1COFA

Yeast cofilin, orthorhombic crystal form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
135
Chain Sequence
VAVADESLTAFNDLKLGKKYKFILFGLNDAKTEIVVKETSTDPSYDAFLEKLPENDCLYAIYDFEYEINGNEGKRSKIVFFTWSPDTAPVRSKMVYASSKDALRRALNGVSTDVQGTDFSEVSYDSVLERVSRGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of yeast cofilin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Actin-binding protein
molecule keywords COFILIN
total genus 34
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 1996-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1cofA00
2MV2A 1TMWA 3CIPG 3DAWB 1Q8XA 1T3XA 2NUPB 3EH2A 3TU5B 3CJCG 1TVJA 4PKGG 4S10C 2W0IA 3L50A 2L72A 3EH1A 1J72A 5DD2A 4PKHB 1YAGG 1QPVA 4PKIG 1C0FS 1PD1A 4CBWG 1NMDG 2NUPA 1M2OA 5KYYA 1CFYA 5KYUA 3EGDB 3A5LS 3FG6A 1NLVG 5IVUA 2LXXA 1T2LA 1JHWA 1M4JA 5HVKD 5KYWB 3A5MS 1WNJA 5KYUB 2FGHA 2VACA 4KEEA 1VFQA 2LLFA 3EGXA 3FFKA 2FF3A 5FAFA 4LIZA 1SVQA 3EFOB 5HVKB 1HQZ1 1C0GS 5KYXA 2VIKA 4KEFA 1P8ZG 4Z94G 2MP4A 2NUTB 1P8XA 3A5OS 1X67A 3EG9A 2D8BA 1SVRA 2FH2A 1D4XG 1CNUA 3EGDA 2KVKA 5KYYB 2FH3A 2I2QA 2FH4A 3CI5G 3FFNA 3EG9B 1D0NA 2FF6G 4CBXG 4KEDA 1V6FA 1YVNG 1M2VA 1AHQA 1PCXA 2XF1A 4JD2H 5KYXB 1COFA 2LJ8A 2QTVA 1AK6A 2FH1A 1F7SA 2XFAA 1RGIG 1DEJS 5L6WC 1SVYA 1Q8GA 1VKKA 1T3YA 3Q2BA 1UDMA 2NUTA 5A1MA 3CJBG 1ESVS 1NPHA 4CBUG 1AK7A 3FG7A 2VILA 1H1VG 5FAEA 1T44G 1PD0A 3A5NS 1KCQA 3EFOA 2HD7A 1MDUA 5KYNA 1NM1G 1WFSA 5KYWA 4BEX1 3EGXB 1EQYS 2MOTA 1M2VB 1WM4A
chains in the Genus database with same CATH superfamily
2MV2A 1TMWA 3CIPG 3DAWB 1Q8XA 1T3XA 2NUPB 3EH2A 3TU5B 3CJCG 1TVJA 4PKGG 4S10C 2W0IA 3L50A 2L72A 3EH1A 1J72A 5DD2A 4PKHB 1YAGG 1QPVA 4PKIG 1C0FS 1PD1A 4CBWG 1NMDG 3DA7A 2NUPA 1M2OA 5KYYA 1CFYA 5KYUA 3EGDB 3A5LS 3FG6A 1NLVG 5IVUA 2LXXA 1T2LA 1JHWA 1M4JA 5HVKD 5KYWB 3A5MS 1WNJA 5KYUB 2FGHA 2VACA 4KEEA 1VFQA 2LLFA 3EGXA 3FFKA 2FF3A 5FAFA 4LIZA 1SVQA 3EFOB 5HVKB 1HQZ1 1C0GS 5KYXA 2VIKA 4KEFA 1P8ZG 4Z94G 2MP4A 2NUTB 1P8XA 3A5OS 1X67A 3EG9A 2D8BA 1SVRA 2FH2A 1D4XG 1CNUA 3EGDA 2KVKA 5KYYB 2FH3A 2I2QA 2FH4A 3CI5G 3FFNA 3EG9B 1D0NA 2FF6G 4CBXG 4KEDA 1V6FA 1YVNG 1M2VA 1AHQA 1PCXA 2XF1A 4JD2H 5KYXB 1COFA 2LJ8A 2QTVA 1AK6A 2FH1A 1F7SA 2XFAA 1RGIG 1DEJS 5L6WC 1SVYA 1Q8GA 1VKKA 1T3YA 3Q2BA 1UDMA 2NUTA 5A1MA 3CJBG 1ESVS 1NPHA 4CBUG 1AK7A 3FG7A 2VILA 1H1VG 5FAEA 1T44G 1PD0A 3A5NS 1KCQA 3EFOA 2HD7A 1MDUA 5KYNA 1NM1G 1WFSA 5KYWA 4BEX1 3EGXB 1EQYS 2MOTA 1M2VB 1WM4A
chains in the Genus database with same CATH topology
2MV2A 1TMWA 3CIPG 3DAWB 1Q8XA 1T3XA 2NUPB 3EH2A 3TU5B 3CJCG 1TVJA 4PKGG 4S10C 2W0IA 3L50A 2L72A 3EH1A 1J72A 5DD2A 4PKHB 1YAGG 1QPVA 4PKIG 1C0FS 1PD1A 4CBWG 1NMDG 3DA7A 2NUPA 1M2OA 5KYYA 1CFYA 5KYUA 3EGDB 3A5LS 3FG6A 1NLVG 5IVUA 2LXXA 1T2LA 1JHWA 1M4JA 5HVKD 5KYWB 3A5MS 1WNJA 5KYUB 2FGHA 2VACA 4KEEA 1VFQA 2LLFA 3EGXA 3FFKA 2FF3A 5FAFA 4LIZA 1SVQA 3EFOB 5HVKB 1HQZ1 1C0GS 5KYXA 2VIKA 4KEFA 1P8ZG 4Z94G 2MP4A 2NUTB 1P8XA 3A5OS 1X67A 3EG9A 2D8BA 1SVRA 2FH2A 1D4XG 1CNUA 3EGDA 2KVKA 5KYYB 2FH3A 2I2QA 2FH4A 3CI5G 3FFNA 3EG9B 1D0NA 2FF6G 4CBXG 4KEDA 1V6FA 1YVNG 1M2VA 1AHQA 1PCXA 2XF1A 4JD2H 5KYXB 1COFA 2LJ8A 2QTVA 1AK6A 2FH1A 1F7SA 2XFAA 1RGIG 1DEJS 5L6WC 1SVYA 1Q8GA 1VKKA 1T3YA 3Q2BA 1UDMA 2NUTA 5A1MA 3CJBG 1ESVS 1NPHA 4CBUG 1AK7A 3FG7A 2VILA 1H1VG 5FAEA 1T44G 1PD0A 3A5NS 1KCQA 3EFOA 2HD7A 1MDUA 5KYNA 1NM1G 1WFSA 5KYWA 4BEX1 3EGXB 1EQYS 2MOTA 1M2VB 1WM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MV2 A;  1TMW A;  3CIP G;  3DAW B;  1Q8X A;  1T3X A;  2NUP B;  3EH2 A;  3TU5 B;  3CJC G;  1TVJ A;  4PKG G;  4S10 C;  2W0I A;  3L50 A;  2L72 A;  3EH1 A;  1J72 A;  5DD2 A;  4PKH B;  1YAG G;  1QPV A;  4PKI G;  1C0F S;  1PD1 A;  4CBW G;  1NMD G;  2NUP A;  1M2O A;  5KYY A;  1CFY A;  5KYU A;  3EGD B;  3A5L S;  3FG6 A;  1NLV G;  5IVU A;  2LXX A;  1T2L A;  1JHW A;  1M4J A;  5HVK D;  5KYW B;  3A5M S;  1WNJ A;  5KYU B;  2FGH A;  2VAC A;  4KEE A;  1VFQ A;  2LLF A;  3EGX A;  3FFK A;  2FF3 A;  5FAF A;  4LIZ A;  1SVQ A;  3EFO B;  5HVK B;  1HQZ 1;  1C0G S;  5KYX A;  2VIK A;  4KEF A;  1P8Z G;  4Z94 G;  2MP4 A;  2NUT B;  1P8X A;  3A5O S;  1X67 A;  3EG9 A;  2D8B A;  1SVR A;  2FH2 A;  1D4X G;  1CNU A;  3EGD A;  2KVK A;  5KYY B;  2FH3 A;  2I2Q A;  2FH4 A;  3CI5 G;  3FFN A;  3EG9 B;  1D0N A;  2FF6 G;  4CBX G;  4KED A;  1V6F A;  1YVN G;  1M2V A;  1AHQ A;  1PCX A;  2XF1 A;  4JD2 H;  5KYX B;  1COF A;  2LJ8 A;  2QTV A;  1AK6 A;  2FH1 A;  1F7S A;  2XFA A;  1RGI G;  1DEJ S;  5L6W C;  1SVY A;  1Q8G A;  1VKK A;  1T3Y A;  3Q2B A;  1UDM A;  2NUT A;  5A1M A;  3CJB G;  1ESV S;  1NPH A;  4CBU G;  1AK7 A;  3FG7 A;  2VIL A;  1H1V G;  5FAE A;  1T44 G;  1PD0 A;  3A5N S;  1KCQ A;  3EFO A;  2HD7 A;  1MDU A;  5KYN A;  1NM1 G;  1WFS A;  5KYW A;  4BEX 1;  3EGX B;  1EQY S;  2MOT A;  1M2V B;  1WM4 A; 
#chains in the Genus database with same CATH topology
 2MV2 A;  1TMW A;  3CIP G;  3DAW B;  1Q8X A;  1T3X A;  2NUP B;  3EH2 A;  3TU5 B;  3CJC G;  1TVJ A;  4PKG G;  4S10 C;  2W0I A;  3L50 A;  2L72 A;  3EH1 A;  1J72 A;  5DD2 A;  4PKH B;  1YAG G;  1QPV A;  4PKI G;  1C0F S;  1PD1 A;  4CBW G;  1NMD G;  3DA7 A;  2NUP A;  1M2O A;  5KYY A;  1CFY A;  5KYU A;  3EGD B;  3A5L S;  3FG6 A;  1NLV G;  5IVU A;  2LXX A;  1T2L A;  1JHW A;  1M4J A;  5HVK D;  5KYW B;  3A5M S;  1WNJ A;  5KYU B;  2FGH A;  2VAC A;  4KEE A;  1VFQ A;  2LLF A;  3EGX A;  3FFK A;  2FF3 A;  5FAF A;  4LIZ A;  1SVQ A;  3EFO B;  5HVK B;  1HQZ 1;  1C0G S;  5KYX A;  2VIK A;  4KEF A;  1P8Z G;  4Z94 G;  2MP4 A;  2NUT B;  1P8X A;  3A5O S;  1X67 A;  3EG9 A;  2D8B A;  1SVR A;  2FH2 A;  1D4X G;  1CNU A;  3EGD A;  2KVK A;  5KYY B;  2FH3 A;  2I2Q A;  2FH4 A;  3CI5 G;  3FFN A;  3EG9 B;  1D0N A;  2FF6 G;  4CBX G;  4KED A;  1V6F A;  1YVN G;  1M2V A;  1AHQ A;  1PCX A;  2XF1 A;  4JD2 H;  5KYX B;  1COF A;  2LJ8 A;  2QTV A;  1AK6 A;  2FH1 A;  1F7S A;  2XFA A;  1RGI G;  1DEJ S;  5L6W C;  1SVY A;  1Q8G A;  1VKK A;  1T3Y A;  3Q2B A;  1UDM A;  2NUT A;  5A1M A;  3CJB G;  1ESV S;  1NPH A;  4CBU G;  1AK7 A;  3FG7 A;  2VIL A;  1H1V G;  5FAE A;  1T44 G;  1PD0 A;  3A5N S;  1KCQ A;  3EFO A;  2HD7 A;  1MDU A;  5KYN A;  1NM1 G;  1WFS A;  5KYW A;  4BEX 1;  3EGX B;  1EQY S;  2MOT A;  1M2V B;  1WM4 A; 
#chains in the Genus database with same CATH homology
 2MV2 A;  1TMW A;  3CIP G;  3DAW B;  1Q8X A;  1T3X A;  2NUP B;  3EH2 A;  3TU5 B;  3CJC G;  1TVJ A;  4PKG G;  4S10 C;  2W0I A;  3L50 A;  2L72 A;  3EH1 A;  1J72 A;  5DD2 A;  4PKH B;  1YAG G;  1QPV A;  4PKI G;  1C0F S;  1PD1 A;  4CBW G;  1NMD G;  3DA7 A;  2NUP A;  1M2O A;  5KYY A;  1CFY A;  5KYU A;  3EGD B;  3A5L S;  3FG6 A;  1NLV G;  5IVU A;  2LXX A;  1T2L A;  1JHW A;  1M4J A;  5HVK D;  5KYW B;  3A5M S;  1WNJ A;  5KYU B;  2FGH A;  2VAC A;  4KEE A;  1VFQ A;  2LLF A;  3EGX A;  3FFK A;  2FF3 A;  5FAF A;  4LIZ A;  1SVQ A;  3EFO B;  5HVK B;  1HQZ 1;  1C0G S;  5KYX A;  2VIK A;  4KEF A;  1P8Z G;  4Z94 G;  2MP4 A;  2NUT B;  1P8X A;  3A5O S;  1X67 A;  3EG9 A;  2D8B A;  1SVR A;  2FH2 A;  1D4X G;  1CNU A;  3EGD A;  2KVK A;  5KYY B;  2FH3 A;  2I2Q A;  2FH4 A;  3CI5 G;  3FFN A;  3EG9 B;  1D0N A;  2FF6 G;  4CBX G;  4KED A;  1V6F A;  1YVN G;  1M2V A;  1AHQ A;  1PCX A;  2XF1 A;  4JD2 H;  5KYX B;  1COF A;  2LJ8 A;  2QTV A;  1AK6 A;  2FH1 A;  1F7S A;  2XFA A;  1RGI G;  1DEJ S;  5L6W C;  1SVY A;  1Q8G A;  1VKK A;  1T3Y A;  3Q2B A;  1UDM A;  2NUT A;  5A1M A;  3CJB G;  1ESV S;  1NPH A;  4CBU G;  1AK7 A;  3FG7 A;  2VIL A;  1H1V G;  5FAE A;  1T44 G;  1PD0 A;  3A5N S;  1KCQ A;  3EFO A;  2HD7 A;  1MDU A;  5KYN A;  1NM1 G;  1WFS A;  5KYW A;  4BEX 1;  3EGX B;  1EQY S;  2MOT A;  1M2V B;  1WM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...