3O0RH 3A6CH 1ZEAL 2BMKA 2C1PA 1O5PA 2GSIB 4NNYB 3WNKA 2YMXL 2Z6FA 2X70B 2L7UA 3BZ4A 1PZ3A 2GC4C 4DPRA 4B60A 2HB0A 4Y1SA 4U6HA 4HOXA 3I85A 3OJ2C 2YSSB 1FO0B 2PCYA 3CJJA 4KTDH 4TUKL 1T04A 3VXUD 2FR4B 2PUQT 4XP9L 3VI4E 3CLFH 3O4LB 1XD0A 5FDYA 1SBSL 3KVPA 5E0FA 1EZSA 1HHGA 3VJ6A 2EVFA 3O9WC 5L2KE 3H6AA 1SRDA 1D5MA 2J4WH 4G1MB 3ARGC 4FL4C 2QMJA 1DQJA 1I9RL 1G7MB 4K07A 1KULA 5J6SA 4NCC1 1H3PL 1GC1L 3ZKXB 5C9KA 4TQ8A 4ZMVA 2Z91A 5DURD 4XB8A 1ZANL 3H1ZA 4UIKH 1WEJL 4XO3A 4AQAB 4TNVF 5D93B 2EC9U 4Z7NF 5E8OB 1CQKA 3L4XA 5HHOB 1IQWL 2VUYA 3O41A 2PETA 2XN9D 5HI5D 1HDMA 3NFNB 5CILL 1SLUA 3S4SB 5CSZA 2IXQB 5B7EA 4IM8A 5I0ZA 1KEGH 2AABL 4WO4A 5DD6A 4CKQA 3BIKB 4JQVC 15C8L 5I0DA 4JCLA 4X4KA 3QCVL 4LHUA 4I9XA 3DDFA 5AVSB 3WN5A 1R3JB 2MOGA 4WU7A 5AKSA 2LR4A 4FCHA 5B38A 3TH2T 5DZ9A 3CBJB 4PGZA 4PJFB 1PYWB 4F7CB 3OKOB 1IC4L 1VHPA 4X99B 3ROLB 4KV5F 4MDIB 1E5BA 4EIUA 4YPJA 3ZE2E 1GYCA 4LASL 1OP5H 4B9YA 2F53D 2GTZA 2B1AL 3QHZH 2F8XC 2VLJB 4NRZA 1U3JA 3RGVD 2KL6A 2R9HC 5EOCH 3VH8G 1E4KA 4Q14A 5GSRB 4BZ1A 1ET8A 2E9IA 2XQYA 4HETA 3LZPA 1UFGA 3ESNA 4NQDB 2IPKB 2X4SB 4AQ1C 5K9JH 3ZL2A 5HVWA 3HS0B 1ZHLB 2ICWI 1G9NL 4AMWA 4OGZA 1S9XA 3W11D 3CN3A 4LEBA 3GGWA 4DQAA 2G4EA 5A2AA 3TBVB 3C08H 2Y07L 3OJDA 4OGYL 4OBRA 1D2PA 1MF2H 2GK2A 1RIVH 2GBUA 1MCEA 4LU5L 4PJDA 3G6JB 3UXFA 3LIZH 5B8CB 4M7JH 2YXVA 1E6OL 5AZ2H 1A4JB 3GZQA 4OZHA 3SBQA 2DWTA 4A2MA 3D39A 4MASA 4XNUL 2OCCB 2X1OA 4FQCL 4J3OH 2FWOA 2E6QA 2ZTBA 4OZFG 2KMWA 4NYLB 4Y5YB 5AVQB 1KCBA 1HZKA 3V0HA 1MJ8H 2VLLA 5K9OB 3KYOB 1RPKA 4AYFA 3DURB 2LAGB 3GS4A 3CHQA 4IQHA 5A6IA 1DBAH 2YWYA 1FFOB 4P9HH 2VDQH 5ESVA 4XOBA 3RVUC 4B7LA 4IRJD 3HMWH 3LKNA 1BXUA 4ZO7A 5CJOL 2ZUYA 4X98A 4IMLA 2IH1A 4HWBA 1D6VL 5CGBA 4X0NA 2NMSA 1NFDA 3ARED 3MAWA 5HI3C 3QS2A 1LD9B 2BVPA 1TVBA 4DOHE 1YMHA 1ZHNB 2VR6A 3BOVA 3OB0K 2XWTA 1IIIA 3QJQB 3SKJL 3SGDI 3CZJA 5CBAA 1NDMA 4WK2B 2DMCA 43CAA 1CYWA 2R2HB 1IJ9A 3U83A 1F3DH 4L8DA 4V2CB 1WA1X 3VSTA 3BJLA 3C60A 3MRDA 2WLHA 1FO0L 5L6YL 3LY6A 4M8VA 3F2LA 4C59B 3CFQA 3TT1H 5J57B 4IEFA 4NZUH 2NCMA 2VMDA 4GUPA 3X3FH 1ERNA 1G1YA 1YEJH 2WINB 3IDNA 5IZ7A 1QFWH 5IK3A 1BD2D 1MCOL 2W07B 3BP6A 3CHRA 3O3DB 4GRWE 3T77B 5FB8B 3GSRA 3TS8A 2XLLA 3U2JA 5KG9A 4UMGA 4V2BA 4I0KA 2NY0D 4GBXB 1KBGH 3BFWA 4N24A 4XMTA 3LOWA 1TSHA 4LESA 4GMSH 4QDGA 2GJ6A 1BFOA 4AKOA 5LXGH 3O8XC 1WWWX 1MXGA 2DQDH 2J6EA 1PZ5A 2ZG3A 1VB9A 3EYFA 3PQYB 2X4PA 4NO0B 5CS7A 5AUMA 1OCCB 4JY4A 4HKZA 5GRJH 3PNRB 3LJ3A 1GHFH 3FFOA 4GW1A 4F58H 2BP3A 3V0DA 3HC0A 5F2FA 1KPRA 3NN8A 4LSPL 2DZEA 4KQ3L 1WAAE 4NQSA 3O2DA 1GH7A 5AYQA 5SX4H 4OCLC 1N3NA 3W38A 2DQHL 4OJFL 3C5SB 2HLFD 1T80A 3MTXA 4BKSC 1NEZB 2ENJA 4IBUA 3LNIA 3IXAA 3ULUC 1ACXA 3PHQA 3A6OA 4OB5H 5BO1H 3BP5A 1I82A 4EN3B 4LSQH 1XT5A 4NLAA 4XBEH 3FT3A 2MKWA 3SBPA 3VYOA 2DH2A 2R56H 1Z2KA 1A7RL 1PZAA 1QYGH 1X7QA 3EADA 3HHSB 3IAQA 4MCMA 5F1NA 3UABA 4PCKA 2VXQA 4RNRB 4PVNA 1F4XH 3M1OA 5DUJA 2WO2B 1ACYL 4OD3L 2ADGA 1M56B 3N42B 2YD2A 1DJHA 3QULA 1VGEL 1O75A 4JPQA 3DIFA 2GC7C 1T4KB 5AZEH 1NCAH 1XGPB 3SDXF 3QORC 1KCRH 3IDMA 4JKNA 1DYZA 2V9RA 4NN6B 3QIBD 4UOJA 5DEJA 2P24A 4F33B 1UKSA 2YWZA 4GT0A 5M94B 4QCIB 3TCLB 2APSA 2A9MH 1JCVA 3AG4B 1R34A 5DJAA 4W6YB 3IJ7A 3ATFA 1NOFA 2F1BA 5D1QE 4BFIA 2KH2B 4JREB 4Y16C 3SKMA 1UB5B 3DARA 2J5WA 1SHMA 3JT0A 2A6DB 5DT1L 4ZMTA 3NT0A 3Q6GL 1ZE3C 4PRPA 4X6CB 4CU6A 3UJJL 2ORBH 4M4PA 5AZUA 5EUOE 4BFFA 1IM3A 1K6QL 2Z7ZA 1WZLA 3CC1A 3OKMA 4XCNA 1R5VB 4LSVL 4RVBA 1UZGA 1AZUA 3ZDXB 2QTVA 1JGIA 2H3KA 1U8JB 4H8VA 4DO5A 5C7ZA 4QRTB 2ENSA 1TQCB 4PBDA 2X09A 4S2SA 4ELMB 1MFUA 1LQBC 2CDFA 4Z7VF 3S3SA 5I76A 3UACA 2OMWB 1Z5LB 2ZSVB 1WD8A 3V6FB 2DI9A 5H94B 3X1GA 1JI2A 1EO8L 2ZP0T 3MQIA 4HS6B 3DX7B 4WFFD 5GGRB 4DUVA 3EO9L 1RV6X 5HYJD 4FYTA 4HFWB 2GFBA 1GGYA 4R90H 3L5WB 4XVUD 1OF2A 4ALAC 4WUUB 5AW7B 2IVFC 3IJ9A 4PLOB 1KTKE 2YZ1A 1IKNC 4YO0B 1OPGL 4AJVA 4UDUA 5IF0B 4G82A 5A43C 5FGCB 3VMNA 1OEZW 4YHNB 3GSXB 2NY3D 5E1GA 4OLZH 4HJGA 4DVRL 1SEQL 2EDLA 2OLDA 4JQIA 1CL7L 3DYPA 1KJ2B 4M5TA 2APXA 3F64A 2VUKA 2MHAA 5KVGH 1TLKA 4JCMA 5EC1B 4WKZA 3EO0A 2NYZA 5DYOB 1VF5C 1U8CA 2BSDA 1QKZH 4X5PA 2ZQKA 1IGTA 4OZ4B 4MXWH 4N2IA 3MKKA 2R83A 4A66A 4GAJL 3RU8H 4Y5VB 3ZKND 3RFRA 5EZIL 1CJYA 1OAKL 2A6IA 3LPPA 3ESPA 3OKLB 3KPRD 5GPRA 1T1XB 2WLLB 1VFOA 4YDZA 1SY6A 1YY9C 3IM1A 3NCEB 2F53A 2LT9A 4Z7OB 2C3GA 1MUJB 1XB6A 2X2YA 1JPGB 4WNJA 3S36X 3X14A 1AJ7L 2BW4A 1DQQA 4U1LB 1YMMB 1UEYA 1MCIA 5EF2A 1BMZA 1PG7H 3TPUB 4M1GL 5D55A 4NHUB 4O58H 3KPMB 4BGDA 1IGML 3EDJA 1J88A 3G6AA 3K6SB 2QVFB 5F0LB 2EKSA 5AAWC 3P2BA 4DEUA 5I1IL 3SZ6A 1CTNA 3PHSA 4FXGB 4K5MA 4ZXBB 5KS9F 1ONQB 5LN8A 3QCUL 2HG5B 3ZSSA 2AXFA 3WNNA 4O2FA 1D5BB 3MREA 3MRBA 5DVKA 1H3UA 4ZRGA 4G70B 4UUJB 3Q6FA 4Z7NE 4MB1A 3D52A 4IRSA 3L5XL 5CHNA 3GB7A 3K2UL 2F5BL 4L5FL 4QIRA 4XBMA 4HS8H 1WCQA 4IHOA 3CMOL 5T8IA 3TNMA 2G0LA 1XBDA 2QKIB 2Z7UA 4FABH 2F0CA 2HFEA 2NR6A 1LEKA 5BV7C 4X7SH 4X9YA 4JR9L 4N9GB 5INCA 2K70A 5AB0A 3RVTC 1S7VA 1Y1DA 1HX0A 4JDVA 4CVUA 1JHTB 2MNJB 5AENA 2YPLB 1NEPA 2WUBL 3VM5A 2BIQA 2YO3A 3V0WH 4EQ3A 1CE6A 4BZ1H 5BZXA 4ZUWB 2QGCA 5IROA 3DECA 4KV5E 3KXFD 4KTEL 4NO5B 2WGNB 3IFPB 4HGKC 5D1ZC 4WO0A 2WWKO 1LQSR 1B6UA 2M2DA 5DMIH 4IBVA 1SDDA 3C09C 3LSOA 1A3LH 1ZSHA 5JQ6L 3BZFA 3TV3L 3I9GH 3D2TA 1V7NH 4O5LH 4K2UH 4FXTA 4X9FA 1WVZA 5FO7A 3QR2A 5I30L 2OBGA 2OMTB 5C0GB 3ME0A 3PS6A 1P5VA 4UBDC 3WO4B 3S5YA 3V4PB 4BZYA 2JCCF 5LGJA 3EOTH 4NQXB 3ZHNA 3CGTA 4Y4HB 1I1YB 1G7QB 4EBQH 3ZO9A 1I3GL 1AGBA 4ANUA 3I3EA 2SEBB 4GUCA 4LLQA 5DF0A 2G5RA 4YL9A 5DS1A 5EEUA 2Q7AA 4G83A 3NJNA 1J0YA 5DVPA 1QABA 4MAYB 3KLHD 4L3AA 1T5XA 2PXYB 3RTQC 1KJ2L 3HC3L 2OM5A 2ITDA 4HWBH 1OHZA 1UA3A 2EDMA 3V5DA 3D4YA 4MQTB 3W9DB 4JM2B 3QRLA 4HIEB 4P46C 2WSDA 3VNZA 3AT8A 5G2NA 3X1NA 3BH9B 2FX7L 4KZCA 3UTPD 4NFDA 1S2EA 1JGLH 5L2JB 1UXSA 3MMEB 3GZPA 1KYFA 4LGPB 3B43A 4N8VA 2ZCLL 4WHTB 1GW6A 5T5FL 3ZDZB 1WDAA 3OR6B 4TSBH 4WEUD 2AEPH 3ARBC 4Z8FL 4MJID 3F6IA 3ZTJH 1T20A 3J7HA 4FADA 2IPUK 1J0HA 1NCDL 2WLIB 3K6OA 2DQUH 2Z31D 3F7YA 3VFTA 1AG6A 1ECYA 2HVKB 4RQQB 1JPSH 1HHHB 3OJVC 2DLFL 1IL1A 1FZJB 4IBYA 1CPUA 3QXVA 4WFHD 4YDIL 1KLFA 5FIEA 3UZQA 4QRBA 2CDGB 3FB5A 3N5AA 2M8XA 3CUPB 3L7FB 4XH2A 2YAPA 5CGYD 3DX6A 5SWSD 1FV1A 2EEAA 5IJKA 2A9AA 3EOYG 5JDJA 1B90A 2CMRL 5KSAB 4D8PA 1W0WA 2JQZA 2XHNA 4BRVA 4TVUA 5JHDB 4M29A 4AV4A 4Z5RB 2J6EH 4O4YH 3KR3H 1KYOJ 4MZ3A 4M7ZC 5DZPA 3BESR 5DUBA 2Y36L 4PG9B 5E0QA 2OJZH 5DS8B 4YQXL 3NFPB 2YKKA 3VXTB 2GJRA 3U4EA 3NZHL 3SGEI 2GQHA 3RIKA 2P5WB 4GXVH 4EOWL 4JFEE 3FQRA 5IESL 3CXDH 4LDLB 2B8OT 3D30A 4R2GB 1JWMB 4MDJB 2LVCA 3POHA 3W0WB 1QTPA 1M9WA 1QLRA 5FUOL 1JF5A 1VFMA 1IZJA 1NCHA 1X5YA 4I77H 2BIHA 1BJ1H 1S78C 4W9GC 5A7BA 1B4RA 4H0LC 1RD6A 1NOLA 4NNXA 5KSBA 2VXQH 4MD0A 4HSQA 1RLWA 2VDQB 1JGUL 4U0QB 4FQHB 1LK2B 2UZPA 1OGPA 1KTDB 2X4NB 4G8GD 4LLYB 1MVUA 3O0RL 5BNXD 2MQCA 5IG7A 5L9DH 3A6CL 3IDJB 2HN7A 5JXEC 4XGZB 2EDKA 3AADB 4P4KB 1T7WA 1FGVH 1FG2B 1ZVSB 1ZLWK 4DGUA 5JYMA 1TEYA 4LSUH 4XVTH 3SDCD 1ZIAA 5CP3H 4P5RA 1JPTH 5DI8A 3V4PL 1RZ7H 1G9HA 4JZJC 3P3UA 4KTDL 1FFRA 3QEQE 2ED6A 4AE0A 4I88A 3M8OH 3WY1A 3V6OA 4FYRA 1AKJA 3EYUH 1A64A 1ITBB 3BUYB 3ZPDA 4TYUA 3QDMB 4HKBB 4LXFA 3UYOD 2X0VA 4UU9A 2WQRA 3B2UC 1XDTT 4PMFA 2PYED 3IAPA 4C47A 1AGFA 3QHTC 5EZLB 2DH3A 1FVDB 2VQ4A 4HZAA 2D7TL 5GS1B 4L29A 3WJMA 4ABQA 5IBUB 2X12A 4XN8A 3V95A 2LFGA 1B2WH 3U1QA 1C7TA 1TF4A 1OLZA 4XXCA 1FC2D 4ECNA 1X5FA 4LPTA 4RISL 2I60H 2EYSB 3UC0L 3VMOA 1AOHA 1C8PA 3MNZB 2QPFA 4JKPL 1NQBA 2PO6C 1TJIL 3NTCL 2NY2D 4WGKA 5DR5H 2VM4A 5FYJE 4AYEC 5BRZE 2BSSA 1S9YA 2ZWLT 5C0CE 4HFUH 4M1CC 4JFOB 2CHXA 4JRXE 1W8EA 4JQIH 4DK6A 4ZMXA 2MOVA 4KO6A 2CLZB 3LKRA 5LQBL 1FN4B 5E4EB 3ILEA 2EVGA 2GI7A 2DTSA 2PP9A 2D03L 3ILQD 3KS0H 4PLKD 3CDGB 2AK4D 3T2LA 4IOSA 4JM4L 1YN7B 1PKQB 3GHEH 4NWTH 3T0EC 2HXAA 3QHZL 2I27N 4UTCA 2MOQA 1UQSB 4WI7A 3VD1A 4L3EA 4DUXA 5EORL 2AQSA 2PKDA 1TZHB 4ISVA 1P5UB 1HEZA 1P2CA 4MMZB 2GY5A 4A67A 5K9JL 5B39G 1NM4A 1SY6H 1TJGH 1KIQA 3CV5A 1GA2A 1OW0C 2VC2H 2A9CA 2DV6A 2MSPA 1NGXA 4JPVH 2H6UA 3JWDC 1LGVA 2GAZA 3IWVA 2XA8H 1LP9B 4Q56A 1E4JA 4JG1H 1MF2L 2R1XA 2YPVL 4RFNB 2N4IA 1FFQA 4M7JL 3TA3B 4Y4FC 4BHUA 1UOVA 5AZ2L 2WLZA 3MV9D 4YK4B 1FBIH 4IDLA 4U0RC 1SYSA 2H1LM 1X9QA 3LVTA 3B2DC 4Z77B 1EK3A 2WVVB 4YAQA 4Z23A 5A40E 4B96A 2E46A 3R0MA 1ZLSH 1MJ8L 2R0KH 2WW8A 4OUOA 5L8LB 3Q8FA 3EYQC 1B6DA 3MLTA 1H8NA 3KWWB 3L5IA 1DBAL 4HA1A 1O7DE 4P9HL 2VDQL 2ISDA 4ZS7H 1H8OA 3C6LC 3Q3GB 4ADGA 2R2EB 2EIDA 4JW3A 1G7JA 4Y2DB 4F7TB 5GGSY 4MYPA 4APQC 3FTGA 5DK2A 5KS9E 2YAQA 3F7QA 1BMGA 4I0CC 4AV0A 5ESQA 1S8DA 1CDUA 2JI2A 2XKSA 4KX7A 4PI2A 3F7LA 2R1WB 4HJ1A 5IV2A 3CVIL 5J3HD 3RWJA 5CEZH 4JFFD 4HWEH 4MLIA 4UAOB 1K5NB 2OMUB 5AW0B 5IM7B 1MJJB 1F1DA 4NBXB 4G6FD 5IQ9B 2GUOB 1NUDA 2IDQA 4WTZA 4P57A 2B5IB 1ZVYA 3RZCB 1YQVL 3SE3A 1ZT1B 4Y4KC 2OXGB 1BLNA 3T3PF 3X3FL 2Z1PA 4I0PD 5EV7A 4N2HA 1YEJL 3ISRA 5FW7A 5FUCC 4R0LA 3B2VH 3RWFB 4PWHA 5DUML 1WIUA 3TN0D 4V1DD 5KVFL 2O6DA 2BVQB 3I6KA 2DQEH 1NFAA 3MXWL 4MJIA 2BMKB 2C1PB 4WI5A 3ZL4H 3VXQA 4OLXL 2BS71 3MLYL 1MLBA 4GMSL 2PCXA 3QC5X 3BZ4B 4H2AA 3MV8E 1JI1A 2HJKA 5A1AA 5LXGL 4TF4A 1LE5A 2WZPA 4U6HB 5EO9A 2DQDL 4LEOB 4MJHA 2NZIA 3CH1A 5SWSA 1UASA 5IHZA 5EBWA 1E8XA 1T04B 1YLBB 3HS8A 3N44F 4LK4A 5GRJL 3TC9A 3CFUA 5D9SA 1GHFL 3P4OA 4HLZH 4ZZFA 4F58L 1HHGB 1BM3L 2DQGH 4YPGA 3VJ6B 4ZSOA 1TQSA 3RFZA 1D5MB 1I7UB 1YEFH 3OF6A 3GFUA 3DGGA 3NIDB 3P2TA 4FG6C 4GQQA 2JCCE 2X38A 4KROD 5FYJU 1OE1A 4NC1E 2DWEA 4L0ZA 3CFTA 3WHE0 4A2DA 3FHEA 4XB7A 4PYHA 3IDXH 3HZVA 1CB4A 1KN2L 4E9RA 2Z91B 3WFBH 3BVTA 1V7ML 1NFKA 1BZ7A 4OB5L 5BO1L 3QZNA 4XBEL 4Y9CA 3U0TA 2R56L 1CXEA 1QYGL 5ISZA 3NPZB 3QWNA 2OMBA 4HZ1A 2HT2D 1Y6MR 3O41B 5D8JH 1FYTD 2OSXA 3GI9H 1HDMB 2NX5D 5BZZA 1HKLL 4L23A 5CSZB 5H37H 5I6MA 3HUJF 3QZOA 4WO4B 5DD6B 4NFCA 3OXSA 5AZEL 1NCAL 5EIVA 4B9JA 3PWPE 4LHUB 1BWWA 1KCRL 3MRKB 4JS7A 3WN5B 2A2QT 4EJ1C 5KUKA 4WU7B 4HGWB 1LWJA 3HG1E 5B38B 3U0PA 1G7IA 3UTSD 3T6VA 5AB2A 2EINB 2EJ1A 2A9ML 4NJ9H 3TEUA 5H4ZA 2XJLA 4X7TA 2DQFB 1KC5L 3SGKC 2FYYA 2HLAA 3TJPA 4GFXA 1MCCA 2E7CA 4AH2A 5ITFB 1AFVL 4J3UA 4NRZB 1TCRA 1EJOH 3RP1A 3FTZA 3D5OF 3F5WA 3T6XA 5EF1A 5FGRA 2ORBL 4JO8A 2OJEA 4R96A 3QJSB 1QD0A 1UGKA 4ONFH 3U48A 3GGWB 3MUGA 1USZA 1NM9A 4KHXH 2Y2WA 3OJDB 4Y8DC 2NSMA 3KBHE 3NK4A 4QXTA 4PJDB 2C8NA 1KXTA 2VSKB 5LUMA 4OZHB 3U30C 3QUMA 4D9RE 2OX5A 2FVNA 4QWWC 3EDKA 4ZMQA 1XH2A 2FWOB 1QWHA 3KGUA 3C75A 1QSEE 2C9UA 4EKXA 3MOAH 4AENA 4GQRA 1XF1A 2YPKA 2VLLB 4AYFB 3AU0A 5AVWB 3PL6D 3U7WH 1P7QD 4PJXF 3EJCA 1BEYH 4OLZL 1PZDA 5ESVB 5GRUH 5IUCA 3CHOA 2DKUA 1MAKA 2ZX5A 3LKNB 4XZ4A 3OKNA 4X98B 4IMLB 1NINA 4J4PA 2ZD0A 3AG2B 2IH1B 4GP8B 3L9RA 1T89A 2VW6A 1NFDB 5BQ7A 1QKZL 1U30A 4H8HA 1YMHB 4H44C 4NNPH 2XWTB 5DJ0B 4DF9A 5CBAB 3G04A 4FGMA 4P3DB 1XZ0A 5EEWA 1DFBH 2DD8L 3AXLA 4KK6D 2AJUH 2FX9H 3GEFA 4L8DB 2EVIA 4UT7H 1SPDA 1BZ9A 1S6NA 1RMFL 3EYSH 4Y19D 5AW9B 4DP9X 1BA9A 1DLFH 5HPMA 3O45B 1KB9J 4GRLD 2YMTA 1GMEA 1T6VN 4HV8A 4NAJA 2X05A 4IEFB 1FL6A 1KB5H 2M26A 4GUPB 1YUHA 1OF0A 1G9ML 3MJ9H 4PJIA 3EF7A 3IDNB 4MGXA 3F7PC 4TNEA 3BP6B 4HOZA 2CWRA 2MWCA 2XACC 3GSRB 2VE6A 1EJ8A 1PG7L 5KG9B 3O9WA 2HYMA 5L7XH 5EZPA 5IFHL 5GGSA 1KGCD 3ARGA 5AALA 3TCTA 2GJ6B 1BFOB 1RK1A 1H6UA 1RLBA 3I3BA 1H3TA 2JELH 2O6CA 2ZSWA 2EUVA 3ABLB 1ETZA 3DGDA 3DMMC 2NPLX 1PZ5B 3EYFB 3QPQC 4U1KB 5AUMB 2X4PB 1GJUA 4N0FB 4P5TD 4UIMA 4JY4B 1D5XA 1T1WA 2BNQE 4HKZB 4UZGA 3WDHA 1MWAA 2WXOA 3IGFA 1PY0A 1RZGA 5FX3A 2NXYC 4Q52A 1Q1JH 4ETYA 3HC0B 4H0HB 4W6WB 2VOTA 2Z8RA 1CICC 1V10A 1B3IA 4NQSB 1SM3L 3WJJC 2F61A 5L4JA 3CFIC 4JQVA 4MB5A 3R7RA 3LQAH 2XTJB 5E51A 3IXAB 4UNTA 4O9HH 3BP5B 2YK1H 3CFBA 3T2PA 2V5RA 3FT3B 3QSKB 1X7QB 3IBEA 5F1NB 1CGWA 3DRQB 3CZNA 3QO0A 4X8GA 3MLWH 3NQIA 1H5BA 2D4FA 1E4XH 3V0WL 1AQKH 2E7BA 3I02A 2ADGB 4BZ1L 1P84K 1DVXA 2R8SH 3QULB 1JYVA 4XNAA 2Q20A 3BXNA 4U1NA 4CVZA 4G3YH 3DIFB 5D7SL 3NRFA 1MW0A 3E38A 3NH7H 3ARFD 3EBIA 4XOEA 5AQ0A 2JKXA 2L7QA 3LRGA 4F7EA 3VXSE 2DQCH 2XXCB 3IDMB 4XVOA 1C16B 2W88A 4OJDH 4AQ1A 1LEGB 1T22A 1A3LL 2FGWL 2P24B 2V33A 3W3BA 3I9GL 4ZD3L 5C0DA 4X4XA 2A74C 5DJAB 1FHGA 1YYLH 1MXDA 3CG8A 4DGWC 5MENE 5T3ZD 5C3TA 3MUJA 3NSCA 4BFIB 1Y18A 5EO0A 4RSYA 3EOTL 3SKMB 3CPLA 4ZO6A 2Q8BL 3FB6A 4LAQH 4EBQL 5IBLC 4UQAA 2E8YA 3FT9A 3OKMB 3PE9A 4IBZA 1CDBA 4XCNB 5E23A 3ATBA 1PFOA 5T1LA 2BNRE 2GVYA 5EZJA 3BLBA 2J8UA 3I2CH 5E4AA 3WFEL 5INDB 3LEYH 2FJSA 3H4FA 3UEQA 4D9QD 3B56A 4HWBL 3Q1SH 4S2SB 5EIIG 3V0VA 4QRQB 1GS7A 4ZOCA 4KOBA 2IDUA 2EKJA 1DCLA 2G5BB 3VA2C 5I76B 4HJIA 3VD7A 4X83A 3MI6A 2D3NA 2WSPA 3N1QC 4HKJB 1JGLL 4YNYA 3CN2A 1JGVH 1F11A 4WI9A 3VX0A 2GFBB 4ZFOA 5I18H 3L7EA 1OF2B 1UGNA 2N1TE 3EDEA 4N20A 5FYKD 4TSBL 1S9WA 2AEPL 4GIPD 2XWEA 1Z5HA 4UDUB 2K0RA 2YA1A 4R26L 1Z9MA 4N5UA 1U91B 5EBLA 2IQ9H 4J5VA 4HJGB 2Y7OA 1O9ZA 3LRLA 1J05A 1N6QH 4MCZA 4XNXL 4GEIA 2M1KA 2A9BA 2MHAB 4S10A 4CADA 3ARDC 5LDUA 1FYTA 3EO0B 2O61B 4MQ7A 1U8CB 2XZQH 2NX5A 4P3CH 1IGTB 4F37F 2WXKA 2D73A 1NGPL 2PR9A 4NRXA 1HXMA 4QHLA 4BA0A 4HH8A 5I1KH 3WAJA 2HKFL 3T3PE 3CZLA 3RA7L 3L08A 3DC0A 4AUUA 1JZDC 5GIRA 3LEVH 4B9GA 4C56E 3MNDA 2J6EL 2OL3A 2A6IB 5C07D 4O4YL 1CD8A 4DN3H 1EMTH 2KPNA 3O8XA 4UI2A 1QACA 3S36L 4LB8A 3MLZL 1OVZA 5J6HA 3FUEA 3LYRA 1NGYA 2VC2B 1YNLH 1KZYA 2F53B 1WRFA 2JI1A 3VXRE 3X14B 5MHSE 4DKFL 1DQQB 4IJTA 3MNMA 5HGHA 4TULH 3VB9A 1HE8A 1A8JH 3ARYA 5ANHA 3O2DL 4X9BA 5EU6D 3CXDL 3GXDA 1EHNA 4KH2A 4N26A 5IQNA 3UBHA 1JNNL 1IJNA 4BUHA 1ICTA 2PWEA 5ILTL 3S37X 3G6AB 2B9BA 5DMGD 1AVAA 3V79C 3HBZA 4F9PC 2EKSB 3BDBA 1IAOA 1ETB1 2CD0A 3MNWA 4OD1H 1X6NA 4CW1B 5E5LA 1UKQA 3MHZA 3SYQA 1QFPA 1TQTA 1BVLA 3CFMA 3H3PH 2AXFB 1IO4C 4O2FB 1KFAH 4LP4A 1R5WB 2KKQA 3EJUA 1DFXA 2NW3B 1HCVA 5CHNB 5FAAA 3QIUC 5C0RL 3SYAA 4IHOB 3TNMB 4L48A 5L88H 4BQCA 2CR6A 4MCYA 2AERT 2OTWA 2HFEB 1FGVL 3PL6A 4Y9BA 4LSUL 5HSFA 1LNUB 4XVTL 2WIMA 5IHHA 5INCB 4LF3A 5KN5A 1L9SA 1S7VB 1FQ9C 4E9XA 1JNJA 5AVTB 2X4RA 4JDVB 1NC4D 1RZ7L 1L5GA 2XV6B 3BDXA 4LVOB 3UGXA 2JKRM 4OAWA 4BH8B 2ZOLB 2BY3A 3UO1L 5HTSA 3O3BA 4H25B 3M8OL 4Y16A 4PJ9C 4W9CC 1TO5A 2BIPA 3EYUL 4PJBF 5CZVH 5I0VA 4U1HA 3BYTA 4P8QA 1MDAA 3DHPA 2VXTH 5F7DA 2ENPA 4HWZA 3VYNA 4E9LA 5BOPA 2YRBA 3LSOB 1ECZA 2FLBT 4FNQA 4P2RE 2OYPA 3BZFB 4KRLB 4PM1A 4JFVA 2MJWA 5ENWB 1A7OL 2DQJH 1A6UH 4JDEA 3BSGA 3ME0B 4NQUA 5T1JA 1B2WL 1M6OA 1EEYA 2XWXA 1UA7A 1P5VB 2ATKA 3B9KC 3BD5A 3QUMH 5B4MD 3TP4A 2APBA 2RAMA 1BD2B 1M7XA 1PAMA 4S1RH 4UOQA 5IB1B 3VFVA 5LGJB 1NLBH 4GP4B 2I60L 4FQXC 4PLNC 1AQDA 4FOMA 2JXMA 2DEWX 4FXLA 3D06A 1AGBB 4LLQB 4NAMA 2ROYA 3SE4A 2FJGA 5D5MA 5I1LB 5C7XH 1RZKH 3FRUA 2JKLA 1RZJH 4JQIL 4FEIA 1T5XB 5JNYA 4Q9RH 1IKNA 4G2AA 4BBWA 4ANWA 4LRNH 1MRCH 2ITDB 4YHOL 3VG0H 3V5DB 3WEXB 5IMLB 1IC5L 1UUNA 2XKUA 1IV8A 5CLXA 1ADQA 2LLNA 4BFEA 3H0TB 4XWGL 4BIKA 3GHEL 3CVHH 1ET5A 3TJEH 3QNXA 3EO1A 1DJIA 1UXSB 3U6RA 2CG9X 5E95B 1E4WH 2X88A 3ILPB 4N8VB 5I15L 1T0MA 2ARWA 4JPWH 5JUEH 2BSTB 4M02A 1YO4A 5ETUA 1CQYA 5CJBA 4U3HA 1JXDA 3MRFA 4L8BA 1T20B 4QLWA 4A7UA 4OCMC 1SY6L 1TJGL 2IH3A 4GW4B 5TQ2H 2VC2L 2MCG1 3F7YB 1F2XK 4JPVL 3VFTB 4UQBA 5HDBF 1IL1B 1BZEA 4TNFA 1KLFB 2XA8L 3AUVA 4X80H 5I6XB 5K1JA 2WKGA 3FB5B 4PP2A 4XH2B 3VWKB 1FV1B 3GBLA 3NRQA 1WC7B 4R4NC 1F58H 1KCSH 3IKKA 4FS0A 5F9OH 3BGFC 3LN5A 1RJYA 4WW2F 3VCLA 1W0WB 1MLCA 2JWYA 4W9EC 2K4AA 3CVDA 4HJ0D 3CWGA 5C86A 4WHYG 4TLTA 2C3VA 4LCIL 4EI6A 3OB0H 3QIWC 4DIXA 1GKOA 1IU1A 1ZLSL 2O5ZH 1FSKB 2CHWA 5AAWA 1MWAH 5HVHB 4U3XA 1X9UA 1UH4A 4TLUA 2OTPA 4ZS7L 3U4EB 5A16A 2VKWA 2WBWB 4PB0L 3SN6N 3FQRB 4IGBD 3WHE1 5HGBA 1FLTX 4YFDB 3FN3A 1JXJA 1JZHA 4IOIB 2UVFA 3O3UN 1QLRB 3AB0C 4PR5A 4ZTOH 1T0NA 2BJML 5CEZL 4N0YH 3UGUA 3TASA 5EF0A 4ODTH 5SWZA 1A6WH 4PPTA 4HKXA 1IBZA 5KSBB 2YOCA 4NNXB 4TVPD 2DWDA 1I1CA 3KE0A 4YSPA 4MD0B 3KM1A 2VMFA 4LBEA 5LXVA 3HOGA 1BF5A 3BP4A 3KHOA 1E28A 3NCCB 3B2VL 5HYJB 5MI0C 2V0AA 3CD4A 1KJ3L 3IS1X 5IG7B 1MVUB 2PPEA 2DQEL 4QGYA 2IADB 4XC1L 5DJYA 2HN7B 4G59C 4DJMA 2W80C 2NY3B 5D1ZA 1A5FH 1DUYA 1T1YA 4B6ZA 1R5IA 1UA6L 2QVKA 1I7ZA 1UXMA 4XBGB 1YNTA 4L4VE 4J1UB 3LN9A 4PS7A 5DI8B 4YSDA 3DXAE 2IGLA 4QF1A 3SDAC 4F3FA 2YQ3A 4AQEA 1BOGA 3NIFF 3LPWA 3AQXA 2FBRA 1EAPB 4OF6A 4FJ6A 5GRYA 3T0BA 3TJHC 3TVMC 5J13B 3OGCA 3ES6A 1AKJB 2NTFA 3SPHA 3PGFL 1UYWH 2HRPH 1YEFL 3DHJA 2GPZA 4APQD 4FN0A 1YEEH 4UU9B 4X6FA 5C07A 2I26N 4FNLH 1AGFB 4U1IA 4AVIA 3U0WH 3WTYA 3IDXL 5HI4D 1U8IB 3GMOA 4KK9D 4L29B 4S0TD 3UAFA 3PLYA 3WJMB 2R4RH 4UOZA 5L2KD 3LH2H 4OI8A 5C8JA 3NCYP 4V11A 3RTQA 3N3EA 1SOXA 2WWNA 3D1MC 3CX2A 3S8WA 4R97B 3RHWK 4ENED 4P46A 1VFAA 1UD3A 2APTA 3BPOC 5K39A 3GJFB 2AJZA 1Q0EA 4BM7A 2R29A 4XI5C 3D85D 4MA7H 1S9YB 2UVEA 3SQRA 5HYSA 2ZYIA 4PLJD 1BZOA 1AP2A 2AZUA 3MBEC 1URZA 2CALA 3ARBA 1PSKL 2QV2A 1CL7I 4Q8BA 3LKRB 2G75A 4DNLA 3P9LA 3NCYS 2GT9A 4NJ9L 4KJPD 4XPTH 3D4CA 4OT1L 5F0JB 3G3LA 3CZKA 4NN7C 4HD5A 2Y06H 3REVA 1EJOL 2BVTA 5D7JD 5EU7C 2H2SD 3A24A 1RXLA 4ISVB 1HEZB 1P2CB 5DFVD 4JLRA 4HIPA 4PSRA 4MVBC 1KIQB 4ONFL 4QRAA 2IANA 4U1MA 3BVXA 4KHXL 3AS3A 2X2IA 2WYHA 4XMXA 4JK0D 4HEME 3X12A 2R1XB 4TPRH 1IC0A 4I3GA 2X41A 3IDIA 3ATDA 3T6QC 2UX6A 5IMKA 1SYSB 4WEMB 3SQOL 6CGTA 2H1XA 1L9OA 2VZUA 1IAIH 3FYIB 4D3CL 4YAQB 3CFKA 5KVDH 4AWJC 5E6ID 3TA4D 4AVHA 1M7DA 4WWOA 3ULUH 5DVMA 1HOCA 3TIEA 5T3XH 4XPAH 4U1GB 3N41F 1VEOA 3U7WL 5FO8A 1NAKH 2R0WL 4OJEH 4TSCH 5GRUL 4EUPA 3UIYA 5JIPA 1FJ1A 2Y3AA 3W57A 3FT2A 4XP5L 1KPUA 3BUTA 3RB7A 1G7JB 3BAKA 3TBSA 4PJ5A 3ZHLA 2X3AA 5DK2B 3IFNH 2EC9T 3P11L 5T5NG 5KW9L 2R23A 1S8DB 1BHGA 1UB6A 4M5SA 4NNPL 4NQCE 4KZDH 5IV2B 1N19A 4PV1C 2IDSA 4WKXA 3RWJB 1J5HA 1VJSA 1AIFA 2V9QA 1PJ9A 4P4RB 1DFBL 3S0PA 5JXEA 2D2CC 2FWUA 4GIAA 4UT7L 3EYSL 2Z9TA 4N2LA 3H4HA 4KKNA 4P57B 5IB2A 5IREA 5DC4B 5TDPA 1BLNB 3HG0A 1Y0LA 3L16A 2QKSA 3JQOB 1XF4A 4JZJA 2D3VA 4R0LB 2IDFA 2IEPA 1HIMH 4Z7AA 4HG4K 2P4AB 1ZE3H 3I6KB 3TFBA 4MJIB 2XKNA 4U7MA 3S35H 4FMVA 2EICA 5DMJB 3VXQB 1MLBB 5I6KA 1IEBA 1YPZA 4DP4X 4PJBE 2HJKB 2JELL 3RHWF 4IIQC 4A6YA 1LE5B 5EO9B 5E08H 4N8CH 2H32H 3GWJA 3PXHA 5A2IH 3CBRA 4Y1TA 3CH1B 4H0IA 2KZBA 5SWSB 3HPLA 1BEXA 5EBWB 5FUZL 3G9AB 5E1AA 1N5YL 4C4BA 1GGBH 3WY4A 1Q72L 3P4OB 1TENA 1PLBA 1QUNB 1ML0A 4K3EL 3V4VA 3RFZB 2E9GA 4O2CA 5JPNC 3DGGB 3MXVL 4ALAH 4XP6H 2ZAIA 1AMYA 2PO6A 2DWEB 3KHQA 3LDBB 1I53A 2MPAH 3HZVB 3S88H 2Q2EB 5BZWA 2ZXAA 2XN0A 4LVNB 4PRBB 2DKMA 3LQAL 1NANI 4I87A 2ALAA 1P4IH 1BZ7B 4O9HL 5C0EA 1OTTC 2A5UA 2FUTA 5JQIB 3U0TB 3UG3A 4F80A 5ISZB 3Q05A 1TJXA 2JKJA 4HBCH 3MLWL 43C9A 4EI5C 1QTSA 2UWEF 1AQKL 1G9NC 3T0EA 4X4YA 4B7IA 4XWOD 4TQHA 4DAGH 4ZMNA 1AXIB 2YQBA 3NIGB 5KVEE 4FTVA 4OBSA 2NY6C 3OXSB 3NH7L 4LOFA 4Z3HA 4ZNCD 4P2QA 2NT0A 2E47A 2OR8A 3V4LA 4YJZL 1HNFA 1W8NA 1DEDA 3U0PB 1G7IB 1FC1A 3E3QE 4HCRL 3BDYL 5FDWB 35C8L 1U6AL 3D0AA 1OW0A 2LW3A 1NBYA 3BUBA 4X4ME 3MNVA 5FOBA 1JTPA 4Z7QB 4X7TB 3QXWA 3DMMD 1CGSH 2HLAB 4AH2B 1AO7E 1TCRB 4UNIA 5HDBE 1XGYH 4I3SL 4IHBA 4Y4FA 3F5WB 5FFOA 4M7LH 2EC8A 2NXYD 3QO1A 2PF6A 5D1QD 3SDCB 2OJEB 4R96B 1DANU 5KTEL 2VLKE 4JJOA 5F1OB 3US9A 1FLRH 2UYLA 2H2PC 3NGBB 5T1DH 3MUGB 1GZHC 2N0MA 1ES0A 1NMCC 4ZOEA 5IOKA 3I2CL 3LEYL 4IDJH 3O4OC 4Y0GA 8FABA 5JMRA 2C3XA 1IAKA 1KDJA 4BSVA 1UC6A 3RWCA 4PJHF 1HHIB 2COVD 2JJSA 3C6LA 1UWFA 3MRGA 4E9SA 2OX5B 4LBAA 5IEHA 1GYAA 4APQA 2YJQA 4NJAL 1T7ZA 4YLQT 1XGQA 1HAUA 3VI4A 1JGVL 1JOIA 4P2OD 1K9TA 1T83A 5BVJA 2YD0A 2NDGA 3SY0A 4AENB 3S4SG 1Q9KA 5BV7H 1E42A 2KQMA 2UY7A 2YPKB 2G2PA 4L1SA 3C8DA 4XZUB 1DJWA 2IQ9L 4P23C 1W9XA 1KIRA 2RD0A 5CFHA 5JOEA 1BGXH 3GINA 2HJLB 3OKNB 1N6QL 3GI8L 1U92B 4PGDA 1UVQA 3ULVF 1FVCA 1NSNH 3L9RB 4UV7H 2F9BT 3IRZA 5BQ7B 1HYSC 2XZQL 2BIIA 4Y4KA 2WAQA 2NY2B 1FFNA 3OAWA 4P3CL 4WI3A 1C5CH 1OGSA 1NC2D 3FK3A 5D93C 1Q9LA 5C0FA 3B7TA 2WTPA 1XZ0B 4ZPTA 3AXLB 1QRNE 2FZ3A 5B22A 2ESVE 1F18A 1GYVA 1U8LA 2RTTA 1BZ9B 2UY6A 4DN3L 5E9NA 3VTTA 2H45A 3KYAA 4FMFA 5I73C 4PY8J 2JB5H 4HCIA 4HV8B 4UYQA 3WNOA 1FL6B 3FBKA 4NO2A 3BLKA 1SFDA 2WKOF 1KJVB 4PJIB 3ZHDA 3KGSA 4DEWA 5CD5C 5D7JA 5I8OH 1RIHH 1JN6B 2CBOA 2X7LA 3O2VH 2GCYA 2CIKA 3NIFE 3DX3A 3GK8H 5GGSB 2YEVB 4U7SA 3ARGB 4HIXH 3T4AA 3IPEA 1I31A 3P4LA 1RK1B 1TYRA 2E6JA 1R24B 2ZSWB 4CN1A 4JHBA 1ETZB 4Y2LA 5D72H 5KAQF 2EIBA 1WG3A 4KUCF 2IALA 4OD1L 4UIMB 2AAVA 5AAMC 2ARJA 1ZLWH 1D5XB 1EDHA 1T1WB 3UMNA 1SMDA 5CJ5A 4G6KL 2V17H 4LT7A 5GS3A 2PPDA 1MWAB 1OKEA 1RZGB 1KFAL 3CIAA 2R29H 2F8VA 3MV9B 4XPGH 1ETJA 5DLMH 3BYYA 3TTYA 3WXVH 1F8TH 2H6OA 1KLGA 3ARDD 3CHPA 1OE3A 3HMXA 1X4XA 2ZKWA 4LSSH 4L1BA 1W80A 1SXZA 3QJXA 5E6IA 4ZK8A 3S96A 5L88L 2BM3A 3NSFA 4LDOB 4JZOA 5DWUH 3FH5A 4EZJA 4OZIF 1Z9NA 1JFHA 4Y5YC 4BK5C 1DVYA 5F8QC 2ICEC 3QO0B 2EAEA 2WB7A 3MO1A 3D4ZA 1H5BB 2JH2A 4MXQD 3ARPA 2VLRA 3I02B 2W81C 3BAEL 3STLA 4JO5A 3MJ8A 3SGKA 1A21A 2Q76A 5HHPB 2RGSA 5F7NC 4ZFFA 3BXNB 4QI3A 4AC2A 1UT2A 4U1NB 3L3OB 4CSPA 5EF3A 2NXZD 2XA3A 3PGCA 3RL1B 4F7EB 3WIHH 4XP4H 3S48A 4QKXB 1OP9A 5T5NF 4JO4L 1BG1A 4AQ1B 1T22B 3P73A 2H41A 4R6UA 3ZKMD 3WS6C 3Q2NA 4OZGB 1P4LA 1I1RA 4RFEA 4X4XB 4MKMA 25C8H 4E9QA 1A6UL 1GOGA 5CU9A 3FQUA 4HAGA 3IYLW 4UAHA 2WNXA 3J2PA 3PY9A 5EO0B 1ASPA 1NLBL 5HGDA 3VWJD 3CPLB 3FB6B 4R83A 3RG1C 4JFWA 4OLWH 4HMDA 5JHLA 2WHVA 1EXUA 2JQAA 4PJCF 2BP0A 3P54A 3HZKA 3P0GB 1KYAA 2OK0L 5G4MA 3O6LH 5C7XL 5T1LB 5CCJA 5EZJB 1RZJL 3HAEA 4EUPH 4YHIA 4F20A 2ODIA 4WF7A 2J8UB 3D3VA 5F3BB 2ZKXA 4LRNL 4GBXC 4YE0A 2EUXA 5HXMA 1FZOA 4XMPL 3V0VB 3FU3A 4EF3A 3TESA 4H8UA 3A4EA 1FNGA 5AYTA 3TJEL 3V6ZB 4KROB 2QMKA 4HUVA 4YNYB 3VA6A 1F11B 2XQBL 1KGIA 1E4WL 1EBAA 3HE7D 4ZFOB 2WIIA 1FE8H 3CFCH 3GBNL 4HJUA 3L7EB 2VH5H 2XIBA 4JPWL 1PD6A 2NTSP 4ZUVA 5JUEL 1J11A 3GBDA 4YBHA 4UB0H 1MI5A 5BS0E 4TSAH 5DHEA 1LTXA 5EBLB 4LHJB 1VGKA 5TQ2L 1KXHA 2FEEL 4BKTC 4RLDA 3WDIA 1J05B 4MCZB 1GZPA 4CADB 1TMCB 4UOW0 3LXAA 1FYTB 4N8PA 4X80L 1M71A 1A9BA 5HY9A 4RAUB 1FZMA 2NX5B 4WK4B 3ALPA 4EN3C 1E67A 2XPGA 4NRXB 1SOKA 1F58L 4QHLB 1KNOA 3DYOA 4F9LC 5F9OL 2DRUA 5D1XE 4I48B 4KTGA 4A6YH 1OAZH 3PPSA 2KUTA 4M5ZH 5ERWA 5GIRB 1HWHB 2OL3B 4E9TA 1SN2A 3UTSB 3LKPB 3QJRB 3O8XB 3W56A 4JFDE 4RGNC 4LLVA 4U2YA 3DMMA 2AK1L 1MWAL 1NGYB 4CC4C 4F2MB 1ZK5A 3CFEB 4L8SC 3V4VH 2BOCB 4NN6C 3U2SA 4GEJA 2QSCH 2R0ZL 5HGHB 2WXPA 4K9JA 3RKDC 7PCYA 2ZJSL 5SX4I 1KCVH 2X87A 2YUVA 1KENL 3D34A 3F62A 3QDGE 3QNYA 5I23A 4NUPA 3WJJA 4JREC 1JD7A 1MCLA 1WZ1H 4JFED 4N0YL 5FV1L 4HALA 1A6WL 1IAOB 1MIEH 5I1CH 1TETH 3QE5A 5FGSA 4JZNA 1XCTB 3CHXA 4ILDA 1U2HA 5I24A 1FNHA 1I8KA 4YHLH 3QNFA 1BVLB 4I7ZC 3U7YL 1S5HA 5TK2A 4S1DD 3AFLA 2X5PA 4A55A 5KANI 2GHZA 3ATEA 3BIAX 2F58H 1IBGH 8PAZA 3VGAB 1TQCC 2YQ2A 4A7GA 3BUQA 1PF3A 2UWEE 4M4RA 1JF1A 3LMJL 4N25A 4FFYA 1NPJA 3QYMA 3PL6B 1ZV2A 4J3WA 1D2OA 1A5FL 4N3TA 3JWDH 4ODSL 5KN5B 2X4RB 4K8RC 1L5GB 3TZVD 1YEIL 2A74A 3KPSA 3MRPA 4JANA 4OAWB 3ZDYB 5DZVA 2XFGB 3X13B 4FQIL 2Y3NA 3O3BB 4IKJA 3IMRA 4MAUH 2BVYA 4NKMA 3ZTEA 2EDXA 2FEDC 2HRPL 3NJKA 2YAMA 4QRRE 4XPHL 4YVNA 4U1HB 4YWGH 3VXPA 4F15B 5F7DB 1YEEL 4HWZB 3QEQD 4XNBA 1V27A 5EBGA 4QHNA 1MFNA 4FNLL 3WGUB 3BQUC 4F93B 1KIPA 4F27A 4J8RA 3LH2L 5CEYA 3B9EA 4JDEB 2O6PA 1AQHA 1M6OB 2I9TA 1EEYB 1NJ9B 2ATKB 4OM1H 2GUYA 1OAUH 2VZ1A 2UXVA 3VFVB 1JXGA 2G60H 1USQA 2P80A 4ZFOL 3FRPA 4DO4A 1AQDB 4QYOA 4PJHE 4I9WE 3MACH 3PWNA 3TTSA 1NGZA 5D5MB 3RVXD 5CFAA 2FO1A 1U95A 3HVDA 2WBXA 3FRUB 3HHMA 3MUY1 4X0KA 2RBLA 5JNYB 3G6JF 4P5TB 3BGAA 3MOBH 5BRZD 3MLSH 4C58B 2O4EA 2CGRH 5FYJD 1EEZA 2W9DH 3ZRFC 4PJGA 3ZIMA 3L1GA 5JQHC 5C0CD 1E9PA 1UHVA 2K8QA 4FP8L 4XPTL 3WTXA 4JRXD 1EH9A 1XXDC 3ARDA 4FERA 3QNXB 1K8IB 3EO1B 1WSST 4FXGC 4ZXBC 2Y06L 3U6RB 3AU1A 1J8HE 3FQ1A 1NBQA 3ULVE 1F86A 2VQ1A 3U4BH 4DGIH 2OL3L 2OPCA 1VZHA 4AM0Q 4MNHA 3UL4A 5GSVA 3MRFB 4L8BB 3IKCA 3RZWA 2F19H 1E43A 2IH3B 3B5HA 2F7IA 4M8UA 1HE7A 5HDWA 1BJMA 4NUMA 3K8MA 4IRZA 4PP2B 1EEUA 2O6FA 4H13C 4TPRL 5TH2A 1LL1A 4KDWA 1G0DA 1VFUA 1EAQA 1A6PA 2V5TA 1ZT4A 3LN5B 4FFVD 3VCLB 1MLCB 2ENQA 1IAIL 1JERA 3BPLC 3HN8A 2C3VB 4EI6B 3SYCA 2R7EA 3ULUL 3E80A 1WYJA 3UFIA 1OM3H 3U79A 3Q48A 4NM8H 1KCWA 4KKQA 3L5HA 4GUQA 1NAKL 5EB9A 4TSCL 4E41E 1FP5A 4FQJL 5I74B 3HMXH 5AOZA 2CZNA 2LLGA 3GTNA 5FO9A 5HGBB 3ETBJ 5IQ7L 4AKPA 4CMHB 2V37A 1PDKA 2EILB 5HD8C 5DQDH 4KZDL 1P9MC 3F7KA 3QIUA 2KLTA 4PR5B 5D2NC 1T0NB 3W5MA 5HBBA 4KI5C 1CT8A 1BJ8A 3GXFA 5HVFB 3MR9B 4PRAA 4Y4HC 4BCXA 3ARVA 4HKXB 3LCYA 1F5WA 5D7LE 1CWVA 1I8AA 1CYGA 2AJYL 2DWDB 4UDTA 5F7MC 3ZJAA 2XN1A 12E8H 3CSYA 2FT6A 4LBEB 3H9SE 5CBEA 4QO1A 1ZPLA 3T0VA 3MZGB 4OZIE 3HB3C 3JZ7A 2CXKA 3BP4B 3DWTA 3KBFA 1E28B 4J28A 4OCNC 3FCTB 3WEOA 1ZGLP 3LKOA 2CJUH 4JM2C 3T8VA 4W9HC 4PJ9A 1QEWB 3B5GA 5DJYB 5CN3A 2X0UA 4RGOH 4J3XA 4XB3A 2K3TA 1KXQE 4POZD 1T1YB 1DUYB 4RZCA 5D1ZB 1AHWB 4ESKA 1I7ZB 1YNTB 4XVSH 4JFTA 2LLLA 1SFHA 4ZODA 4ZW7A 1QSZA 4PWJA 4QF1B 3N42F 3T5WA 4N9OB 3TV8A 4LOUD 1BOGB 3DX9A 5D6DC 3QFJE 3GPEA 1QAWA 1WD9A 3B9KA 2JB6A 1GGBL 2RCSL 1SLXA 3MV8D 3PXJA 5JHLH 3OGCB 4FNTA 2NTFB 4QHKI 5AKTA 4A2HA 3IAGC 1XXFC 3WS3A 4FQXA 2J55A 4X4ZA 4XP6L 2UZIH 4X6FB 3HAEH 4WEEA 5C07B 3UJIH 3KNBA 3U9UB 2F68X 2DJMA 4U1IB 2MPAL 4G6AC 5DHMC 3GMOB 4XN7A 4PJCE 4ONOA 1A7PH 4J3OG 1P4IL 5C8JB 3RTQB 1U3HD 1ADQL 1IFHH 4L1HA 2RQEA 1CU4L 3KG5A 3RWEA 2BC4A 4HBCL 1F90H 4P46B 4UT6A 1BXAA 1VFAB 1H15A 5K39B 1E65A 3DX8A 2AJZB 1RUAH 5FCUH 3ZDXF 3VB8A 1GGTA 4U33A 3Q06A 4DAGL 1J0ZA 4RMQA 4JFEA 5HYSB 1L9TA 4XX1G 1LYQA 1Z9OA 1AP2B 1LVEA 1RUPL 3BMWA 1JYNA 3SGEH 4EPSA 4ZMAT 2G75B 1OLLA 3PWUA 4A7QA 1RZIB 1JP5A 2AQTA 1DR9A 3TNNA 2BHFA 3M7OA 4CSZA 3PWPD 2X6CA 4MD4A 1MRDL 1CGSL 1RPQA 1QMUA 3T2NL 3MV7E 1CVSC 3HG1D 4Y1AE 3BMVA 4EIBA 3REVB 4YSQA 1HJCA 4KXZH 4NT6B 1XGYL 4LE8A 1S7UA 1DUZB 4HUNB 5ITBH 4NFBA 3LX9A 2HTLC 4MLSA 4L2LA 2VAAB 3QUXD 5TD4A 4ANKA 1L7TL 1M05A 4JQXC 2NUTA 1WUNT 4WTWA 3QPKA 1RVFH 1FLRL 5T3ZL 3GMMA 1NC4B 3AG3B 3V9FA 3CSPA 3QIWA 4G42A 1KYOK 4U1MB 1OPOA 3TZVA 2BWQA 3VTMA 3R8BB 3X12B 2I7SA 3G5XA 4L4TE 1NCUA 5IBUG 5I2IB 5J5EA 1R17A 5TDOA 1EBPA 5DC2A 3VSVA 4RSVA 2R39A 3IDIB 3FO0L 2DQ6A 2RACA 5IMKB 4XOAA 2Y6TE 1QR1A 3BVUA 4XNYL 1EZLA 1D5IH 5HPOA 3CFKB 4G72B 5E2VH 5F1IA 5AW2B 4BA8A 1OM9A 1M7DB 4D9RD 2YD5A 4Z7OF 4AEIH 2K8MA 2NY6D 3D25A 3LQMA 1ZY9A 4LLAA 4WFEE 3CN4A 4AEHH 3MGTA 4OLEA 4EUPB 1QSED 4FHBD 3UP6A 1FJ1B 3FT2B 5HDLA 1KPUB 1DEEA 1MPAH 4PJ5B 3TBSB 4FXKC 3M17A 2TSAA 2YAEA 3HE6D 4L3CA 3K3QA 4ZTEA 1NGQL 5FYKL 1F4WH 2B2XH 2R23B 1C5CL 4FFYH 2GIXA 1CBVH 4M6NH 3TF7C 4NP4H 3WAKA 3WKML 3T3ME 2GITB 1WCBA 3E6HA 3R8QA 3MV11 3HZYA 3S5LG 3HVNA 2Z7WA 3TH4T 4WHCA 1UJ3C 1D5ZA 1IGCL 3PDDA 1LO4L 3BQVA 1LWRA 4F2FA 3G6DH 3PDOA 4GKNA 2XBZA 2JB5L 1YRKA 5HHOE 3QJHA 5TDPB 3SDAA 1Y0LB 2DMGA 3A22A 4LMQI 1XF4B 4JZJB 4NUJA 1NAMA 2WBKA 5E4EC 4ODVL 5I8OL 1EV2E 5BZDA 4RGMB 4LIQE 4TUOA 4D7PA 3O2VL 5F89A 5C3IA 2WQUA 4KKAC 1A9EA 4JG5A 4PV9B 2XKNB 1OV8A 1BQHB 3GK8L 2CPCA 4HIXL 1EXHA 1AZCA 1IEBB 1YPZB 4M56A 2YGPA 1CE1H 1RSYA 2EVJA 4LSRH 1NL0H 3L4VA 2XBTA 5D72L 3TEYA 3NEEA 3PHAA 4EQ2A 3B5TA 3U9WA 4PJ8D 3HPLB 2CKNA 4MMZC 4W9DC 3E3QC 1KACB 1HQRB 1PBYA 2H0JA 2V17L 3AXHA 3PWJA 5E1AB 1I3RB 1Q0YL 5K69A 2Q0ZX 1RIUH 2JJTC 2R29L 3WFCH 2VLJE 3SCMC 1MH5B 5IGXH 3HRZB 5HDQL 3KWUA 3WXVL 1F8TL 3AAZA 1CR9H 4KVNL 2BNQD 3NFSH 3L4UA 4L0PB 4LSSL 5JTWA 2PO6B 1CXFA 4PJAA 3TA3C 2GK0A 4Z7UA 1MEXH 2PW1A 4WJG3 5BZWB 2Y7NA 1MFVA 5DO2D 1FGNL 1HH6A 2ITCA 5BPPA 3TO4D 3EYVB 4TOYH 5CM1A 5CUSH 4OFIA 1MHCA 3HI6H 3D69A 3G6JE 4IGBB 43C9B 2DWSA 1N8ZA 2W9EL 5F8RC 4U3CA 1UM4L 4G8EA 4X4YB 3VH8A 5D7IA 2ZKHH 1M53A 4JO1H 2ATAA 1OT2A 4ZOBA 4DP0X 2BHYA 2R15A 4FA7B 4W4NA 3W81A 4KBPA 4FQ1H 2H3XC 4UOW1 2V2XA 2CQVA 5C9JA 4IRZH 4JUTA 4OF3A 4X8JA 4APXA 1NBYB 1QSVA 3MNVB 25C8L 3Q5YA 3CQFA 3VXSD 1S3KL 1P53A 2BP5M 3ZDZF 4F5CA 1ZTXE 1MRFL 3ZYOA 1JDCA 4Y4FB 2AEIT 2VJ0A 2P42B 2WNWA 4G7YH 4PUBH 1IBBA 3I75B 4JPKL 4OLWL 2VMEA 3S8GB 2B5IC 3RZCC 3QO1B 5MEND 2M83A 3D12B 2Q7YA 3V7MA 3NZ8B 2DDQH 2E74C 1G7HA 3ARTA 3H3KA 1YY8A 1XGZA 2UYLB 1ES0B 4YSSA 3NZUA 1KN4L 2MIZA 2Y69B 3L95A 3MJ7A 4LLUA 5EEXA 1IAKB 1R4XA 3NCXA 4BSVB 1SUJA 3RWCB 4G9FE 3C6LB 3G5VA 2BNRD 1PEWA 1QO3A 3MRGB 4UANA 5A2KH 2B15A 1A3ZA 3GMLA 3S3CB 2X4QB 3UBXA 4B50A 5IEHB 4APQB 1XGQB 4GP5B 1KCUL 3BWUF 3VI4B 1QSFA 1TZGH 3LEXB 5IQLA 1ZOXA 4HJTA 1FE8L 4HXAH 4PS8A 3LRHA 2VH5L 3IU3A 3GSNA 4XMWA 3FUKA 3SY0B 2UY7B 1G9MC 3NRPA 4TSAL 4ZQKA 3EDFA 1WP6A 1HHJA 1GOHA 1WBXA 4LHUG 4Q6IA 1KIRB 3BAYA 4NBZB 2UUDK 4PGDB 5ANMA 2G2NA 1UVQB 4KJWC 1FVCB 1B4JH 1W0VA 5B38G 1OCWH 3FT1A 3MCLL 4GAGH 5F7AA 4Y4KB 1FFNB 1D9KC 1I8IA 3AWEA 3MGAA 4KJYA 1OCZB 3ENEA 3H2WA 5C0FB 4M6OH 4M7KH 4NERA 1QHQA 4AXWA 4ZPTB 1MDTA 4LCCC 5TFSH 3DO3A 1OAZL 1ACCA 2FZ3B 2IG2L 2YSTA 3BKYL 4M5ZL 3RNKA 4JB9L 1XGUA 1U8LB 4ONHA 5ECJE 4L18A 2BFGA 2XQYG 2CR0A 2UY6B 2JTDA 1X5LA 2QADD 2AXGA 2ALWA 4IIQA 5GZOD 2YD7A 5CCGE 1JXFA 1SVZA 4JY5H 3KPQA 4NO2B 5DGQA 3VACA 5CJQH 3UJTL 1EPFA 2FK9A 3QZWB 4LNVA 3QRBA 1UWEL 5D7JB 2X7LB 5EH1A 1NTDA 2QSCL 2O5XH 2GCYB 5C08A 5J89A 4GKZA 1S7WA 3ZE2B 4M6AA 2WK2A 5E8NA 1KCVL 3BRGC 3OXRA 4O02B 3VXRD 3S34H 3T4AB 5JPNA 5MHSD 4L5FE 1A2YA 3IBOA 4PH8A 5FR3A 2X1WL 2W0FA 2ICES 3HCVA 1WZ1L 1R19A 1MIEL 3KPPA 5I1CL 5JOFA 2IALB 3K0WA 1CFVH 4OFYD 2ARJB 3NUKA 3FQTA 4UT6H 3STZA 5DQ9A 4YHLL 2EH8H 2JJWA 2JI3A 5D71H 1EXGA 1GZQB 2CCVA 4TKWA 4B41A 2E7DA 4X6BA 4B3EA 1KLGB 2ADIB 2F58L 1IBGL 4UTAA 4X9HA 2JV6A 4XHJC 4XO9A 2YBGA 5J1AA 2Y22A 5E6IB 1PX3A 3FH8A 4NPKA 4UQ2A 3S96B 3JUYA 5JO5A 3HFML 3ZDXE 3BE1H 1B4TA 4JZOB 3JV4A 1KWGA 2OR9L 1CGVA 4P06A 4YH6A 1L6XA 2XY1A 1G87A 5CJXC 4J12A 3MO1B 3ZTJG 3HG3A 3BSHA 4WWPA 1TR7A 3STLB 3MJ8B 5JXAH 1P4UA 2Q76B 1JS4A 4ZFFB 4MAUL 1F4YH 4Z3TA 3QNZA 2EACA 1GIGL 1CFSA 2NDFA 3PGCB 4YWGL 4WUUE 4WSJA 4DOHB 4MS8C 4NENA 1IRAY 5BVPH 3N1FC 3PXLA 3FOMA 3QDJA 1P4LB 3QEGH 4DCQA 1I8MA 1GZHA 1XB3A 5H4YA 2G9HA 4I18C 4Z1PA 1XF2A 4OM1L 2Q3XA 3FQUB 3L3HB 3MPCA 4NQTA 1X3DA 3GIZH 1OAUL 4P2RD 4XX5A 1J48A 2QEJA 4UILH 2G60L 5HGDB 2X70A 5E2TH 4PU2A 1HYRC 3ZYIA 5LGYA 3ASWA 4HSCX 1NIBA 4JVPA 4KHTH 1X5AA 4MDRA 1EXUB 4BZ2A 2BP0B 1E0OB 2ZUQB 2VISA 2C9AA 3HZKB 4HS3A 1ZVNA 2RR3A 3MACL 1FO0A 4NQEA 5MEPA 2DQTH 5J6GA 3FONA 1LP9F 3AS2A 3HAEB 5DHVB 2IF7A 4YHIB 4B5ZA 3D3VB 4PD4J 3MLSL 2CGRL 3K72A 2W9DL 1FZOB 2VDLB 5GISH 4Z7OE 4P23A 3T8XA 1O5DT 1YMME 3BN9C 4NPYA 5ICYA 1FNGB