1CODA

Solution conformation of cobrotoxin: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
62
structure length
62
Chain Sequence
LECHNQQSSQTPTTTGCSGGETNCYKKRWRDHRGYRTERGCGCPSVKNGIEINCCTTDRCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution conformation of cobrotoxin: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study.
pubmed doi rcsb
source organism Naja atra
molecule tags Short neurotoxin
molecule keywords COBROTOXIN
total genus 4
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1994-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1codA00
3EBXA 2JVEA 1CDTA 2X8BB 4OM5A 2MUPA 2QJ9C 3LAQU 3FEVA 1ERGA 1KXIA 1CDQA 1FASA 2CRTA 4HQPF 4BDTB 1I02A 2H62C 1LSIA 2UX2A 1ZADA 1FF4A 2OFSA 2QJAC 4BIKB 6EBXA 1KFHA 1XT3A 2ABXA 4OM4A 1CVOA 1LX5B 1HAAA 2H62D 1KBAA 3PLCA 1HC9B 1BTEA 1QKEA 1H0JA 3BT2U 1CODA 1RL5A 3U73U 1M9ZA 4LFTA 2MJ4A 5DU1A 1V6PA 2NBTA 2LCRA 1CB9A 1L4WA 1LXHA 1KU6B 1TXBA 1ES7B 4ZQYA 2LA1A 1COEA 1FSSB 2L03A 2CDXA 1HOYA 1IDGA 2CTXA 1HAJA 3QB4B 4AEAA 2QC1A 2GOOC 2MFAA 1G6MA 1LXGA 2MHYA 3KFDE 4QTIU 4DO8A 1YWHA 1KS6A 1UG4A 1F8UB 1IK8A 2CCXA 2UWRA 5DO6A 1IKCA 1CDRA 1LJZA 2I9BE 3NEQA 1TXAA 2L5SA 2J8BA 1CHVS 1QM7A 2BTXA 4EY8B 2FD6U 1KBSA 1CXNA 1NYSA 3BT1U 2H7ZA 2GOOB 2H5FA 2MJYA 3NDSA 4UY2C 1CRFA 1TGXA 4XJJA 1ONJA 2MUOA 3VTSA 1VB0A 2HLRA 2N99A 4IYEA 2ERAA 1REWC 1FRAA 1CXOA 1QKDA 2VLWA 1NTNA 1TFSA 1B41B 1W6BA 1S4YA 5IMTD 4RUDA 1KBTA 1HC9A 1CREA 2PJYB 2QJBC 2JQPA 5EBXA 3EVSC 5IMYC 1IDLA 2K3GA 1KC4A 1JE9A 1FFJA 1DRSA 2CRSA 2MJ0A 1IDIA 1NEAA 3HH7A 1MR6A 2H7ZB 1BXPA 1RGJA 1CDSA 2PJYC 1JGKA 4FAOC 5DZ5A 3KFDI 1MAHF 2H64C 1IJCA 3NH7A 1NYUA 2HLQA 1IQ9A 1JBDA 1FSCA 1PLOA 2H8UA 4FAOE 1NORA 1F94A 1ERAA 2BHIA 3U74U 1KL8A 1KTZB 1NXBA 1CCQA 3ERAA 1IDHA 4P7UA 1ABTA 1NTXA 2H64B 1CTXA
chains in the Genus database with same CATH superfamily
3EBXA 2JVEA 1CDTA 2X8BB 4OM5A 2MUPA 2QJ9C 3LAQU 3FEVA 1ERGA 1KXIA 1CDQA 1FASA 2CRTA 4HQPF 4BDTB 1I02A 2H62C 1LSIA 2UX2A 1ZADA 1FF4A 2OFSA 2QJAC 4BIKB 6EBXA 1KFHA 1XT3A 2ABXA 4OM4A 1CVOA 1LX5B 1HAAA 2H62D 1KBAA 3PLCA 1HC9B 1BTEA 1QKEA 1H0JA 3BT2U 1CODA 1RL5A 3U73U 1M9ZA 4LFTA 2MJ4A 5DU1A 1V6PA 2NBTA 2LCRA 1CB9A 1L4WA 1LXHA 1KU6B 1TXBA 1ES7B 4ZQYA 2LA1A 1COEA 1FSSB 2L03A 2CDXA 1HOYA 1IDGA 2CTXA 1HAJA 3QB4B 4AEAA 2QC1A 2GOOC 2MFAA 1G6MA 1LXGA 2MHYA 3KFDE 4QTIU 4DO8A 1YWHA 1KS6A 1UG4A 1F8UB 1IK8A 2CCXA 2UWRA 5DO6A 1IKCA 1CDRA 1LJZA 2I9BE 3NEQA 1TXAA 2L5SA 2J8BA 1CHVS 1QM7A 2BTXA 4EY8B 2FD6U 1KBSA 1CXNA 1NYSA 3BT1U 2H7ZA 2GOOB 2H5FA 2MJYA 3NDSA 4UY2C 1CRFA 1TGXA 4XJJA 1ONJA 2MUOA 3VTSA 1VB0A 2HLRA 2N99A 4IYEA 2ERAA 1REWC 1FRAA 1CXOA 1QKDA 2VLWA 1NTNA 1TFSA 1B41B 1W6BA 1S4YA 5IMTD 4RUDA 1KBTA 1HC9A 1CREA 2PJYB 2QJBC 2JQPA 4KSNA 3EVSC 5EBXA 5IMYC 1IDLA 2K3GA 1KC4A 1JE9A 1FFJA 1DRSA 2CRSA 2MJ0A 1IDIA 1NEAA 3HH7A 1MR6A 2H7ZB 1BXPA 1RGJA 1CDSA 2PJYC 1JGKA 4FAOC 5DZ5A 3KFDI 1MAHF 2H64C 1IJCA 3NH7A 1NYUA 2HLQA 1IQ9A 1JBDA 1FSCA 1PLOA 2H8UA 4FAOE 1NORA 1F94A 1ERAA 2BHIA 3U74U 1KL8A 1KTZB 1NXBA 1CCQA 3ERAA 1IDHA 4P7UA 1ABTA 1NTXA 2H64B 1CTXA
chains in the Genus database with same CATH topology
3EBXA 2JVEA 1CDTA 2X8BB 4OM5A 2MUPA 2QJ9C 3LAQU 3FEVA 1ERGA 1KXIA 1CDQA 1FASA 2CRTA 4HQPF 4BDTB 1I02A 2H62C 1LSIA 2UX2A 1ZADA 1FF4A 2OFSA 2QJAC 4BIKB 6EBXA 1KFHA 1XT3A 2ABXA 4OM4A 1CVOA 1LX5B 1HAAA 2H62D 1KBAA 3PLCA 1HC9B 1BTEA 1QKEA 1H0JA 3BT2U 1CODA 1RL5A 3U73U 1M9ZA 4LFTA 2MJ4A 5DU1A 1V6PA 2NBTA 2LCRA 1CB9A 1L4WA 1LXHA 1KU6B 1TXBA 1ES7B 4ZQYA 2LA1A 1COEA 1FSSB 2L03A 2CDXA 1HOYA 1IDGA 2CTXA 1HAJA 3QB4B 4AEAA 2QC1A 2GOOC 2MFAA 1G6MA 1LXGA 2MHYA 3KFDE 4QTIU 4DO8A 1YWHA 1KS6A 1UG4A 1F8UB 1IK8A 2CCXA 2UWRA 5DO6A 1IKCA 1CDRA 1LJZA 2I9BE 3NEQA 1TXAA 2L5SA 2J8BA 1CHVS 1QM7A 2BTXA 4EY8B 2FD6U 1KBSA 1CXNA 1NYSA 3BT1U 2H7ZA 2GOOB 2H5FA 2MJYA 3NDSA 4UY2C 1CRFA 1TGXA 4XJJA 1ONJA 2MUOA 3VTSA 1VB0A 2HLRA 2N99A 4IYEA 2ERAA 1REWC 1FRAA 1CXOA 1QKDA 2VLWA 1NTNA 1TFSA 1B41B 1W6BA 1S4YA 5IMTD 4RUDA 1KBTA 1HC9A 1CREA 2PJYB 2QJBC 2JQPA 4KSNA 3EVSC 5EBXA 5IMYC 1IDLA 2K3GA 1KC4A 1JE9A 1FFJA 1DRSA 2CRSA 2MJ0A 1IDIA 1NEAA 3HH7A 1MR6A 2H7ZB 1BXPA 1RGJA 1CDSA 2PJYC 1JGKA 4FAOC 5DZ5A 3KFDI 1MAHF 2H64C 1IJCA 3NH7A 1NYUA 2HLQA 1IQ9A 1JBDA 1FSCA 1PLOA 2H8UA 4FAOE 1NORA 1F94A 1ERAA 2BHIA 3U74U 1KL8A 1KTZB 1NXBA 1CCQA 3ERAA 1IDHA 4P7UA 1ABTA 1NTXA 2H64B 1CTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBX A;  2JVE A;  1CDT A;  2X8B B;  4OM5 A;  2MUP A;  2QJ9 C;  3LAQ U;  3FEV A;  1ERG A;  1KXI A;  1CDQ A;  1FAS A;  2CRT A;  4HQP F;  4BDT B;  1I02 A;  2H62 C;  1LSI A;  2UX2 A;  1ZAD A;  1FF4 A;  2OFS A;  2QJA C;  4BIK B;  6EBX A;  1KFH A;  1XT3 A;  2ABX A;  4OM4 A;  1CVO A;  1LX5 B;  1HAA A;  2H62 D;  1KBA A;  3PLC A;  1HC9 B;  1BTE A;  1QKE A;  1H0J A;  3BT2 U;  1COD A;  1RL5 A;  3U73 U;  1M9Z A;  4LFT A;  2MJ4 A;  5DU1 A;  1V6P A;  2NBT A;  2LCR A;  1CB9 A;  1L4W A;  1LXH A;  1KU6 B;  1TXB A;  1ES7 B;  4ZQY A;  2LA1 A;  1COE A;  1FSS B;  2L03 A;  2CDX A;  1HOY A;  1IDG A;  2CTX A;  1HAJ A;  3QB4 B;  4AEA A;  2QC1 A;  2GOO C;  2MFA A;  1G6M A;  1LXG A;  2MHY A;  3KFD E;  4QTI U;  4DO8 A;  1YWH A;  1KS6 A;  1UG4 A;  1F8U B;  1IK8 A;  2CCX A;  2UWR A;  5DO6 A;  1IKC A;  1CDR A;  1LJZ A;  2I9B E;  3NEQ A;  1TXA A;  2L5S A;  2J8B A;  1CHV S;  1QM7 A;  2BTX A;  4EY8 B;  2FD6 U;  1KBS A;  1CXN A;  1NYS A;  3BT1 U;  2H7Z A;  2GOO B;  2H5F A;  2MJY A;  3NDS A;  4UY2 C;  1CRF A;  1TGX A;  4XJJ A;  1ONJ A;  2MUO A;  3VTS A;  1VB0 A;  2HLR A;  2N99 A;  4IYE A;  2ERA A;  1REW C;  1FRA A;  1CXO A;  1QKD A;  2VLW A;  1NTN A;  1TFS A;  1B41 B;  1W6B A;  1S4Y A;  5IMT D;  4RUD A;  1KBT A;  1HC9 A;  1CRE A;  2PJY B;  2QJB C;  2JQP A;  5EBX A;  3EVS C;  5IMY C;  1IDL A;  2K3G A;  1KC4 A;  1JE9 A;  1FFJ A;  1DRS A;  2CRS A;  2MJ0 A;  1IDI A;  1NEA A;  3HH7 A;  1MR6 A;  2H7Z B;  1BXP A;  1RGJ A;  1CDS A;  2PJY C;  1JGK A;  4FAO C;  5DZ5 A;  3KFD I;  1MAH F;  2H64 C;  1IJC A;  3NH7 A;  1NYU A;  2HLQ A;  1IQ9 A;  1JBD A;  1FSC A;  1PLO A;  2H8U A;  4FAO E;  1NOR A;  1F94 A;  1ERA A;  2BHI A;  3U74 U;  1KL8 A;  1KTZ B;  1NXB A;  1CCQ A;  3ERA A;  1IDH A;  4P7U A;  1ABT A;  1NTX A;  2H64 B;  1CTX A; 
#chains in the Genus database with same CATH topology
 3EBX A;  2JVE A;  1CDT A;  2X8B B;  4OM5 A;  2MUP A;  2QJ9 C;  3LAQ U;  3FEV A;  1ERG A;  1KXI A;  1CDQ A;  1FAS A;  2CRT A;  4HQP F;  4BDT B;  1I02 A;  2H62 C;  1LSI A;  2UX2 A;  1ZAD A;  1FF4 A;  2OFS A;  2QJA C;  4BIK B;  6EBX A;  1KFH A;  1XT3 A;  2ABX A;  4OM4 A;  1CVO A;  1LX5 B;  1HAA A;  2H62 D;  1KBA A;  3PLC A;  1HC9 B;  1BTE A;  1QKE A;  1H0J A;  3BT2 U;  1COD A;  1RL5 A;  3U73 U;  1M9Z A;  4LFT A;  2MJ4 A;  5DU1 A;  1V6P A;  2NBT A;  2LCR A;  1CB9 A;  1L4W A;  1LXH A;  1KU6 B;  1TXB A;  1ES7 B;  4ZQY A;  2LA1 A;  1COE A;  1FSS B;  2L03 A;  2CDX A;  1HOY A;  1IDG A;  2CTX A;  1HAJ A;  3QB4 B;  4AEA A;  2QC1 A;  2GOO C;  2MFA A;  1G6M A;  1LXG A;  2MHY A;  3KFD E;  4QTI U;  4DO8 A;  1YWH A;  1KS6 A;  1UG4 A;  1F8U B;  1IK8 A;  2CCX A;  2UWR A;  5DO6 A;  1IKC A;  1CDR A;  1LJZ A;  2I9B E;  3NEQ A;  1TXA A;  2L5S A;  2J8B A;  1CHV S;  1QM7 A;  2BTX A;  4EY8 B;  2FD6 U;  1KBS A;  1CXN A;  1NYS A;  3BT1 U;  2H7Z A;  2GOO B;  2H5F A;  2MJY A;  3NDS A;  4UY2 C;  1CRF A;  1TGX A;  4XJJ A;  1ONJ A;  2MUO A;  3VTS A;  1VB0 A;  2HLR A;  2N99 A;  4IYE A;  2ERA A;  1REW C;  1FRA A;  1CXO A;  1QKD A;  2VLW A;  1NTN A;  1TFS A;  1B41 B;  1W6B A;  1S4Y A;  5IMT D;  4RUD A;  1KBT A;  1HC9 A;  1CRE A;  2PJY B;  2QJB C;  2JQP A;  4KSN A;  3EVS C;  5EBX A;  5IMY C;  1IDL A;  2K3G A;  1KC4 A;  1JE9 A;  1FFJ A;  1DRS A;  2CRS A;  2MJ0 A;  1IDI A;  1NEA A;  3HH7 A;  1MR6 A;  2H7Z B;  1BXP A;  1RGJ A;  1CDS A;  2PJY C;  1JGK A;  4FAO C;  5DZ5 A;  3KFD I;  1MAH F;  2H64 C;  1IJC A;  3NH7 A;  1NYU A;  2HLQ A;  1IQ9 A;  1JBD A;  1FSC A;  1PLO A;  2H8U A;  4FAO E;  1NOR A;  1F94 A;  1ERA A;  2BHI A;  3U74 U;  1KL8 A;  1KTZ B;  1NXB A;  1CCQ A;  3ERA A;  1IDH A;  4P7U A;  1ABT A;  1NTX A;  2H64 B;  1CTX A; 
#chains in the Genus database with same CATH homology
 3EBX A;  2JVE A;  1CDT A;  2X8B B;  4OM5 A;  2MUP A;  2QJ9 C;  3LAQ U;  3FEV A;  1ERG A;  1KXI A;  1CDQ A;  1FAS A;  2CRT A;  4HQP F;  4BDT B;  1I02 A;  2H62 C;  1LSI A;  2UX2 A;  1ZAD A;  1FF4 A;  2OFS A;  2QJA C;  4BIK B;  6EBX A;  1KFH A;  1XT3 A;  2ABX A;  4OM4 A;  1CVO A;  1LX5 B;  1HAA A;  2H62 D;  1KBA A;  3PLC A;  1HC9 B;  1BTE A;  1QKE A;  1H0J A;  3BT2 U;  1COD A;  1RL5 A;  3U73 U;  1M9Z A;  4LFT A;  2MJ4 A;  5DU1 A;  1V6P A;  2NBT A;  2LCR A;  1CB9 A;  1L4W A;  1LXH A;  1KU6 B;  1TXB A;  1ES7 B;  4ZQY A;  2LA1 A;  1COE A;  1FSS B;  2L03 A;  2CDX A;  1HOY A;  1IDG A;  2CTX A;  1HAJ A;  3QB4 B;  4AEA A;  2QC1 A;  2GOO C;  2MFA A;  1G6M A;  1LXG A;  2MHY A;  3KFD E;  4QTI U;  4DO8 A;  1YWH A;  1KS6 A;  1UG4 A;  1F8U B;  1IK8 A;  2CCX A;  2UWR A;  5DO6 A;  1IKC A;  1CDR A;  1LJZ A;  2I9B E;  3NEQ A;  1TXA A;  2L5S A;  2J8B A;  1CHV S;  1QM7 A;  2BTX A;  4EY8 B;  2FD6 U;  1KBS A;  1CXN A;  1NYS A;  3BT1 U;  2H7Z A;  2GOO B;  2H5F A;  2MJY A;  3NDS A;  4UY2 C;  1CRF A;  1TGX A;  4XJJ A;  1ONJ A;  2MUO A;  3VTS A;  1VB0 A;  2HLR A;  2N99 A;  4IYE A;  2ERA A;  1REW C;  1FRA A;  1CXO A;  1QKD A;  2VLW A;  1NTN A;  1TFS A;  1B41 B;  1W6B A;  1S4Y A;  5IMT D;  4RUD A;  1KBT A;  1HC9 A;  1CRE A;  2PJY B;  2QJB C;  2JQP A;  4KSN A;  3EVS C;  5EBX A;  5IMY C;  1IDL A;  2K3G A;  1KC4 A;  1JE9 A;  1FFJ A;  1DRS A;  2CRS A;  2MJ0 A;  1IDI A;  1NEA A;  3HH7 A;  1MR6 A;  2H7Z B;  1BXP A;  1RGJ A;  1CDS A;  2PJY C;  1JGK A;  4FAO C;  5DZ5 A;  3KFD I;  1MAH F;  2H64 C;  1IJC A;  3NH7 A;  1NYU A;  2HLQ A;  1IQ9 A;  1JBD A;  1FSC A;  1PLO A;  2H8U A;  4FAO E;  1NOR A;  1F94 A;  1ERA A;  2BHI A;  3U74 U;  1KL8 A;  1KTZ B;  1NXB A;  1CCQ A;  3ERA A;  1IDH A;  4P7U A;  1ABT A;  1NTX A;  2H64 B;  1CTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...