1COBA

Crystal structure solution and refinement of the semisynthetic cobalt substituted bovine erythrocyte enzyme superoxide dismutase at 2.0 angstroms resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Crystal structure solution and refinement of the semisynthetic cobalt-substituted bovine erythrocyte superoxide dismutase at 2.0 A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Oxidoreductase
total genus 38
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1992-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1cobA00
1YSOA 3CQQA 2E46A 2JLPA 4BD4A 1IB5A 2WKOA 4MCMA 1U3NA 1QUPA 2AQTA 2WZ5A 1SXNA 3KM1A 3GTTA 1E9QA 2APSA 2GBUA 3ECUA 4N3UA 1E9PB 3CE1A 2WYZA 1JK9A 1BZOA 3L9YA 2Z7UA 4A7TA 1TO5A 1IBHA 4FF9A 1EQWA 1OZTG 4B3EA 2R27A 3GZPA 2JCWA 4A7GA 4OJAA 1CB4A 4L05A 3S0PA 1E9QB 4OH2A 3F7LA 1SXBA 1F1DA 1JCVA 5KBMA 1RK7A 1SDYA 5KBKA 2ZOWA 2AQSA 1PZSA 4A7UA 1DO5A 1Q0EA 1UXLA 1E9OA 1FUNA 1XTLA 3KH4A 2AF2A 1KMGA 3GTVA 1ESOA 1CBJA 2C9UA 2ZKYA 1N18A 3HOGA 4A7QA 3KH3A 4A7GF 2GBVA 3HW7A 4U4IA 3QQDA 3MNDA 1E9OB 1N19A 2WWNA 2LU5A 3T5WA 3HFFA 3MKGA 3SODB 3GQFA 1SRDA 2AQRA 5CU9A 2WKOF 1JK9B 3QQDB 3ECWA 1Z9PA 2K4WA 2GBTA 1L3NA 1SDAB 1YAZA 2WWOA 2Q2LA 1OEZW 1HL5A 2VR8A 1S4IA 2VR6A 3F7KA 2E47A 2Z7YA 1Z9NA 2AQPA 4N3TA 4A7VA 2VR7A 2Z7WA 1EJ8A 2WZ0A 4MCNA 1F18A 1F1AA 3K91A 1SXAA 3L9EA 1SXSA 3GZQA 1COBA 2C9SA 3KM2A 2SODB 3KBEA 1TO4A 3RE0A 1B4TA 2Z7ZA 2AEOA 1SOSA 1OZUA 4BCYA 2NNXA 1XTMA 1OALA 2XJLA 1PU0A 3LTVA 1SXCA 4A7SA 1SXZA 1AZVA 1HL4A 1MFMA 2C9VA 1B4LA 2WZ6A 1OAJA 2AQQA 1P1VA 1F1GA 1YAIA 1IBBA 3ECVA 3H2PA 3CQPA 1IBDA 1BA9A 2ZKXA 1PTZA 2AQNA 2XJKA 2ZKWA 1DSWA 3H2QA 1UXMA 3KBFA 1SPDA 3PU7A 4BCZA 2V0AA 2WYTA 3GZOA 1E9PA 5KBLA 1IBFA 1XSOA
chains in the Genus database with same CATH superfamily
3PIQA 1PNDA 4GSDL 3R06A 3ZIMA 1LWJA 3PDDA 4AYGA 3MRKB 5TE6L 4ACTA 3P77B 4PCKA 4WFEE 1F02I 1GGBH 4FKEA 3NCFB 4AE1A 5DMKB 5EZOL 4F15B 2BVEA 1WH0A 3LHPL 3NGBC 4RRPG 5D7EA 5LKNA 3FCBA 2W59A 1GGYA 4J8QA 1P9MC 5AZEL 4KU1A 4R7NA 2JCWA 3NCWA 1A9BB 4JJ5B 1LEGB 3GGWA 4QXVA 4NDMA 4P49A 5E2TH 43C9B 3IGLA 3DI2B 4Y4HB 1KIQA 3S5LG 4HUXB 3ZTCC 5I1GL 5HJGA 2RJMA 5EPMB 1IT9L 4F9PC 4P4KB 5KVDE 1LMIA 1T03L 5LNEA 4OQTH 4EI0A 1ES0A 1EFXA 4JM4L 4W9DC 1N18A 4GW1B 4PJ7B 2YN3A 1BZ7B 1E8XA 4GUPA 5KYNA 2NRDA 3MRPB 3GKZA 1MHEA 1OCWL 3EHBB 4MZ2A 1DJSA 2YAEA 1I85A 1L9MA 4ADJA 1CLVA 1MFDL 5B39A 4YHML 1DEDA 3CHRA 1RFDL 3NFSL 2BPBA 3FQ4A 4FGMA 2LVCA 5DJCB 4JRXD 1URZA 1A3RL 4QEGA 1ZPLA 2FBRA 1UASA 3VFSA 2V3FA 2XKNB 3EJQA 3M45A 3MUY1 4U0RC 4ABQA 3TA3B 4TSCL 5GISL 1PKOA 1L3NA 4XO4A 3RA7H 1SDAB 3UBHA 2BHUA 3MOBH 3GJEA 3L3JA 2DLHA 2NXZC 4LSVH 4PJCE 4WF7A 3QI9A 1S6NA 2N0MA 4X0KA 3T3PE 4ZMQA 3FU5A 4N2HA 1EZSA 5E8EA 5ETUA 5KZCD 3ZT7A 3UYOD 4Z3FA 3S8WA 2J12B 3IDJB 4PJFA 1MAMH 4NRXA 4DQOH 4EZMA 2WNXA 4QI3A 4KKCC 1RZIA 1RZKL 1BCIA 4AIZA 3BVDB 1JGEB 1VESA 3OG4B 4OUUB 3B3IA 4DGVH 3O0RH 1LO2H 1G7PA 4JFQB 3QUKB 5KS9B 1J05A 4WV1B 3WL9A 1C08B 2L7EA 4TNGA 5EBMB 5J6GB 3ZLQC 3D4YA 4I5BA 3H9ZA 4EUPG 4UQAA 1MHPH 3QA3A 3F7YA 3U0WH 1OAJA 3Q48A 1UD8A 5E6IA 4HUUA 1YO4A 3B2VL 4XP5L 2VDNL 3T3MB 1I1AC 3QORA 2NZ9D 1O9VA 3O3EB 3LNFA 4U6VH 1GS8A 4OV5B 4D7PA 2HTLC 4LSRL 2IWFA 3G6DH 3SGKC 4CU8A 4RGOH 4NC2B 1VFMA 4J3UA 5A7BA 4NBZB 2PO6D 3TBCA 1OXYA 2F5AL 4G83A 1AAJA 4GRWB 4EN3C 5EFIA 4QCIA 3O2DH 3OGCB 4WEMB 1VZIA 5CGMA 1UH4A 2VZ1A 3ZTEA 3VXQB 2XXMB 1QYGH 4NX0A 1QR1B 2ZXEB 3L08A 1MF2H 4FNQA 1JYNA 3SPIA 4R8WL 2JLLA 3H9HA 4PEEA 3SKOB 4C47A 2XA8H 3Q2CA 1M2VB 4IBQA 3B37A 3DROB 5A2FA 3KPNB 3CWGA 4BUQA 3RVUC 2A6KA 2XXFA 3BT0A 3NFPA 1P4UA 2E6JA 3RFZC 4M7JH 2O6FA 4HWEH 4J5VA 1QLEB 3JT2A 1MEXL 4JLRB 4U3SB 4NI3A 3T71A 3FTUA 3QIUC 4XVSH 2H3NA 1D5MB 1CE1L 4G8GD 4NENB 1MIMH 2WUCL 3P02A 1UZ8A 1AZBA 2NY2B 5EBWA 1JPGB 1KXTB 1CICB 3V4VB 2UWEE 1SNRA 5DHVA 1XH3B 2YD0A 1DBMH 2VZOA 4HQQL 4G1EA 4ZXBA 1A1OB 3KPMB 1BECA 5HJDA 5GGSY 3OF6D 1VENA 3VXPA 2FWLB 1ZHLB 4RAHA 2FJFA 2IH9A 4JFXA 4YO0A 4X6DA 1OF0A 4C58B 1U58A 1YYMH 2L0DA 3ARBD 3JTBA 3MZGB 4UNIA 1W72L 1Q38A 2GSIA 4P2OA 5HDQH 5INCB 5C0EA 3WJJA 5J1SC 1B0RB 3DSFH 4E0RB 2JELL 1H3UA 2P5WB 3QJVB 4MNQD 1BZDA 2H26B 4LPWA 2Q8AH 5MHSE 3RWEB 1MNNA 2JCCA 4BWWA 1MJ8H 1G7MB 2YXWA 4HXAL 4CKVX 3V4LA 5D70H 3ASNB 4CMMB 1URIA 5EU3B 2G5UA 2WP3O 2HJLB 3V6OE 2QTEA 1S5IL 4PWKA 1M57B 5DGQA 1SOQA 4V1DD 5JNYA 4UTBH 4KMQA 3IK2A 5AL8A 2DDQH 2XIIA 32C2B 3GSOB 1K8IA 2QPEB 1PFOA 5K69A 4ZMVA 2IGFH 3WJLC 4LIQL 3MRRB 1YPZB 1KXVC 5IY5B 4FTDA 2ZCLH 3AU0A 3GS7A 2ZAHA 3BVVA 4QRAA 2Q8BH 4JREC 3D0AA 4G2AA 2ZUQB 2UZXB 3KAAA 2VSMB 3LKNA 4PTUA 1EEYB 5IF0A 2GYSA 3U4BL 3CVIH 5MEOB 3P9WB 4LSTH 3T1FA 2XG4B 1DVUA 2ZCZA 4H88H 4Q7DA 1KNOA 1IAIL 4Q9RH 6CGTA 4BGLA 5JW4N 3BPLB 3VGDA 4ZUUB 1X7QB 3U0TA 2RGSA 3OAUL 5H2BA 4G9FE 4ZFFA 4HVBA 1UM5H 3VGBA 3QCTH 4P46A 4E9LA 5ICZB 3KYNB 2UXVA 1KTLB 1R24B 2Y4SA 4N2BA 4R5XA 4XVJH 1UYWL 2UYLA 5ESQB 3TJHC 5M7QA 4K4KA 2CCVA 3CDFA 5DJXA 4C56B 2C34A 4MASA 5E1AA 4N85A 4BFKA 1YUHA 4KI5C 1U8LA 4MCYB 1QP1A 12E8H 4J7RA 4DZBB 4GYBA 1YMHA 2JIXA 1U33A 4GRLD 5ACMA 5IVNA 2BVQA 1NCBH 2Y7QA 2YD4A 3QDMA 3EDDA 1LO5B 2B1HL 2EUZA 3SE4A 4JPQA 2VM3A 4N90E 4P2RE 1QTPA 4WCYH 3VW3H 4DPRA 2CIKB 5I9QC 1ZXKA 2XWBB 4XODA 3RGVC 5JHDB 4H4NA 1KBWA 4HS3B 3EGDA 3S5ZA 4UDUB 1OPGH 3RI5K 1M56B 5D1ZD 2XXCB 3C5ZD 4ZPTB 4X9YA 5CLWA 1U36A 1OGSA 2LAAA 1EX0A 1H19A 3X3GL 2E4FA 2ZG3A 4PCTA 3WHE1 1J5DA 4NLAA 2XPGB 4OCSH 4JGUA 3T0ED 3C2SA 4WHTA 2G4GA 3BZFA 2VMDA 3NUKA 3P3SA 2EXSA 5DUPL 4FEMA 4MD4A 1NA8A 3J07A 4G70B 5T1LB 1XCXA 2F7QA 1R6VA 2VMJA 3T2OA 1NCOA 1NC2B 3PS6A 4LSQH 3UO8B 1HINH 2WLMA 4DKDC 3CHXA 3T4AC 2ZICA 3K6SB 1P7BA 3QNZB 1O7DC 4G9DB 3BP6A 3EJSA 3SPVA 1LEKA 5IVXF 3GMLA 2GTWA 2HFGL 3QPQC 5IZ7A 3GM8A 2Z3FA 4ZI8A 1TETL 3T6VA 1VB9A 4PGEA 4WTZG 4OM1L 1KC5L 2UX6A 5TDNA 3VD4A 4I0PC 4QXUH 4UB0L 4JAMA 4JO2H 1JVKA 4FA8A 4HCGA 1HIMH 2RTTA 4GG6E 3HNVH 4XH2B 4EDXA 2KH2B 5IMMA 1MW3A 3W9DA 3I74A 3L45A 1FGNH 5ANMB 5L6YL 3B5TA 4XVOA 1VGEH 3FO2B 1QI3A 5L8KB 3IFNH 5F3HA 4EOWH 3JSSA 1XL6A 4I3GA 3IAGC 4N8VB 4RVBA 1HH6A 3FUEA 4ZS6D 3KPPB 2HRPL 2ED8A 3FT3A 1XGRB 5DR5H 4HCRH 2OP4H 1YEFL 5H35A 2B9BA 3ZU8A 1AXTL 3DECA 3GI9L 2I60H 3B6SA 3F6JA 4YNYA 2CWRA 3QUZC 5JPMA 2X1OA 4M7ZC 2ZF8A 1RK1A 3ZTJH 1H5BB 3GBNL 1Q9OB 3JUZA 5E7FA 4D3CH 2O61A 4BKSC 3DX1A 5B8CC 3PDOB 2E27L 2ZX9A 2F53B 1X9LA 4J23A 3QRFM 2MCPL 3Q01A 4I85A 1N4XH 4Z1PA 4X5XB 2BS8A 4LLDB 2WN2A 2BCMA 2IADA 4ZMYA 1HQ4A 3D39E 3B1TA 3D2TA 3ALWA 2MOGA 4GKZA 5AAWC 1X5ZA 3WHXA 3EOBA 3NJIA 2R7EA 4ZUSB 2ICWB 3AU1B 3IWUA 3ERXA 4PRHB 2DQCH 4MMYB 1R3HB 4HXBL 5L2KB 1F41A 3FOMA 3L5XH 2PCFA 2ADIA 3OXSB 4FXKB 4BSVA 3NZ8A 2HLAA 4ZZFA 1L0XA 1R19A 3SKMA 3FB7A 3AZUA 1Z9SB 3EO0A 4LLWB 3IRCA 2DBLL 4PJ8A 3IF1B 4Z3JA 2WQXA 4AQ1B 3ORJA 4X8JA 2V17L 4FP8H 2NYYC 4KMTH 3FSWA 4JR9L 1DQIA 1FP5A 1FYTB 3FRUA 4Y9CA 5FUZH 3WNNA 4BH8B 5KTEL 5KW9H 1FQ9C 1T7XA 2UY7A 4G3YH 2ZAGA 2TSBA 2J43A 2A74C 4YHYB 4JG1L 1J1OL 1JHKL 1UB5A 4L18A 2W0PA 1DBKL 1FNSL 4ZX4A 4N2MA 4NQXB 4R7DB 5C2BL 1GRWA 5A2KH 3BGFB 4ZDHB 3HR5B 3SPCA 2GCYA 5E24E 3Q2VA 1KXQA 5GS0L 3U7WH 3VGAB 5J7CC 2HH0H 3K1DA 2ITCA 2X4OA 3QVAA 4WFGD 1UADC 4DERA 5IJCC 3FCSB 5FYLE 2YMOA 2VWEE 4NO0B 1RZPA 3NFNA 3UTTE 1FGVH 1AP2A 1F58L 3UZQA 4ZD3H 3ARED 1K4DB 2F54D 3FTYA 3B8YA 3LTVA 1L0QA 3NSJA 4MMZA 5AW5B 4BWTA 3P9MA 2C4FU 3BT2H 3MRMB 2XTJC 1M1XA 4PRBB 4WI9A 5DO2D 4F33B 3TGXA 1FAIL 1BQ5A 4FQIL 5FCSH 5T5FL 4K8RH 1A6VL 2BOCB 3LXUX 4NQQA 4LCYA 5FO2A 1QFWM 3A47A 3RDTA 4LRNH 1HHIA 5F7WC 3F12B 3UTOA 4XAWH 1DQLL 1FWXA 4U1MA 2JTDA 3KPTA 5JTWA 4WWKB 1CUOA 4ELME 4EXPX 2BP0A 5K33A 1YECL 3ARDA 4JG5A 1OK8A 3ZKND 1INDL 4N1HB 3EJRA 4ZODA 4TLKA 5KSBF 5DQJB 2KZKA 5C07A 2R0KH 5DJAB 5I6XB 2YAHA 1EEUA 4HP5A 1S7RB 2IG2H 5GHWL 4UM8B 3QEHA 3WDIA 1TEYA 2R4SL 2R23A 1K6QL 5SWZA 1BEXA 3CVHB 3OTTA 4KRNA 3OR6B 5FECB 1X9UA 2J5LC 2UXFA 3ZE1B 2JJTA 3BKMH 1G94A 1HILA 4NPJA 5DK0B 3OXRB 5KANI 2WXKA 4LDLB 2RD0A 4G42B 4J3TA 4OQTA 2N7BA 1XD1A 2NT1A 4X50A 4HJJL 4JPKH 4NIKB 3H9SE 2C3VA 1GPOH 5DFWH 3BYTA 2V4LA 3BKJH 3FH8A 4LE8A 2E9GA 4E41B 3M88A 4BH7B 5GZND 4K71B 4DN4L 1U95B 5J12C 2AQ3A 2WTPA 5F3BB 5ELIA 5IHHA 1AHWC 3VFPA 4QAMB 1NFIA 4I87A 5I1AB 1HCFX 4XMVA 3VFUA 3HA0A 3DURB 3MV11 4RA0C 1JZJA 3ETSA 1OIOA 2MQ0A 3DDFA 3D30A 3S9DB 4H5SB 3EO9H 3VI3F 3QP3A 5F6IB 2DLFL 2XQYG 3PP3K 1LO3L 4NZUL 1NFAA 1X5GA 4AUJA 3MQIA 1A7PH 1JI2A 5KYUA 4F7EB 4HWUA 1ZIBA 1NGWB 3U7YH 3IS0X 3WSQH 1YY9C 3HFML 3DX2A 2VDPL 2FT7A 1J11A 2P80D 4RX4A 5D1QD 1NCUA 2WWOA 5E9DA 4QRFA 4FA7B 4YHLH 5BV7B 1AR1C 3EF7A 1PL3A 1PLGL 1DP0A 3V6BR 4DEWA 4UOQA 3EH1A 1CR9H 3C6LB 4Y8AA 3BHBA 4MWFA 4ZFQA 2J2ZB 5ACLA 3K4AA 1IJNA 5D2LE 1XO8A 4MA7L 3MRGA 1R3IH 3MJ7B 25C8H 1WAAE 3UCQA 4OCNC 1VRSA 2ZIDA 4KK6C 2A73A 1J9TA 4OZIE 2YARA 2XN9E 4NSKA 2C9QA 2HPOA 1A25A 1B88A 5D55A 5D7IE 4JFZL 5GGTL 3KR3L 5IJVA 1CFBA 4DWHA 2AKRB 3VWJC 3SE8H 2YZ8A 3BXNB 3C9NA 2ICEC 4WSJA 1V7NL 1NEPA 3GJFB 2YD9A 3FQ1A 2TSAA 4JQXA 2DJSA 3SKJL 3TBTB 4XMXA 3O2DA 1KCUL 3KPLA 4DK3A 1WEJL 1NCJA 2BVPA 4U1SB 3W3BA 1UENA 5PAZA 1H6TA 4ZO6A 5GPRA 15C8L 3P9LA 4HUCA 3CVBA 3T08A 5DF0A 3QG7L 4M8QB 3O41B 4CVZB 1AZRA 4PJBE 5IESL 1EERB 4X8XA 2JNZA 1HE7A 2HLEB 2HLFD 3UG5A 5SWSD 4FQXA 5JQ6H 2YAQA 3DMMD 4YFDB 2IMMA 3QJOA 4J6IA 2C7FA 4JM2A 5L88L 3V4PH 5ID0A 1JIBA 1A66A 2L7QA 4I2XA 1OTTD 3P3TA 4Y4FA 3KDPB 4NC1C 2WIIB 2YWYA 4AVJA 4QNPF 3GMRB 4X6CF 3EOYG 1DJXA 1UT1A 1JXDA 1TZHB 4CSZA 4Y88A 5AOJA 3FB8A 3SPGA 5CAYB 3P40A 3I6KB 4QXTA 3B5HA 2AJXH 1UUSA 3SE6A 3VNYA 3VXRB 1SEQL 5JXEC 3OHXB 1WZ1L 3NP3A 1FUNA 3VXNB 3Q3GA 1V3KA 4M6ML 4X6BA 5GRYA 3VCLA 4BBWA 4Z77A 3RZCD 2NX5B 5JLZA 5LN4A 2YPKB 1SN0A 3ARTA 5AWNL 2LAGB 1SLUA 4O4YH 5E5UB 5F3FA 3X14A 4BQ9A 5CN3A 5AVYB 4NRYA 4LAQH 4Z0BL 1TQTA 3MRJA 1IC0A 2HFFA 2B1AH 3SDCB 3SGEH 2DM4A 4LPUA 1GH7A 1GIGL 2PCYA 4QKXB 3IKCB 3VE0A 4XPAL 1S9KC 4NUGL 3KYMA 5F70A 1KPRA 1N3NB 5IFHL 2BMKB 4UTBA 2WXLA 4NNPL 4HDIA 4XCFH 1IBGL 3WJMA 3K1KC 4GMTL 2E75C 3DXAA 4OU3A 3VXMA 4F2MA 1KWGA 2CO3A 5J13C 3LKOA 4QJ4B 1JVLA 2PCXA 2CQVA 2EDYA 1XIWA 2QKIB 4PVNA 5KVEL 3D85A 3NA9H 1G7HA 4DGWC 4BZYA 4M9PA 4HOWA 1MFAH 1NCWH 3FXIC 5BRZB 1DJZA 4F8PA 3QT2A 3Q8BA 5FHBL 2FD6H 2W0KA 4Y89A 3NYKA 1SFHA 2VXTH 1OT1A 4PLKC 4HKZB 3E0GA 1UVQB 1AQDB 1RJYA 1NBQA 1P69B 1IGIH 1L9RA 3X1EA 3BPCB 2D3LA 4U3XA 3VA2C 2YRZA 5DRZA 4F9LC 3UP6A 1MPAL 1NCIA 2PR9A 3DGGB 1LQBC 2D2CC 3GI8L 4QHUB 5D6CA 1WPCA 4MNHB 3V0WL 3EFDH 4TQIA 4PJFE 2X2HA 4PG2C 4U1HA 2DM3A 1ICTA 4XOEA 1MCPL 4LLUA 5TD4A 4K3DH 4BZ2H 3B9EA 1U91B 3MBXH 4IHOA 1NMBH 2M1KA 4NFCA 5GGUB 3CLEL 1T1ZB 5JDSA 4Q58C 2CIIB 4XZUB 4JHAL 5EUOF 4JZNB 3G5XB 3WMSA 4R4NC 3ESUF 2CLZA 3LQAC 2H8PA 1X9QA 2YD6A 4ZS7H 5B3JE 2AEQH 4W81A 5DUJA 4FG2A 5JR1H 4KAQL 1YG9A 3L3HA 4QRRB 3B7UX 4BK4A 3F7QA 4YLCA 2VXSL 1EQWA 3C5JA 4B3EA 4MMXA 4A7GA 4J6RH 1MAKA 2QV2A 2FEEI 4X98A 1OY3B 3LKPA 4JPWL 2D8KA 3O45A 1EGJL 1XCTA 2GJ6E 3UIZA 1C8PA 2FGWH 3BUPA 3CX2A 1WYJA 4U2ZA 4O9HL 2NR6C 2XN1A 3AY4A 4C8XA 1T89A 4AQAB 5IMLA 4PJGA 1QBLH 2AF2A 5GGRA 4P3DB 5FYKE 4PJHF 1D6EA 2YPVL 2O6PA 4YSEA 4NCC2 3S3DB 4A2HA 4XMUA 3QYNA 1J48A 4NQEB 4FXGB 4NO3B 2OMUA 1Q1JL 3N1GC 2R2BA 4WFED 5I76A 2XKSA 3HNTH 4HSQA 4GBXC 4XCCL 1JPFB 3RX8A 2L8AA 3RNQA 3VG0H 4H1LH 4K5PA 4FL4C 4LFHG 1NAKH 3S88L 2V3DA 2HVBA 3OAZH 4PGCB 4N9GA 4BSWB 4QOKE 4C4BA 2GAZA 3WIIL 3JWOL 3NSDA 1RVFL 3TC9A 2IGLA 1TZAA 2PR4L 4ZUVB 5HHQA 3LN5B 1DVFA 3LSOB 2J4WL 3GLZA 1HHKB 4YSOA 2CLRB 1KLUA 2B7DT 2Z0UA 2EEDA 3L81A 3UJJL 3V5HA 4LKCB 1UA7A 4GXVL 3HC4L 1DSFL 3HE6D 1RZJL 1OVZA 1Z9OA 3LHAA 4Z7UB 4HBQA 2BM3A 4NI6A 3VMOA 2A9CA 2SEBB 1O9ZA 5IB5B 1YCSA 4MX7B 4KRPB 2A6IA 1KGXA 3UZEA 4PGJA 3JWDH 2XZQL 4HCRA 2CJ3A 4CVUA 3AY2A 2B59B 3PG2A 5IHZB 3CFCL 4LPVA 1OKEA 3ABGA 1HSAB 4FQQA 1FZKA 2JCCE 4FLQA 3D1MC 5C7XH 4ATWA 4DP7X 1E2VA 1ZTXH 2Z93A 2GG1A 4Y16D 1NLBH 4IW4C 3P4MA 2MJWA 3US0A 1CFMA 2BWQA 2WXGA 2PPEA 5FKPB 2HTKD 4EQ3A 4WQOA 1FO0H 1RZKC 1A65A 2GITA 4L4VE 4WWNA 4NYLA 4CC1A 5IQNA 5FM5M 2WLLB 3IN0A 1MVUA 1U8KA 5MENB 3LAFA 4MQXC 2D9CA 1YEKH 5ISZA 1U2HA 3MJ9A 2BIHA 4BIKA 3JWNE 3B9KA 3OJVC 4ONFL 3GMPB 3ARWA 1FVCA 4WO4C 2X2IA 5H4YA 4LT7A 1F2QA 5DS2A 1VGKA 5BZDB 3NEOA 5IROA 3FSOA 2DEXX 4WJ5A 3EADA 3S8GB 3H42H 1YNKL 2AEIT 5I19H 1JRHH 4GFXA 3KHQA 1AGEB 2XZCL 1QO3B 1YEGL 2XWRA 4DP4X 3MNZB 5EU6E 2DKSA 4R0LC 3IU4H 4KO5A 1YRKA 2D7QA 4H20H 2K7QA 5K5YA 4X4XB 1IM9B 2J55A 3RVVD 2OR9H 3IDYB 4Y2OB 4OGZA 1MFUA 5CLYA 2YEZA 1WJ3A 4PRIA 3JTSB 3VRLE 4LU5L 1CXKA 1PG7H 2GBVA 1UD3A 3EJTA 3HE7D 3PNWB 1JZFA 3BCDA 1WCBB 1CFTA 2AK4B 4GRLC 4UCFA 3SO5A 2J8UA 1QRNE 2UV3A 4MCZB 3MOAL 4P48A 1V55B 5FKAB 3UX9B 4I7ZC 4AIOA 1SRDA 1DVSA 2OXHB 4L48A 3AM8A 3DBXB 5ACZA 5CP7A 4DN3H 5FX3A 3U6RA 4K5MA 4MRBA 4UV4H 4MQTB 4XNYH 2BFGA 3MA7A 2Y24A 1ZT4B 3BEWB 1D9KA 4XI5D 5DYFA 3BMWA 1VFAB 3ZL4H 1T2QL 1P4IH 5I1LA 1ONQA 5IB4B 1XEDA 4JDTH 2K8QA 4YX2H 2OMNA 1IILE 4MCNA 4LO9A 3EH3B 1J9QA 5CLXA 2V33A 2MTAA 2WZPA 1ASQA 2ADJB 3CCHB 1AI1L 3WTYA 1WP6A 1FZOA 3HG2A 4RMQA 3NJKA 4MJ6B 2V7HA 5E8PA 5AVWB 2XU9A 5JUEL 4FADA 4YXLL 3ARGD 4B7IA 3GNML 4OI9A 1IE5A 1U21A 2J1WA 4NP4H 3TPUB 2W65A 3NJLA 2VERN 2PUQT 3L3IB 3O11B 1QVOA 1N6UA 2YAFA 3O6ML 2HJKA 4PLJC 3CSFA 2VL5B 4R26L 5SX4H 3X1FA 1F4AA 2GFBA 2VR9A 5KSAA 3WDHA 2EXYD 3D48R 3QC6X 5HHNB 3NSXA 4TLSA 3U2JA 4XNZB 1BZ9A 3B7SA 4IS6B 4IRZH 2P8PB 3U4AA 4NUJA 1J12A 1FRGL 4RDQG 3IJ9A 2J5WA 1QUNA 3EOAA 4JVWA 1IGTA 5IVOA 1LK2B 1P5UC 2HG5A 2LTQB 1CE6B 4H0HB 5HXMA 4HIHB 1W16A 3U79A 3VXOB 5GZOA 1UKQA 5JIDA 1SJMA 3W11C 4TNVK 1I7UB 1ZMYA 3D25A 5EOCH 3VD7A 1MIEL 1O5DT 4PV9B 1IQWH 3CTTA 3TN0D 1E4WL 1HHGB 2EADA 1ZAGA 3A5VA 4G6KH 5K9OB 1E50A 1U8OB 3NSYA 2WCGA 1C5BH 1TFPA 1KTDA 1EO5A 1UH2A 5IM7A 2MNJB 4FG0A 3LZFH 5LGJB 1GYVA 3H6JA 3RNKB 3GEWB 3U30C 1NMAL 3LIUA 5AENA 3TFKC 4L1BA 2BH0A 2FWOA 5E5LA 4JM0A 2VH5L 1PY9A 1T3FA 4KGJA 4DFIA 3VWKA 3MLSH 4PR5B 3T0DA 4HGWB 1YJDH 4G9FD 4XPGL 2WBWB 4FG6C 4NPKA 4S10A 4DP8X 1W0VA 3M07A 3MACL 1IC4L 2DQTL 2Q86B 2R69L 3PF2A 4BFBD 4AGMA 3VU1A 4KXZH 2I9TB 3KWTA 1L6PA 2IWGA 1I1AB 2BNRB 3BH9B 4CA4A 5KJRH 4JHWL 3PQYE 3QO1A 3B9AA 3Q8AA 3SQOH 3G5ZB 4HH9B 3WY4A 2COQA 2Q6WB 3ZR5A 3GUTA 1XSIA 4LLVB 1IUZA 2H41A 4WHDA 5D7JB 2D3NA 3OKNA 2FYYB 2LR4A 3INUH 4PLNC 1X5IA 4TF4A 5I17B 2H1PL 3HRZB 4PJ5A 4U4BA 1JFQL 5H37A 4N90D 4P2RD 4YXHH 3BESR 4A66A 1OF2B 4R96B 1KGUA 1TEFA 2QGDA 5IW6B 1AFVH 4JFSA 2BSCA 4CRPA 2EO1A 3X17A 4L2YA 3RPIA 1MY7A 2VLKB 3FS9A 1BQHB 2PXYB 2DQIH 1L5GA 3RFZB 2E7HA 4N1EA 2YKKA 2YMTA 4AGOA 5BW7A 2O5ZH 3DIFA 3MUGB 4YHOH 1NJ9B 4MNGA 1DLHB 4J3SA 4YAQB 2NXYD 3KS0H 5BVPH 2VZTA 3VFNA 4JN2B 1KXQE 3LPOA 1XCQB 3V4PA 2NDFA 5DJ2B 4Y19D 5AOKA 1OCCB 2P5EE 3PU7A 4NWUL 3QEUA 5ITFB 5IT2H 3O6FB 3CQQA 1AZCA 1FORL 5HGAB 1A0QH 3P3UA 3W0WB 4GT0A 2WKOA 4NKMA 1OANA 2NYZA 3HI1A 3WIHH 3MRLA 4PREB 4L0ZA 4ORGA 4H2AA 3VQLA 3CE1A 4IMKA 3TBVA 2EJ1A 2WYZA 4L8SB 5JO5A 3ME0B 4IBZA 4OFYA 4JFTA 1T0PB 3APMA 4M1CC 4JNXA 4N2AA 5C0GA 1CB4A 3UJIH 3FOLB 3F5WB 3IFOB 2XYBA 4RFEA 1W8NA 1WQVT 2DWDB 3F05A 5B22A 1FCCA 5AZ2L 2KT6A 3O8XD 5EDSA 4M1GL 4MD5B 3AGWA 3MLZL 2KPWA 3UAJD 2AJVL 5ADPL 2BSEA 5SWZE 4AGPA 3PWUB 3VVWA 1JGDA 3ENEA 3ZDYB 1DL7H 3NIFB 5F72S 3WTTA 4P5TA 4F7MA 1AZNA 4YBLC 2Y72A 4GAGH 1E0OB 2UY6A 5KEZA 1GC1L 3E80A 3DO4A 3RJQB 1KJMA 4PBWD 2VW6A 4PS4H 3FAWA 4S1QL 4Z23A 4E9RA 1N59B 1YC8A 2AXGA 2MQCA 4K23L 4MJ5A 1DQDH 3DVNB 1JK8A 3K71B 4MJHA 5BUAA 3D39D 1M7DA 1XFPA 4MSWB 5DWPA 4IKLA 1XL4A 1QSEB 2QVFB 1FFRA 3VFOA 5LVEA 1WBYB 5I66A 1FN4A 1HU8A 2UZYA 2OTWB 1C16A 1PW3A 5I2IA 5J6SA 2A77L 4GRMB 4IEFA 5SWQA 4AVHA 5IKCA 3EFOB 5E5MB 2WXHA 2OW6A 5HGDA 3SYAA 5JMOC 5AFAA 2XWJB 3FU8A 4WKZA 5DMYA 4X7TB 3B3BA 3RIFK 1DVQA 1NDMA 5CN1A 5I8OL 5KBDA 1RCYA 2L3BA 1SXCA 4FLRA 2A6JB 3MBEA 4GXFA 4PWFA 3ULVL 4E5XA 3BQUB 1LEIB 5TJWK 2L4OA 5EA0H 1R46A 5E9DE 4DVRL 3N9GH 3WS3A 1AO7A 1I7TB 4G6ML 1UWXH 2X70B 3RRQA 3QUXD 3TIEA 3IDXL 2X4PA 3HPLB 3H55A 1FJ1B 1JCKA 1IGCH 3OR7A 5T3ZE 5EIVA 3HZYA 2G2RA 4MVBD 2DF3A 1FIGH 5GS0C 3MRFB 5EWIH 3KPOB 1XVSA 5DS8B 5I73B 3LYRA 1N5YL 1KENL 1BVLB 2YD1A 4KJYB 5FCUL 3CDYA 4HIXL 4XXCA 4PCSA 5FYLD 3ZYZA 2IOOA 3RVXC 4GRWH 3UTTD 2Z0BA 5D5ME 3NPSB 4PU2A 4R6UA 3C60B 4XPHL 3ZE2E 1GSKA 1ZK5A 2YLKA 3PAVA 3ARFB 4IBWA 2LLGA 1J5OH 2WBJA 5HGHA 3QEQA 1G7JA 2OJ1A 3MFGB 3T4AB 4N86A 5LCVA 3DDGA 4NQDB 3D2UA 4KHTL 1QBAA 4M6OH 1QLEH 4BINA 3RTQB 3FT4B 4EI5C 4HHAB 4H1LA 2A9NH 2B16A 5F7DA 3VXSA 1KBKA 4MB1A 2I25N 1B0IA 1RIHH 1RZFH 3EYSL 3KW7A 3HI5L 1GZQB 4KJPD 4WW1B 3UTQA 4HPYL 2YKLL 3V4VH 4NJAH 5HYSB 2CE6A 4PMEA 2BNQE 2IBZY 3WUWA 3FO0H 3GBLA 5DU7A 4LZKA 1TENA 3HMXL 3MGTA 5FM4A 3NDYE 4ODUB 1IKNC 3VI4A 3VNZA 4GXUM 5CEZH 3PHQA 3MV9E 1TU2A 4I9WE 4RMRA 4ZTOH 5ICXA 3B2PA 5A6MA 3TLRA 1DE4B 4IDLA 3QXDA 4GW4B 4JFPB 4TSAH 5TTRA 3H9SD 3LEVH 2DH2A 4UV7L 5EU7C 5DCCA 1NGXB 3ULAB 4UM9D 4Y4KB 1D6VL 1FPTL 5EO9A 5DWUH 3NZHH 4BK5C 1LE9A 1HOCA 2EXTA 1F00I 3MR9A 4L8BA 3T6XA 3SDXA 3JV0A 4JFHE 1PCSA 1SZNA 2Z31C 3JTTB 1FVDB 1JF1A 3F7VB 4ZUWB 3S36L 1T7WA 1ZVNA 4GI6A 3WTUA 4YDZA 4AMWA 4XB7A 5JHLH 4C54A 1E6JL 2JJUA 4ZFZB 1BG1A 1PKQB 5DRNA 3FFCA 4JANA 2Y5QA 4X5WB 1KIRB 1U8NA 4Z7OF 2AEPH 4QYAA 3GK8H 1MJ7L 4L3CB 4OLUL 1OAKH 4QRPA 4MJIA 1MJUH 2KS0A 3S2AA 3VXME 1A1MB 2ZCHH 6FABL 3TYGL 3L17A 1F56A 2UUDH 3L3KB 5CHNB 2EZ0C 3FUMA 5DD6A 4A68A 3E38A 4D9LH 1JRHI 1MLBA 5FK9A 5BZXA 3GHBL 3FCGA 1RZQA 3WV0A 3RWFA 5ADOL 1JZ5A 2Z8WC 2XN9D 3F04A 1JMZA 2OSYA 4KI1A 5EU5B 4JUSA 4KFMA 3QJXA 4P23C 2DKUA 2FVNA 3NEXA 4KKQA 1CXLA 1I3GH 2VTFA 4TUKH 1MCEA 1EDHA 3BIKA 3ZYJA 4KX9A 4HPHA 2FZ3B 4Y5XA 3MLWL 4YE0A 1EPFA 4X5QA 2CJUL 2Y5TA 5GSRA 4UNUA 2N7SA 2GIYA 5FYJE 3BP4B 1TMQA 2BSRA 1HQRA 4OCLC 3DYOA 4XMZA 4FMVA 5CEYB 3FONA 1CLOL 4KV5F 4OFPA 4O51B 3T65A 4AIEA 5C0CA 2EIMB 2XG5B 2DQEL 1CXIA 3FU0A 1WWBX 2FJGA 4HJ0D 1WSST 2Y2WA 1KN4L 2G5RA 4OZGB 3GSNL 3JZ7A 2CGYA 4XOBA 2LLNA 3EG9A 1MWAB 2QADC 5MEQA 4A04A 2IANB 2G9HA 3QHZH 4TUOA 3ULVF 4XPFH 4TPRL 4NHCH 3Q1EA 3QQDB 5E99L 1CDCA 3OJDB 4N8VG 4WAFA 2Y3AA 4GAAA 1YMME 3SDAD 5IB2B 2V9RA 1SOKA 5K39A 4OIFA 2H7WA 3KWWA 5HY9A 1URLA 4PJGE 2WWMC 3GEFA 2CALA 3CFKB 4UBDD 5DLML 3ZBMA 3RL1A 2EDWA 3LH9A 2R39A 3BVNB 5E8DL 1S7TB 2F0CA 2QTVA 1EJ8A 1RPKA 4EIZC 4ACPA 1F18A 1SDDA 5FOBA 3ZHFA 5AUMA 1YEHH 4YDMA 5G4MA 3V5DA 4C4UA 4GS7B 4M93C 4BFGA 2UVEA 3HZ3A 1UJ3C 4Z7WF 1WBXA 3JV5A 2FUQA 1KXVA 3M1CA 5IMOB 3UZVB 4LMQI 3O2VH 1T4KB 1ODUA 1UTDA 3E3QC 1L9PA 2EIJB 4MHHI 3TNMB 5I0YA 1M42A 4LFHD 1E4XH 2YK1L 1A2YA 2PWEA 1EDQA 2WVTA 3NVQA 1JGVL 1SN2A 2NQDA 1TZGH 4KJQD 5D2NC 5I16B 1XGZA 3FT2A 2NCMA 4I1NB 1A7NL 3PNRB 4M6NH 3PGFH 4LCUB 2AANA 4XNMA 3RKDD 2XY1A 5F9JA 5DK2B 4ZMWA 1OSEA 3QXWA 3EYFA 3RWDB 5GS1B 2C3GA 4Y16C 1H8LA 2XWTA 3BZ5A 1QUPA 1ZLSL 2OMXA 3DX7A 5AW9B 3AABA 2A1WL 3BH8B 1VF5C 1MRFL 3LRSA 1TZ8A 4YQXH 1MI5E 2QR0A 1OD7A 1BMZA 2ZXBA 3L9YA 3OL2A 4GSRA 2H6PB 1ZHNB 3L3DB 5IR1B 2R8SL 1PFCA 5EOCJ 2MHAA 3UYPA 3QGVA 2D31B 1TQBB 5I1IH 1SQ2N 4RFOL 1H0DA 4HS8H 3WFEH 2J8HA 4KITB 3H9YA 3K72A 3SJVA 3I50L 4K9JA 2XRAH 1YA5A 2BJML 3VD5A 4AM0Q 2H2PC 4NNXA 4W9KC 2WGXA 1E42A 1WZKA 2CGRH 4N0YL 5CUSH 1KB9K 4GQPH 1S78D 3CMOL 2YUWA 3VD2A 3D0LB 5CJ8A 1RK0A 2HMID 4RDBA 1NL0L 3IJEB 3VFRB 3BUQA 4LSSH 3S4SA 1WHOA 1PEZA 3UTZA 5IWLC 1UOWA 5ID1B 2DWYA 1YEEL 4U0QB 2IEPA 5B1AB 2IOIA 4K5LA 4Z7OB 5E6ID 1RZ7H 2XNAB 3I02A 5AD0B 5HVHB 1FF5A 4YLQT 4KDTA 4YPGA 1MCBA 4MA1B 4F93B 1KWKA 3ARPA 3BSZH 4HOMA 1G87A 3OAYH 1F3DH 2GJ6D 1I1YB 4NAJA 1L7IH 1U3HD 1KIUB 2ZUXA 5EEZA 4WK4B 2ESVB 1Q0YH 2J1KA 4OJCA 3WYRA 2XVGA 3QQ3B 5FYKD 2N4IA 3MLRL 2J8UE 4I0PA 2H9GA 3FYEB 4WNSA 1AGDA 1T03H 2KQMA 5K59E 3NK3A 4PB9L 4RFNC 4M8RA 2ZOKA 3OKDB 4MZRA 5TK2A 1GZPA 1S2EA 2C9VA 1OCWH 4EI6A 1AHKA 2CO4A 3TWCL 5I8CB 3UO1L 2NW2A 1F1GA 3DUSA 4A55A 4WI0A 2H3KA 4OCMC 4QOKD 1A3RH 1GTFA 2BY1A 3MODL 2CK0H 1DBJL 3KS0J 3IFPA 3RUGA 3T2NL 3WIHA 3SDDD 3KCPB 4I3RL 1RZJC 2YUXA 2WOYA 3QUZA 1M1SA 3P77A 5LAXB 3B5GA 4XO8A 3V52L 5IREA 4S1RL 2XACC 1AHMA 1WTGT 3HG4A 1JF6A 5DMKA 2VMCA 4LB8A 2V2XA 4DH2A 1HXMB 5CLZA 4ZXBD 2X87A 3V0EA 3MLUH 1ZS8B 2Y1YA 1C1EL 3ZHNA 4ETQB 2Z4TA 3KD4A 4MLSA 3BEVB 3N85H 2AQTA 4K2UH 2ZSWB 3GTTA 1CD1A 1PZBA 4JJ5A 2XV2A 1J8RA 2EE0A 3TT1H 1DBAL 1NCDH 2BZCA 1RERA 5L7XL 3K5RA 4P2OD 1VDGA 3A0OA 43C9A 4Y4HA 3OKOB 3CVHH 2RB8A 4IIQB 2A6DB 2YPLE 2MCAA 4D0DB 4HUXA 4P4KA 4G8FB 4JRXB 3D52A 3ZW3A 4KKAC 1P4BH 4E42A 3MFFB 4GW1A 4PJ7A 4CNIA 3QWNA 3B2VH 4QKTA 4AL8H 4HHGA 1F8TH 3MRPA 1ET8A 2FJUB 3NRFA 4L4VD 1OHQA 4M48L 3R0MA 4FQ2L 2JXMA 2PP9A 5DJCA 4OGYH 4GJTB 5D9SB 3WEXB 5KZCB 1XXFC 3FSZA 4JFED 1IFHL 5LQBL 2WPGA 2ZWSA 3LPFA 3MPCA 3QH3B 2XKNA 2P5PA 4HIJB 5INDB 3TA3A 4O00A 3KLDA 3OSKA 3S37H 3BVXA 1QW9A 1FAKT 2OX5A 4HJ1A 1IZJA 1RI8A 4Y2DC 4YZFF 3EYVB 5DC0A 5DQDH 3BDYL 4F5CE 1KCLA 2DOCA 2KMWA 4G6AC 2EVIA 4TKWA 3OB8A 2IXQB 4LCCB 4WIQA 3IDJA 1JZ7A 3N0PB 4X7SL 3RVTC 4N87A 4TQEH 5IJBC 1N70A 1JGLL 4PUBL 5EU6D 1F4WH 4X6DF 5I74B 3KLLA 4OUUA 3TNNB 3NK4A 3ZL1A 4LARH 2HPTA 4N6QA 3TEZA 4JFQA 1X6LA 3ZTNH 4Q9QL 5KS9A 3MLTA 1UKSA 4WV1A 4AT6B 2I69A 1T83C 5J6GA 3QNYB 1W8EA 5CIPA 2Y25A 1A6TB 1MOEA 2HX9A 1MAJA 3RWJA 1EEZA 2PO6B 1VA9A 3QQNA 1IC7L 4GY4A 2AEOA 4LVEA 4ESKA 1Z5LA 2Z91B 1TYEB 1QRND 2EYSB 1HSBA 1P7QA 4DW2H 4IK6A 3OQRA 3QWQB 3WD5L 3QHFH 1PIGA 5L4FA 1DANU 1OGAA 3OAWA 3O3EA 1TSRA 4OV5A 4PS3A 1K9TA 2APWA 2FLMA 2FX7H 4LVHC 4PJ9C 1TJHH 1IBBA 3OPUA 3L1GA 3I2CH 2GJJA 2JIXD 4QR7A 3BWUF 1SFDA 2BOBB 1RUQL 1NQBA 2KKQA 3UTSE 2OR7A 4PJXF 3GJFH 2KERA 2JELH 4XN2A 1IKOP 5EU4B 3GUFA 4LLQB 4KZEL 2CU9A 3VXQA 1RUMH 3BH4A 5AW2B 2FX8L 3HNSL 1J1PL 4RMTA 2PP8A 4G8GB 1M2VA 5EEXA 1MH5A 4Z7NF 3FUKA 1FH5H 4W9LC 1S5IH 1ZD6A 3RFRA 3F83A 2APSA 1Z7JA 2BHFA 3HG1E 1BQLL 4ZT1A 3V0HA 2WLJA 1Q8MA 3ULUH 3T0WA 4MNGE 5LXGH 1AQHA 3KE0A 4JLRA 4RMSA 1GW0A 1D5MA 5C0AE 4TTGA 1FI8C 2Q76B 3QDHA 4TSBH 3MNMA 2OYLA 1EHLH 4ODTH 1PEWA 2OZ4H 3ARBB 1KXTA 5F9DC 3RWHB 1GXEA 4G59C 4ENEC 4FNTA 1A6AA 5BZWA 1ZLVH 1LO0H 2GC4C 3EH2A 4MNQB 4ZW5A 3QCVH 5FW8A 2CMRH 4RGMB 1U2YA 1R3JA 1ZHLA 2X3AA 3QSKB 2H4EA 1FNGA 3CHOA 3TL5A 3J8F7 3I9PA 4POZC 5DJ8A 5EF0A 1A3QA 1UZGA 2WWKO 1G5AA 1O6SA 4AEFA 3OAUH 5ERWA 1GGBL 1ORSB 3SYCA 4F7PB 4V1DB 4DUWA 4L1SA 3BVWA 3RWEA 3UACA 1UYWH 1G7MA 3QZWA 4GAFB 1IEBA 5EU3A 4JCWA 4LDOB 5C09A 1YAZA 3MXVH 3T2QA 2VZSA 2DLGA 2HJLA 4ANUA 1S4IA 5E2TL 4L5FE 5JHLA 4IBUA 2BZ7A 4XN4A 5E4OA 4YN3A 5CD5C 1PZUB 3HZMB 5HHOE 4J39A 4IOSA 1XZ0B 2BINA 2X0UA 3GSOA 3B83A 2ETWA 3HLKA 4JFOA 4A7VA 4HBCH 3X13B 4GEIA 2AERT 2WINB 3I9GH 2AXFB 1CGUA 4GOSA 1SJVA 4NWTL 3MRRA 4OCXH 2G5BB 3X1BA 1COBA 2DQHH 3MC0A 5EH1A 4S0SD 1V54B 4K73A 4NRZB 2P43B 5EUKA 4X83A 3VWJA 5DJYA 2UZXA 4PJEF 2EC9T 3OKEB 1CD0A 2N56A 4UAHA 4K3EH 4AMKH 2YMXH 1ASOA 3WY2A 4E2OA 3PQYD 3SGDI 1G1CA 4V2CB 3RA7L 3ETBF 4FOMA 1DSWA 3MOBL 4KROC 1HCVA 4ZUUA 3IRPX 1TTCA 4LSVL 3IU3B 4HF5H 4IMLB 4UT6L 5EN3A 1GVIA 4OZFG 4AKOA 1ORQB 4EQ2A 5CJXC 1KTLA 1R24A 1PVHA 3SE3A 3V79C 1QEXA 5ESQA 4AH2B 4WI8A 1MAML 5J6HB 2F15A 4NN6B 4DQOL 4CMHB 4P57B 2XKUA 4PJ8D 4FFYL 2NY0D 1ZEAH 4FCAA 4AQEA 4C56A 2NUPB 3IJHB 5IQOA 5IB3B 4DGVL 4MCYA 3O0RL 1FNEB 5IG7B 1CDHA 2Z8RA 2J6WA 4WFHE 4Y5YC 4DZBA 1B3IA 2E7CA 1AO7E 4OM1H 4AW7A 1KC5H 3KL5A 1EAPB 3M7OA 1JNNH 5D1ZB 1MHPL 3U0WL 4D8OA 3C5ZB 1JUFA 1KBBA 1HEHC 5J11C 3M6DA 1LO5A 1AG0A 5JXEA 3T0EB 5J57B 1KT2B 4YLBA 4MAYC 3ZX1A 4N0UB 1PY0A 5JHDA 1ZGLB 3G6DL 2P5ED 4UDUA 4RGOL 2GY7B 4PV8B 4ZPTA 1D5XA 2C9UA 2Q7NA 1AXTH 1RMFL 3FU7A 2AJUH 3K8MA 4MA3B 2XPGA 1GS7A 1QYGL 4BDVB 4Q6IC 2WKLA 1MF2L 4QT5B 1PYWB 3WFBH 2YEQA 2MPVA 4B97A 2JKRM 2XA8L 1NC2A 4AGNA 3IWVA 4PGDA 1NINA 3RDTD 3LZQA 5F96L 1ZE3C 3ZKSD 3K6SA 3QNZA 1TUPA 1XF3B 3L3GB 5FW6A 4G9DA 4H8PA 2VR8A 5LBGA 4M7JL 1V7MH 1JAEA 1WBZB 3MU3A 4HWEL 4QTHB 4PB0H 4B9KC 5L2JB 4NKOB 3SBWA 3CDCA 1UCTA 1RIUH 1G7QB 4XVSL 5D4JA 2DYRB 2W9DH 1BBJB 1MIML 1P5UB 2NY7H 3RHWF 4WY7H 1GMIA 5ICYB 2WHVA 1RJLB 5DHXB 3TZVA 5DEGB 5SWZD 4Q74A 5ANMA 1DBML 4Z7NB 1Q9WA 4N8PA 5IW1B 1GC1C 1SYVA 1DSYA 1EEQA 2JKSA 5GS3A 2IQAB 4L8CA 1QLFB 3WN5C 3DRQB 4OBRA 5IIEB 4M00A 3FF7A 3FUJA 3LD8C 3LN4B 3KPPA 1YYML 4FFZH 1SUHA 3PJSB 1XGRA 4ZYKA 5DD1H 5HDQL 4NHUA 3P3YA 3DSFL 5HI5D 2IAMD 1N5AB 2YWZA 4L4TA 2Q8AL 3SQBB 4U3HA 1Y6MR 1H5BA 1Q9OA 1MJ8L 3ZDXE 1J0YA 1DBKH 1FNSH 4I9XA 5D70L 5D1XC 1ZWIB 5AOIA 1NFKA 1KLFA 4B5ZA 2MCG1 1NAMB 5DD0L 3Q9QA 4HW6A 2P24B 4B9GA 4Z7QF 3FFCE 2BIQA 2DDQL 4MXWH 1T5WB 3ULVC 1IEAA 3KPRD 5LBSH 1L0YA 1I9RH 2AAVA 3Q9PA 4L29B 2IGFL 4QRPE 5CCHE 3JYCA 4ZUSA 2ICWA 4FI8A 5TF1L 4RX4D 3L7EA 3N6YA 4PRHA 4MMYA 5E9DD 1R3HA 3HCVB 5AW4B 3FPXA 5L2KA 1FAIH 2V5SA 2ZCLL 3OXSA 3K6DA 5T5FH 1A6VH 3RILA 1KPUB 4AZ8B 3LY6A 5T3ZD 4UQEA 3PV6B 3G5YB 2B3IA 4LLWA 3CVIL 4IOIA 4N0CC 3IF1A 1DQLH 4AQ1A 3QNXA 1UWGH 3CU1A 3Q05A 4Q9RL 1WGOA 4KY1H 1E8YA 4FTVE 2ICWJ 5D4QA 2VKWA 3R8QA 1FYTA 4BH8A 1ZLUK 2YC1B 4QD2E 1N8OE 1UM5L 2V6HA 3QCTL 1HEJC 2AHIA 4G43B 3MHZA 4AJ0A 3KNBB 4J3BA 2ALAA 1QPPA 4XVJL 5E4AA 3V2AR 2P8MB 2W9LA 3P54A 4NQXA 5DZLA 3AREB 4MQ7A 3ARUA 1P7KB 2F54B 3ATDA 3N44F 5CSZB 3HR5A 4J3WA 4WDIB 3ES6B 2XVLA 3EYQC 12E8L 3VQ2C 3KHOA 3U48A 3FBKA 1T1XB 5C0CE 3FCSA 3TONA 3VB8A 1B4RA 3CJJA 2VUKA 2ZE0A 4N2EA 1NCBL 4GI9A 3W9EB 4UZGA 1F3DJ 4HV8B 3NMEA 1K4DA 1CDJA 2PNDA 3TT3H 3N91A 3BP5A 5B1JA 5IBLC 4WCYL 2JVUA 3QFJE 4WU5B 3VW3L 1XCWA 2OCFD 4JY6B 4JRWA 1B4TA 3MNWB 3BOVA 4PFEA 2EKJA 1OPGL 1QD0A 3F12A 2K45A 4Y4FD 2BNQD 5IMKB 1B4LA 4LHJB 1QA9B 4NZUH 4WWKA 1JXJA 5LGHH 4OCSL 3BX7C 1YAIA 4IBTA 1S7QB 1KTBA 3RU8H 3LB6C 3MV9D 1CXEA 4FI6A 5DQJA 4WJG3 2XJKA 3AB0C 3REWB 1ZT7A 3HFMH 5DJAA 1A4KB 4ODHH 4DSYA 1S7RA 3D5OF 3M46A 4KQ4H 4LSQL 2Y22A 1HINL 4P99A 4KXAA 5DT1L 5FO8B 2L04A 3CVHA 4PBDA 3OR6A 1N6VA 2OKMA 3WFHB 5FECA 3SD5A 5KBLA 1X5AA 4WNQB 1KELH 2JJSA 2VN6A 1J8HE 4NBYB 5LNGA 4HZAA 4WO4A 3LS4H 3OXRA 5DK0A 3UTPE 1OM3H 3NIGF 4G42A 4R97C 4B9CA 4LMQE 2HUHA 1MHCB 4JGJA 2JB6B 3VG9C 3I75B 4QXUL 1QQDB 4JO2L 3VMNA 1NIAA 5FGCE 4FNRA 3A4EA 1IV8A 4KNUA 3RKDC 3HNVL 4E41A 1OHZA 1KCSH 3UPRA 4BH7A 1FGNL 2ZSVB 5GGTH 4JFZH 3ZGIA 3LDBC 1VGEL 1KIPB 2XV6B 3IFNL 1I85C 5C8JB 3G5WA 3DURA 4JM2F 2VZ3A 5IVXA 2ZOWA 5D1QB 2X4NB 5DR5L 4HCRL 3WELA 5F2FA 5BXFB 2OP4L 1K85A 4HJGA 2N3JA 2FO4B 2I60L 4DAGH 1UA6H 4WENB 1NOAA 5I1KH 4N6RB 3QI9C 3DKHA 2ZOTA 1NGWA 4JHUA 4KI5E 4D3CL 4YHNB 5IESH 3TS8A 3B43A 4HD5A 3WXVH 2E6PA 5FM8A 1J88A 4K7PY 4PP1D 1FLTX 3B2XA 1OV8A 3T8MA 3WE1A 4G7QB 5HI4D 2FNBA 3C6LA 1N4XL 4QXWA 5BNXD 4H8WH 2XX1A 2GEEA 4NQTA 1KTKE 1DFBH 4HPOH 4FFVD 4UQBA 3SJVE 2Y36H 3GLEA 5FYJD 1FFPB 4FQJL 4OZHF 4E9VA 2O93L 2DQCL 4H0GA 5JPNB 4B60A 1TZOA 5E6IC 3GXNA 1QI5A 3L5XL 3V7AE 4FRWA 2V5YA 1AIFB 5T3XE 4UQ9A 1UG9A 1BVNT 1QSFE 2VDOL 3QORC 4MYWB 2FEDD 3IMSA 4M6MH 1BD2E 3TO4D 4EF3A 2PYEE 3OQ3B 2AKRA 2QGBA 3N55A 4TVPE 3BXNA 1OE2A 3ECBA 1AGCB 3D7PA 3GJFA 2CPUA 3B2MA 1CD9B 4FP8L 5SWSB 3DMMB 1XX9C 3HKFA 4KMTL 5I5RA 5FUZL 3CFNA 2I9LB 3P69A 2YRPA 5KW9L 4G3YL 1TPXC 3MJWA 1BBDL 2HT3D 4Z7VF 5FB8B 3ROLB 3IDIB 3DJZA 1JGIA 3DO3A 3O41A 4IJTA 3HAEB 1XB6A 4AK2A 1YMMD 4FZEH 4CVZA 1KCWA 4WUUE 3AS3A 7PAZA 1BREA 4YSCA 4NN5B 1ZIAA 4FCHA 5F9AC 4C55A 2I7OA 5IK3B 4EIBA 2WYTA 4RZCA 3U7WL 2YA1A 4PJCF 3V0VB 4MAUH 3V0AC 2QVTA 2P3YA 5DK3A 2H6OA 4LCWA 5KVEH 2FO8A 3RZCB 3IMWA 4WFFE 3LKQB 5CR1A 1FGVL 1LWHA 3BO8B 5DD5H 3GMRA 4ZD3L 1VFBA 1LJMA 2OMTB 4M4RB 4MHHG 2XVBA 3BT2L 2DLEA 1QSVA 4YE4H 1IAOB 5EHFA 1LYQA 3N44B 4UQ3B 3VXRA 3UBGA 1IAII 5GJSH 4K8RL 1SY6H 3TEWA 3G6JE 3RUGE 2ADGB 1E5CA 4LRNL 1XGTB 4KQ3H 3C6SB 4PRNB 2YPKA 1OSPH 4XAWL 2MQ3A 1MPAH 3AXLB 1SVZA 2I7SA 2P8LB 2ATAA 1Q0EA 1D2OA 3WJJC 4ODWB 3H2WA 5E08H 5IFJB 1IGYA 2E7BA 3RWIB 2R0KL 3S5LB 3SDCA 4A7GF 3CFQA 2VM4A 4GIOA 4PY8J 4DOHE 2DQJH 2VQTA 2IG2L 2X38A 3IKCA 4Q89A 4AENA 4IRJD 1HKLH 3VTTA 1O7SA 2MNUA 5HVGB 4JHAH 1G7IB 2BMKA 4TYUA 4EBQH 5J1AB 2DQDH 1IEHA 1MI5D 5L8LB 3BKML 3MV01 3BWUC 4GO8A 1R5VB 3V0DA 3G08B 4IRSC 3VFTB 3Q8EA 3SYPA 4LOUD 5EF3A 3IBEA 2VXSH 2ATPB 2RACA 3BDXA 3T4YA 2E3VA 1TCMA 3DARA 4LKXA 3STZA 3GMMB 1GPOL 1KG0B 3MRHA 3BKJL 2HX8A 4N0FB 1VPOL 4L1TA 3SN6N 1NIBA 3O9WC 3FDWA 2O6EA 4AVIA 2ZOLB 4WW2F 4CUCA 5KVGE 3OLIA 2R4RH 3S35X 4OLWH 1KGIA 1AQDA 1UVQA 5HDOA 4ISVB 2D0FA 2YPVH 1M9SA 3H53A 4KTDH 3EO9L 3TASA 1THCA 4N9OB 4PJAB 5A2CA 3DGGA 5KSVB 1JYWA 1TJIH 4QHUA 4KH9A 1Q1JH 2VAAB 4MNHA 1G9MH 4S1DC 4U7KA 4X5RA 4ZAKA 1GJWA 2NY3C 3A23A 5HJBA 1YY8B 4P46C 4B50A 4NN7C 3U7YL 3WSQL 3RIAK 3QFGA 2WLZA 4WI3A 3S88H 1U91A 3V55A 3D4GA 4YHLL 3ZOAA 4EUPB 4L0PB 3FTWA 2CIIA 4YPJA 3VO0A 2CLVB 3DOIA 3WIIH 1IVTA 5EEVA 2C4FT 2LVEA 4J28A 4NZRH 2XY2A 2PR4H 4JZNA 3VI3A 3AT0A 1A9EB 5HD8D 3TX4A 4QGTA 3FULA 4LSDA 3A4DA 1R3IL 2BZDA 25C8L 2XTJE 4GXVH 1NUFA 3HC4H 5F89A 2X7LB 4QRRA 3CH1A 3A22A 3T3ME 1NMCC 2HT2D 1OGAE 4MBRA 5F88B 1KV3A 1RURL 2A9AA 3SE4C 3ZXAC 1JK9A 1CPUA 2NMSA 3CZEA 1MFCH 3CFJB 3ESMA 1H6FA 4HZLB 5J8OA 2F61A 2BWIA 4JCLA 3BLBA 3GM0A 3SE8L 1KULA 2V7NB 4GRWE 2F7IA 4OB5H 5J9PA 2I24N 2V8MA 3O3DB 4AQAA 4P3DA 5K93A 4TULH 2PPCA 1KYOJ 2HJFA 3DGCR 1BEYH 4NQEA 4FXGA 3MJ8A 2VSCA 4YDJA 3E8UL 5C08A 1G43A 3KLAA 5I1CH 3NEEA 1U93B 4PP2B 2X6BA 3GBML 2ZZUT 5C0ND 3HPJB 5KN5B 2WZPD 2IDSA 2Z92B 3HE6B 5IQ9B 4JZJB 3EJZD 1E28B 5JIQA 4RSVA 3L7FB 3V4PL 3LIZH 1F0LA 2APFA 1MSPA 4QHKJ 4ZUVA 1AH1A 5EOQH 4MDJB 2YPLD 1HHKA 1DQJA 3DLQR 2WXMA 1GYWA 2FH8A 4LKCA 2GBTA 4Z7VB 1ETZB 3WBDA 5KSAD 1WICA 3C75A 3PHOB 5DFTA 1XEUA 1FHGA 3EO1B 5HTSA 2CPCA 3Q1SH 4MX7A 5DFVC 2ICCA 2AJXL 1PX4A 3L54A 4Y16B 2NLJB 1D5IH 1I3UA 4FFZA 4FHKA 4OY9A 3G6AA 4BXSV 4PJCB 4DF9A 2ZTBA 4DETA 2G4EA 4MXVF 1QZ1A 3T3PB 4DEUA 5IHZA 3DX6B 4O4YL 4PY7B 2CDEB 2VJ8A 1TTBA 4LU5H 3KXFE 3S3JA 2O30A 3V7MA 4LAQL 2NT0A 3IETA 3MGAA 3PCYA 1V3JA 4XNXH 4HK3N 2B1AL 3PWPE 5KVFE 5C09E 3ZHDA 4HEMA 1PD1A 1JWSB 1TZIA 1BAWA 4JRFA 2VW7A 2YIHA 4N24A 1MCIA 4XCFL 4B3VA 1L4IA 3B8SA 4G6FD 5J89A 2YD2A 3ML9A 3JV4B 3LMJH 2YBGA 3GMPA 1AC0A 4O2EB 1NDGB 4KKBC 3NA9L 5A16B 5BZDA 3CFDA 1MFAL 1NCWL 2IO5A 3OZ9H 4JFUA 4LBAA 1E5YA 1XGPB 5D93B 5T5FA 2LU4A 3EXJA 2R83A 5E0QA 1HCZA 4FZ8L 3FUDA 3US1A 5I1EL 4ZUTB 1AGEA 3HE7B 2FD6L 5D7LA 2J6EH 3FZUC 4X9IA 2FX9H 3MNZA 4RESB 2VXTL 1KDIA 1D7FA 1S7XB 2EIEA 2X9YA 3ZKXB 4H8VA 2NY1D 4MRCA 2VO5A 1E5BA 1W6WA 1IGIL 4X4XA 5D6DA 4Y2OA 5HHXH 4IBSA 3GDBA 3QIBD 4EVNB 4BJLA 4ALAH 2V9TA 1V3MA 3SBRA 4EI5A 3UTSD 5C1MB 1JNLL 1XF4B 1DCLA 1CCZA 3EFDL 3O6MH 3PNWA 1J0IA 3LRMA 4XVTH 5GXBB 4IGBC 2V5RA 2AK4A 3GTNA 3B2DC 2DMBA 4MCZA 4K3DL 4BZ2L 1A6WH 3MBXL 1BXXA 4NM8L 5FKAA 3VA6A 3ZJAA 1NMBL 3WTWA 2ZUTA 2OXHA 3DVFA 4LNVA 4NC1E 3N06B 3UAFA 1U92B 3OZLA 2W8CA 2WMPB 2UWEB 4ZS7L 2EIKB 2AEQL 1OAYH 3HG1D 1I82A 3F00A 3QQ4B 1ZT4A 3BEWA 1TQCB 1TTAA 3ZVVA 2VMEA 5F1NB 1MWAH 5JR1L 3N04A 4J3OD 5B4MC 1S9VB 1ZV9A 3ARGB 5C0AD 4J6RL 3RIAF 2R29H 4XPTH 1ROWA 1IFRA 1HL5A 3RWCB 2C9XA 2QVIA 1JHTA 1JPSL 3CSYA 2O4EA 4BK5A 5E9AA 2FGWL 3H56A 1DHKA 4UQ2A 1PD6A 2Z31A 4MJ6A 5JZ7D 3U9UB 1QBLL 2EVFA 3CXHJ 3MLXH 1F6FB 3MLYH 1ID5I 4R2GD 4NZ8A 5AW3B 3TPUA 4DO5A 3WGVB 1TO4A 3FHEA 3ARDC 1XTMA 5CJQL 2FWSA 3MAWA 4R84A 2CDGB 3CBRA 3LXAA 2W9EH 3HNTL 2VL5A 4B27A 3VG0L 4JVUA 1IM3A 4JRYE 4EDWH 4DJMA 5HHNA 1NAKL 5BZZA 3VGGA 1W2KT 4IS6A 4HWBH 5TQ2H 3OGOE 2GQHA 4GQQA 3FB6B 4YC2B 4FLOA 3TN0B 1Z3RA 1NIFA 4PJHA 1JTTA 3UBXG 3X3FH 2DQFB 2JJTC 2DPKA 4AWJC 1M71B 4ONGH 1JL8A 4PHXA 5DURD 1ULVA 5HHOD 2BSED 2RCSH 3MDJA 2XDHA 3GRGA 4HIHA 2A4EA 3NIDF 2EDBA 5GGTA 3CNKA 1NC4D 3NCJH 3QPKA 2VDOB 2FBJH 3KGSA 4BD4A 1TVHA 2Z65C 1HHGA 4P23A 5K9OA 1FSKB 2DMHA 2BS9A 4M3KB 4QJ3B 1U8OA 5DMGC 5H94A 5T1KA 3JWDL 4DUVA 1SBSH 3KJ4C 4G9FB 1AR2A 1YYLH 3POCA 2YXMA 5LGJA 1BHGA 1OTSD 4PW4A 3OKLB 4Y7OC 3RNKA 1Z1WA 2QMJA 3IJ7A 4L4TE 4QY8B 1WT5A 4GAYA 4YFEA 4BKLB 4WVRA 4U1GB 1ZTXL 4OGAC 4V2BA 2VN4A 3KL3A 3VM7A 4JPVH 3H1ZA 4X80H 1BMWA 1NLBL 4HGWA 1PZCA 5FO9A 5TH2B 2GT9B 4ZTEA 1FO0L 4XGZA 2IDUA 2Q86A 2Y07H 4ELMF 3W39B 2I9TA 1JNJA 2E9IA 2FHFA 3WKYA 1PX8A 2UZIH 3BH9A 5DTFB 5FV1L 1YEKL 1RUPH 5E94B 1FZJA 3VXUE 3MBED 4P2RB 3G5ZA 4HH9A 2Q6WA 3E6FB 4WFHD 1INQB 1AGFB 1AO7D 4M7LH 2OK0H 5D7JA 5L2KE 2FYVA 3NRQA 4ICWA 1YDPB 3MCKB 1C12B 5I17A 3H42L 1I3RB 4FQPA 4XB3A 3BQVA 5I19L 3TM6A 4LRIA 2BP8B 3HRZA 3HC3H 1RUKL 1WA0X 3QULA 4JW3A 5E4EB 2W0LA 5CEXA 1OF2A 4R96A 1JYVA 3IU4L 5IW6A 2NXYB 2F7RA 2VLLB 1JWUB 4H20L 3VQMA 3Q5TA 3QUYC 2OR9L 1MDAA 5MERB 2HWZL 2DQGH 2VR7A 4JQXC 1BQHA 2PXYA 4N2FA 3D69A 4Y19B 1UJ3A 3C5XA 5TE7L 3LRHA 3C12A 1BX2B 5TGBB 1PG7L 3L16A 1SHWA 1PDKB 1DLHA 2X88A 1X7TA 3U0PB 2JQZA 4P4RB 1YEWA 4YAQA 1C5CL 3ZQWA 4WJKB 4JN2A 4W70A 1G6RB 2CHWA 1LQSR 4FQXC 4IOFC 4S1SL 3EBIA 5TFSL 2ZWKA 4DN3L 1D5ZB 4JM2C 5D2NA 4UV4L 4GG6B 4YHPA 3D2UD 1UD6A 2FRGP 1LP9F 5HGAA 5CBAA 2WXJA 3L4YA 4RQQA 3W0WA 3ZL4L 1I8MB 1P4IL 2ZXGA 4PREA 4YSRA 4JDTL 4YSAA 4YX2L 4QRQB 3D3VE 2A9MH 1ND0B 5C0DB 3HS8A 2DRUA 2W60B 3ME0A 1C8QA 3O8XB 4KNQA 1H8NA 5AVTB 4NC0B 3CVDA 4Q4IA 1QNIA 2X4SA 5D2LF 4KJWC 4KMLB 3V10A 3FTZA 1E27B 3IFOA 1VAHA 3TCLA 4ZK8A 2P7TA 4TN9A 1IGFL 2FSEB 4OZIF 2DWDA 2NXZD 5DVOA 5DEFB 1I8IA 2WM0A 2QZ5A 1N12A 1TF4A 3P4LA 4MD5A 1L7TH 2X89A 4DVRH 3HLAB 4G6MH 1K2DA 1R5IB 1RK7A 2NQCA 5KBKA 1YHPA 4KKCD 4XAKE 3RTLA 1QI4A 2NOYA 3PWUA 3D39B 3IE4A 5F1IB 1KYFA 4IRZL 3U1PA 1RUAL 1UM4L 4DP6X 1JHLL 3EOTH 1JGUL 2IV9A 4L1DA 2OL3B 3PGCA 3EUUA 4NAQA 4YH6A 4WTQA 5DHYB 4JO5A 3FFCD 4R7XA 1XIWC 1NTDA 3K6OA 3KWVA 2WO4A 1I8AA 4R7LA 1QSEA 1BVKB 1EGJA 2VDLB 1ETB1 4AKQA 1WBYA 2EAEA 2NPLX 2C9AA 4ZFGH 5BOJA 4NGHL 1IQWL 2OTWA 2GSGB 1NCCH 5IVXE 2HTLD 4G6KL 2BY0A 4HUVB 1L6ZA 2GEQA 4L8DB 4UTAH 1C5BL 1ZVSB 2XYCA 2Z64C 3GMQB 3NH7H 3WG7B 5E5MA 2YPVA 3QUXB 1CU4L 2DMKA 3NCYP 4EN3D 3LZFL 2WKGA 2IWEA 3Q5OA 4QHLB 4X7TA 3V6ZB 1WA2X 2EEFA 3NOIA 3O3AB 4NQCA 4JDVB 2A6JA 4AV0A 1AY1H 1BG9A 4UIKH 2MWCA 5JOFB 4FTVD 4FFVC 4L9LB 3BQUA 1M4KA 1DVZA 4DGUA 4JB9L 2IDCA 3BLKA 1H15B 3MLSL 1I7TA 3LEXB 2X70A 1YJDL 1NIEA 3AROA 1KJVB 4DZ8B 5DI8A 3HZVB 3NRPA 2VERA 1S46A 2CG9X 3RVUD 3QDJE 2NYKA 3Q6FB 4XRCB 3UTTB 3DV6B 1ACYH 2X0WA 3QIUD 4LXFA 4Y5VC 3ZE0F 3FHAA 5C0IB 1WK0A 3SQOL 4FKHA 4JHVA 1HI6A 1TVBB 4M62H 2PTTA 2D03H 1BVLA 2ARJB 5C0CD 1PZ3A 2A9DA 2CUMA 3INUL 4N2IA 3ZDZF 4MMXC 4HT1H 1U2CA 2W88A 4PI0A 2NCEA 2ZPKL 3GXMA 5E56A 3C60A 1D6VH 1LD9B 5CWSA 4AYID 3ARFA 1Y18A 4ELMB 3S3SA 3QFJD 3EGXB 1MCJA 2YFNA 1AFVL 1MFBL 1BPLB 5LBVA 4BZ1L 3N1PC 2FDBP 1PZDA 2C1PB 4PGBB 2YBRA 4NZTH 4NQDA 5HYIA 2EE9A 2NSXA 4IBYA 2O5ZL 5TQ0H 3RTQA 3FT4A 4YHOL 5E2WL 1BDYA 4HHAA 2OYPA 2AW2A 4NXSA 5BVPL 1ZGLP 5GSVA 3TA4D 1I8LA 3BZ4B 3AWFA 5BRPA 4R4BB 3IMUA 3LIZA 2JK5A 3BUIA 3BWAB 5HYSA 4LIQE 2IDTA 3H9SB 4LCWE 2OMVA 4OD2B 4F7KA 5AZUA 2B20A 4UM9B 4O58H 2VRKA 5IT2L 3UOAB 1MW1A 4ODUA 1J8HD 1A0QL 1DVFC 1TVDA 4YBQC 1JTPA 3UTPD 5C0RH 4EJ1C 5D7HA 3WIHL 1F3RB 4PG9B 5M94B 3LNDA 4CVXB 3VXRE 4GW4A 4JFPA 4X6EA 1S9YB 3FSVA 3QWOA 3APFA 5KG9B 3F58H 3PAZA 1NGXA 3C8DA 3NQIA 4Y4KA 3DIDA 1MRCH 5B3JF 3DO7B 3UZEC 3UJIL 1WWWX 4IBLT 1CS6A 3ZT5A 1T1YB 2K3TA 2VIRA 3MUJA 2FJHB 2RALA 3TPKA 3F7VA 4ZUWA 1J86A 3Q2WA 1NGQL 1T83A 2WXFA 2JB5H 1OO2A 2PETA 3AUVA 5DJDB 3L3OB 5I24A 3A67H 5CBEB 2D4DA 5FM5O 5CCJA 1PKQA 1OWWA 3HR6A 3TJHD 1CLOH 4I18B 4X5WA 3OKYA 1KIRA 2C9SA 3ELAT 4L3CA 2F2HA 1DL7L 4A2FA 5D2LB 4HHWA 4KI5D 3H0TA 5I15H 5I8OH 4HKJB 1A1MA 4GAGL 2BNUB 5AAPA 2OI9B 2OZNA 1Q9LB 4ZMZA 4OZIB 2XN9B 5KSBE 5AB0A 5DJ0B 4PS4L 3OMNB 3QR2A 3HC2A 4ODSH 5D72H 4MYPA 3B9KC 3C09C 1J0JA 1DQDL 4HALA 5D7IB 8FABA 3WTSA 3BPOC 1EJFA 3UBFA 4WK0B 3SJVD 4NEHB 4W9FC 1KGJA 4FJYA 4QJ5B 3GXFA 1D7BA 5F97E 5IROC 3MA9H 3RGVD 4BM7A 5LO7A 4ES9A 2VQ1B 3ZSTA 3U2SB 1W8OA 4PQXA 3UROR 3KBPA 4P06A 4JMXA 4K7FA 1SMOA 4P5RA 3ZHLA 4TUUA 3EIFA 5T3XD 4ZTPH 4MKTA 1IB5A 1DFXA 1QSFD 2X4RB 1XF5B 5C0BE 1BD2D 4DUXA 1GGTA 2PYED 2FZ3A 3TTSA 4TVPD 2BC4A 4OD1L 4PJBB 4PJIF 3MX0B 4M3HA 2VLJA 4B9YA 1AVAA 3VJ6B 3BP4A 1KCRL 3QZPA 1HAUA 5DUBA 4YBHA 3GSWB 3N0AA 4YVNA 5EA0L 3N9GL 2VQUA 2WV3A 4G72B 1A4JA 2VRQA 3NJJA 3WE6B 2R2EB 2XG5A 5F71A 1IGCL 2Z9TA 2X2UA 3VI3E 2X4UA 3MUUA 3EYOA 5FA3A 4WUUD 3AM8C 3VYOA 1ZDQA 1F6AB 3QPQD 1Z66A 2AQ2A 4EAEA 4KUCF 4OZGA 1JI1A 1MJJB 3SDAB 5EWIL 3WAJA 1U8QB 2PLTA 3AUWB 3T6QC 1MWAA 4U1LB 2IANA 4I0PD 1CLYH 2BLFA 5C9KA 2ERJB 1D9KC 3O6LH 3WS6A 1CLZH 2PW1B 3BP7B 5IEKA 2R29A 3QQDA 3BVTA 3PIQB 1IX2A 1RKRA 4HEPA 4WFFD 3QR0A 3OJDA 2WC7A 4IKKA 4Y2LA 4DO4A 4M4PA 4RDQF 5IB2A 4K8RC 1DJWA 4N26A 1GY2A 2NNRA 4ELKA 1EA9C 1A64A 1J5OL 3RJDA 3U6XS 2WB7A 4DGIH 3BVNA 1S7TA 1OP5H 3CZLA 3QUZD 3GGWB 4NDMB 5C08E 2AITA 4M6OL 3PXLA 1QLEL 2E74C 1CT8B 2YQ3A 2AZUA 4NJ9H 4NCDA 3SOBH 2QT6A 5IMOA 3UIYA 3UZVA 1T4KA 5KSAC 1FFTB 4HWBA 2PWDA 1CQYA 5FFLA 1RIHL 1RZFL 1TJGH 2DS4A 2XT1B 3TNMA 4NUPA 3V4VL 4NJAL 3NZSA 1NL0H 2CCWA 4GW5B 1MHEB 4OR1A 4HJEA 1Y7VA 4Y9EA 5I16A 4G7SB 5EC2B 5CEZL 2F1AA 2XV0A 3O2WH 3VFSB 4I3SH 1U6AH 4JO4H 3V5KA 5ECGA 4D9RE 3W37A 2E59A 4JVPA 5GZOC 5DK2A 4LL1A 4TSAL 4G8IB 5AYUH 3R7RA 4YSTA 1LDPH 1PNCA 4Z7AA 3RWDA 1B4JH 2R1WB 4G5ZH 3HUJE 2JKTM 2ZD0A 3LPPA 3LV3B 1SHMA 1MW2A 3BH8A 5DWUL 2ZWNA 3NZHL 5E8EB 4IU2A 5ETUB 4F7TB 5EEYA 3L4TA 1DUYB 2R9HC 4H13C 1GYAA 4L3ED 4PJFB 2NYYD 4NRXB 1X5XA 5DXWA 1ZHBB 4QNPE 1YQVL 4X6CE 1GAFH 1ZHNA 3L3DA 1DQKA 4IKNA 3TA3D 5IR1A 1NAMH 1UEMA 3BUYB 3MLRH 3T04D 3UEZA 5JHLL 2QQLH 5DVKA 5EIQA 3QUGA 1G7PB 1O6TA 4UINL 5B3NA 5C9JB 1J05B 3GS4A 1AKJA 3VWKC 2AEPL 3VX1A 1M7IA 3GK8L 2WSPA 2NY6D 2H0PA 4XNUH 3AQZA 1OAKL 4MAYA 3J7HA 4LBEA 1MJUL 2BP5M 4QTIH 5E6IB 4HS6A 5LDUA 2ZCHL 4YDNA 5LN8A 4FHJA 5EF2A 4OIIH 3D0LA 1ZOXA 3CK0H 3IJEA 2BHYA 2MKLC 5HHVH 3VFRA 2E9WA 3VH8G 1EV2E 1K8DB 3L4WA 1PZAA 1I7RB 1C7TA 2GJ6B 4PWEA 2C1OB 5ID1A 4D9LL 3POHA 3V52H 1U3HB 2LLLA 4OQ1A 3MRDA 2XTJD 2X53A 5D7LE 4OZ4B 2XNAA 2GUOA 5AD0A 2IPUG 1Y1UA 3JT0A 1P7QD 4WGWB 3SYOA 2LHAA 4FLHA 2F18A 1NOLA 1OGAD 3GQFA 3SHSA 3ZIYA 3PUUA 4AW4A 5FO7B 1I3GL 5AB9A 4TUKL 4JGNA 3PV7A 5D8JL 1I1YA 1ZA3B 1BQUA 5I75C 2V2WB 4Z3TA 2A6KB 3C5SA 3QQ3A 2DN7A 4ZW7A 4QOKB 1IAIM 3ZMEA 3CGTA 4KGLA 4WEEA 5BW7C 3L8QA 4BQCA 3DX0A 2QDVA 4NM4H 1BAFH 3I6GA 1PZ2A 3SDDB 2WXOA 1JN6B 3C8HA 3OKDA 1M7XA 1DEEB 1RD6A 1UZ8B 5EBWB 4W9GC 1ZSHA 3F7PC 1T7ZA 2NTFA 3AQDA 3FFOA 5DHVB 5I8CA 1KGWA 1TKWB 3EH5B 2NY5H 2XBTA 4FQ2H 4G1EB 4QHPA 4ZXBB 3DUHA 1Z3GH 1IFHH 4JCMA 4O02B 4Y7MA 3QHZL 4XPFL 5EU7E 3KCPA 3PWLB 4NHCL 4E9WA 3QZOA 4P2OB 4ANVA 4R2GC 4JDEB 1SHSA 2OS7A 1BZ8A 4TL4A 4IMKC 1HXMA 3BDYH 2P9RA 5EUOE 5D1XA 4HKBA 1ZS8A 2ARWA 4ETQA 2JCCB 3BEVA 4PUBH 3HVDA 1T4WA 1KFAL 2CXKA 2GJZB 1BSIA 1I9EA 4Q8BA 4QF1A 4ZO9A 2WYIA 4D8PB 4IIQA 2A6DA 4QRBA 4D0DA 5JNYB 4L4VB 4GQ9H 4KO6A 4YK4C 4N3UA 4OFKA 1YY9D 4JRXA 5DD3H 5F9WB 4JFEB 3GF8A 3KXFD 4A1RA 5BJTB 3F65A 2ENPA 3SQRA 1CMOA 1EZVX 3MFFA 2BXZA 1UD2A 3O2VL 1AR1D 4FQLH 4LHUG 2X4QB 4GMSH 3PWPD 5C09D 3F01A 1CFQB 2OMZB 4PJHE 4OVVA 3WD5H 1EZLA 3EJJX 4P5TC 1E4XL 2WVSA 4LEBA 5E6YA 2DQUH 2R0LH 5FDYA 1NBYA 4KWUA 4H8UA 1EBPA 4XNQA 5DLLA 3WEXA 5D9SA 1AIZA 4R7VA 2ITFA 1TZGL 5BUPA 3LKNB 4KK6D 4PTUB 3CPLA 4HIJA 1P6AB 2FBOJ 4Z7WA 4M6NL 3T1FB 1S5HA 3OV6A 2X1PA 1SMAA 1Y1DA 1XQ4A 5EU6B 1KNOB 5B38G 3DWTA 4NB7A 3OLGA 1HKFA 2VISB 3QJFA 4K3GA 2P45B 1M9WA 4P2QE 2D3JA 2OCJA 2RFXA 5H2BB 3VWJD 1FG9C 4ZFFB 3GSXA 3QS2A 5K1JA 1AOHA 2IXQA 4KC3B 1F13A 4LCCA 2X3BA 3EH4B 1S8DA 2UYLB 4YQXL 2ED7A 1AQ8A 1PQZA 1QRNB 5DJXB 3T0AA 1UURA 5DUMH 3U1SL 2B4CH 1NEZA 3FQWA 1YUHB 4XP6H 3BLPX 4XWOC 5CM1A 5I1IL 5KJ7E 3MLVH 4YWGH 3VFMA 1IAMA 3P30L 2JIXB 4M9OA 3WFEL 1ETJA 3QR1A 4JJHA 4Q0XL 2PO6A 4UZUA 4AQ8A 2XRAL 2XPZA 2Y7QB 2DZEA 2Z91A 3GSRA 1QHPA 3F62A 2EYSA 5CUSL 3II3A 4RA3A 2JV6A 3L9EA 3HRPA 4XO3A 4XMPH 2X1XR 3WY1A 5EZPA 1ZK9A 5DJ6B 1H8OA 4LSSL 4M61B 5EORL 4ECNA 3ARVA 4U7MA 1CBVH 1N0LB 2K9UA 2ADFH 1UHVA 3VD1A 4TVUA 3QIWC 3ZRFC 3DYMA 4OSUH 5EU4A 4XXCC 1RZ7L 4LLQA 3EJPA 5JXED 1MQKH 1YPZF 1ZANH 3OBAA 3GSQA 1Q0XH 5IUCA 1X44A 4G8GA 1VCBC 3BSZL 3HAEH 1IVLA 1A14H 2DYPD 2WBJC 4FFWC 1L7IL 3PL6C 1IKFL 3K7UA 1CTOA 4HLZG 2NNAA 4O2CA 1Q0YL 5E1HB 5DMIH 3HTLX 5ALCH 2WO3B 3OF6A 5F7AA 3E3QE 3ZUCA 2BK8A 2EH8H 3T0VA 4NWTH 3KM1A 1V5JA 5HDRA 1TDQA 2MMXA 3ARBA 3RWHA 4C57C 5AVQB 3FK3A 4JRYD 2X41A 5D2NE 5B7FA 4MNQA 1MKFA 4EDXB 4N5EC 2MOQA 3T6ZA 1SJXA 5I71B 4OH2A 2PP7A 4LOVA 2F74B 3IPBA 4ZOBA 5CS7A 1U8PB 2CK0L 3DYPA 2GHWB 4AYSA 1MFVA 2MPAH 1OCOB 1PMYA 3FT3B 1QX1A 1JZ2A 1I4FA 1ORSA 4F7PA 4V1DA 4UT6H 5H35B 1ACCA 1FHNA 3PP3H 3WLBB 3TZVD 1S3KH 5ILTH 1BXUA 1YN6B 4YNYB 1Y0LA 1N2RA 4PLKD 1UOLA 2DWSA 3MLUL 4WEBL 4AE0A 5JPMB 3JWDC 4B9PA 1N19A 1RK1B 3N85L 4JY4B 4HLZH 1XGYL 3O4LA 4FFYH 4K2UL 4BFFA 1Q9KB 1FG2A 3TT1L 1UZ6F 4KK5C 4KVPA 1NCDL 2KZBA 2M26A 1UACH 5GIRB 4K3JH 3CVHL 3E9UA 4AXWB 3HZMA 1KEGH 1MZZA 1CFSB 2XFXB 5B3SB 5DMJB 5F0MB 3ZE2F 4L4TD 2IADB 1X4XA 3IPEA 4HIEB 3PFUA 5TDPA 1P4BL 2RQ8A 4F3FA 2AXFA 1INEH 5IOPB 4GKZB 3PQYB 3EOBB 2G5BA 1HOEA 4WWOA 4AL8L 3FFDA 3GSNA 3SCMA 1F8TL 3ZL2A 4GFTB 1II4E 4NRZA 4R4ND 3THMH 2EP6A 5LUMA 3CQFA 4BSVB 1S7WA 2J72A 1OAUH 3QBTB 2WSKA 4OGYL 1UQSB 1ZV5A 3MROA 3WCYA 3BW9B 4KKPA 3VU2A 3EO0B 4BE6A 3QJZA 1A7QH 1RMFH 4PJ8B 2DB8A 3VXUD 2NY0B 3MRQA 1ZT1B 3UYRH 4XVUC 2ITDB 2YJQA 3S37L 2OTUB 4TTDC 4AEHH 4YDLB 2EVHA 2OA9A 3IU3A 4IMLA 1J0HA 4RNRB 2XI9A 1ILUA 4JN1H 1KPVA 4DP1X 1ORQA 5DQDL 2H32A 3BGMA 4PHZA 2NR6D 4JFWA 2AQ1A 3QPXL 3KMDA 5LHDA 4AH2A 2VJ0A 5F96H 4NKDA 1FCGA 4TQEL 4NQCE 4MS6A 1IL1B 1F4WL 4WTWA 3IJHA 5BV7L 4Y5XC 4BCZA 4X42A 4EUPH 1FNEA 3P0GB 4LARL 2GCYB 5IG7A 5IV2B 1O75A 3ZTNL 3NJFA 1G7LB 1IBFA 5BPPA 3CZFB 4GBXD 1EAPA 2P5EB 2ITCB 5D1ZI 5E00A