1COZA

Ctp:glycerol-3-phosphate cytidylyltransferase from bacillus subtilis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
126
structure length
126
Chain Sequence
MKKVITYGTFDLLHWGHIKLLERAKQLGDYLVVAISTDEFNLQKQKKAYHSYEHRKLILETIRYVDEVIPEKNWEQKKQDIIDHNIDVFVMGDDWEGKFDFLKDQCEVVYLPRTEGISTTKIKEEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A prototypical cytidylyltransferase: CTP:glycerol-3-phosphate cytidylyltransferase from bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords PROTEIN (GLYCEROL-3-PHOSPHATE CYTIDYLYLTRANSFERASE)
total genus 42
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 2.7.7.39: Glycerol-3-phosphate cytidylyltransferase.
pdb deposition date 1999-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1cozA00
3A04A 1TYAE 3ISJA 1D2RA 4MW9A 3RK1A 1EFPB 1YUNA 2O5RA 4FZJA 1O97C 4NZPA 1WQ4A 4R2MA 1YIDA 4DNXA 1R6UA 1H3EA 1GN8A 1NI5A 1QRUA 4OJMX 1TFUA 4J75A 1NP7A 5BNZA 4ZCRA 5LFAA 1GAXA 2CFOA 3L93A 1MAUA 3AG5A 5KCMA 3N9IA 1H1TA 1JILA 1O97D 4U8HA 2E21A 1COZA 1F4LA 4NAHA 3INNA 4JXZA 3SEQA 1NSYA 2E89A 1N77A 5KWVA 1TEZA 3CVYA 2WSIA 1OBCA 1PG2A 1NUUA 4YMIA 2CUZA 5J59A 5TEWA 3TNJA 2QTNA 1LW7A 3IDFA 2CV1A 2TS1A 4DDMA 3RJZA 3DO8A 4MUKA 2YWBA 3TZLA 1VBMA 1KH1A 1IRXA 3FHJA 1J21A 4MW4A 4ZT3A 4I6JA 2AZXA 2H2AA 3FOCA 2YY5A 2DXIA 1N2IA 4XFJA 1Q15A 1VL2A 3IVCA 2C5SA 2J07A 1YULA 2HMAA 4NATA 2EJCA 4MQ6A 5LM3A 2CV2A 1M83A 2JANA 2BTEA 2QUKA 1TYCA 3RHSA 2CYCA 3RBAA 4TS1A 5FNZA 3AIIA 4PBRA 4EG4A 1M1ZA 4XFDA 4L2IB 2X3FA 2J08A 3M5WA 2DUMA 3COWA 3IUEA 4F3RA 3CR8A 4I6EA 3AL0C 3FG9A 4WNYA 4EG7A 1KP2A 1J09A 1YUMA 2RE8A 4NAUA 1IQUA 1KKUA 1YI8A 3I05A 4HK4A 3CVXA 4CQNA 1N3LA 1WQ3A 1X8XA 3NBAA 3PXUA 1GTRA 3ZXIA 4ZCSA 2DETA 2XRZA 1R6XA 2QUJA 3IOCA 4MWEA 1T6YA 1O95C 2G36A 3IMCA 1WXIA 2YXNA 1V8FA 4RPIA 2QJOA 4K0RA 1U7XA 2NSYA 1R6TA 3LCJA 1T9GR 4MW2A 1UFVA 5IHXA 1B6TA 1KAQA 1EFPA 1MB9A 2EL7A 3E27A 3P0JA 3HV0A 2ZUFA 1J20A 1N2EA 2CT8A 1H3FA 2JAXA 1S4MA 1WY5A 3BL5A 4MW1A 4NDAA 4P2BA 3IOBA 2Z08A 2VTBB 1YIAA 1IQ0A 5JBNA 4MUGA 4X0EA 5DEOA 1JGTA 4S1OA 1MJHA 3CVVA 5DASA 4G5YA 1U3CA 1P7PA 4GRIA 3G5AA 3IVXA 4ZT5A 1I2DA 1OD6A 5TGTA 3ELBA 1O94D 3P0IA 1ZJWA 1EUYA 1T6XA 2ZP1A 4L2IA 3UMVA 3FIUA 4MW0A 3ND7A 1IHOA 1NUPA 3TZEA 1JIJA 3FNRA 1K4KA 3N2YA 4OUDB 4KR6A 1ZUNA 1O94C 1T6ZA 3G6KA 3RFFA 1PFYA 3A05A 3IVGA 3KT0A 2VXOA 5HUHA 1I6LA 2QJFA 2A88A 2QTRA 2PG3A 1VLHA 2DR2A 4MVWA 3FI0A 4YP5A 4DJAA 1DNPA 1WXHA 3UC5A 5FO0A 2PFSA 1WJGA 2A1UB 3MLBA 3TS1A 1N2JA 5K0SA 3COZA 2E0IA 3CLSC 3GUZA 4U7JA 2X1MA 3S3TA 3MLAA 2B7LA 3IH5A 2DPLA 4MAFA 4HJRA 1PFWA 2X0KA 4MW7A 1KAMA 2V0CA 3JXEA 1JMVA 1PFVA 4MUIA 1JEEA 4UZFA 1PFUA 3LOQA 3N05A 4MWDA 2QJTA 4CDMA 5KHAA 1EXDA 3F3MA 3IOEA 1I6MA 1T9GS 1J1ZA 4CT0A 1KQNA 3COYA 1NURA 4HJXA 4R2LA 1EUQA 3AKZA 1OWMA 1Q11A 2I1LA 1MBZA 3D6UA 4H3SA 1NZJA 4BWVA 1U0BB 1G8FA 1EFVB 3GMIA 3Q4GA 1N75A 3SYTA 3ND5A 4F4HA 2J5BA 4JYZA 1QRTA 3NBKA 1N2BA 3QE4A 4KPUB 1JEDA 3AFHA 4AQ7A 1VBNA 2PXHA 2NZ2A 4JFAA 4ZT2A 5AHWA 2BYTA 3MMXA 1IVSA 4J76A 1F9AA 4PBSA 4EGAA 5HUJA 3P52A 4ND6A 4MVXA 5LLTA 3OTWA 4KR7A 1QQTA 3A2KA 2E18A 4K03A 1Y42X 2AKEA 4EG6A 3HMQA 4NX2A 3CLUD 1LI5A 2GKSA 4DDKA 4ZT4A 3FDXA 1O96A 1OBHA 3L92A 3UOWA 4DDHA 3VGJA 3QTBA 5J58A 2V0GA 4MWCA 2JA2A 2QUIA 4G6ZA 4ZCPA 1JZQA 5FO1A 1QU2A 1GLNA 1GPMA 3CLUC 1PG0A 5TS2A 4OUDA 1U7DA 3FWKA 4ZT6A 2A4MA 2D5BA 3CLSD 1M8PA 1QRSA 1XNHA 5H7XA 4G5FA 3IUBA 1SURA 1OWNA 1Q19A 2PZAA 4EG3A 4EG8A 1M8KA 2D13A 1BS2A 4JZYA 1WXGA 3HGMA 1O0CA 3X1KA 4YP6A 5H16A 2IP1A 1WXEA 3PNVA 2D54A 1CT9A 1Q77A 2J09A 3SP1A 2IJGX 3P0HA 2PIDA 1TYBE 1EJ2A 4KPUA 4PBTA 3GLVA 1TYDE 1OWOA 1EE1A 1GZUA 1K92A 3UK2A 1MC1A 3DPIA 1HYBA 3CVWA 5DK4A 1KH3A 2OQ2A 2A1TS 1QU3A 3H99A 3ILVA 3CLRD 4A91A 5DB4A 3SDBA 3H9CA 1RQGA 3RK0A 2J4DA 2RD2A 4ZT7A 1IQRA 1VBKA 3NV7A 4MWBA 4MLPA 1EFVA 2AG6A 1IFXA 4YP7A 3CVUA 2CSXA 2DEUA 2WQ6A 3G59A 3TQOA 1K97A 2QTMA 4ND7A 1OWPA 3DLAA 1I6KA 2A86A 1U3DA 4ZCQA 3FH0A 1O95D 5HG0A 5EKDA 2WQ7A 1G8GA 4EG1A 3ZGZA 3VRHA 3SEZA 1M8FA 1ZH0A 1KQOA 2OV4A 3IMEA 3OP1A 2WB2A 1MRZA 4AS1A 1XJQA 1ILEA 4HPWA 3H9BA 1KR2A 1NUQA 2HZ7A 1X6VA 1K4MA 2ZUEA 3ZJVA 1WXFA 1MOPA 4KR9A 1ZH6A 4ARCA 1J1UA 1QJCA 4EF6A 4MVCA 1O96B 4EFKA 1ULHA 4XSVA 1JIKA 3ZJTA 1F7VA 4UZEA 2DERA 4MULA 3X1JA 1NYLA 3PNYA 2A1TR 2Z09A 3DV2A 1KQPA 3IMGA 2GOYA 3HZRA 3N8HA 1FFYA 2IELA 4I6GA 4MUNA 4MUFA 1OWLA 3KT8A 1M8GA 3C8ZA 2VTBA 2DLCX 1J70A 2O8VA 3Q12A 3QTTA 1MAWA 1GTSA 1QTQA 4U63A 3K9WA 3TQIA 3ZJUA 3HL4A 3KT6A 3CLRC 1H3NA 3H05A 2XRYA 5IJXA 4GU5A 1QNFA 4QREA 4YBRA 4DLPA 1WKBA 1O6BA 4MW5A 4MUEA 3PNBA 3COVA 1N2GA 1G8HA 2PZBA 1O5TA 1N1DA 4RUKA 1KP3A 1JZSA 3U1VA 3A4IA 2H29A 4DE5A 5J5AA 2CYBA 1M8JA 3ZXSA 1JECA 2PZ8A 3IODA 4E1AA 1MB2A 1XNGA 2HGZA 4MW6A 1O0BA 2Z3VA 2A7XA 1LI7A 4Q93A 4R0NA 4ARIA 1F7UA 4ZCTA 1FYDA 3Q10A 2X1LA 1KH2A 2A84A 3VU8A 3CLTC 1NUSA 4MVYA 4PY2A 3K32A 2YWCA 2A1UA 4QBTA 1WZ2A 3FETA 1KORA 3ND6A 4JXXA 3MUEA 1WOYA 3SZGA 3CA8A 3PRHA 5K0TA 3FY4A 1A8HA 1IH8A 3CLTD 3KFLA 4MUJA 1XNJA 2CYAA 2GM3A 3KT3A 4KKVA 3LE8A 3SZ3A 1G59A 3X1MA 4MUHA 4WSOA 1N2HA 3MXTA 4CDNA 3UY4A 3ZIUA 1JIIA 2R5WA 1NUTA 4Q16A 5F23A 5TEVA 1JHDA 3HFJA 3ZUGA 3D6VA 4QRDA 1TQ8A 3AG6A 4EG5A 1V47A 1N78A 2QUHA 3H97A 1N2OA 2CV0A
chains in the Genus database with same CATH superfamily
1AN0A 3ISJA 5EJ7A 1CJUC 1XPJA 2VYVD 1T8RA 4U5QA 2UXBB 3AVOA 3CX8A 2WJGA 4V39A 1GQRA 5CB0A 1YIDA 4Y2PA 1Z16A 4DSOA 3RU9A 1ECPA 3DTVA 3FMFA 3CQ9A 3P2MA 3I8XA 5GPBA 2QL7A 1YWGO 4ZO6A 4BAZA 1GTJ1 2EZTA 3QVXA 2ALJA 1PYDA 4U6QA 2F9MA 2NXEA 3G0GA 4AWAA 2BEWB 2OFXA 4DMHA 2O4UX 1AKTA 3FSJX 4X8OA 2IU0A 3GFSA 3ZOKA 3NJ4A 3AG5A 2PEYA 3GL9A 2PR2A 2WPDD 4PLZA 3F3KA 2HLHA 3ET5A 3M9WA 3P9CA 1MO2A 3O93A 4LSWA 1XUOA 5LYJA 3UHFA 4I50B 2F8TA 2B30A 4GXRA 2Z5LA 4MWGA 3L6UA 1GM5A 1GITA 3G8AA 2FFBA 3K9LA 4L8VA 1N77A 1N33B 1YQ9A 1Q1AA 3U7HB 2JCXA 4ZU1X 4FZ5A 2MSLA 3C4VA 1KAOA 1QR2A 4X8HA 5EFZA 4JYBA 2P67A 3V4ZA 3RADC 2HSDA 4EIWA 4JJ7A 3L0SA 1KK2A 4HQ6A 5BY2A 1XEAA 1BDMA 1CF4A 1W47A 4YC7A 4H0FA 2G08A 2AIRA 3TF5A 4E5UA 4MUKA 3WLRA 1YQEA 4H6WA 3TIFA 1JG7A 2PUTA 3ELUA 2PD6A 2H1VA 5IAJA 5BUZA 5KOIA 2VUHB 3DE7X 1CDZA 2FP4B 2WTBA 1P0PA 1WHSB 3C74A 1H5QA 3H7IA 2XZOA 4XR9A 1ODTC 4O8ZA 1M5UA 1LK5A 1R9GA 1NXVA 3NVKI 4LX0A 2GBIA 3ID6C 4FFLA 4MQFB 2ZJZA 4XOIA 1XZNA 3OQVA 5U9CA 3FPBA 3PTLA 3ICWA 1DXQA 4Z0PA 2PL5A 3RC3A 4ALNA 4DEYA 5ALUA 2J0UA 3AL2A 1FMLA 4J0DA 1ZMOA 4KU4A 1B3BA 3O73A 1A2QA 1Y5MA 3QRWA 4LF4B 2JLVA 5FFFA 1UANA 3F8WA 4G4SO 1G4AE 2ODBA 4I1VA 3Q8WA 4JB8A 4K87A 3AR8A 5CAEB 3ZY6A 4U9IS 3RT1A 3T94A 5LZ5A 2X5KO 5CXUA 3KXPA 3OE5A 4UEOA 1FX0B 1P74A 2C4HA 4C1BA 3HM9A 2QJRA 3GDFA 3DZIA 4AZSA 5PGMA 3TO5A 1YCHA 2QS9A 3HH8A 1Z8DA 2HTFA 1TM5E 3RPEA 3W2IA 3QXHA 5J4KA 1J09A 2PRYA 2VHUA 1XXHE 3PX2A 5BMOA 2ZB3A 4ARZA 1RBYA 4WBNA 2ZSJA 4Q12A 4ZVSA 2PAAA 3ORFA 3NBAA 4NECA 4AZ0B 2ZPAA 2BI8A 1T1SA 2OZKA 2XRZA 1Z82A 3IP6A 4MNTA 1T6YA 1QHSA 1YUBA 1P8AA 2X7JA 5DM2A 4DLNA 4YCMA 5KTMA 1QVAA 1YJCA 3O3NB 4Q66C 2E3JA 5LKAA 1UEIA 4TL7A 2XCIA 3WGLA 2H7CA 4GI5A 1B2RA 1R6TA 1GLVA 1V26A 1VJTA 5B1SA 2R0QC 4IRUB 2IH5A 1OJ7A 1S01A 2DR0A 1UFVA 1XTZA 4NHEA 1M74A 1PT8A 2BIFA 1Q22A 1YAHA 5EEGA 4B8YA 1G17A 4IIBA 1D6NA 1CIVA 1JEJA 3KRTA 4EEZA 1XCPA 3ASYA 1SEPA 1A98A 1Z5VA 1TT5B 3NANA 4AY5A 2BBTA 4ND4A 3W90A 1VKRA 4TLCA 3UFXA 1ZC3A 4DF3A 2HQRA 2R2GA 3IURA 3CRNA 1W35A 2JKYA 1L8XA 3EGCA 3SQOA 5AKKA 3TL6A 2O3QA 3WAJA 1AKQA 1YIAA 3E7FA 4CZ2A 3ICOA 1F0NA 2XT9A 3ZC3A 4D9MA 1M0SA 4TMVA 4YUYA 1BVHA 1MQ8B 1ZZEA 4LRQA 4CF5A 1WRBA 5CCEA 2BKAA 3MTQA 4H1VA 4CEIB 1RD4A 4I08A 3ZG6A 3ADDA 2RK3A 5JSZB 2LTAA 3E48A 1EFRD 1PR9A 4CG2A 1I2DA 1RHUA 1QH9A 2YFYA 2XCQA 2IGTA 4XLZA 3KZNA 2CCJA 2OL4A 1O94D 1R8JA 3GXOA 1Q12A 1TJ3A 4FFPA 4OL9A 2X9VA 2AFVA 2XUZA 5CK4A 5TQVA 4LVUA 5EHZA 4M21A 1ISMA 3VR1A 1L7EA 1VG9B 2NT3A 2ZP1A 5CH8A 3WK9A 3HTXA 3FHLA 3ZD7A 3EGIA 4TRNA 4JI8B 3HYCA 2VAWA 2XMPA 3IEKA 5GJCA 5FWDA 4D4HA 4F0JA 1T36A 1FZTA 3SJAA 2C2XA 3QYJA 4LXGA 1Z3CA 5H81A 1DRUA 5JZMA 4QTXA 3VDMA 1A7KA 4KO2S 2XKKA 3IIIA 3HO6A 3RFFA 2VWPA 3CLVA 2LWIA 4RPGA 4WUVA 4Q7JB 3AVTA 1KOFA 4ND3A 4P0QB 1I5OA 2B20A 5BSTA 1NDUA 4L4YA 1P9RA 3TBHA 1VLHA 4CIVA 1VRVA 4UTXA 1J5EB 1U1CA 3GUVA 1IN1A 3OEEA 3L9XA 1MAHA 1W52X 2IZ0A 3C5EA 3TRHA 3I5YA 1E5QA 1U28C 1VP3A 1YZGA 3O4IA 4GE3A 4NARA 1BXRA 2GJKA 3WLTA 2X1MA 1GKYA 3AINA 4AJ2A 4KPYA 1SQSA 1KAGA 1AOXA 2CD7A 1CW2B 2XQGA 1YVUA 4TWRA 3GPLA 1T4GA 2XDQA 3F9CA 4YCLA 2IDMA 1VIDA 1RE0A 2YNMC 1O2DA 3ISTA 3JXEA 4KXNA 4DIBA 4S04A 4KK3A 4PZYA 1FQOA 4HAWA 1KPHA 1XOIA 5KHOC 3FHCB 2PTHA 4BNKA 4EUEA 4DPMA 4Z7NB 2X0NA 1ABFA 4AZ3B 3G68A 1YVPA 1EVYA 1VCOA 4J91A 1IONA 1EVLA 1AO3A 1SIWA 2CXPA 2CE7A 3IOEA 4O2AA 5GP1A 4TXMA 2I4LA 1W5TA 4EGSA 1BXKA 3V7YA 2R8EA 4WWHA 1CU1A 3H16A 3RWMB 5EJ4A 4XVQA 1YJAA 2BEKA 4YJ3A 2D5IA 2Y1KA 4EYOA 5CA0F 1BZYA 5I7RA 4JCCA 1QYIA 1VJGA 2H9IA 4N5HX 4XYMA 1JG4A 2RKWA 1NVXQ 1X1QA 5DN6D 1GDDA 2DBQA 2PXXA 2G83A 3IQDB 1J6UA 3KDAA 4LVNA 2PQ2A 2O8CA 1X9GA 3T4UA 2YIDA 3ROEA 1OASA 3FOZA 2KE5A 1RI4A 1UOPA 4KX5A 1I01A 2P75A 3PGVA 2EFYA 1URPA 3M4NA 1AKUA 2QTTA 1FEZA 5HA5A 3AFHA 2MYUA 1TVMA 4K6OA 4M8IA 2JFGA 3DXYA 2WICA 4BO5A 3VM6A 2QE7A 3AETB 4PX3A 4JUIA 3EGEA 4PRKA 4XQ0A 2D5CA 4E1BA 3OOYA 1G21A 1W88B 1XJCA 3HU1A 4K9PA 1H2WA 3WWYA 4ZEVA 2P5YA 2LBPA 4IW3B 1O89A 5HZMA 3RIEA 1ACJA 3K9HA 5H02A 3SX4A 5HUJA 3L8FA 3MQ2A 3FRJA 3KAKA 2Z6AA 2W2KA 1VE5A 2GN8A 3KB1A 3QELB 4G84A 4ASUA 3TTVA 4V0OA 2BRUA 1DPFA 3TIVA 4FYKA 4C01A 4QOHA 5C52B 4RJJA 2GKSA 3W1EA 4LGVA 4YUWA 5FTKA 2I1VB 4LQDA 2O5EA 4QUJA 1E9VA 2JVIA 2VRBA 3EYAA 4IXWA 2PWBA 5TF4A 4N1AA 5B4VA 3OMXA 1WVGA 1SJ9A 1J97A 3BMNB 4EBBA 5CBPA 2CXXA 2C8KA 2NXWA 1FUUA 1OU4A 3FPEA 3HCNA 4HFMA 1V3UA 3AJRA 2W6ZA 3CPSA 2EKZA 2JA2A 3PJGA 1SELA 1R6DA 5D5QA 2PMCA 3UMBA 3TTXA 1TW3A 2FHPA 3S1AB 4IRMA 2BEJA 3ENWA 1O6FA 5TS2A 1MQAA 2ZRQA 1TPZA 4DQDA 1C3XA 1OAOC 2H52A 3QU4A 4FNMA 2VBCA 3RVDA 3UXEA 2QTWB 4G5FA 4GSKA 4JN6B 3IAUA 1OUMA 1EFTA 3D8BA 2IHZA 1KIMA 5M29A 2GFQA 3KWJA 1ZI9A 4EG8A 2HD4A 1H2RS 4ZI7F 2I4NA 4Y9TA 1K8RA 1MC4A 1VCHA 3ZQKA 4YRCA 4ZCMA 2HZBA 4E2XA 3MWGA 1EVIA 2VSYA 2XD9A 1UINA 2W8ZA 2ZSAA 3EXEB 4JITA 2JL1A 1W0JD 1QF6A 4JLMA 1FRFS 3ILYA 4K9SA 1C30A 2NPIA 4ZHSA 1T43A 2P69A 4B5LA 4DB4A 4I9GA 1IYZA 4CG3A 1XALA 1UBHS 2ON6A 2X2PA 3G49A 1HR0B 1JDSA 2BGMA 1OH7A 3UV3A 4MICA 5F64A 1G0NA 2VHTA 4WCVA 3DZDA 2GN0A 5HGJA 1E96A 3VU3A 4RHXA 1Y4SA 1P1BA 4J0FA 4S2UA 1L5VA 2ZCVA 3U4QA 2Q8NA 1NVFA 1CJMA 1P19A 1ULAA 1OYOA 5C31A 2XY4A 3ZDZB 3O1HB 2A1TS 2HBRA 5DJ5A 3GOHA 1HI9A 3KR9A 3SGLA 1XB2A 4RF4A 5IT0A 3Q0EA 1TMGE 3D6AA 1AXGA 3T7IA 2P2YA 1I7NA 1NYTA 5AI0A 4KDFA 5IXSA 2Q1TA 3E9NA 4MPPA 2GTPA 4NOMA 3WLJA 1H4QA 4LC9A 3IPRA 4C2TA 1T8PA 2CLCX 3IVMA 3KTOA 4FSHA 4R83A 2PSSA 1W34A 1UBSB 1NOJA 2IOYA 3TVYA 1N4DA 2OM6A 3K4HA 4KLNA 3P8ZA 4JUCA 4YP7A 2GBLC 3QU5A 4BO0A 5KNCH 5TF0A 1ULUA 2CL5A 2VDMB 2QRKA 3K9CA 1QH8B 4DWJA 1U3DA 3KOUA 2EV9A 1NMYA 3FH0A 3QWAA 5ULLA 4CEJA 1IN4A 1KEEB 1QUFA 3LBIA 4JBYA 4KQ9A 5CW1A 3QXXA 4F8JA 4RCYA 3RC8A 4BNLA 3IUQA 4LYYA 5KJ6A 4EL0A 4WKCA 4MIEA 4D4GA 3ZWYA 5LZ9A 4UUQA 4ECEA 1N1MA 2V1XA 2R86A 1QYCA 4OSOA 3TLMA 4AN1A 5IDQA 2IYYA 1ISFA 1EDBA 4G85A 4GBGA 4QEDA 3U6KA 4PYKA 2FRXA 1FSSA 1G9SA 1QS0B 2ZI9A 4F4UA 2JCGA 1HE2A 1Q0LA 2EKLA 2E4WA 1RS0A 3NC4A 3CNQS 3D6HA 3MJFA 3OMLA 3H11A 3GLRA 1JYSA 2VIIA 5TB5A 2J3HA 1E32A 2Q4OA 2WOOA 3NCTA 4BMPB 1G42A 5IJAA 2J6HA 4PFKA 4YJHB 3K31A 4MPRA 3CKYA 3JYPA 4GPIB 4DCGA 4FE4A 3U9TA 4OVKA 4R8KA 1YQGA 3N6RA 5FTJA 1U99A 1I32A 3DZBA 1QM5A 5K0EA 3TAXA 3RU3A 2GJAA 4S1PA 3NVDA 1CUWA 4LMBA 4EJSA 3L1JA 2Q6OA 3P9RA 4KDCA 4PNHA 3N8HA 1OR8A 2GOYA 3BMQB 3HZRA 1H2HA 3MB5A 4XCXA 1W5EA 1VHWA 5BV0A 5BWOA 5KHLB 3F7NA 3CNBA 3OF3A 1MZVA 1H85A 2WP8J 3BJIC 3PUZA 3SD7A 1MVOA 3H9EO 2VYND 3L9WA 3WHLA 1LW6E 1ZWLA 3DTNA 4ID3A 2IOHA 3L7NA 2AYYA 3PCTA 5FBWB 3X2FA 4YCJA 3W7AA 5LU9A 3CLRC 3B1WA 3GLTA 3OZ7A 5A5VA 3KSUA 2G67A 3OEWA 3B85A 1SXJB 4JLOA 5E4TA 3ZNOA 1D1TA 4LRSB 4H7JA 4Z7QB 2K2QB 1JBEA 4FFNA 1XMQB 3ZN2A 3BD9A 5DM70 2QPAA 3HKEA 2QZSA 3D6TB 1EUDB 5HJ7A 4GOKA 3HM2A 1PLKA 2QW0X 4YDSA 5AJWA 5FF9A 1FBTA 3L43A 2PKYX 3RWBA 3U13A 1VRWA 1TFRA 1Z5GA 5IT9A 1Q17A 5K4AA 3TQHA 5DHRA 1BMTA 2HHJA 4WCDA 4N03A 2X6TA 1JDBB 5EQTA 3WGOA 4DY4A 2O2XA 1G3MA 3JQ8B 4JVMA 4ZPJA 2R8RA 1QX4A 1DS6A 3A1TA 3QU2A 3H0KA 4LPKA 4BUCA 3R9XA 3F7MA 2AXQA 4P38A 1B00A 2D0OB 4G1EB 4MHTA 1C0LA 3GNTA 4O4IA 3UKOA 4ARUA 2QRVB 5K4GA 4L6IA 5GVSA 5DBGA 4WOPA 5HIJA 2QE6A 2I6GA 3HCBA 5AK6A 3VU8A 1VLLA 2PFGA 1QZTA 2VDUE 2VKTA 1WD7A 2AEEA 4L08A 4KVAA 4W1RA 3RTDA 3D3NA 2IWHA 2EBWA 4MQEB 2P40A 2RHWA 4IIEA 1M7GA 2YWCA 3HBNA 3D3KA 3R4CA 4NBLA 3TDMA 3VSDA 1LB1B 1DWQA 1RQ7A 2YFHA 3U9SA 4DSTA 3FGOA 4IG9A 1A1VA 2NU7B 1G2OA 1SY7A 2QD2A 2X4LA 3QBJA 2RCNA 1ZBDA 2WD7A 4L4XA 3MMZA 1GT91 5EIBC 3O4JA 5JO9A 2ERCA 1WUKS 3N8GA 1SQFA 1KAHA 5ESRA 1SBIA 4E14A 4K6HA 4M46A 2ETVA 1IK4A 1IJFA 2ZBRA 4R51A 3WMGA 3SZ3A 2PKCA 1G3UA 3QX3A 4GAEA 2QG4A 4NPHA 1CQWA 5AKIA 3DMTC 4E7OA 1PLJA 5LP1A 3KE9A 4CDNA 4QECA 1JIIA 1IDOA 4XJSA 4DS3A 3ITNA 3Q3IA 1E66A 4XIJA 2TMDA 1ZL0A 5TQ2B 3N7UA 3PXAA 4KUEA 2CLKB 1YR8A 2LDBA 1QJ4A 4XX1A 1NXOA 2VPPA 4JH0A 3WXMA 1UBGA 2RJNA 1OFGA 4M3NA 1F0KA 3TVTA 1P4AA 1D2RA 4PGAA 1IG0A 1ST2A 2AQHA 2VTKA 3F9RA 4KAFA 3DE3X 3NH9A 3HXLA 4JR1A 4UNIA 1KSFX 2HF9A 5JNWA 4RLQA 4OM7A 2BH9A 3DW3X 4ESEA 1GZVA 2G9ZA 1Q14A 1MG5A 3IQGX 1NP7A 1N7IA 1H65A 2AXEA 2FFHA 1ECBA 2QLMA 2CK3D 5A71A 5T3YA 2WSSA 4J0GA 2XB2A 1H42A 2J30A 3N8DA 3OHSX 4KQMA 1W8DA 3BSWA 4WOCA 3B6JA 4NK4A 5KCMA 3X43A 3UPTA 3CC8A 3O94A 3T7JA 5C8YA 2FR0A 3EGOA 4XPIA 1Y4ZA 1E59A 1C9DB 2P6NA 3EVTA 2DF8A 2E21A 3EY4A 1YZNA 4KW7A 4ZI7A 3EWAA 4KQHA 2RI0A 4K9QA 4AP6A 2TECE 3OX2A 4ZAVA 1TTQB 1NW7A 3A8TA 1LUAA 4CIWA 3OPYI 3OLCX 4BVBA 2MCFA 3KCNA 3QX7A 4IHJF 5EESA 3SQWA 2IP4A 2FSUA 1A5ZA 2P0EA 3AX6A 3DPUA 2XB9A 2HJHA 2LKDA 2QN3A 3IKMB 4YV1A 4ZYUA 4ZVNA 2MT9A 2GTHA 1VBMA 1XMXA 1O4VA 1DAPA 3GRZA 1S2IA 1Y5NA 2FFAA 3ETJA 3QE0A 1XRJA 2V5AA 1I1QB 2RG7A 2Z95A 3VJLA 2FPIA 1U1DA 1KVTA 3OC0A 4II7A 4HNVA 5MN6A 1ZK0A 3AERB 2BHSA 2DSTA 2BEVB 4PLPA 5IAEA 2H07A 4G9GA 1AZSC 1D1PA 1USVA 2YY5A 1N2IA 3BZUA 2GXUA 3I6IA 1SXQA 2P65A 3LKZA 4FI3F 2HXSA 3N0XA 4QPZA 4RK7A 4WN9B 5CU7A 2DQKA 3LOUA 3IVCA 4Q9KA 3IRVA 3WJAA 1ID1A 1ZJZA 2O7RA 4EF5A 4FOOA 1A4UA 3L82B 4RLHA 3I61A 3BE8A 4GEGA 3RNLA 1Z5ZA 3OTGA 2MYNA 2OCBA 1NV8A 1ZUWA 1DAFA 1UAGA 2PUVA 2HRZA 4YAEA 5BSHA 2PNFA 4OHPA 1CZOA 3DM5A 4LHVA 3V4FA 3K72B 2IK8A 3AL0C 4GICA 4K05A 1II8A 2QY6A 4YRNA 5FBZA 4ES6A 3PE3A 5EP4A 1CF2O 1QIGA 2JAQA 1XJWA 3A4TA 5CJJA 3RR2A 3DBLA 1C7IA 4D6XA 1Y6GA 1M9NA 2G9UA 3HV2A 3GP5A 2Q27A 2WMOB 1NHGA 3PRYA 3K92A 3PXUA 4GZ5A 5ALQA 1GGKA 2BGGA 2QBYB 4LDZA 4EW1A 3LLSA 4K9DA 2RHTA 2YJTD 2PUEA 4K5QA 2PH1A 3UEOA 4CEHB 1YONA 2FEMA 4HMQA 3H2JA 1C7QA 4ZC1A 2PRIA 5JSQA 3H19A 4YV2A 1ZIDA 1Q3HA 4MJ7A 1N6IA 1U7XA 2BFAA 4AS2A 3HB9A 4HTFA 2B34A 2CEKA 1P4SA 4YXWD 1D09A 2Q45A 4FEYA 4OHRA 5JCOA 3TEJA 1JR6A 1YC2A 2ZRKA 4WXPA 1ZWKA 5T67A 1TGVA 5TRTA 1Z0KA 3UHJA 3MJVA 3KTFA 1MB9A 5AJHA 3UJCA 4Y1FA 4B9AA 4ABTA 1Z15A 3W8DA 2HO4A 2B8NA 5EXEA 2O4CA 3C5WP 3EIFA 2AYZA 3TSYA 3U16A 1T2AA 2XECA 4UE3S 2V7BA 3RIHA 3ANTA 4CN8A 4TZ6A 1TQHA 2WB4A 1ZGBA 2WPDA 4KOEC 5DVZA 2G1PA 3GI1A 5JBNA 4L27A 1LS1A 2P9YA 4C4TA 5LKRA 3H5IA 3P9PA 2C0QA 1RXIA 1DEOA 1JGTA 5DEOA 2IEIA 2NTEA 2ST1A 4O2AB 3WADA 3AOEA 2Z4SA 5ADVA 5LQMA 4J7UA 3FDIA 1U3CA 2GD0A 3CSUA 1JLSA 3NS7A 5EWMB 3UUFA 3A2LA 1GQSA 3FBTA 3G5AA 2G07A 3AHJA 1PRYA 2PPVA 3IDSA 2P68A 2B4RO 5FJIA 3K4QA 3KDSE 4CHGA 4L4SA 2NAPA 2PQMA 3QK7A 1L4YA 3KSBC 4EENA 5KUTA 4ARVA 5J5CA 3JWJA 4NVRA 5KX5A 3UMVA 4PZZA 4CF7A 5I8WA 1RRVA 3M6MD 1IHOA 1XWFA 4DJFC 4WADA 3AVYA 1NN0A 1NUPA 3GT0A 2OAP1 2V6FA 4HAIA 3L05A 4OJTA 1PWYE 3FF1A 1RI3A 5FBHA 3UKDA 3VPXA 3JASB 3FCSB 5F1KA 2WJ3A 4FEAA 5GY7A 1L6RA 2PD3A 1E1RA 4CG1A 1O08A 4WX2B 1AMOA 5F51A 2EFJA 4X84A 2VP2A 1J8QA 3CUVA 5DYYA 2TRSB 3PEYA 1BVYF 2PG3A 5JECA 1A72A 1RYMA 5LCXA 5C3UA 3AIMA 3L8YA 1DNPA 1F8YA 3K6JA 2P6MA 3GVHA 4Z51A 3TG8A 4PAOA 1WJGA 3ZV3A 5HTOA 2ODQA 4FC7A 2I67A 4HWSA 4U7HA 4TXLA 3DC7A 4XEHA 2JGEA 4C05A 2UYYA 4D79A 3Q8MA 2H2IA 1EFDN 1JR3A 3BGDA 4MR7B 4MPJA 5IP5A 5K3SA 4ETWA 2IYVA 3A9SA 5C35A 3IHKA 4DNPA 4WV3A 1V71A 2A3RA 4LMRA 3N2EA 3R5HA 4D98A 5E0OA 4L9WA 5K3DA 1U9IC 3PHGA 3PJRA 5KYUA 3H17A 4J6EA 2XV1A 1JG2A 1B4DA 1MOQA 1EZ1A 2RB4A 4S05A 1SC4A 4CM6A 1DIHA 3A4YA 4PCLA 3CG4A 5EJ2A 2JW5A 2E48A 4FGKA 1C1XB 4JJKA 2VXCA 5IJ0B 5GOTA 2ONZA 3LT5A 1QIKA 1DOAA 2B69A 3IP1A 3DMYA 3LPDA 3NBFA 3OZFA 4LCJA 4BZWA 4D5EA 3DMTA 3IHWA 3LUBA 4KO4S 2CVPA 3EPRA 3NTRA 3K05A 4RWZA 4BFSA 1G8FA 3NRBA 4DM7A 5CM2Z 4YJFB 2CDNA 4M0CA 4EEKA 3CPHA 3ESRA 1CK4A 3TLKA 4FNGA 4CMEC 2C4KA 4N01A 1F17A 2R5NA 4YRZA 1QV6A 4MR7A 5H9VA 1OB5A 1UZAA 4K9OA 3TR6A 5BWBA 2DTDA 4NE7A 2OQIA 4B43A 4LOHA 4M8KA 4OHMA 4BO3A 1JIXA 4KP7A 2ZG6A 4GMGA 1JH8A 2W93A 4GQBA 4X92A 1D2AA 2BYTA 2OILA 2XQFA 5EJ9A 1RWMA 3D4LA 4NCNA 4RNDB 1NLUA 4O6VA 3TW8B 4RFSA 4ZANA 4PTLA 3TOSA 1KTIA 1K86A 3I45A 4CM4A 1LDNA 4Q34A 4Z9BA 1WMEA 2H17A 2VL7A 3FBGA 2MU1A 3D0QA 1TVCA 3AM1A 3UG6A 1KK1A 1I4EB 3HZHA 4OF4A 4QPDA 2MJLA 2XMCA 3HMKA 3M1LA 3VR2A 4D3ZA 3OIUA 3T4PA 2D6FA 2C3YA 2HLDD 5F9MA 5JXIA 4Y6QA 1QHYA 3A6EA 1KO1A 2VSQA 1XZPA 3B9RA 4MKFA 4ZU6X 2QTLA 2XE6A 3GAMA 3MGCA 5JAMA 3SS8A 2GAFA 4DBVO 2GYYA 1GZSA 4Z0NA 5KX5B 3DMNA 1VKJA 4LNUB 2M9MA 3S6JA 1DDIA 5AO9A 4TWAA 1YGPA 5GJWC 4RKEA 1N9ZA 3WSWA 2JI7A 3BHMA 5TY0A 3V7FA 3U4QB 1L9KA 2WVGA 3L0IB 2GSDA 4MVJG 1H2YA 2WR8A 3IIMA 1KS2A 2FWNA 3HJFA 1M8PA 1QRSA 2M1ZA 3HP4A 2WAYA 3FFXA 2VDNB 1ISJA 3GMDA 4G5HA 3W6PA 2YVAA 4XQCA 3A10A 3ROXA 2W42A 3CZ9A 1XLVA 1TQ6A 4AO8A 1R4MA 2D13A 4DBLC 3GFVA 3HKCB 4WMLA 1N32B 2COEA 4YV7A 1O0CA 4YP6A 4MGHA 4OBEA 3S81A 4G4JA 4UOQA 4OO3A 3RVPA 1M2KA 4YV0A 1P5HA 4FGSA 3EZ9A 3PQDA 3PNVA 4KGDA 3SC2B 2Q9CA 3T3HA 2AOVA 3SZMA 3GEDA 4H60A 1CQIB 4EJ6A 1T29A 5DIFA 1L5KA 4F97A 1OXVA 1CJCA 1Z2DA 4U0KA 1MO6A 1XN1A 4TWZA 4YUXA 4XEUA 1X87A 4LXIA 4IAOA 3C98A 2YZ7A 1LPNA 3GJQA 4RJLA 4KV7A 4UBNA 5T41A 1VYUA 4BFZA 2BHRA 4UQPA 2AXNA 1NR7A 1U8EA 1W96A 4PANA 4RD0A 5IDYA 1YU6A 3R74A 4WBNB 1NUAA 5EWJA 2VAPA 1RQLA 1USGA 2X0EA 8LDHA 2IZ5A 2O2SA 3UAYA 2XNJA 5M2QA 3KQHA 3QMVA 2Z9CA 3GVIA 4KHZA 2FFRA 4F12A 4JVNA 4OBXA 4H7KA 4F2GA 3SF0A 4A9AA 3IJEB 2V03A 2CSXA 1ODCA 1OIWA 2PL1A 4IJUA 6LDHA 1KZHA 2PJZA 3NYWA 4C6TB 2B83A 3FLMA 3L4BA 4LIPD 3EUEA 1E3DA 4U2GA 4NG5A 2GGSA 4XGRA 2QLJA 4CKWA 4D3DA 4RL6A 3BJRA 2IC5A 4KIUA 4UDOA 5CGQB 3VZSA 1BN7A 1YB6A 1ZLYA 2QMYA 3KNZA 3L18A 1KARA 3QYPA 4PYLA 5EKDA 3UIEA 5AVXA 5HBRA 3GEPA 4UEKA 2YVUA 1NHWA 1EVZA 2HWWA 4J29A 1XU7A 1DSSG 1R1DA 2Z58A 3UFBA 1MTOA 7MHTA 2AN3A 2QX6A 3OZVA 4CTJA 1DRWA 1W9MA 3IR5A 4NDNE 1K27A 2ADFA 2VRCA 3EZ6A 3LO5A 3F98A 2NQ8A 2EJBA 2CUNA 3HGTA 3RFVA 1XK7A 5GV8A 1X6VA 5CDFA 3MN1A 5FEMA 1GRVA 3KUDA 5LPNA 1MOPA 5E95A 3BWCA 4HYTA 1ZH6A 2I7XA 3H6HA 3NIDB 5GGYA 1CUIA 4IMPA 4CTKA 1MA3A 2V6JA 2QXYA 3HC7A 4C5CA 3RTBA 5JD4A 1A7AA 1JJVA 1X1DA 2A5YB 4H1TA 3SHOA 4EMUA 3C3DA 3KKOA 2OB2A 1T4BA 4XM2A 4OQXA 5A9SB 3MWDB 2DERA 3WLOA 4AF6A 1CIPA 1JXOA 4FU0A 2G80A 4BKOA 2DETA 2J3DA 4NH4A 3E9QA 1G7RA 1RRMA 2A1TR 4C1NA 1T4CA 2DPMA 2WVJA 4NR0A 4TUYA 3FVTA 5ES4B 2O8CB 2EWMA 2GHQA 3SXUB 1N6LA 1K8ZB 5I7SA 2A14A 4ZVRA 5JV5A 3PFCA 2W8BB 4L5CA 4TV9F 5ECDA 1B1CA 1F06A 3ZHSA 4P3KA 3DFMA 4YJKA 5KQMA 3B13B 5IYZB 1Z62A 1EFUA 4MRMA 1M8GA 3OC6A 4QU8A 5FRDA 4BCDA 2WT4A 1L5GB 1ONBA 5SICE 3G2QA 1EDDA 1VMEA 2A5DA 1G20E 2Y99A 2Y77A 2YZKA 5I9NA 4MIKA 2GS9A 2GQ0A 2FX2A 3KEQA 4M9QA 3L4JA 2JLXA 2O8VA 2QGFA 1MAWA 1R50A 5F76A 4ZOLB 1W4RA 3AFNA 2J59A 2FPOA 1VXOA 3MT9A 3T3DA 1HH4A 3HFSA 4H27A 2P9ZA 5U4XA 2XRYA 2VWHA 3L4EA 1F38A 4QFCA 2NLOA 2LD4A 2HJGA 1AK2A 2C8VA 3UGTA 3FTFA 2XTNA 4RU1A 4X3OA 3TOCA 2UXDB 2F00A 3PC3A 3AUTA 3T4EA 5I8PA 2DBYA 4CIXA 3TLJA 3PFGA 4F5YA 4M7WA 5AVSA 2I5PO 4DNOA 1ATZA 2R25B 1QKKA 1VKNA 4PC6A 3PQ5A 1HRDA 3IP5A 1HETA 1B8OA 2PZ8A 4MA5A 4OLJA 2JLYA 3PFWO 1ZNZA 2WE8A 4RJKA 3RVMA 3C3PA 2Y1OA 4JBXA 3ZHBA 2A7XA 3G5LA 1JS1X 5IKEA 1E62A 1P2GA 3EDOA 2IEYA 2CDCA 4ZCTA 1EVQA 1CUEA 3FBWA 1Y3HA 2YWJA 4MPDA 4PHGA 5ECWA 1SQ5A 4IFEA 3ZNQA 3BERA 5DM1A 1M0TA 1BQEA 1R6AA 3C70A 5I9SA 3ZLJA 2I7DA 5K3FA 4XASA 1GZHB 1FMFA 4QBTA 3WO0A 4OQFA 5B1HA 4B3CA 2VDQB 2HPAA 2HHAA 3ER6A 1G5PA 2SECE 1S3GA 2C5LA 1HYQA 3BCSA 2V6BA 3E3AA 4TMTA 4BB5A 4ENTA 2OK7A 4RH1A 4A1OA 4BO4A 4NYMR 2VHWA 1DCMA 1JZTA 2ZT8A 4MUJA 3DL4A 3W3AD 4FQ7A 2BFBB 1E2PA 2FQWA 3LGSA 5BSVA 3RKSA 1EQ2A 4BNZA 3HN2A 4R31A 3X1MA 4NENA 3ZDEA 5FR1A 4WSOA 4NESA 4JB0A 1CTQA 4X44A 4BLOA 1BJTA 1OFVA 4DZZA 2X8LA 5EPOA 4CKBA 4HWKA 2X7XA 1HEIA 2PV7A 4G67A 1ZW6A 4Q16A 4I9HA 4TROA 1SU7A 3HHPA 3RFTA 4DKJA 1D4AA 2XF8A 2H2DA 3L8ZA 3QHPA 3GU3A 1CRPA 1KJWA 4MRRA 3BFKA 4C07A 2Q3CA 1FFHA 2NVUA 5EJAA 1S5PA 2OENG 1KDYA 1TAGA 1XTIA 3KD2A 4DMMA 3HWSA 4F2DA 1RWNA 4LBVA 5BO5A 4MKZA 4UQLA 5BQPA 4FN5A 1B8VA 3ONNA 4OQPA 4R2MA 5CT9A 1L4UA 2BKEA 3ZDRA 2IS6A 3OCJA 1GN8A 1RFGE 1OU0A 2CFCA 1QRUA 2GPNA 3I92A 2FZLA 2ORIA 4G0OA 4EJ0A 4MGZR 3BD7A 1YQXA 2YN4A 4XDGA 3NYQA 3MCAA 2I2FA 3VO2A 3ZDFA 1SBHA 1FDWA 3QE3A 2ZBPA 2P5SA 2PGDA 5ALWA 4WFKA 4CPDA 4DY6A 4ZI3A 1PR4A 1QG0A 1E3JA 1O97D 5ALKA 4D8TA 1FIUA 1D0IA 1DJOA 4A6XA 1MDFA 3S2UA 2OD9A 4CEHA 4HDNB 5ALSA 4M7OA 4B4DA 3SZLA 4F3CA 2J45A 2XE7A 1PG2A 1PEYA 4MYHA 2WABA 5TEWA 3GLKA 4JMLA 1PV2A 1Y63A 3V1UA 4AI6A 2JLUA 3DBIA 1NN3A 3FTNA 5ALNA 4O63O 1A9RA 5DNYB 4QLBA 1QIDA 4C3VA 4HP8A 1LLDA 4O5OA 4QXQA 4YAOA 4AAYA 1F60A 3IOYA 1XEWX 4BMDA 1XROA 3SVZA 2I03A 2P7IA 1QE0A 4RCVA 4B76A 3H5NA 2XMQA 1MHPA 3CH5A 1NKTA 4I6JA 2EP8A 1CR1A 2F3SA 3OZIA 4UULA 4UAVA 4HRAA 2H59A 2NUPA 5HKAA 2GM4A 1VLJA 2GNPA 3GJ6A 1KDTA 3ZYCA 1UK7A 2JBAA 2J3JA 5JBIA 2A67A 1Q15A 3F47A 4L6AA 1OX6A 3GCZA 4R1QA 4DLWA 5CM9C 3MT8A 2H51A 3X1WA 1R15A 3B8EA 4E5YA 1IM8A 2J07A 1SOVA 1YULA 3ABQB 4E2ZA 2RH8A 2EJCA 3HBFA 3I6MA 5AUOB 2BTEA 1YDMA 1IJBA 2C4WA 1D9XA 4WZZA 4JLSA 1C2TA 1HC7A 3KKLA 2QRPA 3C45A 3JWGA 4H4EA 4PFQA 2CCGA 1W73A 5BOVA 5HJEA 1HG1A 4L3OA 1MJNA 3ZDYB 4XFDA 1QANA 3FAZA 4HAXA 4I19A 1BS9A 4ZVMA 1Z0DA 4QDZA 3Q6MA 4HB0A 1PJZA 1T3HA 4G1VA 4B3DA 1TRHA 3KOYA 3PUKA 4DVJA 3HA7A 3KALA 3KQKA 2BCEA 4ERNA 1KP2A 2IH4A 1XU9A 2PVCA 4A6EA 5JHHB 3RE1A 5NULA 3K8OE 2RE8A 4NAUA 2OKCA 5HCNA 1KRHA 1NNSA 3LUGA 2RGCA 3WS7A 4A03A 1QS0A 1FS6A 2C7BA 2P9JA 4CQNA 1A2BA 2BMAA 2ZWVA 3OOHA 9MHTA 1E1NA 4MQFA 3R40A 3HBMA 4FFMA 4JI0B 4W1QA 1K08A 1LBSA 3LFHA 2JGAA 3RIMA 2H0RA 3MW8A 3HFRA 4W7SA 3NDBB 4XH9B 1LDBA 4UARA 1QFSA 2FZCA 1W0CA 4QDOA 5CMLA 4RZQA 2R4TA 1CQJA 1Q0PA 4N39A 4NKRA 4S3MA 2JJQA 5TE9A 4DMCA 2RI1A 3RIXA 3U7EB 2BISA 3P27A 3ZGLA 1QONA 5ITVA 2VT6A 3G8CA 3JW8A 1KE1A 3THXA 2DBVO 2VUTA 1XE3A 4TRJA 4NDAA 3QU7A 4LRYA 1OH5A 4HN2A 1XEXA 2L19A 4P2BA 5F98A 3L6OO 1VL1A 1A5AB 3IQHX 1V2HE 3BRWA 5AQEA 4BFTA 3QKRA 4N3BA 4UXIA 1LJLA 2ANBA 1MJHA 2SKDA 4TQGA 2GJSA 1P3Y1 4N47A 2P9CA 2IUSA 2NXNA 3IEPA 3JQQA 3O90A 4GX0A 2NV2B 3E2MA 3EQ6A 3NHBA 2OGTA 2OORC 1GSAA 2YX1A 1I1NA 3LYAA 4DDVA 3KKZA 3ETCA 2A57A 3R6GA 1RIFA 1JA0A 4GG1A 4RVSA 2IKQA 2SBTA 3OCWA 4L2IA 3QSYA 1GA1A 1CRZA 1K9SA 2CDRA 2VSXA 2X4GA 4G0XA 3KYIB 2ZB2A 5EKTA 5I9TA 3EHDA 5TPZD 2P1ZA 2Q2VA 5FFNA 3HXMA 4RTQA 1A88A 1GZ4A 3QY0A 3TZEA 1N6NA 3QUBA 3UUGA 1XKXA 2VJMA 2QQGA 4BP1A 3CW9A 2EATA 2NP7A 1FDIA 3CE6A 2H4XA 3AESA 1ZUNA 3R3ZA 2WNIA 2ZTUA 2KBFA 4HWRA 2FN7A 4U02A 3L04A 2PM8A 4IH4A 2YV2A 1UH5A 3D8RA 2QTRA 4NYJQ 1W2HA 5KYWA 3THWB 3W5IA 3HJBA 4YP5A 2CL7X 2I54A 2UU9B 3I6QA 5HCIA 2AH5A 4QYIB 3P0RA 1SR8A 4UTZA 3LHFA 5ITZB 1FNCA 3JRNA 2QG6A 3LUJA 3HRIA 5FIUA 2ZQZA 3EB9A 3EGDB 3ROPA 3COZA 4CLOA 2D4HA 1C1HA 4JGGA 3FJOA 4BVAA 2H4YA 4AJHA 3MERA 4BTLA 5JDIA 1BD3A 4ZO7A 1YV9A 1KSHA 2ZYVX 4Y2TA 2JJ2A 2RIPA 5JH7A 1L5OA 4FYIA 4RGQA 2DVMA 2IUEA 2OHVA 2NGRA 3FN4A 1JEEA 2IXTA 2XAUA 3D0OA 1II9A 2AUTA 3LJKA 4KFSA 4AJLA 1P2UA 1NIPA 2ONYA 1T25A 2G0NA 1EWRA 2VN8A 3SJBA 3A4MA 2EKDA 4W63A 1M2GA 3LPLA 3S44A 2WZQA 1JLKA 1RPAA 2P4UA 3AMVA 3CSDA 3MOGA 3ICEA 4EW2A 3VKUA 2GNOA 3A3KA 4HJXA 3BUSA 4B4KA 1Z4PX 2PKXA 4TXHA 2JJ1A 2QG9A 4X1KB 3D7MA 2LCQA 1E4OA 1CR0A 1AUVA 4BE7B 3GP3A 4Q82A 3ZZMA 3V8VA 1THMA 4NH0A 3WGIA 2JJ1D 4YGXB 3K2QA 2CLMB 2C98A 2ZIXA 2QY9A 5FOTA 2HRBA 1G7TA 2FSIA 4BIMA 1L4HA 3FCOA 2HT1A 4B3HA 3IJ5A 2QAJA 1O77A 2NO6A 1AU9A 4X3PA 3JQ9C 4FFOA 2V74B 2IEZA 1L1FA 3NWPA 3Q7QA 1IBCA 2GN6A 2J3KA 2P4QA 2PLNA 3KPYA 3LWBA 4GZMA 4P92A 3F90A 1UWKA 4OV6B 4LE1A 2W6ID 4NDZA 4OL0A 1Z7BA 2PUJA 4YAJA 2IS1A 4YCBA 2LRHA 4B34A 1YMVA 3WBKA 1YU9A 4EGAA 3HLKA 4I0WB 3BSYA 4KSYA 1ZD1A 2QSJA 2G9VA 4LHYA 3MTDA 3ZLBA 3CGWA 1Q16A 1MV8A 2R6FA 4D74A 1GNLA 1S2MA 4J16C 1TD9A 1V8PA 2P4HX 4KN9S 5A7GA 1DGQA 4JROA 1IJEA 2AKEA 4DLUA 5LWHA 3LKBA 1KOLA 5C80A 4YAIA 3QX8A 5K0BA 3H2ZA 1VG0B 3GUCA 4JP5A 2Y2UA 1EK5A 4CMCA 1NNEA 1VJ5A 2N1BA 3DVLA 3G3EA 3IEUA 2GZDA 1UBJS 5EIHA 1C50A 4CM8B 4NY1A 1LDYA 1K5DA 2DPGA 2EOAA 4HL6A 4YHBA 4IV8A 3NHZA 3CE9A 1E6UA 2HA5A 3QTBA 4LI0A 2V0GA 2HU5A 4RD2A 3EMVA 4CTMA 4CM3A 3I42A 3U61B 3WNQA 1J1IA 4YMVA 1IOVA 4HDRA 3IPAA 4MVJI 1FK8A 1QU2A 2PX0A 3R7SA 5JS7A 1J9ZA 4NFYA 1B73A 2Z6UA 4M87A 1YC5A 1ZJJA 2ZI3A 4KNVA 4PS0A 4RZ3A 3VO1A 3H7AA 3Q85A 4E94A 1O5IA 3IAM6 5HBGA 1SURA 2X23A 1U9IA 3BBLA 3WLEA 4RZSA 1XI2A 3LWDA 4YGYA 1E98A 4JZYA 5C8ZA 1RAIA 4HWTA 5CT8A 1U11A 3SPXA 5MHTA 4V0LA 1XCJA 4GI1A 5MN5A 2HEIA 4MEBA 4F4JA 4OLAA 3KEOA 1CUUA 4HNGA 1E7WA 1SFRA 2J09A 1RKXA 4GVXA 4D41A 1O6CA 1KMNA 3VZBA 2PIDA 2GWHA 2RBGA 4KQ1A 3EG9B 2H2WA 2NZ8A 2GAJA 3GLVA 1XPOA 5CYFA 3LC7O 2RGRA 3KKNA 5E2AA 4C20A 2UZ0A 5I6DA 1RXWA 4HEJA 2BSQA 1V4VA 2ZKIA 3GVCA 4TUYB 3UJ3X 1AQUA 1JG6A 2REOA 1LZLA 2KHZA 4IGIA 3E1KA 4UNNA 3GCGA 2Q1WA 2ZK7A 4PC7A 4CM4B 2NO7A 3B1JA 1TO6A 2V3VA 1FUIA 2A3NA 3DDHA 3LNCA 2A5FA 3DV0B 2GASA 3N7AA 3T3GA 1D7OA 5B1YA 3G2HA 1K6MA 3WNCA 3PYXA 3GCWA 4MWBA 3QJ5A 4Y2SA 1M2EA 5C4MA 1GEGA 4NCJA 3UF0A 3IEVA 1C8VB 1UMDA 1IE3A 3PFBA 3O0TA 1EFVA 3GK3A 3IP9A 4I8IA 4U2EA 3SCZA 4NYJR 1S2DA 4HVCA 5DKFA 3LVFO 4MEJA 2HADA 3HHEA 2VYCA 3I34X 3IS3A 2FN9A 1KY4A 5C9ZA 3AHHA 3DLAA 4U3JA 1QYRA 3HB4X 3MTIA 1KI4A 1L7DA 1ZDMA 3ESQA 1IHXA 4FMCF 4L7QA 2A94A 4O33A 1ETUA 1FQJA 3L7AA 5TMDA 5TPWB 4URFA 2AG0A 3TLXA 4EY4A 4WEQA 1D2HA 2EWVA 1G8GA 2PMEA 3VC1A 5KJ1A 1DARA 2EZ4A 4DHEA 4C87A 3UXYA 3AUKA 4HC4A 5HZKA 3IXLA 4MVJD 2B3TA 3LM8A 2AGVA 5DMHA 1ZIXA 2YWHA 4BN5A 3HEMA 2A33A 1U7TA 1XHLA 4E07A 1WUHS 4G09A 4K9NA 4BO2A 1HOTA 3A26A 4H1HA 5AI8A 1WG8A 4G1UC 1IATA 4D82A 4UNRA 1OX4A 3KCQA 1VI5A 1TF2A 3M6AA 4MUMA 4F91B 3ZJVA 1RVDA 3PWTA 4Y7DA 5THQA 4AXBA 3CF4G 2C2BA 4LC0A 4EF6A 4CDRA 3KR1A 3C87A 4G0PA 2C5FA 3HA5A 4PS1A 2FN3A 2N42A 1NQOA 1VC2A 1I7LA 1RXSA 1G8SA 4BKRA 3ZS9A 3JPYA 4MYRA 3R6LA 1E4VA 2OC4A 1W48A 3DHVA 4D92A 4K3VA 2WYVA 3JTMA 3PF9A 5ERYA 4BV9A 3GR6A 1ESMA 4Q6BA 1PR2A 2I87A 2PA3A 1TX4B 3IMGA 4G01B 3RYCB 3BQ9A 2IX3A 2XYVA 4EVIA 1HO3A 1QPGA 2IYOA 4NMMA 1L4GA 4URHA 1GSOA 1B76A 4W9NC 1LTQA 3OZBA 1TCVA 4M9XA 5BYKA 1U4NA 3Q12A 1Z0SA 3HXTA 2E4VA 2P2GA 5DBHX 1QYDA 1U8ZA 5BYJA 2VQEB 1N6RA 5K8JB 1HEYA 3H05A 1YDGA 2GK3A 2QYHA 5BN4B 1BGXT 4GLOA 4R71A 4HYEA 4OLBA 4PSKA 2G28A 2NZYA 3BTVA 5HQJA 2NZVG 5IHPA 5D00A 3HUTA 3U60B 3LV8A 2OO7A 4MTLA 5SYNA 7MDHA 1ZSNA 4BBAA 1FBNA 3CISA 3G5TA 1EP9A 2VJLA 2EBFX 3M49A 4HKTA 1KFEB 4XI9A 1N34B 3EXHC 4P4SA 1P1IA 4V38A 4E2YA 3UAXA 1N5LA 4J4HA 1JLLA 1W44A 1NBMD 2C1ZA 5B3AA 2CYBA 1DDOA 2DWCA 3LQFA 4XWTA 2QZJA 2Z83A 3ZXSA 4BTVA 1MB2A 3RU7A 1KI6B 1VFPA 4AC9A 4V0NA 4QTUB 4YP9A 4RK5A 4P7FA 2QL9A 4TQUS 3EIEA 3T54A 4A0RA 2GRAA 3CPEA 4YRTA 4DILA 4RTLA 1FYDA 1I0ZA 2KX7A 2X1LA 3F8SA 3CNLA 4G63A 4DZRA 2I3ZA 5BPHA 3QG5A 1Y8RB 2C7VA 2ZJ3A 4X41A 4DEXA 1Z7GA 1BCSA 2IYLD 2PPLA 4JI4B 2H6EA 3FFTA 2VPXA 3DEKA 3TQQA 4AMUA 1M76A 3VJMA 1RZ3A 2YS6A 1SXJA 2A1UA 1XZFA 3BE6A 3AJ8A 1YA6A 3RCBA 1G8KA 1YE8A 2UZAA 2EW1A 3O91A 4BMXA 4DQKA 3HN7A 2C9CA 1LK0A 3L8EA 3K73O 5IM4A 1NBMA 4LK2A 1ONNA 4RYLA 4B0OA 5KSZA 2BUBA 3IIJA 2GZHA 2Q4DA 5AKJA 4DA6A 2ZITA 1Z06A 2YC2C 4ROTA 1QGZA 4ZQIA 4CFZA 3Q3CA 3PGKA 1SKQA 1YQUA 1B14A 9ATCA 4HQRA 1DC4A 3FZYA 1PQUA 1GGJA 1TUEA 3JALA 3NEAA 3PQ7A 3V2UA 1LX6A 2PR7A 2W7TA 3O2QB 2Q6VA 1TEVA 2QOEA 1WPQA 2WNSA 3A06A 3BGIA 3EEIA 3QW2A 3RI3A 4O4JB 2FEKA 1IXZA 1FNDA 1P81A 5G0UA 4XVUA 1W29A 5F23A 3DCJA 4LXQA 2AHRA 2W6OA 3GIWA 3I28A 3O8QB 2Q3BA 3P9YA 4EG5A 3U3JA 4G9EA 4HSGA 4RBNA 3H2BA 2ID8A 2XHZA 4UMVA 2Q3JA 2PU5A 3SM3A 1QK4A 1QMGA 4OD0A 1AQYA 4KTVE 4FFBB 4G9BA 1NVBA 3EH2A 1I7PA 1XQWA 1EFPB 5FEUA 2XWJI 4DNXA 4MIOA 3H5LA 3SC3A 3K15A 3PUVA 4RELA 2GN2A 3NTVA 2ECQA 3PPWA 4V0KA 4IRXA 1OH6A 4JUBA 4OA8A 3FRHA 1DKOA 3P9QA 5BNZA 5D5PA 4ZCRA 3S55A 1U5BB 1ZK2A 4ITUA 3SS7X 3PA8A 2P1DA 2BJVA 1LNZA 3GRVA 1L6IA 1JKXA 2QRVA 1JILA 3L07A 3N07A 4C2BA 1E9CA 1ZJ4A 4KR6A 1BH2A 3SBDA 4BB0A 3DG9A 2Q9AA 2PUFA 1TTHA 2O54A 1Y4DE 4JLPA 2CHQA 2GEBA 4GR5A 1REQA 1SCDA 2ZREA 1P9LA 2X4DA 4IY1A 4N54A 5KOHA 3O3CA 2O6LA 3SE0A 4HDMA 1X70A 1NUUA 3GVPA 1IAQA 2DJIA 1ZM7A 4YMIA 5G3ZA 3R9KA 4JLKA 3U4AA 1C7FA 2YVQA 1IB6A 2QP9X 3GARA 5JSFA 2GVNA 1V6SA 2OBXA 2YWFA 3B6ZA 3NBMA 4F1JA 3U0BA 3W7BA 3DHYA 2PYZA 3RQSA 4BFUA 2BGLA 4L6CA 2RH5A 3HY3A 4JBLA 4N0MA 2DH6A 4PLWA 5L3ZA 3WQHA 4X7BA 3SVTA 2YVKA 3S2SA 4MGEA 4WESA 2EW8A 3VZRA 2Y68A 2KSQA 4AKSA 5BRJA 4TLBA 4ZCLA 3A36A 5GWXA 2BW0A 2AZXA 2QP4A 2WIFA 4B4VA 3BFPA 2J8ZA 1DOZA 1ZW1A 4Q1DA 3EYWA 4EITA 3C14C 3RYFA 4R8SA 3EXFB 3QKSB 1J7KA 2R751 4KN5A 3SDZA 3ROGA 4MAAA 4POAA 2H06A 4EHIA 4XM1A 1P4JA 1XCGB 4ZYXA 1JHUA 2DY1A 5LM3A 1I4DD 4YJGB 2VTVA 3N3BC 2G8NA 3EZ2A 3DE5X 1JFFB 1LSUA 2GJ8A 1RKQA 4YWJA 3SI7A 1CQIA 1Z45A 2CJPA 3LT4A 3N0WA 2IHVA 3ZU6A 4BJ3A 5HRCA 4LCBA 1WM1A 5K99A 5KMGB 3CUUA 3M5WA 3CVOA 4RGBA 3L4BC 4TOIA 4UCXA 4B6PA 1DL5A 4BNGA 1M6VB 1ZHFA 3S7TA 2HFJA 3DEIA 4DLRA 2O8BA 4CMKA 4AKGA 3TXYA 4YCCA 4GR9A 2C5GA 1KI9A 3WL5A 1JFRA 2CXNA 3KUCA 3GGJA 1IQUA 1LQ2A 3EJ6A 3LECA 2DHDA 4WKBA 1YIOA 2QE7D 1MW9X 2IIVA 4D80A 3PIIA 1GTRA 4Y0AA 1WKVA 5KVQA 3WNBA 4HUQA 2VHCA 3V42A 4DLXA 5KTOA 3M1IA 3PGMA 4X6LA 4YJ3B 4YQFA 3IHLA 5FPQA 2PSHA 3AGPA 3QA3E 3NGMA 3NKLA 3WGYA 3K6KA 4F2WA 1FVHA 3AB7A 4L7VA 4YY3B 1V6AA 3FVWA 4JLAA 5FBLB 3WFIA 3MS7A 4G0MA 4DDUA 5CEEA 4P5DA 4BO1A 1KAQA 1IB0A 1U0GA 1KVRA 5CW2A 4B1FA 4ESVA 1TO2E 4PXAA 1K3UB 4DSUA 4J03A 1SXJD 1WP4A 4DIKA 4UFNA 5BSWA 4NU5A 4C7OB 1GAQA 2BFEB 3IOBA 2WTEA 2Z08A 3KBBA 4HWGA 5E0KB 5ERXA 1BCRA 4BNFA 5JZ9A 2CLFB 1IY2A 3PICA 4YDQA 2EWWA 3CB4A 5JVDF 4MKHA 1O8CA 1UIMA 4YA6A 1E7YA 3IERA 4AYXA 2A9QA 2FWJA 5DFAA 2BP7A 5DASA 5CLHA 5JRZA 4UC0A 4X3CA 4TKZA 2ODTX 4JENA 1TLFA 3PV0A 4MIYA 4OIFA 5CTJA 5A1JA 4N7RA 1A4RA 1V7QA 4KQWA 5JC1A 2ERYA 4HY3A 3LGAA 1DV1A 3LUKA 3TW0A 3S40A 4Z54A 3BIJA 4PC1A 4II3A 2NU8A 5HHTA 2C7RA 2X0DA 3TL2A 3V6MA 3WMFA 5LA6B 2XCSB 4MW0A 1SUPA 2COKA 1U2ZA 4Q7MB 4TL8A 4PZAA 1RJGA 4ZO9A 1LBTA 2DC1A 2YIJA 3K0BA 1GV1A 4MI9A 4B48A 3D6JA 4OQ4A 1Q6YA 3RFCA 3LWNA 5D01A 4P4TA 3UICA 5G0WA 4WESB 2HGSA 4UE6A 2FFJA 4KMRA 1KJ9A 3O8NA 3QV2A 1P1KA 2VK2A 2ZUDA 1L5FA 3LYLA 2BFMA 2XNHA 2UZ3A 5E7IA 3NM5A 1LFAA 1H1DA 1KO8A 3FI0A 5BNTA 2HF8A 5IK2A 2YW2A 3OI7A 3EIUA 1MIHA 4Z4GA 2QM7A 2QVYX 4KKXB 3ZY3A 4FS8A 5HMMA 5KYNA 1D6JA 2NUTB 2PHZA 4FGWA 1UP4A 4GP6A 4YJGA 2OO5A 1EJ6A 3FUTA 1J2YA 5EP2A 4E6PA 3R2JA 1CRWG 2VJNA 3V2HA 4A0QA 5KSYA 2ISSD 3UH1A 3HCRA 4R3NA 4GPTA 3ZD6A 2Y76A 5FWAA 4HJRA 3AB8A 3NHYA 5JHGB 2QR2A 1RWVA 1GPH1 2MHCA 2O8BB 1ZGCA 2WT8A 3KU4A 3LOQA 5CA0A 3UC9A 1RYZA 2AOTB 2ZYDA 1BJRE 5HRAA 3ND8A 1UP7A 1EXDA 3ZX4A 3TQCA 1IHUA 4D3XA 1B6SA 2NPFA 4D2IA 3PC6A 1AS0A 4GVLA 4QPPA 4ZAWA 4CF6A 1HMYA 4Y6PA 5F5XA 1CDDA 1UFQA 2P35A 5LQDA 2NVUB 4JJ8A 2HA0A 3A2NA 3EEBA 3QLEA 5FYDA 4B7AA 4BFLA 4DLTA 5JCXA 3K5IA 3OJ0A 3WYFA 2ZIUB 2ZYHA 1Q2UA 2AX4A 3GXBA 3A58B 3VOAA 3T5AA 1UIRA 3SYTA 1OI4A 3ZIAA 2WTNA 4US2R 4XSHA 3QWBA 4RY0A 5DLDA 3VI3B 3GJ3A 4JYZA 2ZSFA 3HZZA 1CR2A 4KXVA 3NBKA 4C30A 3TQTA 3G23A 1QRTA 3E05A 3DTVB 4BQPA 1KEEA 1E1QD 1GILA 1U9CA 1KEUA 4C4SA 1HF3A 3UQYS 5BWLA 1NASA 1IIBA 1NTRA 2AF4C 2ZBUA 5LBTA 4L74A 5AHWA 3CCFA 3FNBA 1CUSA 1GG8A 2YWRA 1EP1B 2DSNA 2CHVA 4H4DA 3C24A 2SCUA 1M2OB 1ZI8A 2PCLA 2EZ8A 4J94A 3LUPA 1TM4E 5EIWA 3ESXA 3QWHA 4LY0A 3MRVA 3CX7A 3ENKA 2H3HA 2VHZA 3RREA 4E7PA 5J23A 2Z8ZA 1NWHA 1SD5A 2CZCA 2EG5A 2BJWA 2NU8B 3VBCA 1BVUA 3ZZ1A 3A1UA 4L4UA 4LJ8A 3WGVA 3GUHA 3MAJA 3EC1A 1WZIA 1P0IA 3OIYA 3GJRA 3O9MA 4WTOA 2BSXA 4TTTS 3QOFA 4NJMB 4AO6A 1V11A 5FO1A 3UJBA 1HFWA 2HI0A 2GVDC 2ZYSA 2JIDA 1QO7A 2WSBA 5HCUA 3VR5D 4DQ0A 4TMFA 1AV6A 4J6FA 1PG0A 1U81A 4CKZA 2X0RA 4OUDA 3SNHA 4BMSA 3PDUA 2FW1A 2PU7A 4CVNA 2ZVJA 4BRZA 1VE9A 4DA9A 3SX0A 2H5EA 1R0CA 3WQQA 3QWIA 4H0CA 1ATIA 1JF8A 3IMKA 1U0NA 1QP4A 2VF4X 4RVHA 3VKWA 2JCSA 3K8ZA 1HZJA 1TPYA 1TKAA 3E3NA 4XWOA 2CL0X 3GGCA 1OI2A 3H84A 4CMBA 4NQZA 1E2HA 2C58A 5F7XA 5HQ3B 3DMGA 4HD8A 2QM0A 1B93A 5JARA 4ESOA 1WA5A 4RMNA 5ICFA 2W2TA 5FL7D 4QHYA 3TCNA 2D54A 4QA9A 1BAPA 1Q77A 4GSYA 2IZ1A 3JVVA 1UMCA 1A5TA 3MIZA 4RS3A 2CXTA 3ZH9B 3ZQ4A 2XGOA 3OG9A 1ADBA 2GJ9A 2ZOSA 3PNSA 2PZMA 4JLJA 4QUKA 3V33A 1X7WA 3JYLA 1L5ZA 5JBQA 1EIZA 1WV1A 2OO3A 3EULA 4FW9A 4AP5A 3M7IA 2HCJB 3W8FA 1Z4LA 4G0UA 4G41A 3BE5A 2O3JA 2X58A 4J0CA 4LE2A 4M54A 1LPSA 1VGVA 2IQIA 2VUUA 2QRZA 2D4AA 3FKQA 3DA8A 1QU3A 1D1QA 4MV7A 3EGXA 4B84A 1BYUA 2AW3A 3COPA 4BP3A 3K9QO 2FE1A 1ISSA 5C8DA 3HU2A 2CMHA 4A0GA 3IKTA 1EBBA 2RDMA 4ZKEA 4YRGA 1TB4A 2PRJA 5HDBB 2B4YA 4ZT7A 1V96A 2RAFA 2XVMA 4RPHA 3HKCA 1NZDA 1FYEA 1P4HA 1RFLA 3KOMA 4Q47A 2PNJA 3WLSA 1DCKA 1J8MF 3RJTA 2X1HA 3UXMA 1ZR2A 2YS7A 4HLUA 3GH3A 2DFNA 3TLBA 3O8OB 2II6A 3ZE9A 3ZD9A 3ZGOA 4WQMA 2G06A 4MVJM 4JQSA 1E7QA 4PZPA 1MABA 2ZXEA 3NYRA 1E18A 3LDAA 2CXOA 4XYGA 1SZDA 5HWSA 1TT5A 2IVFA 4HQOA 2V8OA 4ETIA 3EOZA 3VYRB 4J4BA 3UA4A 3EODA 3QXSA 3R4VA 4IQ8A 1Q0RA 1UPTA 3AT1A 3NIGB 4UAUA 4XIYA 1WABA 3CKKA 3U4GA 3ZQUA 2CE2X 4D9KA 4NBKA 3IYLW 3R5SA 3UZUA 3W2EA 3BWYA 4AUMA 4Q03A 3HDYA 2H11A 2D2EA 2O7SA 2QL5A 5CT4A 2EC5A 3SMQA 5JATA 2WB2A 5E2BA 2WZDA 5KTTA 5JJIA 1N6OA 4JLUA 2PLRA 4X71A 5BSGA 5AFSA 3ACCA 1LCIA 3FA2A 1LF5A 2GM5A 4UDYX 3RIGA 3JYNA 1K4MA 3PNKA 1OV4A 3FYHA 1DQSA 5K3CA 2CK3A 3DFUA 2Z0MA 1R18A 3NLLA 1X80A 5E1MA 1Y48E 1YE5A 1DC7A 2QMOA 3G0DA 4JP3A 1ORVA 3UM9A 4REQA 1Q7BA 1JNYA 4KQIA 4UBLA 3RANA 1N6KA 1BH6A 2OEPA 3A14A 3FR8A 4GPEA 2CHUA 3GC6A 3KWFA 2X76A 3IESA 4I4TB 5A03A 1R0RE 3X1JA 3WBFA 3A1VA 1OFHA 1MENA 1QDLB 3HY6A 3KP1A 2REQA 2Z09A 3DL0A 2PXAA 3UAZA 4W6QA 5KC9A 4LDJA 1YRLA 4B3TB 1EE2A 2VTDA 3IILA 5AIAA 5EE5B 4YRIA 4W5QA 3H9QA 5KAPA 2GFIA 1YVDA 3RTGA 1QZXA 2RI6A 5AOAA 2P9BA 4ZDWA 4TZKA 1JX6A 2P3LA 1RWKA 4BB6A 1ZSYA 3G13A 1PQWA 4R40A 5I9BA 4JQCA 4QC2A 3AW8A 1QTQA 1G19A 1JR3D 2V5VA 5IT5A 4PG4A 3NOVA 3T1NA 5JYBA 1QXSA 3SC2A 1WQ1R 2JIZA 3C41J 4EYSA 5C5CA 4K3UA 4HHEA 4Q3AA 1PQYA 4YNBA 1WB5A 1L8AA 1HFEL 2LGJA 2R8BA 5COBA 1XVVA 3AXSA 4J2TA 5I7VA 4BX0A 4JQYA 5LZ8A 5GAJA 3TKAA 3VHXA 2IV2X 1R5BA 4CUZA 3E9ZA 4DUYB 1X15A 2REQB 3QPWA 2QM8A 1L5LA 2QN6A 4ISCA 3BIOA 4O0MA 1VA5A 1ZX1A 1LK7A 1MLDA 3JVDA 4OHOA 1H94A 1YZTA 1ZS9A 2Q41A 1VDZA 4IFIA 4RPJA 4XVCA 5CYGA 3QBTA 4QXAA 4CCYA 4Y98A 2RMKA 1Y6QA 3I0MA 3UAOA 1H6AA 4BE4A 1XNGA 3MILA 2C9OA 5ELMA 5A02A 3EIOA 3ZDXB 3KJNA 1C3OB 2HMVA 4F46A 3H1GA 4WXYB 1NW8A 2X3YA 1YJ5A 1JVNA 2XODA 2XTMA 4NYMQ 1XMOB 5ER6A 2H1OA 3ZWDA 4EOGA 1HUQA 1MO3A 5FL3A 4WN9A 3UJHA 3BJMA 1ZU4A 1OHHA 4JMPA 4PY2A 4CWAA 3NBQA 2O14A 5ALMA 4EF4A 4E46A 5CFRA 4BNUA 2H16A 1U1IA 4BE9A 2Y1WA 1QVVA 4ZP1A 1KORA 2WZBA 2VQSA 4KXYA 3ZY5A 3G2OA 1DIBA 2HSEA 2Y71A 4C0AC 3M83A 4DUGA 2VF2A 3KB2A 4AYTA 2O2HA 5ESWA 3TN7A 1A8UA 3GQVA 2B78A 3MTEA 4IS3A 3HGQA 5A4JA 2QR5A 5ICGA 4XRGA 4ZTZB 1C4KA 4KLRA 4XWWA 1YZVA 4KKVA 4E3ZA 1ZGJA 4IP0A 5REQA 3RD5A 4LGMA 2GCOA 1RYFA 4Y9RA 2F4VB 2O2GA 4JJFA 1CX9B 1NI4A 2VJAA 3MPUA 5SY6A 4GYJA 3GFBA 2XWQA 3L0OA 2JH9A 2B5OA 2R5WA 4JC8A 2W2LD 5AVRA 2C4VA 3ZGNA 4A8PA 1ZJ5A 1FDVA 5FTNA 1NT2A 4Y2HA 1XTTA 2QUHA 1A95A 2I4IA 3DEAA 3NDPA 4NBUA 1GPKA 2X22A 1MFPA 1X1CA 2WWIA 1KWGA 2YHAA 2O7VA 2P9FA 4XUGB 2I62A 4HDOB 5ENVA 5FD8A 5EIXA 1NG9A 1RPZA 1EGMB 3QUQA 3GT3A 3K9NA 1NR1A 5A2QA 4A3SA 1E9FA 3T3IA 4WXHA 4F4IA 1WQ4A 1ZFNA 1XMIA 1RQRA 2ZYTX 1EVEA 3GOQA 2N0SA 3MJRA 4EB6B 3Q8KA 1P1HA 1VL8A 4FBLA 4R7GA 5I9MA 2Y67A 3VR2D 2HYDA 3RYHA 1D03A 5TLSA 1GAXA 3GPBA 3NZEA 4V0QA 4URXR 1MAUA 5CT5A 2QQFA 3NHKA 3ZLUA 3G9XA 3CEJA 2MSDB 4IDPA 5F73A 3KQYA 1QV7A 3Q5GA 4QRHA 4PG5A 4YT5A 1CLEA 4R1MA 3ANNA 2P9EA 3BMOA 3MGBA 4EFLA 5LOVF 1DBQA 1W87A 2JC3A 1YMQA 4KBFA 4X97A 2C54A 2XUQA 2AZDA 2ZRIA 4MQLA 1TK3A 4NAHA 4U8HA 3INNA 2C00A 4FILA 4AY4A 1TEZA 3LY7A 3QKWA 3DAHA 5H82A 3TOXA 5J4YA 2WWYA 3E70C 2CUZA 5EJ6A 2V58A 1VI6A 3X1ZA 2P6RA 4BWFB 1LC0A 3PKZA 2WYIA 2WM3A 4AULA 3GWZA 3HE3A 3R7LA 4Z7OB 1W76A 6YASA 9LDTA 3TZLA 1XDBA 1S9HA 3MJSA 4XYEA 3JARA 4D6YA 2ENWA 2GYUA 3VU0A 1M7BA 3G88A 1NZFA 2REXB 3FNHA 4AURA 1E6CA 1W2WB 2XDWA 4EUFA 4EI8A 3O9VA 1SCIA 3FOCA 5JY6A 1M6NA 2XNCA 4J0JA 2QVXX 4KI0A 4QTZA 4XFJA 1YASA 3GJZA 4D1YA 2WU1A 2HJVA 2V3CC 5KOJA 3B3GA 2XBUA 3SYKA 3GEIA 4LPSA 2EU8A 4O02B 4BYGA 5IVDA 5FUQA 2WHXA 2XUAA 2CFTA 1QNLA 1D8AA 2NU6A 4L4RA 4Y0VA 5BSRA 3RS3A 4E30A 4XVRA 2CJWB 1LZKA 2XUHA 5E3HA 1PT7A 3NIWA 3OKCA 3WP0A 1T5DX 3GMTA 1B0AA 1QHIA 4JC5A 1CJSA 3AEXA 1GR0A 2X3FA 1PEKE 1ZEMA 3P5BA 3ORQA 3VHRA 4F7DA 5IWCA 3VDXA 2E4XA 3SSMA 4AJOA 1FOEB 5BVGA 2BEUB 3BL6A 4JCOA 4NPAA 4Z86A 4CI9A 3W5BA 3GD7A 4WNYA 3WIVA 4P8RA 2JZNA 3AOGA 3GCDA 1JIQA 1Q5PA 2FR8C 4LSMA 4KITB 3G82C 1ZD3A 1ZQ1A 1TKRA 4NEGA 2FSGA 2UDPA 3R6WA 4I9UA 1H2FA 5JNTA 3ZE2B 1CEEA 4V3BA 2FQYA 3MMNA 4FX2A 5ANRB 4ITVA 4K40A 1SB8A 3E3LA 2FQ1A 4MWEA 2QUJA 1A1SA 3C6QA 5EWMA 4CNBA 1B6RA 1UJ2A 3N2GA 3IMCA 4AS3A 4DA4A 5A4KA 2KLHA 4I3HA 4NF2A 1UJMA 2BF4A 1GLGA 3QA9A 2J5XA 3PWKA 4LZPA 4UXJA 2ZBGA 3IPYA 3U17A 3I62A 3ZBQA 2QT1A 2WFAA 3VAYA 4LF5B 1K8QA 2EKBA 3DZCA 1D2GA 4G4IA 4MO2A 4UVEA 5AJTA 1SBTA 1TTPB 5A04A 5JMWA 2FHSA 4JGBA 5K8LA 1DAEA 1N2CB 2AJTA 3AI2A 5JSYA 1Q3KA 3L8MA 1I4OA 2H8GA 3LKDA 4KMOA 1LSSA 2NZWA 5FADA 3RC9A 1XKTA 1DQZA 3M0EA 4FDVA 4G0NA 1NMQA 4MW1A 2BZ0A 4QEZA 4BMOB 3GRAA 3VKVA 4W4TA 1Y7HA 1SIBE 3QOYA 4PSCA 3S8YA 2HIGA 4OIMA 5K3EA 1FP7A 3PUHA 3WJ2A 1B16A 2FZVA 5AT1A 2BMWA 1N3IA 2X41A 4R68A 2QD1A 4JJAA 2ODPA 1DHTA 1P7PA 3UHOA 1JVBA 1XKQA 2FPWA 3RRBA 4OAQA 3U80A 1OD6A 1YS9A 1E5DA 1EX6A 3PNQA 5F77A 5TT0A 4BGUA 5KYXA 1EGHA 2W2QA 3ELBA 2C9YA 2HJRA 1SC3A 3TTSA 1XO1A 4DG5A 4W5TA 4IGAA 1YOVB 4I55F 3CT6A 3DO6A 4OYLA 4X6YA 3UWSA 6CHYA 4C2UA 2V9CA 4HR7A 4FZVA 4IVRA 4XYLA 3T0IA 1BXGB 3STHA 5ALJA 3UJPA 4DOMA 3C6ZA 3OTOB 1DZIA 3KB8A 4G0ZA 3G0CA 4ISBA 1GUBA 1UC9A 2KS6A 4J16A 1BKYA 5E4YA 3PHBE 1U98A 2ONCA 1W1IA 4IMJB 2FK7A 1O94C 3ONWA 2C3MA 4Y6GB 4X65B 4PC2A 3USZA 5HXAA 3QUTA 2QZZA 4RXTA 4M4SA 5KNBD 3ADCA 3A1EA 2AUMA 2GDZA 3PT5A 1EDZA 3H9JA 4QUAA 1R4AA 4WH0A 4B6SA 2HDNB 2QLBA 3ZR4B 1OVGA 1RQXA 5E9WA 3KJXA 2WI8A 2XA9A 1J33A 1U0JA 2CFRA 1KQFA 2N3ZA 4DQUA 1AQNA 1C9JA 4M0DA 1RR6A 2E4UA 3RAJA 1IBSA 2I2AA 1N0VC 4H08A 3RRYA 4E09A 4TVSA 1XDGA 1HZZA 1MX3A 3NIBA 1SUEA 3TMAA 1PFWA 3AP1A 1LI4A 4MW7A 3V1LA 1XNRB 3T95A 5FA6A 1T8TA 1ZP6A 5ED0A 1D9ZA 2Q5EA 1MHTA 4UM5A 1VHQA 3ANYB 4U4AA 3WKAA 3O3OB 3DC2A 1GTZA 2X8JA 4F60A 1QHNA 3ROKA 1BCRB 5AI5A 3EFEA 2F1OA 3GLGB 1M5TA 1DBPA 3TIXB 1Z7WA 1OFTA 3VNVA 4TTQA 1YR9A 2AC7A 4EW3A 1JAHA 1SBQA 3A6PC 4HAVA 3D4PA 1YHYA 4B2PA 4C0SA 3NTQA 4R3UC 3UNXA 1YZFA 2NUBA 2W4MA 3AY6A 5EERA 5TMEA 1EUQA 1GL3A 1R0LA 3CZMA 3ILHA 3THRA 1QAOA 1Q11A 2FPPA 2IKSA 2ZVDA 1UDRA 2WYHA 3GJ8A 4MWOA 4PHTA 3VNBA 3WJ1A 4PLFA 1OGIA 1KAEA 4GQAA 5B2FA 3E53A 3MMSA 1FMJA 4KO8A 4IUCS 3FTCA 3INGA 2CMDA 2VBIA 3NUZA 3R3JA 4IGKA 4MI6A 1NRXA 2IL1A 4J2OA 2RGGA 4B46A 4AQ7A 3O8DA 1ODKA 4ER7A 3AUUA 5JG7A 2NZ2A 2QAGA 4MRAA 4A8TA 5B4TA 4JL5A 1TF5A 4BX3A 2Z9BA 5EQJB 1HSZA 1Y8ZA 1VHLA 2Y4NA 3I2YX 4OAOA 3H0CA 5EE0A 4MVXA 5LLTA 3RSSA 1E2NA 3D59A 3EQ8A 4EG6A 5BR4A 4WFQA 1YJ8A 4E4YA 1ZNQO 3R7WB 4IPTA 1I0IA 2Q3DA 2QL6A 1UMKA 4LBYA 3UA3A 4ZJUA 1BWRA 1ZH2A 3I9KA 3S28A 1R4ZA 1PJCA 1HYEA 3PS9A 1M34E 1Z56C 1WF6A 1EFLA 3AI3A 5G4LA 3ZE0B 4BMCA 5B3LA 1JR4A 1JHYA 3H5OA 2BL4A 1QQ6A 5E2IA 3RUHA 3VGJA 9LDBA 4E21A 3V4RA 5IZCC 4OXYA 3K1YA 2XNDD 1H4SA 3HO8A 4M9SA 2W2VA 1ETHA 1XRNA 1AQIA 2EF1A 4DUPA 3TTWA 3UWOA 5IXYA 3DCNA 1PJTA 3W5VA 3OQPA 3I6YA 4K1LA 3ZDBA 4EPYA 1BMFD 1QTNA 2JLQA 1QRDA 1WPRA 2R9VA 5H7XA 3FCXA 3ZKWA 3ZVNA 1JWLA 1QQ7A 5KWJA 2AOUA 2VJYA 5FA8A 4BAGA 4KIWA 4Z4EA 5E7MA 4IF4A 1EDOA 3B2NA 2YNMD 3F6CA 3FUWA 3LU1A 4C14A 4BYMA 4F45A 1H2BA 3A25A 3FPHA 1RJEA 5DYGA 2IXFA 3FSGD 1PNOA 2ZBQA 4XPIB 1WB4A 2C2MA 2AWOA 4X20A 3JX9A 1ID8A 1Z39A 2A59A 2FSVC 2ZZNA 4DIDA 2Q1SA 4TM7A 3MS2A 2Q3HA 3SP1A 2IJGX 2FMHA 1G5TA 3HFGA 3LBYA 1FX0A 3P0HA 4GDMA 5HZGA 1FYXA 2H00A 3TJZA 1IPHA 1Z33A 2JI9A 4EARA 3R20A 2ICAA 5GVRA 5AW5A 3BE4A 1Y5RA 4QOGA 1CDEA 2C7OA 4OH1A 1DQPA 1MC1A 2ZYAA 1XVUA 1KH3A 1E3TA 4OQYA 3STTA 4TYWA 4M0PA 5JS2A 4UHJA 1KJNA 3ZKWB 5DB4A 3HA3A 1FW8A 1TO1E 5COAA 2QXUA 3KHTA 2GR9A 1ANKA 5DGCA 1NQVA 2OKGA 2E4AA 1MC8A 1BW9B 1PS8A 3PEWA 5ESXA 2JJMA 3QOWA 2ZWMA 4PLVA 1M7HA 5LQUA 3K1ZA 1FL9A 1GHTA 2EZUA 2Y0BA 3G2PA 1OE0A 3KLOA 1WMFA 4LE0A 2XGGA 4K6MA 4BLPA 1K97A 2R68A 2QYOA 1NXPA 1M1NB 1I6KA 3A3YA 1IXKA 3DD1A 4XUDA 1D07A 3PVZA 5EJEA 4YYZA 3DNFA 4R05A 1C1YA 3U7RA 4QNRA 4BO6A 4KE7A 2XLCA 1SVNA 5J1TB 1C1DA 5CH3A 3UVEA 3FLAA 4RSHA 2VPQA 1HYGA 4Q9HA 2OFFA 1TOAA 2RAPA 3EMKA 5JE8A 3K16A 2LP4Y 3IMEA 2JH3A 3WLPA 3L0CA 2FPRA 1S1CA 3SIXA 5I7WA 3IOMA 3TEMA 3WO1A 2GZ2A 1N