1CODA

Solution conformation of cobrotoxin: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
62
structure length
62
Chain Sequence
LECHNQQSSQTPTTTGCSGGETNCYKKRWRDHRGYRTERGCGCPSVKNGIEINCCTTDRCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COBROTOXIN
publication title Solution conformation of cobrotoxin: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study.
pubmed doi rcsb
source organism Naja atra
molecule tags Short neurotoxin
total genus 4
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1994-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1codA00
1S4YA 3QB4B 5IMYC 2H7ZB 3KFDI 4FAOE 2JVEA 3BT1U 1CVOA 1HOYA 1TFSA 4LFTA 1LSIA 1NORA 3KFDE 1KBSA 4AEAA 1ERGA 3NH7A 1CODA 2GOOC 4OM4A 1ABTA 3U73U 4QTIU 1F8UB 1IK8A 1NYUA 3EVSC 2MFAA 3U74U 1KFHA 1NYSA 1KBAA 1CDRA 1QM7A 1IQ9A 1KBTA 2OFSA 1VB0A 2X8BB 2CRSA 2BHIA 1TXAA 1IKCA 2H7ZA 1KL8A 1ONJA 2JQPA 2L03A 1QKDA 1I02A 4RUDA 2K3GA 1CXOA 1LX5B 4UY2C 1LXGA 3NDSA 1HC9B 5DZ5A 4BIKB 1CREA 1CHVS 2UX2A 2CDXA 1FFJA 1NXBA 2PJYB 1IDIA 2L5SA 2QJ9C 1FRAA 2NBTA 3VTSA 1CDQA 2HLRA 3FEVA 4OM5A 4XJJA 1MAHF 1CRFA 2ABXA 5EBXA 4ZQYA 1TXBA 2CTXA 1F94A 1FSSB 1H0JA 2MHYA 6EBXA 1M9ZA 1RGJA 1DRSA 2I9BE 2H62D 3HH7A 4FAOC 1CDSA 1LJZA 1W6BA 2FD6U 1XT3A 2LCRA 2UWRA 2CRTA 1NTNA 1HC9A 2PJYC 1G6MA 1QKEA 2VLWA 2H64B 2QC1A 2ERAA 2J8BA 1KC4A 2LA1A 1B41B 1V6PA 3ERAA 1IDHA 1ZADA 1CB9A 1KS6A 1RL5A 2MUPA 1IDLA 1BXPA 1CTXA 4EY8B 1ES7B 1YWHA 3LAQU 1L4WA 1JBDA 1LXHA 2N99A 3EBXA 2MJYA 2QJAC 2MJ0A 3BT2U 4BDTB 4DO8A 2H5FA 2QJBC 1COEA 5DU1A 1FASA 1KXIA 1IJCA 4HQPF 2MUOA 2BTXA 1NTXA 1PLOA 1ERAA 4IYEA 1HAJA 1KTZB 2H64C 4P7UA 1JGKA 2H62C 2H8UA 2MJ4A 1UG4A 1CXNA 1JE9A 1MR6A 1BTEA 2GOOB 1KU6B 1TGXA 2CCXA 1CDTA 1REWC 3NEQA 3PLCA 5IMTD 5DO6A 1FSCA 1HAAA 1FF4A 1IDGA 1NEAA 1CCQA 2HLQA
chains in the Genus database with same CATH superfamily
1S4YA 3QB4B 5IMYC 2H7ZB 3KFDI 4FAOE 2JVEA 3BT1U 4KSNA 1CVOA 1HOYA 1TFSA 4LFTA 1LSIA 1NORA 3KFDE 1KBSA 4AEAA 1ERGA 3NH7A 1CODA 2GOOC 4OM4A 1ABTA 3U73U 4QTIU 1F8UB 1IK8A 1NYUA 3EVSC 2MFAA 3U74U 1KFHA 1NYSA 1KBAA 1CDRA 1QM7A 1IQ9A 1KBTA 2OFSA 1VB0A 2X8BB 2CRSA 2BHIA 1TXAA 1IKCA 2H7ZA 1KL8A 1ONJA 2JQPA 2L03A 1QKDA 1I02A 4RUDA 2K3GA 1CXOA 1LX5B 4UY2C 1LXGA 3NDSA 1HC9B 5DZ5A 4BIKB 1CREA 1CHVS 2UX2A 2CDXA 1FFJA 1NXBA 2PJYB 1IDIA 2L5SA 2QJ9C 1FRAA 2NBTA 3VTSA 1CDQA 2HLRA 3FEVA 4OM5A 4XJJA 1MAHF 1CRFA 2ABXA 5EBXA 4ZQYA 1TXBA 2CTXA 1F94A 1FSSB 1H0JA 2MHYA 6EBXA 1M9ZA 1RGJA 1DRSA 2I9BE 2H62D 3HH7A 4FAOC 1CDSA 1LJZA 1W6BA 2FD6U 1XT3A 2LCRA 2UWRA 2CRTA 1NTNA 1HC9A 2PJYC 1G6MA 1QKEA 2VLWA 2H64B 2QC1A 2ERAA 2J8BA 1KC4A 2LA1A 1B41B 1V6PA 3ERAA 1IDHA 1ZADA 1CB9A 1KS6A 1RL5A 2MUPA 1IDLA 1BXPA 1CTXA 4EY8B 1ES7B 1YWHA 3LAQU 1L4WA 1JBDA 1LXHA 2N99A 3EBXA 2MJYA 2QJAC 2MJ0A 3BT2U 4BDTB 4DO8A 2H5FA 2QJBC 1COEA 5DU1A 1FASA 1KXIA 1IJCA 4HQPF 2MUOA 2BTXA 1NTXA 1PLOA 1ERAA 4IYEA 1HAJA 1KTZB 2H64C 4P7UA 1JGKA 2H62C 2H8UA 2MJ4A 1UG4A 1CXNA 1JE9A 1MR6A 1BTEA 2GOOB 1KU6B 1TGXA 2CCXA 1CDTA 1REWC 3NEQA 3PLCA 5IMTD 5DO6A 1FSCA 1HAAA 1FF4A 1IDGA 1NEAA 1CCQA 2HLQA
chains in the Genus database with same CATH topology
1S4YA 3QB4B 5IMYC 2H7ZB 3KFDI 4FAOE 2JVEA 3BT1U 4KSNA 1CVOA 1HOYA 1TFSA 4LFTA 1LSIA 1NORA 3KFDE 1KBSA 4AEAA 1ERGA 3NH7A 1CODA 2GOOC 4OM4A 1ABTA 3U73U 4QTIU 1F8UB 1IK8A 1NYUA 3EVSC 2MFAA 3U74U 1KFHA 1NYSA 1KBAA 1CDRA 1QM7A 1IQ9A 1KBTA 2OFSA 1VB0A 2X8BB 2CRSA 2BHIA 1TXAA 1IKCA 2H7ZA 1KL8A 1ONJA 2JQPA 2L03A 1QKDA 1I02A 4RUDA 2K3GA 1CXOA 1LX5B 4UY2C 1LXGA 3NDSA 1HC9B 5DZ5A 4BIKB 1CREA 1CHVS 2UX2A 2CDXA 1FFJA 1NXBA 2PJYB 1IDIA 2L5SA 2QJ9C 1FRAA 2NBTA 3VTSA 1CDQA 2HLRA 3FEVA 4OM5A 4XJJA 1MAHF 1CRFA 2ABXA 5EBXA 4ZQYA 1TXBA 2CTXA 1F94A 1FSSB 1H0JA 2MHYA 6EBXA 1M9ZA 1RGJA 1DRSA 2I9BE 2H62D 3HH7A 4FAOC 1CDSA 1LJZA 1W6BA 2FD6U 1XT3A 2LCRA 2UWRA 2CRTA 1NTNA 1HC9A 2PJYC 1G6MA 1QKEA 2VLWA 2H64B 2QC1A 2ERAA 2J8BA 1KC4A 2LA1A 1B41B 1V6PA 3ERAA 1IDHA 1ZADA 1CB9A 1KS6A 1RL5A 2MUPA 1IDLA 1BXPA 1CTXA 4EY8B 1ES7B 1YWHA 3LAQU 1L4WA 1JBDA 1LXHA 2N99A 3EBXA 2MJYA 2QJAC 2MJ0A 3BT2U 4BDTB 4DO8A 2H5FA 2QJBC 1COEA 5DU1A 1FASA 1KXIA 1IJCA 4HQPF 2MUOA 2BTXA 1NTXA 1PLOA 1ERAA 4IYEA 1HAJA 1KTZB 2H64C 4P7UA 1JGKA 2H62C 2H8UA 2MJ4A 1UG4A 1CXNA 1JE9A 1MR6A 1BTEA 2GOOB 1KU6B 1TGXA 2CCXA 1CDTA 1REWC 3NEQA 3PLCA 5IMTD 5DO6A 1FSCA 1HAAA 1FF4A 1IDGA 1NEAA 1CCQA 2HLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4Y A;  3QB4 B;  5IMY C;  2H7Z B;  3KFD I;  4FAO E;  2JVE A;  3BT1 U;  1CVO A;  1HOY A;  1TFS A;  4LFT A;  1LSI A;  1NOR A;  3KFD E;  1KBS A;  4AEA A;  1ERG A;  3NH7 A;  1COD A;  2GOO C;  4OM4 A;  1ABT A;  3U73 U;  4QTI U;  1F8U B;  1IK8 A;  1NYU A;  3EVS C;  2MFA A;  3U74 U;  1KFH A;  1NYS A;  1KBA A;  1CDR A;  1QM7 A;  1IQ9 A;  1KBT A;  2OFS A;  1VB0 A;  2X8B B;  2CRS A;  2BHI A;  1TXA A;  1IKC A;  2H7Z A;  1KL8 A;  1ONJ A;  2JQP A;  2L03 A;  1QKD A;  1I02 A;  4RUD A;  2K3G A;  1CXO A;  1LX5 B;  4UY2 C;  1LXG A;  3NDS A;  1HC9 B;  5DZ5 A;  4BIK B;  1CRE A;  1CHV S;  2UX2 A;  2CDX A;  1FFJ A;  1NXB A;  2PJY B;  1IDI A;  2L5S A;  2QJ9 C;  1FRA A;  2NBT A;  3VTS A;  1CDQ A;  2HLR A;  3FEV A;  4OM5 A;  4XJJ A;  1MAH F;  1CRF A;  2ABX A;  5EBX A;  4ZQY A;  1TXB A;  2CTX A;  1F94 A;  1FSS B;  1H0J A;  2MHY A;  6EBX A;  1M9Z A;  1RGJ A;  1DRS A;  2I9B E;  2H62 D;  3HH7 A;  4FAO C;  1CDS A;  1LJZ A;  1W6B A;  2FD6 U;  1XT3 A;  2LCR A;  2UWR A;  2CRT A;  1NTN A;  1HC9 A;  2PJY C;  1G6M A;  1QKE A;  2VLW A;  2H64 B;  2QC1 A;  2ERA A;  2J8B A;  1KC4 A;  2LA1 A;  1B41 B;  1V6P A;  3ERA A;  1IDH A;  1ZAD A;  1CB9 A;  1KS6 A;  1RL5 A;  2MUP A;  1IDL A;  1BXP A;  1CTX A;  4EY8 B;  1ES7 B;  1YWH A;  3LAQ U;  1L4W A;  1JBD A;  1LXH A;  2N99 A;  3EBX A;  2MJY A;  2QJA C;  2MJ0 A;  3BT2 U;  4BDT B;  4DO8 A;  2H5F A;  2QJB C;  1COE A;  5DU1 A;  1FAS A;  1KXI A;  1IJC A;  4HQP F;  2MUO A;  2BTX A;  1NTX A;  1PLO A;  1ERA A;  4IYE A;  1HAJ A;  1KTZ B;  2H64 C;  4P7U A;  1JGK A;  2H62 C;  2H8U A;  2MJ4 A;  1UG4 A;  1CXN A;  1JE9 A;  1MR6 A;  1BTE A;  2GOO B;  1KU6 B;  1TGX A;  2CCX A;  1CDT A;  1REW C;  3NEQ A;  3PLC A;  5IMT D;  5DO6 A;  1FSC A;  1HAA A;  1FF4 A;  1IDG A;  1NEA A;  1CCQ A;  2HLQ A; 
#chains in the Genus database with same CATH topology
 1S4Y A;  3QB4 B;  5IMY C;  2H7Z B;  3KFD I;  4FAO E;  2JVE A;  3BT1 U;  4KSN A;  1CVO A;  1HOY A;  1TFS A;  4LFT A;  1LSI A;  1NOR A;  3KFD E;  1KBS A;  4AEA A;  1ERG A;  3NH7 A;  1COD A;  2GOO C;  4OM4 A;  1ABT A;  3U73 U;  4QTI U;  1F8U B;  1IK8 A;  1NYU A;  3EVS C;  2MFA A;  3U74 U;  1KFH A;  1NYS A;  1KBA A;  1CDR A;  1QM7 A;  1IQ9 A;  1KBT A;  2OFS A;  1VB0 A;  2X8B B;  2CRS A;  2BHI A;  1TXA A;  1IKC A;  2H7Z A;  1KL8 A;  1ONJ A;  2JQP A;  2L03 A;  1QKD A;  1I02 A;  4RUD A;  2K3G A;  1CXO A;  1LX5 B;  4UY2 C;  1LXG A;  3NDS A;  1HC9 B;  5DZ5 A;  4BIK B;  1CRE A;  1CHV S;  2UX2 A;  2CDX A;  1FFJ A;  1NXB A;  2PJY B;  1IDI A;  2L5S A;  2QJ9 C;  1FRA A;  2NBT A;  3VTS A;  1CDQ A;  2HLR A;  3FEV A;  4OM5 A;  4XJJ A;  1MAH F;  1CRF A;  2ABX A;  5EBX A;  4ZQY A;  1TXB A;  2CTX A;  1F94 A;  1FSS B;  1H0J A;  2MHY A;  6EBX A;  1M9Z A;  1RGJ A;  1DRS A;  2I9B E;  2H62 D;  3HH7 A;  4FAO C;  1CDS A;  1LJZ A;  1W6B A;  2FD6 U;  1XT3 A;  2LCR A;  2UWR A;  2CRT A;  1NTN A;  1HC9 A;  2PJY C;  1G6M A;  1QKE A;  2VLW A;  2H64 B;  2QC1 A;  2ERA A;  2J8B A;  1KC4 A;  2LA1 A;  1B41 B;  1V6P A;  3ERA A;  1IDH A;  1ZAD A;  1CB9 A;  1KS6 A;  1RL5 A;  2MUP A;  1IDL A;  1BXP A;  1CTX A;  4EY8 B;  1ES7 B;  1YWH A;  3LAQ U;  1L4W A;  1JBD A;  1LXH A;  2N99 A;  3EBX A;  2MJY A;  2QJA C;  2MJ0 A;  3BT2 U;  4BDT B;  4DO8 A;  2H5F A;  2QJB C;  1COE A;  5DU1 A;  1FAS A;  1KXI A;  1IJC A;  4HQP F;  2MUO A;  2BTX A;  1NTX A;  1PLO A;  1ERA A;  4IYE A;  1HAJ A;  1KTZ B;  2H64 C;  4P7U A;  1JGK A;  2H62 C;  2H8U A;  2MJ4 A;  1UG4 A;  1CXN A;  1JE9 A;  1MR6 A;  1BTE A;  2GOO B;  1KU6 B;  1TGX A;  2CCX A;  1CDT A;  1REW C;  3NEQ A;  3PLC A;  5IMT D;  5DO6 A;  1FSC A;  1HAA A;  1FF4 A;  1IDG A;  1NEA A;  1CCQ A;  2HLQ A; 
#chains in the Genus database with same CATH homology
 1S4Y A;  3QB4 B;  5IMY C;  2H7Z B;  3KFD I;  4FAO E;  2JVE A;  3BT1 U;  4KSN A;  1CVO A;  1HOY A;  1TFS A;  4LFT A;  1LSI A;  1NOR A;  3KFD E;  1KBS A;  4AEA A;  1ERG A;  3NH7 A;  1COD A;  2GOO C;  4OM4 A;  1ABT A;  3U73 U;  4QTI U;  1F8U B;  1IK8 A;  1NYU A;  3EVS C;  2MFA A;  3U74 U;  1KFH A;  1NYS A;  1KBA A;  1CDR A;  1QM7 A;  1IQ9 A;  1KBT A;  2OFS A;  1VB0 A;  2X8B B;  2CRS A;  2BHI A;  1TXA A;  1IKC A;  2H7Z A;  1KL8 A;  1ONJ A;  2JQP A;  2L03 A;  1QKD A;  1I02 A;  4RUD A;  2K3G A;  1CXO A;  1LX5 B;  4UY2 C;  1LXG A;  3NDS A;  1HC9 B;  5DZ5 A;  4BIK B;  1CRE A;  1CHV S;  2UX2 A;  2CDX A;  1FFJ A;  1NXB A;  2PJY B;  1IDI A;  2L5S A;  2QJ9 C;  1FRA A;  2NBT A;  3VTS A;  1CDQ A;  2HLR A;  3FEV A;  4OM5 A;  4XJJ A;  1MAH F;  1CRF A;  2ABX A;  5EBX A;  4ZQY A;  1TXB A;  2CTX A;  1F94 A;  1FSS B;  1H0J A;  2MHY A;  6EBX A;  1M9Z A;  1RGJ A;  1DRS A;  2I9B E;  2H62 D;  3HH7 A;  4FAO C;  1CDS A;  1LJZ A;  1W6B A;  2FD6 U;  1XT3 A;  2LCR A;  2UWR A;  2CRT A;  1NTN A;  1HC9 A;  2PJY C;  1G6M A;  1QKE A;  2VLW A;  2H64 B;  2QC1 A;  2ERA A;  2J8B A;  1KC4 A;  2LA1 A;  1B41 B;  1V6P A;  3ERA A;  1IDH A;  1ZAD A;  1CB9 A;  1KS6 A;  1RL5 A;  2MUP A;  1IDL A;  1BXP A;  1CTX A;  4EY8 B;  1ES7 B;  1YWH A;  3LAQ U;  1L4W A;  1JBD A;  1LXH A;  2N99 A;  3EBX A;  2MJY A;  2QJA C;  2MJ0 A;  3BT2 U;  4BDT B;  4DO8 A;  2H5F A;  2QJB C;  1COE A;  5DU1 A;  1FAS A;  1KXI A;  1IJC A;  4HQP F;  2MUO A;  2BTX A;  1NTX A;  1PLO A;  1ERA A;  4IYE A;  1HAJ A;  1KTZ B;  2H64 C;  4P7U A;  1JGK A;  2H62 C;  2H8U A;  2MJ4 A;  1UG4 A;  1CXN A;  1JE9 A;  1MR6 A;  1BTE A;  2GOO B;  1KU6 B;  1TGX A;  2CCX A;  1CDT A;  1REW C;  3NEQ A;  3PLC A;  5IMT D;  5DO6 A;  1FSC A;  1HAA A;  1FF4 A;  1IDG A;  1NEA A;  1CCQ A;  2HLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...