1COV3

Coxsackievirus b3 coat protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
238
structure length
238
Chain Sequence
GLPTMNTPGSCQFLTSDDFQSPSAMPQYDVTPEMRIPGEVKNLMEIAEVDSVVPVQNVGEKVNSMEAYQIPVRSNEGSGTQVFGFPLQPGYSSVFSRTLLGEILNYYTHWSGSIKLTFMFCGSAMATGKFLLAYSPPGAGAPTKRVDAMLGTHVVWDVGLQSSCVLCIPWISQTHYRYVASDEYTAGGFITCWYQTNIVVPADAQSSCYIMCFVSACNDFSVRLLKDTPFISQENFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of coxsackievirus B3 to 3.5 A resolution.
pubmed doi rcsb
molecule tags Virus
molecule keywords COXSACKIEVIRUS COAT PROTEIN
total genus 33
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cov300
1VBD2 1PGL2 4Y5Z0 1HX6A 2FZ1A 4CEYC 2WFF2 5CFCA 4RR3A 1RUJ1 1RUI2 1VRH1 5C4WC 2R062 4GMP0 1FMD2 1NY72 4IV3C 1AL22 4LLFA 4RS5B 5C4WB 2WZR2 2BFUS 5BNOA 3ZFFA 2RMU2 1C8M2 2HWC3 1QQP1 1AL0G 2XBO1 4CDQC 2RS52 3ZFGC 3FBMA 1QJY2 5AC92 5CFDB 1MQTB 1Z7S3 2RS31 1VBC2 4CDUA 1QQP2 2XBO2 1HRV2 2HWB3 5DDJ2 2HWB1 2RS51 3CJIC 1RUE2 4EJRA 1EV13 1AYN3 1RMU1 1RUJ3 2BPA2 4YVWB 1PVC1 4GB32 1VBC1 1PVC3 1SMVA 1POV3 1COV3 4PDWC 4SBVA 1RUH2 1NA1A 2HWB2 2TBVA 1A6CA 1RUE1 3VBSB 1VBA2 1DDLA 3VBOA 1RMU2 1EV12 4AEDB 2RR12 4GB33 1RUI1 2RS13 4IV1A 1POV0 1RHI3 4WM7C 1RUC3 1BBT2 4N43B 1AR71 4CEYA 4RHV2 2BFUL 3J8F1 3VBSC 1V9U1 2RM21 4CEWA 5A33B 1AR82 1PGW1 4N53C 2HWF3 1RUD2 1NCQC 3DPRA 1RHI2 3ZFFC 1R092 1RB8G 1VBE1 1AR72 3NAPC 5FMOS 3VDDC 3VBFC 4RHV3 4JGYA 5BNNB 1HRV1 1QJU1 2RM22 2R041 1HRV3 4GH4C 2PLV3 1X36A 4GH4B 1TMF3 1R091 5K0UB 1VAKA 1NCQB 5C8CA 1FPN3 2X5IB 5C9AB 4Q4Y3 4YVSB 2GSYA 2HWE1 2ZZQA 5L7OB 1HRI3 3VBUB 4WM7B 4QPIA 2BUKA 1V9U3 1ZBE3 4Q4V3 1ND2C 4PDWA 4N43C 1FPN2 1VBC3 1W39A 5JZGC 4FTSA 1NCRC 1RUG3 4RR3B 1PIV3 4FTBA 2RS12 2HWC1 1BEV1 4RS5A 4Z92B 1FMD1 4IV3B 3LOBA 1WCDJ 1HXS2 1AL21 2HWD3 3J8F2 1ASJ1 1AUYA 3TN93 3ZFGA 1AR81 1PGW2 1RUH3 1PO21 4Y4YA 1RUD3 1RUC1 3JD73 1RHI1 3VBHC 4CDXA 4JGZB 1VBE2 4RQPA 1AR73 1AR91 5BNPC 1IHMA 1QJU2 2R071 3VBFB 1R082 3ZXAC 1RUC2 4Q4W2 1VB4A 1ZBA1 4JGYC 3VBHB 1NA1C 1B35A 1OOPC 2R072 1K5MB 3ZFEA 1CJDA 1RUH1 2R061 4Q4W1 1FOD3 3TN91 5FMOL 5D8AB 3CJIA 2IZWA 2WS92 1ND2B 3VBRA 4QPGA 1PIV2 1NG0A 5FOJB 5LK7B 4N43A 4CEYB 4Q4X3 1NCRB 2VQ0A 4CDWA 1OOPB 5AC91 4Q4Y2 1QJX1 4N53A 4RHV1 1OPOA 1EAH3 5A33A 4AEDC 4CEWB 1BEV3 5BNOC 3NAPA 3DPRB 1BMV2 2GH8A 4GMP1 1COV2 4IV1C 1C8M3 3JBG1 2WWSA 3JD71 5C8CC 4WM8C 1ZBA2 4CEWC 3ZFFB 1D4M2 1RUF3 2HWF1 3JBG2 2FZ2A 2RM23 1AYM3 4CDQB 2DF7A 1RUE3 5AC93 2BBVA 1ND3B 3JB4C 1VBB2 5CFDA 4QPIB 2Y26A 3JB8A 1BBT1 1D4M1 1H8TC 5JZGB 2WS91 2HWF2 1C8NA 1AYN2 1GFF2 1M06G 5ABJA 2HWE3 4YVWA 4Q4Y1 5D8AC 2RS53 1R1A2 1VRH3 1AR93 1AR61 1NA1B 4QPIC 4CDXC 2R042 4Q4V1 3M8LA 3VBOB 4Q4X1 1POV1 1TME3 5CFCB 2X5IC 4AEDA 3S6PA 1R1A1 3VDDA 1NOVA 4IV1B 3VBFA 4RFT0 1AL23 5BNOB 1R093 4Q4X2 1PO23 1AR83 1B35B 1RUF2 5CFCC 1HRI1 2PLV2 1AR63 1MEC3 1PO13 1TMF2 2HWC2 1RMU3 4CDUB 5A32B 1AYM1 2RR13 2ZTNA 1RUG1 5BNNA 1RUF1 1VBD1 1ASJ2 1TME1 1E57A 1PIV1 1CD3G 1H8TA 1NCRA 1B35C 2WFF3 1QQP3 2XBO3 1D4M3 1OOPA 5J96B 2XPJA 1QJU3 1QJX2 1RUG2 5L7OC 1QJZA 1AR92 1VBA3 3VBUA 2WZR3 1BMV1 2RMU3 1HXS3 3VBRC 1X33A 4QPGC 3J8F3 4WM8A 2QQPA 1VBD3 1ZBE1 1FOD2 3JD72 4JGZC 4IV3A 3VBOC 5DDJ1 5BNPA 3TN92 1RVF3 1R1A3 1RVF1 4CDQA 2WFF1 4BCUA 2PLV1 1HRI2 1F2NA 5CFDC 1ZBE2 4Q4W3 4CDXB 1TMF1 1RUJ2 4RQPB 1VBB1 1NY71 5J98B 3JBG3 2WZR1 4RR3C 1RVF2 4CDUC 3IDEA 5C4WA 2RMU1 1K5MC 1NCQA 1AYN1 1ND3C 4YVSA 1COV1 5ACA2 1QJX3 2RS32 4CDWC 1MQTA 3ZFEB 4PDWB 5K0UC 5C9AC 3CJIB 1RUI3 2R063 1R083 1ASJ3 5ACA1 4QPGB 5GKAC 3VDDB 5ABJC 5ACA3 1FOD1 4CDWB 2HWD2 2ZAHA 3ZFGB 2MEV2 1EAH2 3VBSA 1EV11 2R073 3NAPB 4JGZA 1PGL1 3DPRC 2RR11 1VBE3 2HWE2 4RS5C 5A32A 1EAH1 1FMD3 2WS93 1Z7S1 1AR62 1MEC2 1PO12 1V9U2 1TME2 1C8M1 1H8TB 1VBB3 4Q4V2 3VBHA 1RUD1 4RQPC 2RS11 1OHFA 1BEV2 3VBUC 1K5MA 1QJY3 2WLPA 1HXS1 1QJY1 4YVWC 1Z7S2 1ND3A 4FSJA 1F8VA 5D8AA 1MEC1 1PO11 4YVSC 5BNNC 4JGYB 1PO22 5DDJ3 3HAGA 1ND2A 3VBRB 1VB2A 5JZGA 1MQTC 1HQNA 4GH4A 1BBT3 4WM8B 4NWWA 5K0UA 1ZBA3 2R043 5C8CB 2X5IA 5C9AA 5ABJB 3ZFEC 1PVC2 4GB31 4N53B 2HWD1 5BNPB 5L7OA 4GMP3 4FTEA 1R081 1VRH2 2MEV1 4NWVA 2MEV3 1VBA1 1AYM2 2RS33 4WM7A 1FPN1
chains in the Genus database with same CATH superfamily
3OEBA 4I02A 1VP6A 5HCHA 4Y5Z0 2WBKA 2ZGQA 3LD8A 5JSPA 1UY1A 1W05A 4MADA 1XPWA 1QOTA 1IS6A 3GYDA 1SACA 2D97A 1RUJ1 2VXRA 3WZ1A 2VAUA 1ULOA 2IVJA 1GQGA 1N1TA 1AL22 4RS5B 4N8MA 1TQ5A 2Z42A 3KQ4B 3SISA 3ZSJA 2BFUS 3WXPA 3I59A 3MYXA 5JMCA 2FDFA 2HWC3 2WO3A 4LQRA 1QQP1 4E8DA 2D3PA 1ZRDA 1OPMA 3CHXA 1K45A 4Q8KA 4JDNA 3WNXA 5B4NA 3N9PA 2O8QA 5FPUA 3JUUA 2PHTA 3M70A 2WYFA 4X8NA 5HV0A 1MQTB 4YM2A 3URFA 2RS31 2VC9A 1VBC2 1UY0A 4MVTA 3VKLA 2XBO2 1CX1A 4Q27A 3T2TA 4NRPA 3U78A 3OG2A 3IBMA 1RUE2 5FYVA 5H9QA 2Z4FA 2MPFA 3VZJA 1W9FA 1MZ5A 2RHPA 4XE9A 4K9SA 2WINB 2GC2A 2XQRA 4Y22A 1DCSA 2WABA 3D82A 4ZONA 1NE4A 1SMVA 3AKSA 3ZSKA 1ZZBA 2BTVC 1HDKA 2I2SA 3MW3A 4GXLA 4PJYA 4HVQA 1J84A 2ADDA 3B5LB 3H7JA 4K21A 4KBBA 5C3OA 4MG2A 3PLQA 1VBA2 1LHWA 2JDZA 2JDUA 2WWJA 4QX8A 1REDA 4OMDA 5LY2A 1XNCA 1EV12 2EXIA 3BIEA 3TAYA 1YFUA 2RR12 4GB33 3MFAA 5FZLA 4GZ9A 1LHNA 4AW7A 1GZCA 5FXZA 1POV0 1RHI3 4HONA 1RUC3 3MPBA 2CDOA 4H14A 4IEYA 5L36A 1CQ9A 1BBT2 1BYHA 4B7EA 3INAA 4CEYA 4HOOA 1PZ7A 4RHV2 2BBAA 1H1AA 2BGCA 4P5YA 4QKDA 3VZKA 4TSVA 2QE3A 3A0NA 3PUIA 4AEJA 1BVP1 1PGW1 3O0VA 1SPPA 4ZZ5A 4YNIA 4MGTA 4CCCA 4URTA 1JS9A 5I0SA 1R092 3BTYA 3FMGA 3D4KA 3PTYA 4XDPA 2ZBJA 3WHTA 2JG9C 4CUCA 2WIIB 4C0HA 3MO4A 5BNNB 4NIHA 2RM22 2R041 1HRV3 5FYBA 1X36A 1APNA 2JENA 2VM9A 1W99A 1U5ZA 4CXWA 5A3TA 1TMF3 4G9SB 1YUDA 2KR2A 3IAQA 5CYYA 4QPYA 1UYPA 1G6NA 1XE8A 1ZRRA 1BHGA 1DBNA 3C8XA 4Q1RA 5DMYA 2ZX3A 4DPNA 3WX5A 2HWE1 2Q8CA 2DTYA 4U36A 3TEYA 3VDAA 1MS5A 4FQZA 2WN2A 3UGHA 1HRI3 3IWZA 2QCSB 1WKYA 2QFEA 4KGGA 1QIQA 1UXXX 2PHFA 5H9RA 3U11A 3AJZA 3VBUB 2DBNA 4QPIA 1W9SA 2YU1A 2ES3A 4MHUA 4Y20B 4HFSA 4Q4V3 2DYCA 4N43C 5I0TA 3IMNA 4TLFA 4EQVA 4AVCA 5CBLA 5DAWA 2YGMA 1J1TA 1XNTA 1LOFC 3O0WA 5FY4A 1PIV3 3RMYA 3MUZ1 1IQDC 4PLOA 4IETA 2HWC1 4LOSA 2EVXA 2RDRA 4UFLA 5E16A 3HQRA 1XNKA 4B1MA 2ENRA 4RS5A 4Z92B 3M2MA 3LDBA 1QNWA 2QQIA 5EZWA 3WNPA 3T1LA 2HWD3 3J8F2 1TEIA 4FPLA 4EROA 3DV8A 3NNGA 2WNUB 4MGKE 2BNMA 2OZJA 1PGW2 4QX5A 4A2UA 1UIKA 2FDKA 2R6QA 3N9NA 3ACFA 4IGOA 2HLEA 2JE8A 2KD7A 2UY9A 1VBE2 4JGZB 4ES8A 4JC1A 3I2FA 5LZ6A 5FZ4A 5G05L 3DXTA 1OD5A 3MV01 4JQRA 3AVSA 3TNPB 4QGNA 1AX0A 4YZ5A 5BNPC 2EIBA 3I8TA 2R071 2XH6A 5H9PA 1H9WA 3FLRA 1RUC2 1QF3A 4GWMA 4RFRB 2A6WA 5FPBA 2VH9A 3O14A 4JCKA 5FYSA 5FY7A 3RSJA 4DO0A 1ZBA1 1Z78A 3OGVA 5F3GA 3CU7A 3WNOA 3OY8A 5HCBA 1NA1C 5FZOA 1YLLA 1OOPC 2I74A 2VQAA 3WDYA 1KFXL 5GM0A 2YHJA 5T54A 1K5MB 1WCUA 4IEOA 4XW3A 4Q4W1 1NXMA 5D8AB 3O1PA 5HBAA 3CJIA 2ZEYA 2IZWA 4X6QB 4W8JA 3T4HB 2LTNA 3VBRA 2CNAA 5E89A 4FXKB 3O1RA 5LK7B 1UYXA 1YQ5A 2XONA 3Q8EA 1N1YA 2DCJA 2WT1A 4N43A 1NCRB 3IIIA 1UMIA 3PMSA 3QH6A 4W6XA 4XCAA 5FPVA 3HQXA 4Q4Y2 4CA9A 1QJX1 3LA2A 4N53A 1HJGA 2MHFA 4CP0A 1DQ0A 1EAH3 1G9DA 1YCIA 4O65A 5FREA 1SPPB 2E51A 5J1XA 2DCYA 5FMCA 5BNOC 1BMV2 1WMFA 3LGRA 1WCKA 2NMOA 1DGRN 4BB3A 2GH8A 4GMP1 4J25A 4PI2A 4W50A 2GMMA 1GNHA 3LQCA 1RUOA 4LT5A 3KWVA 3LA7A 4XC9A 4YW4A 3GZTB 2WWSA 1PZ9A 4BQ5A 3LIGA 3SH3A 2QNKA 3GCXA 4IQPA 3SCFA 1CIYA 1LULA 5FWEA 5IWFA 1ZBA2 3HN1A 4LUKA 3ZFFB 2G1MA 1CAWA 3LFMA 4IEXA 1U5XA 4MV2A 4LK6A 4XABA 3M7AA 3KQRA 2IXKA 1ULGA 4TYSA 4WBBA 4CCNA 2FZ2A 3ZYJB 4LUMA 2O0OA 3P3PA 4CDQB 2XUEA 4XCBA 3VD5A 1MS4A 1RUE3 2DF7A 1V6IA 5FP9A 2UURA 4WV8A 3RJ2X 5FJHA 3WNMA 3RS6A 3J7MA 5CFDA 4QPIB 4AGRA 5JDBA 5DG1A 1ZZ6A 2WR9A 4AVBA 4A3ZA 3RRDA 1A3KA 4FFFA 1BKZA 4TTGA 4ARYA 4XBNA 2ARXA 4JVAA 1M06G 1UWWA 4MGSA 4MX3A 2XJSA 2VXJA 4G4FA 3ES1A 4D0QA 4YVWA 2PTMA 1CONA 4Q4Y1 1L3JA 2RS53 3OUIA 4NE9A 2VZUA 2O8OA 3MHZA 5KWRA 1AR61 3ZYBA 2VMCA 4ISRA 2F4PA 5CISA 3J7LA 3M8LA 1BVVA 4AVTA 2Y6LA 3KT7A 1UYZA 4META 4B8EA 4EYUA 4V1PA 3LE0A 3W5MA 1JHJA 2VCBA 2X5IC 1UZ0A 4AEDA 3DECA 3WQ1A 3BI3A 1MS3A 1XB9A 3S6PA 1R1A1 4BHPA 2PMWB 3KS7A 2W1WA 2BYVE 2XKPA 4O7XA 5K7PA 3PVOA 4YWAA 4HBNA 2J1VA 2JG9A 4TWTA 3GALA 1R093 2XUMA 3RGBA 2J1SA 5EPAA 3NL1A 4M4PA 4DRVA 4DIQA 3B69A 2ZCWA 3DN7A 3NO8A 4O61A 4XHBA 3VHOA 4FPKA 3WNKA 1IPJA 4XJUA 2VVEA 4OHZA 4R9CA 1HRI1 2XR4A 1QEXA 4M01A 1AR63 3W59A 4A6SA 1MEC3 1K42A 1WW7A 1TMF2 4GKXA 4MOAA 4Y5TA 3D8CA 5FZ6A 3ZMOA 4YGDA 3MZHA 1AYM1 1S2EA 4LBNA 1Q56A 4WVVA 1D0GA 3GZUC 4GKYA 5FFOC 1RJ8A 4DOUA 2FD8A 4XZUG 5BV6A 3F95A 1CD3G 3L2YA 2PAKA 1MS1A 2C9KA 3KD4A 1D4M3 2DDUA 4XUNA 4QXHA 5J96B 2BERA 3NNMA 1TNFA 1QJU3 4I0WB 4LLOA 4Q0VA 4XXPA 4E27A 1RUG2 2D6KA 4CCOA 5A6YA 2ZGOA 5L7OC 3KV4A 4OHXA 1QHDA 1OH4A 2YG0A 1HV1A 1N3QA 4H7LA 1U12A 1QXPA 1X33A 2X8KA 4QPGC 2YYOA 4Y5SA 2WSUA 4UBGA 2CSGA 3ZR6A 4I0BA 4JDMA 4XAEA 3ZDSA 1JZ5A 1F4HA 3FN9A 1VBD3 1ZBE1 3MBWA 3PUQA 1FOD2 1GOGA 3Q9OA 4NMIA 5EXOA 2JD4A 3POWA 3QACA 1ENXA 4IV3A 2BJSA 4K7JA 4BH9A 4YFWA 2D6PA 1GICA 5DZFA 4DZGA 1PX3A 4CPBD 4YM3A 1RVF3 3OYWB 1O6UA 4CDQA 1NLSA 2DCZA 5CFDC 2HBTA 4KWLA 2FQPA 1QY4A 4Q4W3 3WDWA 1TMF1 1RUJ2 1W6PB 4HN1A 4RQPB 5FXWA 1DZRA 2R0HA 3ZYPA 3JZVA 4LBQD 1X9PA 4GWIA 4W4ZA 5J98B 3JBG3 1RVF2 4GA9A 5K4LA 4E8CA 2CWMA 2Z69A 5C4WA 2J1TA 3DEMA 2RMU1 3FJSA 5FO7B 2VMIA 1W04A 1RJ7A 3I3BA 3KV5A 1ULEA 4N7UA 4XF1A 3S30A 1Y4WA 5E1RA 1OQ1A 1D7PM 4UF0B 4IE7A 2H6BA 4LKEA 3T2PA 1MS0A 3RZJA 5A7QA 2VU9A 4PT6A 2P3KA 4I30A 1RL3A 3U1XA 3ZKUA 4CYDA 4GJZA 1FV2A 2QQNA 5ACA2 2ZS6B 2VZSA 2BVBA 4LK7A 5I93A 5LW9A 3VD7A 4HL0A 4Y33A 1MQTA 2BU9A 1YO8A 4IW3A 1YFWA 2DVGA 3T1MA 2V5DA 1QDCA 4PDWB 5K0UC 4P9JA 4LORA 5FZBA 3AKRA 2C6SA 2OXBA 1CPMA 4QX1A 4XXAA 3DYMA 2DWRA 4XMIA 5FUNA 1O91A 3ZPOA 2WA4A 1A78A 1H4HA 4QPGB 5ABJC 5ACA3 5T5JA 4S2DA 3ABZA 4UFMA 4D7YA 3NWKA 2ZKNA 4KBZA 4ES9A 5FYMA 3H8OA 3ZO0B 4A3XA 1GWKA 2R30A 4CDWB 5IVBA 5CVRA 4M00A 4UW5A 5FBZA 3ZSEA 4BXSV 2Y0OA 5AFBA 2W68A 5F5AA 2XJUA 1JOPA 1Q8OA 1Q43A 4E4HA 5FDBA 5JPMB 3UT0A 3O12A 3DPRC 3GBGA 3T0DA 1VBE3 1GOFA 5AVAA 4I3GA 1ZNPA 2XVKA 4E9KA 3S57A 2AUYA 1OLQA 5A32A 4KWJA 3SEEA 2VUCA 3OPTA 4XVHA 5F2WA 3LEMA 3KCCA 1G9CA 2V73A 1QXRA 3SXWA 4M3CB 4LA3A 3KMHA 4Z82A 3WUDA 3HR9A 2R0FA 3C7HA 1JYIA 3BOWA 1Y3TA 2NMNA 3G6JB 5JWPA 5FP3A 3ZLIA 1MEC2 2AH2A 1TME2 1C8M1 1VBB3 3LCPA 1OT5A 3VBHA 1TNRA 4QM8A 5ISLA 1UZWA 5JXIA 2C1FA 2VECA 1GR3A 1OHFA 4HXCA 4CTEA 1BEV2 4D6RA 3CJXA 3IAPA 4WVMA 4UI9L 2BW8A 3D0JA 3LPFA 5GLZA 5GZDA 1HXS1 1G7YA 1WCSA 2ZX4A 2ZXQA 3UV9A 4V2WA 2OIIA 5F37A 3KVAA 4AHWA 5T5PA 3AM2A 3EYPA 3GHNA 4KG0A 2W08A 1OI6A 3IZOA 3PTRB 2B4KA 3W5NA 4XQ4A 4AWDA 1V00A 1V6JA 2E7QA 4PIYA 5FYHA 5JZGA 3RNSA 4ZU4A 1MQTC 4OUMA 5LBFA 4GH4A 2RVAA 1L7LA 3N9QA 4WM8B 3NV2A 3ZXLA 2OKXA 1BK0A 4LHKA 4NIAA 3C2UA 5ABJB 3R4UA 1PVC2 2B5HA 3ZFEC 2IXHA 2JE7A 2O14A 5BNPB 4ASKA 2VMEA 5FOBB 1SHWB 1ZREA 1R081 1KXGA 2EIEA 2Y33A 5BYNA 2A6XA 4AI3A 4FPJA 2PXJA 4D7TA 4YARA 3WQBA 1VBD2 1S0GA 2B45X 2J7MA 3AXDA 4BQXA 1SDDB 2FZ1A 3BTXA 5FXVA 4AEMA 1W6PA 1YNAA 3H0OA 4CCMA 3CEWA 4RR3A 3VLBB 4Z8BA 1VRH1 3GZAA 5C4WC 1J1LA 4BJ0A 2W47A 4LLFA 1OLMA 3AYAA 4CCJA 5C4WB 1WA4A 1LGNA 2E33A 4IE4A 2RE9A 1UF2C 3ES4A 2XXZA 3WVJA 1JXNA 3IDCB 1C8M2 5CEHA 3AMHA 1AL0G 4PI0A 4QPWA 3OPZA 1PMJX 2ZMNA 2Y6FA 4DUXA 3I49A 2XKOA 1CAXA 3USUB 2UWCA 4YLZA 4I2OA 5AC92 4FPFA 5F9TA 3HPNA 1ZA7A 3S5AA 1YJLA 2VTXA 4EV0A 4COUA 4K1YA 4LOTA 3NJVA 5LRRA 3FLPA 4X8PA 2XLAA 1NLRA 4WVZA 1QQP2 5DZEA 5FZ0A 4JKKA 1QWRA 2P34A 5DDJ2 4DXRA 1G86A 2ZMLA 4QB1A 3K4DA 4HPKA 1YHFA 1CZVA 4OHYA 1RIRA 4COYA 2XJRA 3SKVA 5GZFA 3PNAA 3ZXGA 5JPNB 1RUJ3 2VCMA 2IVIB 1O3QA 2BPA2 3OY8B 5A3NA 4GB32 1VBC1 2YB7A 1POV3 1W9TA 3M3QA 1ODMA 5C7GA 1NA1A 2ETEA 2TBVA 3MW4A 2QQVA 2CWSA 1DDLA 2LM3A 3J4UH 2Z2SB 1CN1A 4YW5A 1F4AA 1RMU2 1I3HA 5AFEA 1MACA 5IVFA 3A22A 1ACCA 5DUVA 3IKWA 1SFYA 3AZZA 4LO4B 2D3RA 4NAMA 4LBMA 4XJWA 1UOJA 4ATFA 2HYKA 2QQJA 2RS13 5L9RA 1NQJA 3ME2A 3NJZA 1KJRA 1WCQA 3NNJA 4XF4A 2VNVA 1GQHA 3NJXA 4N43B 1AR71 5JMOA 1QU0A 4L11A 1EUUA 2QVSB 4FI9A 4P02B 4NN0A 1L7RA 4QM9A 4QQ2A 3FBYA 4HLTA 3VBSC 1AR82 4N53C 4DUWA 2VZQA 2HWF3 1RUD2 5FYYA 2WC2A 5DUWA 1WW5A 3KT1A 1RB8G 3VDDC 3W21A 4W6YA 5FMOS 4RGKA 4EN6B 3KSCA 1V6OA 1DGWX 4EWEA 1YWKA 3DYPA 3KV9A 3SH4A 1H6YA 4XFFA 1XU1A 5F6KA 1C4RA 4GH4C 2PLV3 5LCWL 1WMEA 1CAUB 1OA3A 1SG3A 3AZXA 2YC2A 4GH4B 1DG6A 5K0UB 1HV0A 3FX3A 4K8RB 2K46A 2SBAA 2X5IB 2D93A 4F7ZA 1GKBA 4Q4Y3 1HB2A 4ZU5A 4Y24A 4YVSB 2GSYA 3WG4A 4CCEA 2CY6A 4A4AA 3OUHA 1DZQA 2P3IA 3USSA 3GJAA 1Q8VA 2OYZA 3THCA 4B4RA 4CVUA 1BCXA 3HVDA 3VL8A 1XSQA 2JIJA 1SFNA 4WM7B 2BUKA 2DVBA 3WOGA 1V9U3 4YYOA 1ZBE3 1O4TA 4OYUA 1V6KA 4MGZE 1FPN2 1KDMA 2OX0A 3H7YA 4IE5A 1LOGA 2JKBA 3KGLA 4FTSA 3G7DA 1H9PA 4FAGA 5FP4A 1QH6A 1Q8QA 2GMEA 4RR3B 3SKJE 3TWIA 4K3UA 2B42B 2ZGPA 3KB5A 3LWCA 1XRUA 2RS12 3VDCA 3GBFA 3HN3A 1RTVA 2BV4A 1FMD1 3LOBA 3AP6A 3AC0A 4LXLA 3UKTA 1ASJ1 4XBQA 4NIIA 3TN93 3O1UA 3ZFGA 4CP9B 1GP4A 1AR81 3IPVA 4NJ4A 4QX3A 1RUH3 2UYAA 4Y4YA 1H2KA 2WT0A 5EV7A 5C3SA 1LGCA 2VOXA 1KITA 3N7MA 3VBHC 4NHXA 1I1EA 4HKOA 4ASLA 5T5LA 2VMGA 4IGQA 2FCUA 3AVRA 3D5OA 3PVEA 3WLUA 3NSTA 3WW3A 3H8RA 5T3NA 4ATEA 3KCXA 1OLRA 3B3QE 4FXGB 4UW3A 2F6BA 3B9CA 2XVLA 5BUVA 4J1XA 5CAZA 4LBJA 3K75B 5C3QA 1IOAA 2A70A 5FXXA 2JG9B 1V0AA 4HVOA 5FLIA 3JQXA 2DCTA 1X9TA 1XNAA 5C71A 4TZDA 3LKJA 1H6XA 1PX4A 2KM2A 4NUBA 3VKOA 2D6NA 2BGPA 2YBSA 2BEOA 4H55A 3VDBA 4OCTA 1PNFA 4XFCA 3MLLA 1DGLA 1C1LA 4QX0A 1WD3A 5JOZA 4XF9A 1I9RA 1GSLA 1UQXA 1W06A 3K51A 1J59A 4RYDA 1RUH1 3SC7X 4AI9A 2R061 5J09A 1DYOA 2ARAA 3MGUA 4GIQA 4NIGA 2GH2A 4OMCA 3DYOA 4BWOA 2R32A 2BP6A 4YG3A 1SLBA 1UZZA 2OPKA 1S55A 2V5YA 1NG0A 2FMYA 3H8UA 3OBRA 1W8TA 3ECQA 1VPHA 4K1ZA 4Q0QA 2P6HA 2ZPXA 3PMEA 4HZFA 4X6RB 2J22A 1LOFA 5FYUA 1OURA 1WLDA 4A41A 1T2XA 4FPHA 2LW8A 1HLCA 5ANQA 2NZ9A 1VALA 2V4AA 3ILRA 4QX7A 2ZX0A 1TG7A 4YZ2A 1ZRFA 3POIA 2WLQA 3P1IA 1U5IA 2JD9A 2VOWA 5E88A 2WQ4A 2W94A 2QQKA 2VZOA 2VMHA 5A6XA 1COV2 1XQNA 4IV1C 5M0TA 2PHRA 3T3YA 2Y0IA 3P5BA 4DINB 2Y34A 3BU7A 2YGLA 1OLME 2CHHA 1W6OB 3WP6A 3WW4A 4BK4A 2LS6A 1H8VA 5C5UA 1CAUA 2WAOA 3WNLA 4WM8C 5DN2A 3KM5A 4CSWA 1I5PA 1PMIA 3GJBA 1UN1A 4Q1PA 4CEWC 3H3LA 1YFXA 2VE1A 5HPOA 1RYYA 5IAVA 1RUF3 3W20A 4AVAA 2HWF1 2GN3A 3JBG2 2DTWA 1ULDA 1AYM3 4IESA 1DFQA 2WZEA 1ND3B 3PU8A 4QKFA 3JB4C 3KF3A 4LA2A 4COVA 3CLPA 1AZDA 5JXGA 2QTWB 3JB8A 5IW0A 4N90A 1D4M1 2Y6GA 5IVVA 3HJRA 5GLVA 3FFZA 2VVFA 4IE0A 2CAVA 1GANA 4MGQA 3RMXA 2VNRA 1ST8A 3KZ4C 1IKPA 2Q8OA 3VB9A 4Q2FA 1AYN2 1JMUB 4OUEA 3AJYA 3E6CC 4CU6A 4BQ3A 3K48A 2VTXJ 1JN2P 4MGIE 1PNGA 5D8AC 2E53A 1L7QA 2VULA 2VPVA 5JSRA 2WYSA 2YZ4A 2CYFA 3ATGA 3OD0A 5FYCA 4CDXC 2R042 2W5FA 1Q3EA 4JQTA 2GMPA 3SITA 2HEVF 3VBOB 1SBEA 2A6YA 3A4UA 4E2QA 2VUDA 4NOTA 5CFCB 1XXNA 1YC61 3AZWA 2VOKA 1QJFA 5FYTA 1PK6A 3T0BA 5F32A 3HOBA 3NKGA 1LOCA 1NOVA 4IV1B 4Z2WA 1CAVA 3RYRA 1RC6A 2ORXA 1OMIA 5BNOB 1K3IA 2HKXA 3I59B 2PHDA 4RN5A 3AP7A 1W2NA 4Q0PA 4UFIA 4AOCA 2WSVA 4AI8A 1PO23 2GNTA 1FI2A 2JDMA 5CG8A 1DLLA 1WD4A 1N1SA 4BZ4A 3O1TA 1WLTA 4LJHA 1E5IA 2OUJA 5FQ0A 4OVEA 1S0DA 1Z0HA 5C8WA 1ONAA 2W1SA 2BQPA 3S7IA 5L73A 2HH9A 4BM8A 2HWC2 4URAA 5A32B 4OZXA 5FMBA 1RITA 3LZZA 1PM7A 4XURA 2XJTA 1BZWA 1UU5A 2RR13 2JX9A 4EN8B 2ZTNA 4HMZA 1MVEA 1AXYA 3AMPA 3Q8FA 1GBGA 1O7FA 5BNNA 2BVVA 4CPBA 3DKQA 1TME1 2A3WA 2DUQA 4XMAA 3F2ZA 1PIV1 3WD5A 2OW4A 1AJKA 2W0XA 5BY5A 5JUVA 2Y6HA 1B35C 3RFRA 1QQP3 2AENA 2OA2A 3W9AA 4A44A 3GM8A 1LOEA 3WCRA 1ZA4A 2QZ3A 3V65A 4AFMA 1QJZA 3MIBA 1AR92 2GDFA 3UJOA 3KGZA 2WZ8A 3QOPA 3WG2A 4UYBA 2VOTA 4BQ2A 2F4LA 1XNDA 5HXVA 2X05A 4UW6A 5FZ3A 2W9XA 4MO3M 2PA7A 3J8F3 2IXJA 3HT2A 1W90A 4MH0E 4Y1XA 4HKWA 3RYKA 1MZFA 4BISA 2GALA 3C7EA 2HJIA 4WM8A 3KHCA 2ZX1A 5BNQA 3NKTA 4XFBA 3WEZA 4C90A 3JD72 3E6DA 1PZ8A 2ATFA 4JGZC 4Q0SA 5BNPA 3ZN6A 2W2IA 3HIFA 1JW6A 4XZPA 1HQLA 3AKTA 4I01A 3BUCA 3AFKA 1W2UA 3VD9A 4CRQA 2EIGA 1F9KA 1QDOA 4LR4A 4XJ8A 4W65A 5LA2A 2L9LA 1HRI2 2VZTA 4BCUA 1I5ZA 2A6VA 1SLIA 1ZBE2 5CB7A 4QU1A 1H0BA 2FMDA 1KS5A 5GJ6A 4CXXA 1QH7A 4B1LA 2DVDA 2EAKA 1OQDA 1YEWA 1VBB1 2VR4A 3EB7A 5EHDA 2CTVA 3HNMA 4XOGA 3AYDA 3ASIA 4KU8A 5LA9A 4RR3C 4AGVA 1US3A 4XUOA 3T08A 3MDPA 1UAIA 1W8NA 5GLTA 1OFNA 3IM0A 1K5MC 5DUUA 1NCQA 2UY8A 2BOIA 4L8QA 3GHMA 5KHHA 2DFBA 3ZMNA 4AI2A 4FOYA 1GU3A 4P9WA 3ACLA 4TXWA 1FATA 2DV9A 4P00B 1AXZA 2H0BA 4XFIA 1UD1A 4AL9A 3I2HA 1LECA 3LFIA 1W8OA 5I91A 5IYYA 4CE8A 1MVQA 5GZGA 1W6QA 4D7SA 2LALA 2J1AA 1FX5A 1G8WA 2ORZA 2RS32 2V72A 4QXCA 2QZ2A 4HVRA 5KHJA 4YGEA 1YFYA 3ZXEA 1IGOA 3VHPA 5C9AC 1UKRA 1VJ2A 1RUI3 3WHUA 3PURA 4JZRA 1LJ7A 1XNBA 1QKQA 1R083 2C4XA 3NW4A 2ZEZA 1EP0A 3H9AA 5GKAC 3VDDB 1QOSA 1NXD1 4OHVA 1CAVB 3RVHA 3ZIXA 1FOD1 1VMFA 2YV8A 5FZ9A 3AMNA 2AEZA 2ZHNA 1GZ9A 1Y9GA 2WUHA 4UFKA 4LBKA 3POJA 4XJ9A 4XQDA 5J3UA 2OPWA 2MEV2 3DCQA 1EAH2 1N47A 3EHKA 4NR1A 3Q8AA 1EV11 1UY4A 1HB3A 2BNOA 3MIFA 4M3CF 3LB9A 5FUIA 4KWUA 3TB0A 4NO4A 1V6LA 1RINA 2RR11 5FZDA 4FOWA 2HWE2 4K40A 2W52A 4EN7B 2D40A 3DXUA 5C6CA 5A7WB 4R9DA 5A7NA 4OZOA 1ZRIA 1SZBA 1O8SA 2E31A 4JAAA 1S0EA 3U4SA 2IFRA 4V2VA 3MI8A 3OBAA 4GULA 1N3OA 3N7LA 4JV4A 3B02A 3O1VA 2PELA 1HKDA 1DZTA 3WDXA 1DP0A 3FUOA 1D2SA 1YQ6A 3M4FA 5LBCA 4ORFA 2AC1A 4RQPC 4YZ3A 1W28A 2F17A 3WNNA 1F35A 3O1MA 5JVVA 1UW8A 4A7KA 4OUSA 4AXOA 1JOJA 3VBUC 1K5MA 5FCCA 5SV5A 3ORJA 1ZZ7A 4AI1A 3RDIA 3BALA 1UNBA 3E5XA 4YVWC 2D5HA 4EWAA 3ZYFA 5LWBA 2JICA 1MEC1 1NQDA 2JKXA 4IXLA 1WMDA 3TEWA 4UAPA 4BU2A 1PO22 4AQ2A 3HAGA 1ND2A 1VB2A 3ZXFA 1UXZA 1R64A 3ZDVA 4XILA 1DU3D 4CP2A 4BPZA 1BBT3 1KQRA 5K0UA 2XQXA 2R043 4YZ4A 2X5IA 5C9AA 1LB2A 5CU1A 3MLKA 1SDWA 4D69A 2VNOA 3LPGA 4XDOA 1LODA 2E7AA 2IXIA 3H1YA 3LF7A 2G9FA 2ZGTA 4L2NA 3Q8BA 4XQWA 2W95A 3BVCA 3FHIB 2VW1A 2KA3A 2VW0A 1LRHA 1AYM2 1FNYA 3I2JA 4LHNA 4WM7A 2DBIA 3AFGA 2WAAA 4AFAA 2ZHLA 5A1FA 2WFF2 2YC4A 4LITA 5DUXA 3GDBA 3HQUA 5GZCA 3V0BB 1O8PA 2CDPA 1PM4A 4FCAA 2D6OX 1NY72 4YW1A 2A5ZA 2GN7A 2PYTA 2WZR2 1WW6A 3R4SA 4JRAA 2JEMA 4ISQA 1UU4A 2ZGSA 4FPCA 1LR5A 3IB3A 3I3DA 3NRUA 4YFZA 3E6BA 5JR2A 5F39A 4CDQC 2W39A 2ZEWA 1UOGA 2RS52 1JZ8A 3CZUA 4XBLA 3TBDA 3ZFGC 3OSDA 1C1FA 2BRTA 3FZ3A 4JKLA 3FBMA 3T30A 4BOWA 4BLIA 5C5TA 1VIWB 2XLGA 3NNLA 5FLJA 4MYEA 4DEQA 5A6ZA 5DAVA 4CDUA 1C3HA 5DQ0A 3BB6A 1HRV2 3LEGA 1ULPA 2HWB3 2D5FA 2HWB1 2OQ7A 3EQEA 4QWNA 2W1QA 2E32A 1AYN3 3GGLA 2A3XA 4Y1YA 3GNEA 2RG4A 1S0IA 4LNVA 4W6WA 2HYXA 4XAAA 1PVC1 3WUCA 4A45A 2R1DA 1PVC3 2PN5A 1COV3 4PDWC 4N9IA 1FXZA 4SBVA 2IWGB 3A7QA 4LTAA 4FPEA 2W46A 4OULA 2XWJB 4KMQA 1RUE1 4D8MA 4LO5B 3VD4A 1OUXA 3WP4A 1O4YA 4JTNA 3RQ0A 2WO1A 4E4SA 1LHOA 1OH3A 1O3TA 3MFCA 2DUOA 2G9ZA 1YQ8A 5LK5A 3CDZB 4AEDB 2ZACA 3MEPA 5LEJA 4QB2A 5F3IA 4HN0A 1UO9A 4WM7C 1VAMA 5DZGA 3DL3A 3PHMA 4CCKA 2JE9A 1LEMA 3IDBB 4PIXA 3RI8A 5FUPA 3UYJA 4LBQA 2BFUL 4KL1A 4NPRA 2R1BA 1W6MA 1XYPA 1ZM1A 3IT8A 4MXVA 1ZZCA 3RZZA 2GP5A 5A70A 5IVJA 2GAUA 1V9U1 1X7NA 2RM21 5A33B 5KC6A 3OGRA 4N9HA 2JG8C 5FZEA 2WZPP 1W2AX 1NCQC 4BMEA 4Z07A 1RHI2 1FT9A 1XC6A 3VUOA 2Y60A 1AR72 2LRPA 3NAPC 4HETA 3VBFC 3BPZA 1OF3A 4FP2A 3AMQA 5KHGA 3AP9A 1GZWA 2B39A 1HRV1 1J3PA 1QJU1 2XG3A 4OFGA 1GLHA 5JR7B 1W6OA 4NRMA 5T50A 3VKMA 4LIVA 1LHVA 3RWKX 5I8YA 1S0CA 3POFA 4FO9A 2NLRA 4LMFA 3UGFA 4R8HA 3KV6A 3PUAA 4HK8A 1R091 2J1EA 1W0OA 1FPN3 5IT6A 4YW2A 2JDNA 4Q8LA 1OUSA 3ETPA 5C9AB 3BTAA 1UPIA 2XVGA 3IDAA 1G9AA 2XWBB 4P08A 4XEZA 2K0GA 1UKGA 2ZZQA 5L7OB 3HT1A 1WGPA 3C7FA 4FPYA 4A7YA 4UFJA 1LNSA 2IXLA 2YPDA 4QXBA 5FY1A 4ZU7A 5J36A 4LE4A 2Q1ZB 3ITQA 1OXCA 3CO2A 4QQHA 5FZAA 4E2SA 2A6ZA 1IS4A 4PDWA 2XOMA 3LDRA 1VBC3 1W39A 3SLIA 5JZGC 5IFTA 4CU7A 1NZCA 1DQ5A 1RUG3 4ONUA 4PBPA 3V0BA 4FTBA 5D2AA 4GQ7A 2QBXA 2D3SA 3WP3A 2A7AA 3AP5A 5A3UA 3BCWA 2Q1FA 1WCDJ 2Q8EA 4PQQA 4DS0A 1W8ZA 2OZ6A 5E8AA 3U07A 5JLVA 4FVVA 1SCRA 2IFWA 4AVVA 5IATA 5LA0A 1RUD3 2GNMA 1OFSA 1RHI1 1OSGA 2HBUA 2JWPA 1GQPA 2NM1A 4Q5OA 4CDXA 3M3EA 2VZPA 4PBOA 1IPSA 3OEAA 3ZN5A 1GUIA 2NQYA 5LEKA 4MXWB 3AL6A 2VD7A 5DXDA 1PK6B 5JAXA 5KXCA 1IHMA 1QJU2 1W6NA 1JYXA 3AKPA 2ZAAA 1PK6C 4IEUA 1R082 2YBPA 3ZXAC 3PIJA 3MF9A 1JZ6A 1NYWA 3ENRA 1HW5A 3B00A 3E1F1 3QD6A 4P14A 4UF0A 5F1RA 3WDVA 3O0XA 3ZSLA 2H6CA 5B2GB 3VBHB 5EWSA 3X29B 2AYHA 1PVXA 2XL9A 2JDAA 3VZMA 3K2OA 1WLWA 3L9JT 3ZN4A 2ARBA 5LBBA 3WY6A 2R072 4LHSA 3ZFEA 1CJDA 5CG9A 1IZ3A 4QHBA 3TN91 2CAUA 4HSJA 1DIWA 1ZZ8A 1WZXA 3PVNA 3ILFA 1CGPA 1O3RA 1W03A 5KHKA 2WS92 4GD4A 1S2KA 3D6EA 3UNPA 5A3PA 1LOBA 2P17A 2QQOA 1NZIA 1UPSA 4QPGA 3EMRA 2JB4A 2WN3A 5EP9A 5FMDA 1DQ6A 2XJVA 2QKDA 5DAPA 5FIXA 3VGIA 4XUPA 1HN0A 5FY5A 2VQ0A 4CDWA 1OOPB 5I8SA 3CF6E 5FPZA 2VZ1A 2VNGA 1XE0A 3I2IA 4QQOA 4RHV1 4BIOA 4XF3A 2JG8A 2XLFA 5KXEA 2NP0A 3Q8CA 5A33A 3TNQA 5FY0A 1BEV3 1S1AA 1KJLA 2BWCA 3ACIA 2XHKA 3NAPA 2Z79A 1K12A 3DPRB 5DPNA 5FK8A 3WF3A 2J1UA 4M0NA 4FPGA 1ULFA 4DQAA 4QHOA 2WNOA 4KU7A 5F5IA 4ZXEA 3K46A 1UU6A 2G9GA 1OKQA 3K77A 4NAOA 4M3CA 1REFA 5BXXA 2WT2A 3JD71 5EYYA 2E9QA 1H2LA 4L99A 3THTA 3N3HA 1SBFA 4C0BA 5A3MA 1W8UA 4C1XA 2EA7A 2A1XA 5FTTC 3SHRA 1JZ7A 3VD3A 3MUY1 4M4RA 2VQUA 2Y64A 1JU4A 5AC93 3KF5A 2BBVA 4XFGA 4E4DX 3RZLA 3L2HA 2P5BA 1BBT1 1H8TC 4YM1A 1CIWA 4ZS2A 4AAXA 5JZGB 3PL0A 2HWF2 4IDZA 3I2OA 5B4XA 1Y9QA 2XHNA 1C8NA 2VMFA 3QBQA 1HB4A 1GFF2 4IGPA 3SEPA 2J42A 3POSA 4IEVA 4FPOB 4BMBA 5ABJA 2A73B 2YUEA 3TEZA 3WQ0A 2UU8A 2HWE3 3HWJA 3PJYA 4C91A 1JU3A 2YY1A 3POYA 4S2GA 5APAA 5F3EA 3DF0A 3SMHA 1JYNA 1R1A2 2TEPA 1F31A 1VRH3 2GU9A 4RL7A 1G9BA 2D6MA 1AR93 2W3JA 3CL1A 5FP7A 1NA1B 5I8TA 4QPIC 3WP5A 4AFCA 4AK3A 1ZZ9A 4Q4V1 3RZGA 1ENRA 1JI6A 4Q4X1 1UY3A 1HJFA 4AAPA 1POV1 4PLMA 1TME3 5KBFA 3H3UA 4MLOA 3T0AA 1MZ6A 1ODNA 4QGLA 5EJ1B 1BK1A 4XF0A 1O4ZA 1MS9A 3B94A 3VDDA 3WINE 3VHRA 1X50A 1W3VA 4YW3A 1ALYA 4ASMB 4QAWA 3NMBA 4CXYA 1LHUA 2W92A 4OQ8A 2WRAA 1HB1A 3CQOA 2WO7A 3IIAA 4LKDA 1GWMA 2V4VA 5GALA 4XJAA 1RUF2 2ZGRA 3OGSA 2WNUC 2P3YA 4QGMA 4RSUA 5CFCC 4BK5A 4DUVA 2B9VA 3K4ZA 5FLHA 2PLV2 3FC0A 1H2MA 4QXKA 1PO13 3WT3A 1S0BA 2PHWA 4QDQA 3T4VA 3CKHA 4CUAA 5LASA 2DVAA 4AG4A 3MW2A 5FO8B 2XMLA 4IERA 5HXMA 4Z1VA 5D21A 3VV1A 2JXAA 3BKZA 2I45A 4L92A 1RUG1 1W9YA 1VBD1 4IEQA 5IK5A 2D98A 1QJEA 2EF6A 4Q29A 4XIKA 4DXSA 1WBLA 4Y4RA 4Y22B 4XFAA 1JBCA 1SLTA 2TNFA 2XBO3 1OOPA 4TLGA 4XTPA 4NHMA 1SLLA 1JZ3A 3M3OA 1VLNA 4P9YA 5D1IA 2LUWA 1D4VB 3NVCA 1GNZA 3VBUA 4YZ1A 3WDTA 2AGSA 4QX2A 3LSEA 4FP3A 1BMV1 4Y20A 1UX6A 4NVPA 1HXS3 3VBRC 3I7DA 2RV9A 5FY9A 3AB0A 1IS3A 1N3PA 3I3EA 1KDKA 4ZY9A 4LO6B 1OVPA 3GXUA 2VO5A 4D94A 4DRRA 3ST7A 5HV4A 4IUGA 1LOAA 1P8JA 2YC0A 3A21A 4HG6B 1A8MA 1ENSA 3VBOC 5DDJ1 3WR0A 1URXA 5I0DA 3ROUA 1QMJA 3IN9A 4DB5A 4S2HA 5AVPA 2YDEA 2VMDA 1RVF1 2AREA 2DFCA 1RXGA 3DUIA 5T52A 3LEKA 4YM0A 2X09A 1JTZX 3IPVB 4ZXKA 4XUTA 5A1LA 2WFF1 1BXHA 5IFPA 1SCSA 1XOYA 3R4DB 3N35A 3WDUA 2FDJA 4LEJA 4PCRA 3TYJA 1GP6A 3V64A 4P9GA 5IAXA 2WL1A 3JXSA 1O3SA 2WO2A 2EXKA 2J1RA 3OJBA 3ZXJA 4MUVA 2WZR1 4UWDA 3HNYM 4BE3A 3V0AA 1BLZA 2VCCA 5FKCA 3NNFA 2EXJA 3MLJA 4BIFA 1CPNA 1YI7A 4L0PA 3PVBB 1ND3C 1CZSA 2VZRA 1IG0A 2A75A 2QJVA 4YVSA 4PIZA 5FWJA 3R6SA 4U2AA 4LE3A 4UXAA 1VAVA 2CGOA 5FZOB 4Z2AA 1W0PA 1DYPA 3FHQA 5LA1A 2P37A 4GAZA 2WJSA 3RJRA 3N4MA 2WQ8A 4IEZA 4R52A 4RGAA 3PU3A 3U14A 2WNVC 3BIWE 3C7GA 4IEPA 4LPLA 3ZOIA 4K6BA 4GALA 3CJIB 4YRDA 3UL2A 4LBLA 4YGBA 1YYNA 2R063 5J37A 2ID4A 2JDHA 2PQQA 5ACA1 1DYKA 5F7UA 2JIGA 2RDNA 3J7HA 4AE2A 3HEIA 3KT4A 1FAYA 2FBEA 2QQUA 2X10A 1F5FA 3S7EA 1GMMA 1GWLA 3OD4A 2WNUA 4CP9A 5JI7A 1NUKA 5FPLA 3ZXKA 4PQ9A 3PUHA 2BZDA 3OGJA 3VBSA 4CP1A 4UOJA 2B8MA 5E6HA 5FAXA 3WV6A 2R073 1S0FA 2RDQA 4JGZA 4PF1A 5K8SA 4PHZA 1PGL1 2YMZA 1RGSA 4FOVA 5GZEA 5JIUA 5SV8A 4P9IA 4RS5C 2ZZJA 4COWA 2UWBA 1GOHA 2MNGA 1EAH1 4I09A 4INDA 5CIRA 1XBFA 1UL9A 2AEYA 2E26A 5C3RA 1W2OA 2VQTA 1OF4A 1Z7S1 1AR62 3LEIA 2NPIA 1DGRA 1PO12 3NQHA 4B4QA 1YI9A 3ELNA 2ZABA 1H8TB 2SLIA 3CMGA 3J9SA 2JDPA 1WLCA 2B7YA 1JUIA 1RUD1 2CGNA 4IL7A 4WVWA 3RG0A 5IJRA 1RUNA 3ILNA 4AHXA 2ET7A 5EYXA 1N1VA 3WG1A 4HKLA 3FHAA 3MIGA 4P5HA 3ZPYA 3ZYIB 2WLPA 1QJY3 3POGA 1AJOA 1QJY1 1YJKA 3SCGA 1ND3A 1KRIA 5D8AA 5K9YA 3WG3A 2HEYF 4JGYB 1OD3A 3D3AA 4QDSA 3VBRB 5F8PA 1UYYA 3ON7A 5FBJA 1HQNA 1DF0A 1EY2A 2IXCA 1CZTA 5CADA 2D6LX 4NWWA 1DQ1A 5EIYB 3I97A 3H8XA 1WA6X 1MS8A 2WNVA 3B9IA 3PIGA 2Z5WA 2ZMKA 4N53B 4XJZA 4AHZA 3VZOA 1F15A 2YU2A 4BLJA 5L7OA 4GMP3 4FTEA 1VRH2 2MEV1 5JSOA 3BYWA 3M3CA 2MEV3 4NWVA 1C28A 2ZHKA 1REEA 1QGLA 5TSWA 3PDQA 4BDVB 1FPN1 2V09A 3OB8A 1PGL2 1HX6A 3I2GA 3U75A 4CEYC 3CNAA 3WQ7A 2W1UA 1CR7A 2VBBA 2X53S 2ZHMA 5CFCA 5KHIA 3LDKA 4L9BA 1UMHA 1RUI2 2Q1MA 1WBFA 1V6NA 2R062 3VHNA 4GMP0 1FMD2 5ERLA 3HBKA 3RZHA 5FO9B 1UIJA 4IV3C 4QKNA 3I2KA 5BNOA 5CNAA 3ZFFA 4DMIA 3TEXA 1DGWA 2RJKA 2GC1A 2RMU2 3EXUA 1VR3A 4XYXA 4ZKTB 2C0ZA 2XBO1 3ZR5A 5IHRA 1ZX5A 2UYBA 3OBTA 4F3JA 3FWEA 1D0HA 1W0NA 1LTEA 1OA2A 1QJY2 2VZVA 5FQ0B 5HCAA 5CFDB 4QU2A 1B09A 1KEXA 1Z7S3 4K8FA 5FR3A 2ZGNA 4LULA 3K3NA 4XPVA 1NLQA 1W6NB 4AZZA 4QQPA 2FDIA 2RS51 3CJIC 1WMXA 1DQ4A 1Q8PA 4EJRA 4AHYA 4F8AA 1EV13 2EAAA 1RMU1 2ADEA 5FZ7A 1PHMA 3HD8B 2DURA 4F83A 4NHLA 1GZTA 3HNBM 1VRBA 4YVWB 3K4AA 1EUTA 2ZOEB 3T2OA 1D2QA 4BA6A 2R49A 1YRZA 1RUH2 2XJPA 2HWB2 3ACHA 5FYIA 1LGBA 1A6CA 3VBSB 1ZYBA 2AR6A 3PJQA 4B3NA 3VBOA 5LRSA 4XHXA 3KLSA 1CVNA 4H3WA 4RGGA 5GLUA 4UT5A 2YFUA 4XTMA 3UGGA 2VUAA 1LU1A 3H1MA 5LB6A 1J58A 1H30A 1RUI1 5CA6A 2VJXA 4IV1A 5HCFA 4QB6A 3OGGA 2BOJA 1OVSA 3BGAA 1SLCA 2GNBA 5IVCA 3HMYA 4AFBA 1EYBA 3AXEA 4DFSA 3J8F1 3O1SA 1IPKA 3JCIA 5A3WA 1UY2A 3QLQA 3WSOA 3WW1A 3ZN6B 4A6OA 2W91A 3BODA 4PF5A 4CEWA 4YSFA 3I3MA 1ENQA 1CWPA 1AX2A 4BQ4A 5T55A 3OCPA 4A7ZA 3DPRA 3BN6A 1WUVA 3ZFFC 4OI4A 1VBE1 5FKBA 4ZZ8A 1XYNA 4RHV3 1KD7A 2RDSA 4JGYA 2JECA 2E7TA 4AQ6A 5IK4A 3APBA 4RA0A 1JYWA 4D6SA 1Q8SA 1W9WA 3SQOA 2AZ5A 5FV3A 2FCVA 4LKSA 1VAKA 1NCQB 5C8CA 5CZKA 2WNVB 3AL5A 2JB8A 4AGGA 4MZUA 3BOPA 1T6BX 3B01A 4FOQA 3H1WA 2VTFA 5EQUA 3T2QA 3ZYRA 3NV3A 4LBOA 1W6QB 5KXDA 2OT7A 3AYCA 1A8DA 1LCLA 2Y6KA 5FZHA 1LAJA 4LO8A 4XUQA 1UZYA 2VG9A 1ND2C 5FPXA 4UW4A 2VUJA 1MR5A 5L19A 1TZOA 1NCRC 3CIHA 2YPJA 5IK8A 4MSVA 4QQLA 2AACA 4XACA 3ZYHA 2A3YA 5JXJA 2RJLA 1BEV1 3MIDA 1GYKA 4Y26A 3NV4A 2IC1A 3AK0A 2R16A 4IV3B 2FHRA 1HXS2 1JUHA 1AL21 2LROA 5EJ3A 5A7SA 1T6GC 4K20A 1AUYA 5L9BA 3UESA 4D3WA 3OYWA 4P9LA 1OBNA 1AXKA 1PO21 2P4EA 3ACGA 2VCAA 1RUC1 5A80A 3ZKYA 4GWNA 2Q5TA 3JD73 1H1IA 1SBDA 4RQPA 5FP8A 5FZKA 3UKVA 1AR73 2D43A 1SEFA 4JKMA 3GBWA 4UBHA 2C5DA 1AR91 5A7WA 5LBEA 4KWKA 4ZHNA 5J7MA 3VBFB 5FJKA 5FPAA 1K5JA 1GP5A 5BPXA 4Q4W2 4M0HA 1VB4A 2UWAA 5ANNA 1J83A 5FK7A 1YQ2A 2ZGMA 5FZ8A 2OQ6A 4JGYC 2WKKA 3MPPG 2D7FA 4JTOA 2EXHA 1SQ4A 1B35A 2WNEA 2PQSA 3WCSA 1JH5A 1OQEA 1PMHX 3I3QA 4I0AA 4R4XA 3WF1A 2BDRA 3E5QA 5DG2A 1W8WA 3SH5A 1BJQA 2N7GA 2X29A 1FOD3 2PHXA 2VW2A 2Y8KA 4KGQA 5A3OA 5FMOL 3WF0A 4B7KA 1KFUL 3GCWA 2G4IA 2W87A 1V6MA 3WF2A 1QXJA 1ND2B 4CZSA 4B29A 1PIV2 1C5HA 5FOJB 3QH7A 1HQWA 2IUWA 2ZX2A 4JDOA 4YG6A 5KC5A 4CEYB 1S0JA 4Q4X3 3K3OA 5GLWA 4KI5M 2VOVA 5AC91 4YG0A 5KR7A 1S4CA 3A0KA 1OPOA 2ET1A 1EPWA 2P1BA 2Q8DA 4AEDC 4CEWB 1SLAA 2ERFA 4D6QA 2ZEXA 1WW4A 2XB6C 1XE7A 1DLCA 1IS5A 1MZEA 1PGSA 1C57A 2Y38A 2YBKA 3RWNA 1UMZA 5KXBA 1NX9A 4HANA 1BQPA 3RZMA 3PUSA 2ZA9A 1FNZA 1LENA 1C8M3 4J6GA 4OHWA 4OI1A 3JBG1 2G19A 4BQYA 3R05A 1O59A 4ET7A 1H1MA 1NAEA 3CBNA 3GZEA 2QDNA 3H3ZA 5C8CC 4S2FA 4FAHA 3D0SA 3U37A 1UCXA 3UETA 3AZVA 5I0RA 3WW2A 1D4M2 2NYYA 2YROA 3U10A 4DXTA 4FBFA 2VBDA 2BNNA 4BQ1A 4WVMB 2RM23 4ITCA 3VKFC 3BTZA 1LKNA 4J1WA 4AI0A 4JHTA 4LHLA 4XETA 1OA4A 2DU1A 5LATA 2P6CA 4FQ4A 1VBB2 2CV6A 4KH9A 2Y26A 2PAMA 2NN8A 1O5UA 2GNDA 5IVYA 3P6BA 4AYUA 3N36A 4SLIA 3AYEA 4UFHA 2WS91 4AQTA 3V0AB 1ULCA 3SCHA 4QHZA 2EIDA 5JI9A 4BQWA 4FFIA 5IK7A 1XYOA 2WA3A 2EALA 2CGPA 1E5HA 4XIOA 4ZPIA 1IKQA 2D44A 2YFZA 3RPQA 3AX4A 4QKBA 4LO7A 1UZVA 5F5CA 4Y3OA 4DNYA 2RJ2A 4Y1ZA 2VL4A 1JODA 2EICA 3KCYA 3ZVXA 1EPZA 2XGXA 2ZJCA 1NKGA 2XJQA 4EN0A 4EN9B 5FYZA 4YPJA 4DXZA 4NRQA 4QT6A 1V70A 4OI2A 3I4IA 2OS2A 5DAQA 4P9XA 3J7NA 3MICA 4COZA 4NHKA 1AHSA 3EJKA 5IUQA 2HEWF 2Q4SA 4H7MA 5DAXA 3J26N 3VBFA 4HT1T 1R1ZA 2VVDA 1AL23 3KVBA 4RFT0 2PHUA 1KGYA 2VZ3A 3TOJA 1UX7A 4AF9A 1FV3A 4HSLA 4Q4X2 4TN7A 5JCTA 2BWAA 1JZ2A 3V56A 3QCWA 2GZWA 2C24A 3B7MA 3OBZA 1AR83 5C33A 2VY0A 3FLTA 1B35B 2R7EB 3MIEA 2DCKA 3W58A 1CAXB 3USUA 3BU0A 2XDVA 1OKOA 4ARXA 2A71A 1VE0A 5JIAA 3H50A 5JXHA 2I07B 4EWDA 5F2SA 3EBRA 4BXFA 1TE1B 1RMU3 5C3PA 2WQZC 2GP3A 1LU2A 4CDUB 4CU8A 5H9SA 1IQAA 4QDRA 2VGDA 4M3CE 4EZHA 5C70A 3ZXDA 1Y7BA 2C26A 3FUQA 3HBZA 5G04L 1STMA 1XSRA 3C3VA 5T5OA 2E63A 1RUF1 1ASJ2 2Q30A 2WDBA 2WFPA 1SFPA 4HPKB 5CKNA 2Y6JA 3S0MA 2K2SA 1E57A 3MV11 1W3XA 1POQA 3LIHA 1H8TA 3TRSB 2O1QA 1NCRA 1F5JA 4WZCA 2WFF3 1E5RA 4AVSA 5CKQA 2JDKA 2OUHA 4CUGA 4AQSA 2XPJA 4QD2A 4AFDA 1TVGA 3U4XA 1H2NA 5A7PA 3RI9A 1QJX2 2GC3A 3LOIA 1QOOA 5F6LB 1VBA3 1JOBA 2WZR3 1UOFA 3M3IA 1O5LA 1YIPA 4CCDA 2OVUA 2C9AA 2CU5A 4MHRA 4Y1VA 2RMU3 3AKQA 3ZYGA 1JYTA 4JHZA 4R9BA 2QUOA 4AEKA 3U0ZA 4E2GA 4G3YC 3B93A 2BGOA 1VMHA 3UK9A 3VKNA 2CL2A 2ZKLA 3N9LA 1WWYA 2XL7A 3ETQA 4XDQA 1YQCA 3POBA 3N9OA 2JDYA 4NHYA 3THPA 4FT8A 2DUPA 2QQPA 3JQWA 3ZSMA 2VBPA 4LBQB 1KS4A 1W6MB 4C1WA 3EO6A 2PHLA 5A1AA 4GWJA 3NV1A 1DHKB 1CAWB 3VN4A 3TN92 3DKWA 3VL9A 1R1A3 3ZIWA 4JX0A 1Q5OA 2PAEA 1LEDA 3NJYA 3OTFA 2PLV1 1F2NA 1YIFA 2P3JA 4GJYA 4EZ4A 1DQ2A 4CDXB 2ZGLA 5L9VA 4FFGA 4FFHA 2B46X 1GZWB 5FRAA 1NY71 4CDUC 4DEVA 1XU2A 1FYUA 2KXLA 1AX1A 3IDEA 3E97A 4HK9A 1JYVA 4BYYA 4C8DA 3ZM8A 1CJPA 3N7JA 5A3LA 3I54A 1AYN1 2FCTA 4JRLA 4Q26A 3MIHA 5JOWA 3BPSA 5HI0A 4H2AA 2P2KA 1U5YA 1ZVFA 1U0AA 1COV1 1AF9A 1QJX3 3VZLA 4B4PA 4CDWC 3ZFEB 4NPLA 5FZFA 2WWUA 5A7OA 3UKNA 3LAGA 1RXFA 4CU9A 2ZGUA 4I3PA 3ZX7A 4CUBA 4DY5A 4O9GA 1ASJ3 4NROA 5FY8A 2DVFA 3CZJA 5F3CA 4OQ9A 4LKFA 1CESA 1HN1A 1UOBA 1XJAA 2HWD2 4XFHA 1JHNA 2ZAHA 3O5SA 3ZFGB 1E5SA 1GNYA 1NE6A 1W8HA 2JG8B 3P3NA 4E4ZA 1H4GA 4RD7A 1YXWA 1M4WA 3ALQA 4QMAA 1X8EA 2QDRA 3NAPB 5F5QA 1Y43B 5FZMA 5FZ1A 4ZS3A 4LIUA 4MXWA 1CX4A 4KG8A 5DABA 5FZCA 5LY1A 4R4ZA 3FL7A 1A34A 3M1HA 1HIXA 3MF6A 1J3QA 1GV9A 5EFUA 1FMD3 2WS93 3O7OA 5FZGA 1US2A 3VZNA 1LESA 1I6XA 4PLNA 3H42B 1JZ4A 4R9AA 4A42A 3OF1A 1X8MA 1J3RA 2YXSA 5JOXA 4YW6A 3T09A 5JOYA 4DY3A 4OI0A 3N7KA 4Q0UA 1V9U2 3R0RA 5IVEA 4Q4V2 4Y1UA 1C5IA 3POEA 2FDGA 3LSDA 1G9FA 2RS11 2H0VA 1S2BA 4KQ7A 4OLLA 2GC0A 3E5UA 3RYPA 4L97A 2K9ZA 1IG3A 3AZYA 3A23A 2PFWA 3FE5A 4O9EA 3IMMA 4CCLA 3OOXA 2ARCA 1Z7S2 3AMMA 4YW7A 4FSJA 1F8VA 1PO11 2E6VA 4YVSC 4YGCA 4NIDA 3SNMA 1MPXA 1ZRCA 1W2TA 3AP4A 1W8FA 5BNNC 5DDJ3 2B9UA 3S5QA 2QQWA 3UJQA 4EE2A 3C7OA 1OC1A 3O1OA 3KHBA 3GF6A 2Q0AA 4IE6A 1Y9MA 5J48A 2ILMA 2JJ6A 4NPMA 3N9MA 4N7IA 5CKMA 5A6QA 5I0UA 1JYCA 2DU0A 3DGTA 1ZBA3 1QNYA 5C8CB 3THDA 4IEWA 3RZKA 2QQLA 3LA3A 4GB31 5FZIA 4AR2A 3FFQA 2FDHA 2ZGKA 5EJZB 2HWD1 3WF4A 4KNCA 1AVBA 2TUNA 1X82A 3I2DA 3JU9A 3OUJA 1VBA1 1VMJA 3OPWA 1NT0A 4MGYE 4WZFA 2RS33 2QQMA
chains in the Genus database with same CATH topology
4I02A 1VP6A 4Y5Z0 2ZGQA 5JSPA 1QOTA 1IS6A 3GYDA 1SACA 2D97A 1RUJ1 2VXRA 3WZ1A 1GQGA 1N1TA 1AL22 4RS5B 1TQ5A 2Z42A 3SISA 3ZSJA 2BFUS 3WXPA 3I59A 3MYXA 5JMCA 2HWC3 1QQP1 1ZRDA 2D3PA 1OPMA 4Q8KA 4JDNA 3WNXA 2O8QA 3JUUA 2PHTA 3M70A 4X8NA 1MQTB 4YM2A 3URFA 2RS31 1VBC2 4MVTA 3VKLA 2XBO2 4Q27A 3T2TA 3IBMA 1RUE2 5H9QA 2MPFA 3VZJA 1MZ5A 2RHPA 4XE9A 4K9SA 2WINB 2GC2A 4Y22A 3D82A 3ZSKA 1NE4A 1SMVA 3AKSA 1ZZBA 2BTVC 1HDKA 2I2SA 3MW3A 4GXLA 4PJYA 4HVQA 3B5LB 4K21A 3H7JA 4KBBA 3PLQA 1VBA2 1LHWA 2JDZA 1REDA 1XNCA 1EV12 2EXIA 3TAYA 1YFUA 2RR12 4GB33 3MFAA 4AW7A 1LHNA 1GZCA 1POV0 1RHI3 1RUC3 3MPBA 4H14A 5L36A 4IEYA 1CQ9A 1BBT2 1BYHA 4B7EA 3INAA 4CEYA 1PZ7A 4RHV2 1H1AA 2BGCA 3VZKA 4TSVA 2QE3A 3A0NA 4AEJA 1BVP1 1PGW1 3O0VA 4YNIA 4URTA 5I0SA 1R092 3FMGA 3D4KA 3PTYA 2ZBJA 3WHTA 2JG9C 2WIIB 4C0HA 5BNNB 2RM22 2R041 1HRV3 1X36A 1APNA 2JENA 1U5ZA 1TMF3 4G9SB 1YUDA 4QPYA 1G6NA 1XE8A 1ZRRA 4Q1RA 1DBNA 2ZX3A 4DPNA 3WX5A 2HWE1 2DTYA 4U36A 1MS5A 4FQZA 1HRI3 3IWZA 2QCSB 2QFEA 4KGGA 5H9RA 2PHFA 3VBUB 3U11A 3AJZA 4QPIA 4Y20B 2ES3A 4HFSA 4Q4V3 2DYCA 4N43C 5I0TA 3IMNA 4TLFA 5CBLA 4AVCA 2YGMA 1J1TA 1LOFC 3O0WA 1PIV3 3RMYA 4PLOA 5FO8B 5LEJA 4IETA 2HWC1 2EVXA 5E16A 1XNKA 2ENRA 4RS5A 4Z92B 3M2MA 1QNWA 5EZWA 3T1LA 2HWD3 3J8F2 1TEIA 4FPLA 4EROA 3DV8A 2WNUB 4MGKE 2BNMA 2OZJA 1PGW2 4QX5A 4A2UA 1UIKA 2R6QA 4JGZB 2UY9A 1VBE2 4ES8A 4JC1A 1OD5A 4JQRA 3TNPB 4QGNA 1AX0A 4YZ5A 5BNPC 3I8TA 2R071 2XH6A 5H9PA 1H9WA 3FLRA 1RUC2 1QF3A 4GWMA 2A6WA 2VH9A 3O14A 4JCKA 3RSJA 1ZBA1 1Z78A 3CU7A 3OY8A 5HCBA 1NA1C 1YLLA 2VQAA 1OOPC 2I74A 3WDYA 1KFXL 5GM0A 2YHJA 5T54A 1K5MB 4IEOA 4XW3A 4Q4W1 1NXMA 5D8AB 5HBAA 3CJIA 2IZWA 4X6QB 2LTNA 3VBRA 2CNAA 5E89A 4FXKB 5LK7B 1N1YA 2DCJA 2WT1A 4N43A 1NCRB 3QH6A 3PMSA 4W6XA 3HQXA 4Q4Y2 1QJX1 3LA2A 4N53A 2MHFA 4CP0A 1DQ0A 1EAH3 1G9DA 1YCIA 5FREA 2E51A 2DCYA 5BNOC 1BMV2 1WMFA 3LGRA 1WCKA 2NMOA 1DGRN 2GH8A 4GMP1 2GMMA 1GNHA 1RUOA 4LT5A 3LA7A 4YW4A 3GZTB 2WWSA 1PZ9A 3SH3A 2QNKA 4IQPA 3SCFA 1LULA 1ZBA2 3HN1A 4LUKA 3ZFFB 1CAWA 4IEXA 1U5XA 4MV2A 3M7AA 3KQRA 2IXKA 1ULGA 4TYSA 4WBBA 2FZ2A 3ZYJB 4LUMA 2O0OA 3P3PA 4CDQB 1MS4A 1RUE3 2DF7A 1V6IA 3RJ2X 2UURA 4WV8A 3RS6A 5CFDA 4QPIB 4AGRA 5JDBA 5DG1A 1ZZ6A 4AVBA 3RRDA 1A3KA 1BKZA 4XBNA 2ARXA 4JVAA 1M06G 4MX3A 2XJSA 4G4FA 3ES1A 4YVWA 2PTMA 1CONA 4Q4Y1 1L3JA 2RS53 2O8OA 5KWRA 1AR61 4ISRA 2F4PA 3M8LA 1BVVA 4AVTA 3KT7A 4META 4B8EA 4V1PA 2X5IC 4AEDA 3WQ1A 1MS3A 3S6PA 1R1A1 4BHPA 3KS7A 2XKPA 2BYVE 5K7PA 3PVOA 4HBNA 2JG9A 4TWTA 3GALA 1R093 2XUMA 3NL1A 4DRVA 3B69A 2ZCWA 3DN7A 3NO8A 4XHBA 3VHOA 4FPKA 1IPJA 4XJUA 2VVEA 4OHZA 4R9CA 1HRI1 4M01A 3W59A 1AR63 1MEC3 1WW7A 1TMF2 4GKXA 3D8CA 3ZMOA 4YGDA 3MZHA 1AYM1 4LBNA 1Q56A 4WVVA 1D0GA 3GZUC 4GKYA 5FFOC 1RJ8A 4DOUA 5BV6A 1CD3G 3L2YA 2PAKA 1MS1A 3KD4A 1D4M3 5J96B 4I0WB 1TNFA 1QJU3 4Q0VA 4LLOA 4XXPA 4E27A 1RUG2 2D6KA 5L7OC 2ZGOA 4OHXA 1QHDA 1HV1A 1N3QA 4H7LA 1U12A 1QXPA 1X33A 2X8KA 4QPGC 2YYOA 2WSUA 4UBGA 4I0BA 4JDMA 3ZDSA 1VBD3 1ZBE1 5EXOA 1FOD2 3Q9OA 2JD4A 3POWA 3QACA 1ENXA 4IV3A 4K7JA 4BH9A 4YFWA 2D6PA 1GICA 5DZFA 4DZGA 4YM3A 1RVF3 3OYWB 4CDQA 1NLSA 2DCZA 5CFDC 4KWLA 2FQPA 1QY4A 4Q4W3 3WDWA 1TMF1 1RUJ2 1W6PB 4HN1A 4RQPB 1DZRA 2R0HA 3ZYPA 3JZVA 4LBQD 5J98B 3JBG3 1RVF2 4GA9A 2CWMA 2Z69A 5C4WA 3FJSA 2RMU1 5FO7B 2VMIA 1RJ7A 3S30A 4N7UA 1ULEA 4XF1A 5E1RA 1OQ1A 2H6BA 1MS0A 2VU9A 2P3KA 4I30A 1RL3A 4CYDA 1FV2A 5I93A 5ACA2 2ZS6B 2BVBA 4HL0A 1MQTA 3T1MA 1YO8A 1YFWA 2DVGA 1QDCA 4PDWB 5K0UC 4P9JA 3AKRA 1CPMA 4XXAA 2DWRA 4XMIA 1O91A 2WA4A 1A78A 1H4HA 4QPGB 5ABJC 5ACA3 5T5JA 4S2DA 4D7YA 3NWKA 2ZKNA 4ES9A 3ZO0B 4A3XA 4CDWB 2R30A 5CVRA 4M00A 4UW5A 5FBZA 3ZSEA 5AFBA 2Y0OA 2W68A 5JPMB 2XJUA 1Q8OA 1Q43A 5FDBA 3O12A 3DPRC 3GBGA 1VBE3 5AVAA 4I3GA 1ZNPA 2XVKA 4E9KA 2AUYA 1OLQA 5A32A 4KWJA 1G9CA 3KCCA 2V73A 1QXRA 3SXWA 4M3CB 4LA3A 3KMHA 4Z82A 3WUDA 3HR9A 2R0FA 1JYIA 3BOWA 1Y3TA 2NMNA 3G6JB 5JWPA 1MEC2 2AH2A 1TME2 1C8M1 1VBB3 3LCPA 3VBHA 1TNRA 4QM8A 2C1FA 2VECA 1GR3A 1OHFA 4CTEA 1BEV2 3CJXA 4WVMA 2BW8A 3D0JA 5GLZA 5GZDA 1HXS1 1G7YA 1WCSA 2ZX4A 3UV9A 2OIIA 4AHWA 5T5PA 3AM2A 3GHNA 4KG0A 2W08A 1OI6A 4XQ4A 4AWDA 1V00A 1V6JA 2E7QA 4PIYA 5JZGA 3RNSA 4ZU4A 1MQTC 4OUMA 4GH4A 4WM8B 3NV2A 3ZXLA 4LHKA 3C2UA 5ABJB 3R4UA 1PVC2 2B5HA 3ZFEC 2IXHA 2JE7A 5FOBB 5BNPB 1ZREA 1R081 1KXGA 5BYNA 2A6XA 4AI3A 4FPJA 4D7TA 4YARA 1VBD2 1S0GA 2B45X 3AXDA 2FZ1A 4AEMA 1W6PA 1YNAA 3H0OA 3CEWA 4RR3A 3VLBB 4Z8BA 1VRH1 3GZAA 5C4WC 1J1LA 4LLFA 3AYAA 5C4WB 1WA4A 1LGNA 2RE9A 1UF2C 3ES4A 3WVJA 1JXNA 3IDCB 1C8M2 3AMHA 1AL0G 3OPZA 2ZMNA 2XKOA 1CAXA 3USUB 2UWCA 4YLZA 4I2OA 5AC92 4FPFA 5F9TA 1YJLA 4EV0A 4COUA 4K1YA 5LRRA 3FLPA 4X8PA 2XLAA 1NLRA 4WVZA 1QQP2 5DZEA 1QWRA 2P34A 5DDJ2 1G86A 2ZMLA 4HPKA 1YHFA 4OHYA 1RIRA 4COYA 2XJRA 5GZFA 3PNAA 3ZXGA 5JPNB 1RUJ3 2BPA2 1O3QA 3OY8B 4GB32 1VBC1 1POV3 3M3QA 1NA1A 2ETEA 2TBVA 3MW4A 2CWSA 1DDLA 2LM3A 3J4UH 2Z2SB 1CN1A 4YW5A 1RMU2 1I3HA 5AFEA 1MACA 5DUVA 3IKWA 1SFYA 3AZZA 4LO4B 2D3RA 4LBMA 4XJWA 4ATFA 2HYKA 2RS13 1NQJA 3ME2A 3NJZA 1KJRA 4XF4A 1GQHA 4N43B 1AR71 1QU0A 4L11A 2QVSB 4NN0A 4QM9A 3VBSC 4QQ2A 3FBYA 4HLTA 1AR82 4N53C 2HWF3 1RUD2 2WC2A 5DUWA 1WW5A 3KT1A 1RB8G 3VDDC 4W6YA 5FMOS 4EN6B 3KSCA 1V6OA 1DGWX 4EWEA 1YWKA 3SH4A 4XFFA 1XU1A 5F6KA 1C4RA 4GH4C 2PLV3 1WMEA 1CAUB 1OA3A 3AZXA 4GH4B 1DG6A 5K0UB 1HV0A 3FX3A 2SBAA 2X5IB 2D93A 4F7ZA 1GKBA 4Q4Y3 4ZU5A 4Y24A 4YVSB 2GSYA 3WG4A 2CY6A 1DZQA 2P3IA 3USSA 4B4RA 1Q8VA 2OYZA 1BCXA 3VL8A 1SFNA 4WM7B 2BUKA 2DVBA 3WOGA 1V9U3 4YYOA 1ZBE3 1O4TA 1V6KA 4MGZE 1FPN2 1KDMA 3H7YA 4FTSA 1LOGA 2JKBA 3KGLA 3G7DA 1H9PA 4FAGA 1QH6A 1Q8QA 2GMEA 4RR3B 3TWIA 4K3UA 2B42B 2ZGPA 3KB5A 3LWCA 1XRUA 2RS12 3GBFA 1RTVA 1FMD1 3LOBA 3AP6A 3UKTA 1ASJ1 4XBQA 3TN93 3ZFGA 1AR81 3IPVA 1RUH3 2UYAA 4Y4YA 1H2KA 2WT0A 5EV7A 1LGCA 2VOXA 1KITA 3N7MA 3VBHC 1I1EA 4HKOA 4ASLA 5T5LA 2VMGA 3PVEA 3D5OA 3WLUA 3NSTA 3WW3A 5T3NA 4ATEA 3KCXA 1OLRA 3B3QE 4FXGB 4UW3A 2F6BA 3B9CA 2XVLA 4J1XA 5CAZA 4LBJA 1IOAA 2A70A 2JG9B 4HVOA 5FLIA 3JQXA 2DCTA 4TZDA 3LKJA 3VKOA 2KM2A 2D6NA 2BEOA 4H55A 1PNFA 4XFCA 3MLLA 1DGLA 1C1LA 1WD3A 5JOZA 4XF9A 1I9RA 1GSLA 3K51A 1RUH1 5J09A 2R061 3MGUA 4GIQA 2GH2A 4BWOA 2R32A 4YG3A 1SLBA 1UZZA 2OPKA 1S55A 2V5YA 1NG0A 2FMYA 3H8UA 3OBRA 3ECQA 4K1ZA 4Q0QA 2ZPXA 3PMEA 4HZFA 4X6RB 1LOFA 1WLDA 4FPHA 1HLCA 2NZ9A 1VALA 3ILRA 2ZX0A 4YZ2A 1ZRFA 2WLQA 1U5IA 2VOWA 5E88A 2WQ4A 2VMHA 1COV2 1XQNA 4IV1C 2PHRA 2Y0IA 4DINB 3BU7A 2YGLA 3WW4A 1W6OB 3WP6A 1H8VA 1CAUA 4WM8C 3KM5A 1PMIA 1UN1A 4Q1PA 4CEWC 1YFXA 1RUF3 4AVAA 2HWF1 2GN3A 3JBG2 2DTWA 1ULDA 1AYM3 4IESA 1DFQA 1ND3B 3JB4C 4LA2A 4COVA 3CLPA 1AZDA 3JB8A 4N90A 1D4M1 5GLVA 3FFZA 2VVFA 2CAVA 1GANA 3RMXA 2VNRA 3KZ4C 1IKPA 2Q8OA 4Q2FA 1AYN2 3AJYA 3E6CC 3K48A 1JN2P 4MGIE 1PNGA 5D8AC 2E53A 2VULA 2VPVA 5JSRA 2YZ4A 2CYFA 3ATGA 3OD0A 4CDXC 2R042 1Q3EA 3SITA 2GMPA 2HEVF 3VBOB 1SBEA 2A6YA 3A4UA 4E2QA 4NOTA 5CFCB 1XXNA 3AZWA 2VOKA 1PK6A 3NKGA 1LOCA 1NOVA 4IV1B 4Z2WA 1CAVA 1RC6A 1OMIA 5BNOB 2HKXA 3I59B 2PHDA 3AP7A 4Q0PA 2WSVA 4AI8A 1PO23 2GNTA 1FI2A 5CG8A 1DLLA 1WD4A 1N1SA 4BZ4A 1WLTA 2OUJA 5FQ0A 4OVEA 1S0DA 1Z0HA 5C8WA 1ONAA 2BQPA 3S7IA 5L73A 4BM8A 2HWC2 5A32B 4OZXA 1RITA 3LZZA 1PM7A 2XJTA 1BZWA 1UU5A 2RR13 2JX9A 4EN8B 2ZTNA 4HMZA 1MVEA 3AMPA 1AXYA 5BNNA 1GBGA 1O7FA 2BVVA 1TME1 2A3WA 2DUQA 4XMAA 1PIV1 3WD5A 2OW4A 1AJKA 2W0XA 5BY5A 1B35C 1QQP3 2AENA 2OA2A 3W9AA 1LOEA 3WCRA 1ZA4A 2QZ3A 3V65A 4AFMA 1QJZA 3MIBA 1AR92 2GDFA 3UJOA 3KGZA 3QOPA 3WG2A 1XNDA 5HXVA 4UW6A 2PA7A 3J8F3 2IXJA 3HT2A 4MH0E 4Y1XA 4HKWA 1MZFA 2GALA 2HJIA 4WM8A 2ZX1A 5BNQA 3NKTA 4XFBA 4C90A 3JD72 3E6DA 1PZ8A 2ATFA 4JGZC 4Q0SA 5BNPA 3ZN6A 3HIFA 1JW6A 4XZPA 1HQLA 3AKTA 4I01A 3AFKA 1W2UA 4CRQA 2EIGA 1F9KA 1QDOA 4LR4A 4XJ8A 4W65A 4BCUA 1HRI2 1I5ZA 2A6VA 1SLIA 1ZBE2 5CB7A 1H0BA 2FMDA 1KS5A 5GJ6A 1QH7A 2DVDA 2EAKA 1OQDA 1VBB1 2CTVA 4XOGA 3AYDA 3ASIA 4KU8A 4RR3C 4AGVA 3MDPA 1UAIA 5GLTA 1OFNA 3IM0A 1K5MC 5DUUA 1NCQA 2UY8A 4L8QA 3GHMA 5KHHA 2DFBA 3ZMNA 4AI2A 4FOYA 4P9WA 3ACLA 1FATA 2DV9A 1AXZA 2H0BA 4XFIA 1UD1A 1LECA 5I91A 1MVQA 5GZGA 1W6QA 4D7SA 2LALA 1FX5A 1G8WA 2RS32 2QZ2A 4HVRA 5KHJA 4YGEA 1YFYA 3ZXEA 1IGOA 3VHPA 5C9AC 1UKRA 1VJ2A 1RUI3 3WHUA 1LJ7A 1XNBA 1QKQA 1R083 3NW4A 1EP0A 3H9AA 5GKAC 3VDDB 1QOSA 1NXD1 4OHVA 1CAVB 3ZIXA 1FOD1 2YV8A 3AMNA 2ZHNA 1GZ9A 4XJ9A 5J3UA 4LBKA 4XQDA 2MEV2 1EAH2 1N47A 3EHKA 4NR1A 1EV11 2BNOA 3MIFA 4M3CF 3LB9A 3TB0A 4NO4A 1V6LA 1RINA 2RR11 4FOWA 2HWE2 4K40A 2W52A 4EN7B 2D40A 5C6CA 4R9DA 4JAAA 1S0EA 2IFRA 3MI8A 4GULA 1N3OA 3N7LA 4JV4A 3B02A 2PELA 1HKDA 1DZTA 3WDXA 3FUOA 1D2SA 3M4FA 4ORFA 4RQPC 4YZ3A 5JVVA 1UW8A 4A7KA 4OUSA 4AXOA 1JOJA 3VBUC 1K5MA 5FCCA 5SV5A 4AI1A 1ZZ7A 3RDIA 3BALA 3E5XA 4YVWC 2D5HA 4EWAA 2JICA 1MEC1 1NQDA 4IXLA 1WMDA 1PO22 4AQ2A 3HAGA 1ND2A 1VB2A 3ZXFA 4XILA 1DU3D 4CP2A 4BPZA 1BBT3 1KQRA 5K0UA 4YZ4A 2R043 2X5IA 5C9AA 1LB2A 5CU1A 3MLKA 1SDWA 4D69A 2VNOA 1LODA 2E7AA 2IXIA 3H1YA 2G9FA 2ZGTA 4L2NA 4XQWA 3FHIB 2VW1A 2KA3A 2VW0A 1LRHA 1AYM2 1FNYA 4LHNA 4WM7A 3AFGA 4AFAA 2ZHLA 2WFF2 5DUXA 5GZCA 3V0BB 4FCAA 2D6OX 1NY72 4YW1A 2A5ZA 2GN7A 2PYTA 2WZR2 1WW6A 3R4SA 4JRAA 2JEMA 4ISQA 1UU4A 2ZGSA 4FPCA 1LR5A 4YFZA 3E6BA 4CDQC 2W39A 2RS52 4XBLA 3TBDA 3ZFGC 1C1FA 3FZ3A 3FBMA 4BOWA 4BLIA 1VIWB 2XLGA 5FLJA 4MYEA 4CDUA 1C3HA 3BB6A 1HRV2 2HWB3 2D5FA 2HWB1 3EQEA 1AYN3 2A3XA 4Y1YA 3GNEA 4LNVA 1S0IA 4W6WA 1PVC1 3WUCA 2R1DA 1PVC3 2PN5A 1COV3 4PDWC 4N9IA 1FXZA 4SBVA 2IWGB 4LTAA 4FPEA 4OULA 2XWJB 1RUE1 4LO5B 3WP4A 1O4YA 4JTNA 4E4SA 1LHOA 1O3TA 3MFCA 2DUOA 5LK5A 4AEDB 2ZACA 3MEPA 4HN0A 4WM7C 1VAMA 5DZGA 3DL3A 3PHMA 2JE9A 1LEMA 3IDBB 4PIXA 3RI8A 4LBQA 2BFUL 4KL1A 4NPRA 2R1BA 1W6MA 1XYPA 1ZM1A 3IT8A 4MXVA 1ZZCA 3RZZA 2GAUA 1V9U1 1X7NA 2RM21 5A33B 5KC6A 4N9HA 2JG8C 2WZPP 4BMEA 1NCQC 4Z07A 1RHI2 1FT9A 3VUOA 1AR72 3NAPC 4HETA 3VBFC 3BPZA 4FP2A 3AMQA 5KHGA 3AP9A 1GZWA 2B39A 1HRV1 1J3PA 1QJU1 2XG3A 4OFGA 1GLHA 5JR7B 1W6OA 3RYRA 5T50A 3VKMA 1LHVA 5I8YA 1S0CA 4FO9A 2NLRA 4R8HA 4HK8A 1R091 1W0OA 1FPN3 5IT6A 4YW2A 5C9AB 4Q8LA 1G9AA 3BTAA 1UPIA 2XVGA 2XWBB 4XEZA 2K0GA 1UKGA 2ZZQA 5L7OB 3HT1A 1WGPA 4FPYA 4A7YA 2IXLA 4ZU7A 5J36A 4LE4A 2Q1ZB 3CO2A 4QQHA 4E2SA 2A6ZA 1IS4A 4PDWA 1VBC3 1W39A 3SLIA 5JZGC 1NZCA 1DQ5A 1RUG3 4ONUA 4PBPA 3V0BA 4FTBA 4GQ7A 2D3SA 3WP3A 2A7AA 3AP5A 3BCWA 1WCDJ 4DS0A 2OZ6A 5E8AA 3U07A 5JLVA 4FVVA 1SCRA 2IFWA 4AVVA 1RUD3 2GNMA 1OFSA 1RHI1 1OSGA 2NM1A 4CDXA 3M3EA 4PBOA 3ZN5A 2NQYA 5LEKA 4MXWB 5DXDA 1PK6B 5JAXA 5KXCA 1IHMA 1QJU2 1W6NA 3AKPA 2ZAAA