1CP6A

1-butaneboronic acid binding to aeromonas proteolytica aminopeptidase
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (AMINOPEPTIDASE)
publication title 1-Butaneboronic acid binding to Aeromonas proteolytica aminopeptidase: a case of arrested development.
pubmed doi rcsb
molecule tags Hydrolase
total genus 114
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 1999-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1cp6A00
3SJXA 4JZ0A 3FX6A 4A39A 1ZG7A 3D7DA 1FNOA 4ZX8A 4CPAA 2ABZA 2ANPA 5K8MA 5LYIA 3PB4X 4UEZA 3BHXA 3SI0A 2PJAA 2GLFA 3ISXA 4MCSA 4OIDA 3GLJA 4X8IA 2PRQA 1F57A 2EWBA 1CPXA 1ZG8A 2EK9A 3KQXA 3L2NA 3B3VA 3KASA 3VATA 5K8PA 3D4UA 2XEJA 4OP4A 6CPAA 4R7MA 4UEFA 2IQ6A 2ZELA 5ELYA 1Z5RA 3B3SA 1Y7EA 1VGYA 3WC6A 4IK2A 5HXDA 2WYRA 4MHZA 2CF4A 3LWUA 5D8NA 1TKJA 4R76A 4OC0A 4AXVA 4NGNA 5HVHA 2PJ6A 2ZEHA 1IY7A 1XFOA 3S9LA 3KR4A 2XEFA 3H8GA 4UF4A 1DE4C 1IGBA 2BO9A 3IIBA 4ONWA 5LYLA 8CPAA 1LAPA 4A38A 1H8LA 3PB9X 2ZEPA 3CPXA 2PJ1A 2PJ5A 4MHNA 3WC5A 2XEGA 5DS0A 5J1QA 4OKOA 3IO1A 1GYTA 2PVWA 2AFMA 1CPSA 3TC8A 3QNVA 3KHXA 3KI9A 3KL9A 3HLPA 1HEEA 4O23A 1PYTB 2NYQA 3NH5A 4P10A 3DLJA 4B6ZA 2IMOA 3FJUA 2PJ4A 3PBBA 2AFSA 2OOTA 4NJQA 2WZNA 4P45A 1TF9A 4KSIA 4NGSA 4RUHA 2V77A 3FEEA 3SJEA 3B2YA 4ZY2A 1XMBA 4NGRA 4JYWA 3SI2A 5IB9A 2OR4A 3FF3A 2XEIA 2C6PA 4BD9A 4PXBA 1ARMA 3IJ3A 1RTQA 3FECA 1VIXA 2QYVA 3N5FA 2F8HA 3TX8A 4EWTA 2PJCA 3PRTA 2PIZA 2JEWA 1Y0YA 3LMSA 3D67A 3V38A 2RFHA 4DUKA 4DYOA 4X3RA 4OC5A 1ELMP 1YW4A 1QMUA 2G9DA 4PXCA 4UIBA 3KZWA 1XRYA 2GU2A 2ZEOA 4OMEA 4P44A 2JBJA 3B3TA 2PJ8A 3B35A 2ZOFA 5D29A 4P4JA 5CBMA 1LANA 4IHMA 4F8ZA 2RB7A 4WWVA 2ZEGA 4MCQA 4EFDA 4LQGA 2C6CA 3VH9A 4YU9A 5LYFA 1AMPA 3SJFA 2EK8A 1XBUA 2Q4ZA 1LCPA 4UEEA 3MRUA 4P4BA 4UIAA 3T8WA 2GREA 5K8OA 4P4EA 4MHPA 4TWEA 3D7HA 4OC1A 4W9YA 4FUUA 4OC4A 2IJZA 1F2PA 1LOKA 3SJGA 3GUXA 2PCUA 5THWA 1TKFA 2PIYA 1BAVA 5HVFA 3MN8A 3PB8X 2V8DA 4OIWA 7CPAA 3D68A 2VL1A 2AFUA 2I3CA 5LYDA 2V8HA 2CIJA 2CTCA 3KQZA 2ZENA 1Q7LA 3BI0A 3JRUA 4MXUA 2HC9A 2CTBA 2PJ7A 4F9VA 4ZY0A 5HVGA 3RBUA 3B7IA 2POKA 3DGVA 1F2OA 3PFEA 4MHYA 3NH8A 4FAIA 2F7VA 3CT9A 1Z8LA 4NJRA 3PB6X 4PQAA 2HB6A 1BPMA 4MCRA 2QVPA 3H8EA 5K8NA 1VHOA 3V7ZA 2ZEFA 3PBEA 1BPNA 3IWWA 3FVLA 3FEDA 3VARA 4X2TA 1YMEA 4ZX9A 3D7GA 4A37A 3KGQA 2C1CA 3SI1A 5LRKA 5LRGA 1CP7A 1YW6A 4PPZA 2AFZA 5JH9A 3K9TA 1ZG9A 4Z65A 3IFEA 3WABA 4MRIA 3FMCA 2PJ2A 3D7FA 3I1UA 2QJ8A 2J9AA 4TNUA 1PCAA 1BLLE 4MMOA 1EE3P 4P4FA 3NFZA 2ZEDA 1CG2A 2BCOA 3WC7A 1NSAA 1R3NA 4IAVA 4ZYQA 3PEIA 1XJOA 1LFWA 4OC3A 3HUVA 1ELLP 3RZAA 5F09A 2O53A 4K3NA 2PJ3A 2Q51A 1CX8A 2ZOGA 2V8VA 2AFOA 4H2KA 2PVVA 3K2KA 4NGPA 4MCPA 1R43A 4R8FA 1ZLIA 3GB0A 3CDXA 4PXDA 2V8GA 3NH4A 3IEHA 5LRJA 3FH4A 1FT7A 1CP6A 2JBKA 2BOAA 2AFXA 1AYEA 2PJBA 4EMEA 4NGMA 3RAMA 4FBEA 4YWYA 4NFRA 3NA6A 2PE3A 1M4LA 1VHEA 3B3WA 4NGQA 4R6TA 5I4MA 2ZEMA 3ISZA 4DJLA 1UWYA 1Z2LA 3B3CA 4NGTA 4ZI6A 2ZEEA 4P4DA 2NSMA 4PXEA 1YLOA 3IC1A 4P6YA 3WT4A 3BXMA 5JM6A 1TKHA 2O4HA 3D66A 1YSJA 4P4IA 3PFOA 4GM5A 2DEAA 3CPAA 1JQGA 2C6GA 1ARLA 1ZLHA 3KHZA 1Y0RA 4G1PA 1TF8A 4Q7AA 3BI1A 4A94A 4WJBA 5JGFA 1CBXA 2PJ9A 3H8FA 1HDQA 3PB7X 4OC2A 1DTDA 4F9UA 2FVGA 1OBRA 1TXRA 1QQ9A 1LAMA 5CPAA 3S9NA 2GLJA 2AFWA 4ZY1A 3S9MA 1KWMA 2PJ0A 3KR5A 4FWUA 1HDUA 2Q43A
chains in the Genus database with same CATH superfamily
3SJXA 2VEZA 2GE3A 4JZ0A 3FX6A 3G3SA 4MY3A 1XMTA 1M4GA 4A39A 2CY2A 3LD2A 1ZG7A 3A9LA 3D7DA 1Y7RA 1FNOA 2VQYA 4B14A 1HDUA 4ZGYB 1FY7A 4HNYB 3C26A 4ZX8A 1YVKA 4CPAA 2ABZA 2ANPA 5K8MA 4KSAA 5LYIA 5C88A 3PB4X 3CXQA 3UY5A 1Z4RA 4UEZA 3BHXA 4QC6A 3SI0A 4DNCA 2PJAA 2Z3KA 2GLFA 3JVNA 2Z11A 3ISXA 4MCSA 4E8OA 3DSBA 4OIDA 3GLJA 4HKFA 3R9EA 4X8IA 2DPSA 2PRQA 4A30A 1F57A 1KUVA 4CRYB 2EWBA 4R3LA 4KOTA 4MFLA 1CPXA 1ZG8A 2Q4VA 4NF1A 2EK9A 2B5GB 2VZZA 4PV6A 3KQXA 4RS2A 2Q4YA 3L2NA 3B3VA 3CXSA 1PU9A 3KASA 3S6HA 2GIVA 5J8FA 2K5TA 3VATA 5K8PA 4OLLA 1A2ZA 2DXQA 2B58A 3D4UA 1S7FA 2XEJA 3V8IA 4KLVA 2ZW7A 4OP4A 1MJBA 2WUUA 3P2FA 6CPAA 4R7MA 4UEFA 1Q2YA 2IQ6A 2ATRA 2ZELA 3I3GA 1Z5RA 4KOXA 3B3SA 4MJ8A 3QAHA 5ELYA 4F0XA 5EC4A 1Y7EA 2A4NA 1VGYA 3GYAA 4KVXA 4XNHC 4CYOA 3S6FA 4IK2A 3WC6A 2ZW6A 3TO7A 5HXDA 2WYRA 2CNTA 4B11A 5KTAA 2P6EA 5FVJA 4MHZA 4MFKA 2CF4A 2G3AA 1S60A 3LWUA 1TKJA 2AE6A 5D8NA 4C2ZA 4A2ZA 2FE7A 2VBQA 4IUSA 4OADA 3B8GA 3H4QA 4FD6A 4OC0A 4R76A 4B12A 4AXVA 1XEBA 3TO6A 4MI4A 4NGNA 5HVHA 4C68A 5KTCA 2PJ6A 2ZEHA 4QB9A 1IY7A 4L89A 3GY9A 1XFOA 1IU8A 3KR4A 3S9LA 2XEFA 3H8GA 4UF4A 3D2MA 2CNSA 1DE4C 1IGBA 1NMTA 1QSTA 2BO9A 3IIBA 4ONWA 5LYLA 8CPAA 1LAPA 4Q36A 4A38A 1H8LA 3PB9X 5F48A 1XIXA 2ZEPA 3CPXA 4R87A 4AG9A 4EVYA 4OAEA 2PJ1A 2PJ5A 4X5KA 2EO8A 2FT0A 4MHNA 4M3SA 3WC5A 3JTKA 2XEGA 5DS0A 3QB8A 5F47A 4OKOA 5G22A 5J1QA 1KZFA 4B5PB 4UWIA 3IO1A 1GHEA 1GYTA 2VZYA 2PVWA 1M4IA 2AFMA 4PSXA 4CYPA 1VKCA 1XOVA 1CPSA 2B4BA 3TC8A 4AG7A 2CNMA 4U5YA 1IYLA 2P0WA 2G3TA 5AG6A 2HUZA 1UFHA 3QNVA 3KHXA 5EMIA 3R96A 1L0CA 3BJ8A 3KI9A 2PR8A 2WPWA 3KL9A 3HLPA 1HEEA 4E2AA 4O23A 1PYTB 3D3SA 2NYQA 1AUGA 3NH5A 2C27A 4P10A 2F5IA 3NE7A 2Q43A 3TFYA 3DLJA 4MFQA 4CAFA 4C2XA 4B6ZA 2IMOA 3FJUA 2PJ4A 2H5MA 3PBBA 4H6UA 1K4JA 1YX0A 2AFSA 3W6SA 2OOTA 1IOIA 4NJQA 1Y9KA 4QVTA 1M1DA 2WZNA 4P45A 4KOYA 1TF9A 4I49A 1S7LA 4KSIA 2Z3MA 4NGSA 4CYNA 4RUHA 2V77A 3FEEA 5IB0A 1CJWA 2Z0ZA 4NCZA 3SJEA 4B5OA 4FD7A 3B2YA 5C82A 4ZY2A 3IU1A 3VWDA 4A32A 1XMBA 4C7IA 4NGRA 4JYWA 1NE9A 2CXAA 3PZJA 3SI2A 5A28A 2OR4A 5IB9A 1N71A 2R98A 4XPDB 3FF3A 3TE4A 1M44A 2I79A 2XEIA 2C6PA 4BD9A 4PXBA 1ARMA 3IJ3A 1RTQA 3FECA 1VIXA 1YLEA 2QYVA 2O28A 2ZPAA 3N5FA 4NEXA 3SHPA 2F8HA 3TX8A 2ARHA 4EWTA 2PJCA 1S3ZA 3PRTA 3F8KA 2PIZA 4ZBGA 2VI7A 2JEWA 1Y0YA 3LMSA 2D4PA 1CM0A 2JLMA 3D67A 3V38A 3R95A 2RFHA 4DUKA 4DYOA 1BOBA 4X3RA 4UWJA 4OC5A 2OZHA 1ELMP 1YW4A 1QMUA 2G9DA 3GIUA 1ON0A 1B87A 4PXCA 4LQ6A 4KVME 3DNSA 4UIBA 5I0CA 4U9ZA 3KZWA 5HH1A 1XRYA 2R1IA 1MK4A 2GU2A 3K9UA 3F5BA 2ZEOA 2Q04A 4OMEA 4P44A 2Q44A 2JBJA 3B3TA 3T9YA 1KUYA 2YNDA 1YQEA 1Q2DA 4R57A 2PJ8A 3B35A 2ZOFA 4K30A 1NSLA 5D29A 4GXHA 4P4JA 4GS4A 4C2YA 4MY0A 1YVOA 5CBMA 1LANA 4IHMA 3I9SA 3R9GA 4KUBA 3EXNA 4KOWA 4F8ZA 2RB7A 4WWVA 1X12A 2ZEGA 2WSAA 1S5KA 4MCQA 4EFDA 4Q38A 4LQGA 4UCNA 2C6CA 3VH9A 3IU2A 4YU9A 5LYFA 1AMPA 3SJFA 4YFJA 4XNHB 2EK8A 3SXOA 1XBUA 1WK4A 2OH1A 2Q4ZA 1LCPA 3E0KA 3IWEA 1YR0A 2Q7BA 3R9FA 4CGMA 4UEEA 3GKRA 3MRUA 4BMHA 4P4BA 4UIAA 5AG7A 4IF5A 3T8WA 2GREA 4XPKA 1R57A 5K8OA 4P4EA 2FS5A 4MHPA 4TWEA 5F46A 3TCVA 3D7HA 3NE8A 2OZGA 4OC1A 3CXPA 4W9YA 2Z3PA 5DWMA 4FUUA 4L8AA 5E96A 4MFPA 2NMTA 4OC4A 2IJZA 3BLNA 1F2PA 3CZXA 1Z8TA 3DR6A 4CYQA 5CNPA 3DR8A 1LOKA 1QSOA 3SJGA 2FL4A 3GUXA 4JD6A 1SQHA 3TOBA 2PCUA 5THWA 1TKFA 2PIYA 3D8PA 3TT2A 2FSRA 4QBJA 1BAVA 4M6GA 5HVFA 2B3VA 3TTHA 3MN8A 1J4JA 3PB8X 2V8DA 2Z10A 4OIWA 7CPAA 3D68A 2VL1A 4LX9A 2AFUA 2EVNA 2I3CA 4KVOE 5LYDA 4KSFA 4QUSA 5BWAB 1WWZA 2V8HA 2P6FA 2CIJA 3W91A 2CTCA 4YRHA 3S6GA 3KQZA 4R3KA 2GANA 4CAWA 2ZENA 1P4NA 1Q2CA 1Q7LA 3BI0A 4YGOA 3JRUA 4MXUA 2HC9A 2PRBA 2BUEA 4UCPA 3FXTA 2CTBA 2FCKA 1U6MA 2PJ7A 4F9VA 5ISVA 2HQYA 3WR7A 2J8NA 4ZY0A 5HVGA 2PQ8A 2PR1A 1Y9WA 4BINA 4MFJA 3RBUA 4HNWB 4B10A 4H6ZA 2DPTA 5IX3A 4B13A 4UCMA 3B7IA 4KORA 2POKA 3DGVA 3G8WA 1F2OA 5GCNA 3PFEA 3W6XA 4MHYA 4AB7A 4PK2A 3NH8A 4AVAA 2F7VA 4FAIA 1V0CA 3CT9A 4H89A 2FIWA 4BBHA 1Z8LA 5JPHA 4NJRA 3PB6X 3PP9A 5H84A 4UA3A 2JDCA 2KCWA 4PQAA 2FXFA 2HB6A 1M4DA 2EUIA 1BPMA 1I21A 4A33A 1Z8XA 4NSQA 4MCRA 2QVPA 3H8EA 3FB3A 5K8NA 5A27A 2ODFA 4KZTA 4CAEA 1VHOA 3V7ZA 2ZEFA 3PBEA 1BPNA 3IWWA 3QAYA 3FVLA 4MFZA 2QECA 3FEDA 3VARA 4X2TA 4KUAA 3T90A 4RN7A 1YMEA 4ZX9A 4CGOA 3D7GA 4A37A 3KGQA 2C1CA 2RC4A 3SI1A 4CAVA 5LRKA 5LRGA 1CP7A 1YW6A 3RYOA 4PPZA 2I00A 1OZPA 2AFZA 5DWNA 5JH9A 1YK3A 2BSWA 3K9TA 1IYKA 4AVCA 1ZG9A 4C7HA 4Z65A 3IFEA 5IV0A 3N7ZA 3WABA 5EBVA 4MRIA 1I1DA 4U9YA 3FMCA 3FYNA 2PSWA 4CS0B 2PJ2A 3D7FA 3I1UA 3EY5A 4Y49C 3VWEA 5HMNA 2Z3NA 3MGDA 2QJ8A 1ZO0A 1Z4EA 4E0AA 4CGPA 2J9AA 2REFA 3PGPA 4M6HA 1PCAA 1BLLE 3EC4A 4TNUA 4Y49B 3RNZA 2ZXVA 5J8CA 4MMOA 1EE3P 1YGHA 2BEIA 3EO4A 2QIRA 4P4FA 3NFZA 4JLYA 4UFWA 2OZUA 2ZEDA 1LRZA 1CG2A 4NXYA 1MJAA 2BCOA 3WC7A 1NSAA 5G1ZA 1S7NA 1Z8WA 4UBRA 1P0HA 3FNCA 4IAVA 4ZYQA 1QSNA 1RO5A 4KLWA 3PEIA 2GFQA 4CAXA 2WPXA 3FIXA 5AG5A 1XJOA 1LFWA 1TIQA 1I12A 3F0AA 3JUWA 4OC3A 2X7BA 4MBUA 1QSMA 3HUVA 4UFVA 1ELLP 2JDDA 2R8VA 4KOVA 3RZAA 4KOUA 2ZW5A 2O53A 3IWGA 5F09A 2J8MA 4K3NA 2PJ3A 2B4DB 1Z9UA 2Q51A 1XF8A 1CX8A 3BJ7A 4FD5A 2JEVA 2ZOGA 2V8VA 4R9MA 2AFOA 1JWQA 1PUAA 2BL1A 3RO0A 1B6BA 4H2KA 2D4OA 5JQ4A 2J8RA 4KS9A 2PVVA 3K2KA 4NGPA 4MCPA 1R43A 4R8FA 1ZLIA 1MJ9A 2QMLA 3CDXA 3GB0A 4PK3A 1S7KA 4PXDA 2V8GA 3NH4A 4M6IA 5F49A 4HNXB 3IEHA 5LRJA 2IL4A 3FH4A 1FT7A 1CP6A 2JBKA 1BO4A 4II9A 4ONUA 2P6GA 2BOAA 2Y0MA 2AFXA 1AYEA 3S6KA 2PJBA 4EMEA 4NGMA 4F6AA 3DDDA 5H86A 3RAMA 4CGNA 4FBEA 4YWYA 3ZZIA 4NFRA 2OU2A 3NA6A 2Q7SA 2PE3A 1M4LA 1VHEA 2B5GA 4KOSA 1KUXA 3B3WA 4FD4A 4J3GA 2PDOA 2VXKA 3TOAA 2ZW4A 4NGQA 4R6TA 5I4MA 2ZEMA 3ISZA 4DJLA 1UWYA 1IOFA 1Z2LA 2YNCC 3H5ZA 3B3CA 4NGTA 1IICA 2B4DA 4ZI6A 5AG4A 2Z3LA 2ZEEA 3IGRA 3P2HA 4P4DA 2REEA 2NSMA 4UFXA 2B3UA 4PXEA 1YLOA 2EBJA 3IC1A 4P6YA 5G21A 3WT4A 2DF5A 3BXMA 3KKWA 4A95A 4ORFA 5JM6A 1YREA 1TKHA 3ZJ0A 2O4HA 1IIDA 4CRZB 2G0BA 3D66A 4JXQA 4M85A 5AGEA 1YSJA 2YGWA 3EFAA 4P4IA 3PFOA 4GM5A 3R1KA 4JJXA 2DEAA 4HPSA 3FBUA 3CPAA 4A31A 1JQGA 2C6GA 1ARLA 1ZLHA 3KHZA 1Y0RA 1XE4A 1QSRA 3LACA 3OWCA 4G1PA 1RXTA 1TF8A 2Z3OA 4Q7AA 2FIAA 3BI1A 4F0YA 4A94A 4WJBA 5KTDA 5JGFA 2R7HA 3SXNA 1CBXA 2PJ9A 3H8FA 1HDQA 3PB7X 4OC2A 1DTDA 2Q0YA 3FRMA 1IB1E 4F9UA 2FVGA 1OBRA 2YNEA 1TXRA 1QQ9A 1LAMA 4CGLA 5CPAA 4MHDA 3S9NA 4RI1A 4JXRA 4B5PA 2GLJA 1X10A 2AFWA 2AJ6A 2YNCA 3LODA 4PSWA 4XPLA 3S9MA 2OB0A 3TO9A 4ZY1A 4XPDC 1KWMA 4LUAA 5G20A 2HV2A 4AVBA 1VHSA 2PJ0A 3D2PA 4JWPA 3KR5A 4FWUA 1R3NA 2PC1A
chains in the Genus database with same CATH topology
3SJXA 4JZ0A 3FX6A 4A39A 1ZG7A 3D7DA 1FNOA 4ZX8A 4CPAA 2ABZA 2ANPA 5K8MA 5LYIA 3PB4X 4UEZA 3BHXA 3SI0A 2PJAA 2GLFA 3ISXA 4MCSA 4OIDA 3GLJA 4X8IA 2PRQA 1F57A 2EWBA 1CPXA 1ZG8A 2EK9A 3KQXA 3L2NA 3B3VA 3KASA 3VATA 5K8PA 3D4UA 2XEJA 4OP4A 6CPAA 4R7MA 4UEFA 2IQ6A 2ZELA 5ELYA 1Z5RA 3B3SA 1Y7EA 1VGYA 3WC6A 4IK2A 5HXDA 2WYRA 4MHZA 2CF4A 3LWUA 5D8NA 1TKJA 4R76A 4OC0A 4AXVA 4NGNA 5HVHA 2PJ6A 2ZEHA 1IY7A 1XFOA 3S9LA 3KR4A 2XEFA 3H8GA 4UF4A 1DE4C 1IGBA 2BO9A 3IIBA 4ONWA 5LYLA 8CPAA 1LAPA 4A38A 1H8LA 3PB9X 2ZEPA 3CPXA 2PJ1A 2PJ5A 4MHNA 3WC5A 2XEGA 5DS0A 5J1QA 4OKOA 3IO1A 1GYTA 2PVWA 2AFMA 1CPSA 3TC8A 3QNVA 3KHXA 3KI9A 3KL9A 3HLPA 1HEEA 4O23A 1PYTB 2NYQA 3NH5A 4P10A 3DLJA 4B6ZA 2IMOA 3FJUA 2PJ4A 3PBBA 2AFSA 2OOTA 4NJQA 2WZNA 4P45A 1TF9A 4KSIA 4NGSA 4RUHA 2V77A 3FEEA 3SJEA 3B2YA 4ZY2A 1XMBA 4NGRA 4JYWA 3SI2A 5IB9A 2OR4A 3FF3A 2XEIA 2C6PA 4BD9A 4PXBA 1ARMA 3IJ3A 1RTQA 3FECA 1VIXA 2QYVA 3N5FA 2F8HA 3TX8A 4EWTA 2PJCA 3PRTA 2PIZA 2JEWA 1Y0YA 3LMSA 3D67A 3V38A 2RFHA 4DUKA 4DYOA 4X3RA 4OC5A 1ELMP 1YW4A 1QMUA 2G9DA 4PXCA 4UIBA 3KZWA 1XRYA 2GU2A 2ZEOA 4OMEA 4P44A 2JBJA 3B3TA 2PJ8A 3B35A 2ZOFA 5D29A 4P4JA 5CBMA 1LANA 4IHMA 4F8ZA 2RB7A 4WWVA 2ZEGA 4MCQA 4EFDA 4LQGA 2C6CA 3VH9A 4YU9A 5LYFA 1AMPA 3SJFA 2EK8A 1XBUA 2Q4ZA 1LCPA 4UEEA 3MRUA 4P4BA 4UIAA 3T8WA 2GREA 5K8OA 4P4EA 4MHPA 4TWEA 3D7HA 4OC1A 4W9YA 4FUUA 4OC4A 2IJZA 1F2PA 1LOKA 3SJGA 3GUXA 2PCUA 5THWA 1TKFA 2PIYA 1BAVA 5HVFA 3MN8A 3PB8X 2V8DA 4OIWA 7CPAA 3D68A 2VL1A 2AFUA 2I3CA 5LYDA 2V8HA 2CIJA 2CTCA 3KQZA 2ZENA 1Q7LA 3BI0A 3JRUA 4MXUA 2HC9A 2CTBA 2PJ7A 4F9VA 4ZY0A 5HVGA 3RBUA 3B7IA 2POKA 3DGVA 1F2OA 3PFEA 4MHYA 3NH8A 4FAIA 2F7VA 3CT9A 1Z8LA 4NJRA 3PB6X 4PQAA 2HB6A 1BPMA 4MCRA 2QVPA 3H8EA 5K8NA 1VHOA 3V7ZA 2ZEFA 3PBEA 1BPNA 3IWWA 3FVLA 3FEDA 3VARA 4X2TA 1YMEA 4ZX9A 3D7GA 4A37A 3KGQA 2C1CA 3SI1A 5LRKA 5LRGA 1CP7A 1YW6A 4PPZA 2AFZA 5JH9A 3K9TA 1ZG9A 4Z65A 3IFEA 3WABA 4MRIA 3FMCA 2PJ2A 3D7FA 3I1UA 2QJ8A 2J9AA 4TNUA 1PCAA 1BLLE 4MMOA 1EE3P 4P4FA 3NFZA 2ZEDA 1CG2A 2BCOA 3WC7A 1NSAA 1R3NA 4IAVA 4ZYQA 3PEIA 1XJOA 1LFWA 4OC3A 3HUVA 1ELLP 3RZAA 5F09A 2O53A 4K3NA 2PJ3A 2Q51A 1CX8A 2ZOGA 2V8VA 2AFOA 4H2KA 2PVVA 3K2KA 4NGPA 4MCPA 1R43A 4R8FA 1ZLIA 3GB0A 3CDXA 4PXDA 2V8GA 3NH4A 3IEHA 5LRJA 3FH4A 1FT7A 1CP6A 2JBKA 2BOAA 2AFXA 1AYEA 2PJBA 4EMEA 4NGMA 3RAMA 4FBEA 4YWYA 4NFRA 3NA6A 2PE3A 1M4LA 1VHEA 3B3WA 4NGQA 4R6TA 5I4MA 2ZEMA 3ISZA 4DJLA 1UWYA 1Z2LA 3B3CA 4NGTA 4ZI6A 2ZEEA 4P4DA 2NSMA 4PXEA 1YLOA 3IC1A 4P6YA 3WT4A 3BXMA 5JM6A 1TKHA 2O4HA 3D66A 1YSJA 4P4IA 3PFOA 4GM5A 2DEAA 3CPAA 1JQGA 2C6GA 1ARLA 1ZLHA 3KHZA 1Y0RA 4G1PA 1TF8A 4Q7AA 3BI1A 4A94A 4WJBA 5JGFA 1CBXA 2PJ9A 3H8FA 1HDQA 3PB7X 4OC2A 1DTDA 4F9UA 2FVGA 1OBRA 1TXRA 1QQ9A 1LAMA 5CPAA 3S9NA 2GLJA 2AFWA 4ZY1A 3S9MA 1KWMA 2PJ0A 3KR5A 4FWUA 1HDUA 2Q43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJX A;  4JZ0 A;  3FX6 A;  4A39 A;  1ZG7 A;  3D7D A;  1FNO A;  4ZX8 A;  4CPA A;  2ABZ A;  2ANP A;  5K8M A;  5LYI A;  3PB4 X;  4UEZ A;  3BHX A;  3SI0 A;  2PJA A;  2GLF A;  3ISX A;  4MCS A;  4OID A;  3GLJ A;  4X8I A;  2PRQ A;  1F57 A;  2EWB A;  1CPX A;  1ZG8 A;  2EK9 A;  3KQX A;  3L2N A;  3B3V A;  3KAS A;  3VAT A;  5K8P A;  3D4U A;  2XEJ A;  4OP4 A;  6CPA A;  4R7M A;  4UEF A;  2IQ6 A;  2ZEL A;  5ELY A;  1Z5R A;  3B3S A;  1Y7E A;  1VGY A;  3WC6 A;  4IK2 A;  5HXD A;  2WYR A;  4MHZ A;  2CF4 A;  3LWU A;  5D8N A;  1TKJ A;  4R76 A;  4OC0 A;  4AXV A;  4NGN A;  5HVH A;  2PJ6 A;  2ZEH A;  1IY7 A;  1XFO A;  3S9L A;  3KR4 A;  2XEF A;  3H8G A;  4UF4 A;  1DE4 C;  1IGB A;  2BO9 A;  3IIB A;  4ONW A;  5LYL A;  8CPA A;  1LAP A;  4A38 A;  1H8L A;  3PB9 X;  2ZEP A;  3CPX A;  2PJ1 A;  2PJ5 A;  4MHN A;  3WC5 A;  2XEG A;  5DS0 A;  5J1Q A;  4OKO A;  3IO1 A;  1GYT A;  2PVW A;  2AFM A;  1CPS A;  3TC8 A;  3QNV A;  3KHX A;  3KI9 A;  3KL9 A;  3HLP A;  1HEE A;  4O23 A;  1PYT B;  2NYQ A;  3NH5 A;  4P10 A;  3DLJ A;  4B6Z A;  2IMO A;  3FJU A;  2PJ4 A;  3PBB A;  2AFS A;  2OOT A;  4NJQ A;  2WZN A;  4P45 A;  1TF9 A;  4KSI A;  4NGS A;  4RUH A;  2V77 A;  3FEE A;  3SJE A;  3B2Y A;  4ZY2 A;  1XMB A;  4NGR A;  4JYW A;  3SI2 A;  5IB9 A;  2OR4 A;  3FF3 A;  2XEI A;  2C6P A;  4BD9 A;  4PXB A;  1ARM A;  3IJ3 A;  1RTQ A;  3FEC A;  1VIX A;  2QYV A;  3N5F A;  2F8H A;  3TX8 A;  4EWT A;  2PJC A;  3PRT A;  2PIZ A;  2JEW A;  1Y0Y A;  3LMS A;  3D67 A;  3V38 A;  2RFH A;  4DUK A;  4DYO A;  4X3R A;  4OC5 A;  1ELM P;  1YW4 A;  1QMU A;  2G9D A;  4PXC A;  4UIB A;  3KZW A;  1XRY A;  2GU2 A;  2ZEO A;  4OME A;  4P44 A;  2JBJ A;  3B3T A;  2PJ8 A;  3B35 A;  2ZOF A;  5D29 A;  4P4J A;  5CBM A;  1LAN A;  4IHM A;  4F8Z A;  2RB7 A;  4WWV A;  2ZEG A;  4MCQ A;  4EFD A;  4LQG A;  2C6C A;  3VH9 A;  4YU9 A;  5LYF A;  1AMP A;  3SJF A;  2EK8 A;  1XBU A;  2Q4Z A;  1LCP A;  4UEE A;  3MRU A;  4P4B A;  4UIA A;  3T8W A;  2GRE A;  5K8O A;  4P4E A;  4MHP A;  4TWE A;  3D7H A;  4OC1 A;  4W9Y A;  4FUU A;  4OC4 A;  2IJZ A;  1F2P A;  1LOK A;  3SJG A;  3GUX A;  2PCU A;  5THW A;  1TKF A;  2PIY A;  1BAV A;  5HVF A;  3MN8 A;  3PB8 X;  2V8D A;  4OIW A;  7CPA A;  3D68 A;  2VL1 A;  2AFU A;  2I3C A;  5LYD A;  2V8H A;  2CIJ A;  2CTC A;  3KQZ A;  2ZEN A;  1Q7L A;  3BI0 A;  3JRU A;  4MXU A;  2HC9 A;  2CTB A;  2PJ7 A;  4F9V A;  4ZY0 A;  5HVG A;  3RBU A;  3B7I A;  2POK A;  3DGV A;  1F2O A;  3PFE A;  4MHY A;  3NH8 A;  4FAI A;  2F7V A;  3CT9 A;  1Z8L A;  4NJR A;  3PB6 X;  4PQA A;  2HB6 A;  1BPM A;  4MCR A;  2QVP A;  3H8E A;  5K8N A;  1VHO A;  3V7Z A;  2ZEF A;  3PBE A;  1BPN A;  3IWW A;  3FVL A;  3FED A;  3VAR A;  4X2T A;  1YME A;  4ZX9 A;  3D7G A;  4A37 A;  3KGQ A;  2C1C A;  3SI1 A;  5LRK A;  5LRG A;  1CP7 A;  1YW6 A;  4PPZ A;  2AFZ A;  5JH9 A;  3K9T A;  1ZG9 A;  4Z65 A;  3IFE A;  3WAB A;  4MRI A;  3FMC A;  2PJ2 A;  3D7F A;  3I1U A;  2QJ8 A;  2J9A A;  4TNU A;  1PCA A;  1BLL E;  4MMO A;  1EE3 P;  4P4F A;  3NFZ A;  2ZED A;  1CG2 A;  2BCO A;  3WC7 A;  1NSA A;  1R3N A;  4IAV A;  4ZYQ A;  3PEI A;  1XJO A;  1LFW A;  4OC3 A;  3HUV A;  1ELL P;  3RZA A;  5F09 A;  2O53 A;  4K3N A;  2PJ3 A;  2Q51 A;  1CX8 A;  2ZOG A;  2V8V A;  2AFO A;  4H2K A;  2PVV A;  3K2K A;  4NGP A;  4MCP A;  1R43 A;  4R8F A;  1ZLI A;  3GB0 A;  3CDX A;  4PXD A;  2V8G A;  3NH4 A;  3IEH A;  5LRJ A;  3FH4 A;  1FT7 A;  1CP6 A;  2JBK A;  2BOA A;  2AFX A;  1AYE A;  2PJB A;  4EME A;  4NGM A;  3RAM A;  4FBE A;  4YWY A;  4NFR A;  3NA6 A;  2PE3 A;  1M4L A;  1VHE A;  3B3W A;  4NGQ A;  4R6T A;  5I4M A;  2ZEM A;  3ISZ A;  4DJL A;  1UWY A;  1Z2L A;  3B3C A;  4NGT A;  4ZI6 A;  2ZEE A;  4P4D A;  2NSM A;  4PXE A;  1YLO A;  3IC1 A;  4P6Y A;  3WT4 A;  3BXM A;  5JM6 A;  1TKH A;  2O4H A;  3D66 A;  1YSJ A;  4P4I A;  3PFO A;  4GM5 A;  2DEA A;  3CPA A;  1JQG A;  2C6G A;  1ARL A;  1ZLH A;  3KHZ A;  1Y0R A;  4G1P A;  1TF8 A;  4Q7A A;  3BI1 A;  4A94 A;  4WJB A;  5JGF A;  1CBX A;  2PJ9 A;  3H8F A;  1HDQ A;  3PB7 X;  4OC2 A;  1DTD A;  4F9U A;  2FVG A;  1OBR A;  1TXR A;  1QQ9 A;  1LAM A;  5CPA A;  3S9N A;  2GLJ A;  2AFW A;  4ZY1 A;  3S9M A;  1KWM A;  2PJ0 A;  3KR5 A;  4FWU A;  1HDU A;  2Q43 A; 
#chains in the Genus database with same CATH topology
 3SJX A;  2VEZ A;  2GE3 A;  4JZ0 A;  3FX6 A;  3G3S A;  4MY3 A;  1XMT A;  1M4G A;  4A39 A;  2CY2 A;  3LD2 A;  1ZG7 A;  3A9L A;  3D7D A;  1Y7R A;  1FNO A;  2VQY A;  4B14 A;  1HDU A;  4ZGY B;  1FY7 A;  4HNY B;  3C26 A;  4ZX8 A;  1YVK A;  4CPA A;  2ABZ A;  2ANP A;  5K8M A;  4KSA A;  5LYI A;  5C88 A;  3PB4 X;  3CXQ A;  3UY5 A;  1Z4R A;  4UEZ A;  3BHX A;  4QC6 A;  3SI0 A;  4DNC A;  2PJA A;  2Z3K A;  2GLF A;  3JVN A;  2Z11 A;  3ISX A;  4MCS A;  4E8O A;  3DSB A;  4OID A;  3GLJ A;  4HKF A;  3R9E A;  4X8I A;  2DPS A;  2PRQ A;  4A30 A;  1F57 A;  1KUV A;  4CRY B;  2EWB A;  4R3L A;  4KOT A;  4MFL A;  1CPX A;  1ZG8 A;  2Q4V A;  4NF1 A;  2EK9 A;  2B5G B;  2VZZ A;  4PV6 A;  3KQX A;  4RS2 A;  2Q4Y A;  3L2N A;  3B3V A;  3CXS A;  1PU9 A;  3KAS A;  3S6H A;  2GIV A;  5J8F A;  2K5T A;  3VAT A;  5K8P A;  4OLL A;  1A2Z A;  2DXQ A;  2B58 A;  3D4U A;  1S7F A;  2XEJ A;  3V8I A;  4KLV A;  2ZW7 A;  4OP4 A;  1MJB A;  2WUU A;  3P2F A;  6CPA A;  4R7M A;  4UEF A;  1Q2Y A;  2IQ6 A;  2ATR A;  2ZEL A;  3I3G A;  1Z5R A;  4KOX A;  3B3S A;  4MJ8 A;  3QAH A;  5ELY A;  4F0X A;  5EC4 A;  1Y7E A;  2A4N A;  1VGY A;  3GYA A;  4KVX A;  4XNH C;  4CYO A;  3S6F A;  4IK2 A;  3WC6 A;  2ZW6 A;  3TO7 A;  5HXD A;  2WYR A;  2CNT A;  4B11 A;  5KTA A;  2P6E A;  5FVJ A;  4MHZ A;  4MFK A;  2CF4 A;  2G3A A;  1S60 A;  3LWU A;  1TKJ A;  2AE6 A;  5D8N A;  4C2Z A;  4A2Z A;  2FE7 A;  2VBQ A;  4IUS A;  4OAD A;  3B8G A;  3H4Q A;  4FD6 A;  4OC0 A;  4R76 A;  4B12 A;  4AXV A;  1XEB A;  3TO6 A;  4MI4 A;  4NGN A;  5HVH A;  4C68 A;  5KTC A;  2PJ6 A;  2ZEH A;  4QB9 A;  1IY7 A;  4L89 A;  3GY9 A;  1XFO A;  1IU8 A;  3KR4 A;  3S9L A;  2XEF A;  3H8G A;  4UF4 A;  3D2M A;  2CNS A;  1DE4 C;  1IGB A;  1NMT A;  1QST A;  2BO9 A;  3IIB A;  4ONW A;  5LYL A;  8CPA A;  1LAP A;  4Q36 A;  4A38 A;  1H8L A;  3PB9 X;  5F48 A;  1XIX A;  2ZEP A;  3CPX A;  4R87 A;  4AG9 A;  4EVY A;  4OAE A;  2PJ1 A;  2PJ5 A;  4X5K A;  2EO8 A;  2FT0 A;  4MHN A;  4M3S A;  3WC5 A;  3JTK A;  2XEG A;  5DS0 A;  3QB8 A;  5F47 A;  4OKO A;  5G22 A;  5J1Q A;  1KZF A;  4B5P B;  4UWI A;  3IO1 A;  1GHE A;  1GYT A;  2VZY A;  2PVW A;  1M4I A;  2AFM A;  4PSX A;  4CYP A;  1VKC A;  1XOV A;  1CPS A;  2B4B A;  3TC8 A;  4AG7 A;  2CNM A;  4U5Y A;  1IYL A;  2P0W A;  2G3T A;  5AG6 A;  2HUZ A;  1UFH A;  3QNV A;  3KHX A;  5EMI A;  3R96 A;  1L0C A;  3BJ8 A;  3KI9 A;  2PR8 A;  2WPW A;  3KL9 A;  3HLP A;  1HEE A;  4E2A A;  4O23 A;  1PYT B;  3D3S A;  2NYQ A;  1AUG A;  3NH5 A;  2C27 A;  4P10 A;  2F5I A;  3NE7 A;  2Q43 A;  3TFY A;  3DLJ A;  4MFQ A;  4CAF A;  4C2X A;  4B6Z A;  2IMO A;  3FJU A;  2PJ4 A;  2H5M A;  3PBB A;  4H6U A;  1K4J A;  1YX0 A;  2AFS A;  3W6S A;  2OOT A;  1IOI A;  4NJQ A;  1Y9K A;  4QVT A;  1M1D A;  2WZN A;  4P45 A;  4KOY A;  1TF9 A;  4I49 A;  1S7L A;  4KSI A;  2Z3M A;  4NGS A;  4CYN A;  4RUH A;  2V77 A;  3FEE A;  5IB0 A;  1CJW A;  2Z0Z A;  4NCZ A;  3SJE A;  4B5O A;  4FD7 A;  3B2Y A;  5C82 A;  4ZY2 A;  3IU1 A;  3VWD A;  4A32 A;  1XMB A;  4C7I A;  4NGR A;  4JYW A;  1NE9 A;  2CXA A;  3PZJ A;  3SI2 A;  5A28 A;  2OR4 A;  5IB9 A;  1N71 A;  2R98 A;  4XPD B;  3FF3 A;  3TE4 A;  1M44 A;  2I79 A;  2XEI A;  2C6P A;  4BD9 A;  4PXB A;  1ARM A;  3IJ3 A;  1RTQ A;  3FEC A;  1VIX A;  1YLE A;  2QYV A;  2O28 A;  2ZPA A;  3N5F A;  4NEX A;  3SHP A;  2F8H A;  3TX8 A;  2ARH A;  4EWT A;  2PJC A;  1S3Z A;  3PRT A;  3F8K A;  2PIZ A;  4ZBG A;  2VI7 A;  2JEW A;  1Y0Y A;  3LMS A;  2D4P A;  1CM0 A;  2JLM A;  3D67 A;  3V38 A;  3R95 A;  2RFH A;  4DUK A;  4DYO A;  1BOB A;  4X3R A;  4UWJ A;  4OC5 A;  2OZH A;  1ELM P;  1YW4 A;  1QMU A;  2G9D A;  3GIU A;  1ON0 A;  1B87 A;  4PXC A;  4LQ6 A;  4KVM E;  3DNS A;  4UIB A;  5I0C A;  4U9Z A;  3KZW A;  5HH1 A;  1XRY A;  2R1I A;  1MK4 A;  2GU2 A;  3K9U A;  3F5B A;  2ZEO A;  2Q04 A;  4OME A;  4P44 A;  2Q44 A;  2JBJ A;  3B3T A;  3T9Y A;  1KUY A;  2YND A;  1YQE A;  1Q2D A;  4R57 A;  2PJ8 A;  3B35 A;  2ZOF A;  4K30 A;  1NSL A;  5D29 A;  4GXH A;  4P4J A;  4GS4 A;  4C2Y A;  4MY0 A;  1YVO A;  5CBM A;  1LAN A;  4IHM A;  3I9S A;  3R9G A;  4KUB A;  3EXN A;  4KOW A;  4F8Z A;  2RB7 A;  4WWV A;  1X12 A;  2ZEG A;  2WSA A;  1S5K A;  4MCQ A;  4EFD A;  4Q38 A;  4LQG A;  4UCN A;  2C6C A;  3VH9 A;  3IU2 A;  4YU9 A;  5LYF A;  1AMP A;  3SJF A;  4YFJ A;  4XNH B;  2EK8 A;  3SXO A;  1XBU A;  1WK4 A;  2OH1 A;  2Q4Z A;  1LCP A;  3E0K A;  3IWE A;  1YR0 A;  2Q7B A;  3R9F A;  4CGM A;  4UEE A;  3GKR A;  3MRU A;  4BMH A;  4P4B A;  4UIA A;  5AG7 A;  4IF5 A;  3T8W A;  2GRE A;  4XPK A;  1R57 A;  5K8O A;  4P4E A;  2FS5 A;  4MHP A;  4TWE A;  5F46 A;  3TCV A;  3D7H A;  3NE8 A;  2OZG A;  4OC1 A;  3CXP A;  4W9Y A;  2Z3P A;  5DWM A;  4FUU A;  4L8A A;  5E96 A;  4MFP A;  2NMT A;  4OC4 A;  2IJZ A;  3BLN A;  1F2P A;  3CZX A;  1Z8T A;  3DR6 A;  4CYQ A;  5CNP A;  3DR8 A;  1LOK A;  1QSO A;  3SJG A;  2FL4 A;  3GUX A;  4JD6 A;  1SQH A;  3TOB A;  2PCU A;  5THW A;  1TKF A;  2PIY A;  3D8P A;  3TT2 A;  2FSR A;  4QBJ A;  1BAV A;  4M6G A;  5HVF A;  2B3V A;  3TTH A;  3MN8 A;  1J4J A;  3PB8 X;  2V8D A;  2Z10 A;  4OIW A;  7CPA A;  3D68 A;  2VL1 A;  4LX9 A;  2AFU A;  2EVN A;  2I3C A;  4KVO E;  5LYD A;  4KSF A;  4QUS A;  5BWA B;  1WWZ A;  2V8H A;  2P6F A;  2CIJ A;  3W91 A;  2CTC A;  4YRH A;  3S6G A;  3KQZ A;  4R3K A;  2GAN A;  4CAW A;  2ZEN A;  1P4N A;  1Q2C A;  1Q7L A;  3BI0 A;  4YGO A;  3JRU A;  4MXU A;  2HC9 A;  2PRB A;  2BUE A;  4UCP A;  3FXT A;  2CTB A;  2FCK A;  1U6M A;  2PJ7 A;  4F9V A;  5ISV A;  2HQY A;  3WR7 A;  2J8N A;  4ZY0 A;  5HVG A;  2PQ8 A;  2PR1 A;  1Y9W A;  4BIN A;  4MFJ A;  3RBU A;  4HNW B;  4B10 A;  4H6Z A;  2DPT A;  5IX3 A;  4B13 A;  4UCM A;  3B7I A;  4KOR A;  2POK A;  3DGV A;  3G8W A;  1F2O A;  5GCN A;  3PFE A;  3W6X A;  4MHY A;  4AB7 A;  4PK2 A;  3NH8 A;  4AVA A;  2F7V A;  4FAI A;  1V0C A;  3CT9 A;  4H89 A;  2FIW A;  4BBH A;  1Z8L A;  5JPH A;  4NJR A;  3PB6 X;  3PP9 A;  5H84 A;  4UA3 A;  2JDC A;  2KCW A;  4PQA A;  2FXF A;  2HB6 A;  1M4D A;  2EUI A;  1BPM A;  1I21 A;  4A33 A;  1Z8X A;  4NSQ A;  4MCR A;  2QVP A;  3H8E A;  3FB3 A;  5K8N A;  5A27 A;  2ODF A;  4KZT A;  4CAE A;  1VHO A;  3V7Z A;  2ZEF A;  3PBE A;  1BPN A;  3IWW A;  3QAY A;  3FVL A;  4MFZ A;  2QEC A;  3FED A;  3VAR A;  4X2T A;  4KUA A;  3T90 A;  4RN7 A;  1YME A;  4ZX9 A;  4CGO A;  3D7G A;  4A37 A;  3KGQ A;  2C1C A;  2RC4 A;  3SI1 A;  4CAV A;  5LRK A;  5LRG A;  1CP7 A;  1YW6 A;  3RYO A;  4PPZ A;  2I00 A;  1OZP A;  2AFZ A;  5DWN A;  5JH9 A;  1YK3 A;  2BSW A;  3K9T A;  1IYK A;  4AVC A;  1ZG9 A;  4C7H A;  4Z65 A;  3IFE A;  5IV0 A;  3N7Z A;  3WAB A;  5EBV A;  4MRI A;  1I1D A;  4U9Y A;  3FMC A;  3FYN A;  2PSW A;  4CS0 B;  2PJ2 A;  3D7F A;  3I1U A;  3EY5 A;  4Y49 C;  3VWE A;  5HMN A;  2Z3N A;  3MGD A;  2QJ8 A;  1ZO0 A;  1Z4E A;  4E0A A;  4CGP A;  2J9A A;  2REF A;  3PGP A;  4M6H A;  1PCA A;  1BLL E;  3EC4 A;  4TNU A;  4Y49 B;  3RNZ A;  2ZXV A;  5J8C A;  4MMO A;  1EE3 P;  1YGH A;  2BEI A;  3EO4 A;  2QIR A;  4P4F A;  3NFZ A;  4JLY A;  4UFW A;  2OZU A;  2ZED A;  1LRZ A;  1CG2 A;  4NXY A;  1MJA A;  2BCO A;  3WC7 A;  1NSA A;  5G1Z A;  1S7N A;  1Z8W A;  4UBR A;  1P0H A;  3FNC A;  4IAV A;  4ZYQ A;  1QSN A;  1RO5 A;  4KLW A;  3PEI A;  2GFQ A;  4CAX A;  2WPX A;  3FIX A;  5AG5 A;  1XJO A;  1LFW A;  1TIQ A;  1I12 A;  3F0A A;  3JUW A;  4OC3 A;  2X7B A;  4MBU A;  1QSM A;  3HUV A;  4UFV A;  1ELL P;  2JDD A;  2R8V A;  4KOV A;  3RZA A;  4KOU A;  2ZW5 A;  2O53 A;  3IWG A;  5F09 A;  2J8M A;  4K3N A;  2PJ3 A;  2B4D B;  1Z9U A;  2Q51 A;  1XF8 A;  1CX8 A;  3BJ7 A;  4FD5 A;  2JEV A;  2ZOG A;  2V8V A;  4R9M A;  2AFO A;  1JWQ A;  1PUA A;  2BL1 A;  3RO0 A;  1B6B A;  4H2K A;  2D4O A;  5JQ4 A;  2J8R A;  4KS9 A;  2PVV A;  3K2K A;  4NGP A;  4MCP A;  1R43 A;  4R8F A;  1ZLI A;  1MJ9 A;  2QML A;  3CDX A;  3GB0 A;  4PK3 A;  1S7K A;  4PXD A;  2V8G A;  3NH4 A;  4M6I A;  5F49 A;  4HNX B;  3IEH A;  5LRJ A;  2IL4 A;  3FH4 A;  1FT7 A;  1CP6 A;  2JBK A;  1BO4 A;  4II9 A;  4ONU A;  2P6G A;  2BOA A;  2Y0M A;  2AFX A;  1AYE A;  3S6K A;  2PJB A;  4EME A;  4NGM A;  4F6A A;  3DDD A;  5H86 A;  3RAM A;  4CGN A;  4FBE A;  4YWY A;  3ZZI A;  4NFR A;  2OU2 A;  3NA6 A;  2Q7S A;  2PE3 A;  1M4L A;  1VHE A;  2B5G A;  4KOS A;  1KUX A;  3B3W A;  4FD4 A;  4J3G A;  2PDO A;  2VXK A;  3TOA A;  2ZW4 A;  4NGQ A;  4R6T A;  5I4M A;  2ZEM A;  3ISZ A;  4DJL A;  1UWY A;  1IOF A;  1Z2L A;  2YNC C;  3H5Z A;  3B3C A;  4NGT A;  1IIC A;  2B4D A;  4ZI6 A;  5AG4 A;  2Z3L A;  2ZEE A;  3IGR A;  3P2H A;  4P4D A;  2REE A;  2NSM A;  4UFX A;  2B3U A;  4PXE A;  1YLO A;  2EBJ A;  3IC1 A;  4P6Y A;  5G21 A;  3WT4 A;  2DF5 A;  3BXM A;  3KKW A;  4A95 A;  4ORF A;  5JM6 A;  1YRE A;  1TKH A;  3ZJ0 A;  2O4H A;  1IID A;  4CRZ B;  2G0B A;  3D66 A;  4JXQ A;  4M85 A;  5AGE A;  1YSJ A;  2YGW A;  3EFA A;  4P4I A;  3PFO A;  4GM5 A;  3R1K A;  4JJX A;  2DEA A;  4HPS A;  3FBU A;  3CPA A;  4A31 A;  1JQG A;  2C6G A;  1ARL A;  1ZLH A;  3KHZ A;  1Y0R A;  1XE4 A;  1QSR A;  3LAC A;  3OWC A;  4G1P A;  1RXT A;  1TF8 A;  2Z3O A;  4Q7A A;  2FIA A;  3BI1 A;  4F0Y A;  4A94 A;  4WJB A;  5KTD A;  5JGF A;  2R7H A;  3SXN A;  1CBX A;  2PJ9 A;  3H8F A;  1HDQ A;  3PB7 X;  4OC2 A;  1DTD A;  2Q0Y A;  3FRM A;  1IB1 E;  4F9U A;  2FVG A;  1OBR A;  2YNE A;  1TXR A;  1QQ9 A;  1LAM A;  4CGL A;  5CPA A;  4MHD A;  3S9N A;  4RI1 A;  4JXR A;  4B5P A;  2GLJ A;  1X10 A;  2AFW A;  2AJ6 A;  2YNC A;  3LOD A;  4PSW A;  4XPL A;  3S9M A;  2OB0 A;  3TO9 A;  4ZY1 A;  4XPD C;  1KWM A;  4LUA A;  5G20 A;  2HV2 A;  4AVB A;  1VHS A;  2PJ0 A;  3D2P A;  4JWP A;  3KR5 A;  4FWU A;  1R3N A;  2PC1 A; 
#chains in the Genus database with same CATH homology
 3SJX A;  4JZ0 A;  3FX6 A;  4A39 A;  1ZG7 A;  3D7D A;  1FNO A;  4ZX8 A;  4CPA A;  2ABZ A;  2ANP A;  5K8M A;  5LYI A;  3PB4 X;  4UEZ A;  3BHX A;  3SI0 A;  2PJA A;  2GLF A;  3ISX A;  4MCS A;  4OID A;  3GLJ A;  4X8I A;  2PRQ A;  1F57 A;  2EWB A;  1CPX A;  1ZG8 A;  2EK9 A;  3KQX A;  3L2N A;  3B3V A;  3KAS A;  3VAT A;  5K8P A;  3D4U A;  2XEJ A;  4OP4 A;  6CPA A;  4R7M A;  4UEF A;  2IQ6 A;  2ZEL A;  5ELY A;  1Z5R A;  3B3S A;  1Y7E A;  1VGY A;  3WC6 A;  4IK2 A;  5HXD A;  2WYR A;  4MHZ A;  2CF4 A;  3LWU A;  5D8N A;  1TKJ A;  4R76 A;  4OC0 A;  4AXV A;  4NGN A;  5HVH A;  2PJ6 A;  2ZEH A;  1IY7 A;  1XFO A;  3S9L A;  3KR4 A;  2XEF A;  3H8G A;  4UF4 A;  1DE4 C;  1IGB A;  2BO9 A;  3IIB A;  4ONW A;  5LYL A;  8CPA A;  1LAP A;  4A38 A;  1H8L A;  3PB9 X;  2ZEP A;  3CPX A;  2PJ1 A;  2PJ5 A;  4MHN A;  3WC5 A;  2XEG A;  5DS0 A;  5J1Q A;  4OKO A;  3IO1 A;  1GYT A;  2PVW A;  2AFM A;  1CPS A;  3TC8 A;  3QNV A;  3KHX A;  3KI9 A;  3KL9 A;  3HLP A;  1HEE A;  4O23 A;  1PYT B;  2NYQ A;  3NH5 A;  4P10 A;  3DLJ A;  4B6Z A;  2IMO A;  3FJU A;  2PJ4 A;  3PBB A;  2AFS A;  2OOT A;  4NJQ A;  2WZN A;  4P45 A;  1TF9 A;  4KSI A;  4NGS A;  4RUH A;  2V77 A;  3FEE A;  3SJE A;  3B2Y A;  4ZY2 A;  1XMB A;  4NGR A;  4JYW A;  3SI2 A;  5IB9 A;  2OR4 A;  3FF3 A;  2XEI A;  2C6P A;  4BD9 A;  4PXB A;  1ARM A;  3IJ3 A;  1RTQ A;  3FEC A;  1VIX A;  2QYV A;  3N5F A;  2F8H A;  3TX8 A;  4EWT A;  2PJC A;  3PRT A;  2PIZ A;  2JEW A;  1Y0Y A;  3LMS A;  3D67 A;  3V38 A;  2RFH A;  4DUK A;  4DYO A;  4X3R A;  4OC5 A;  1ELM P;  1YW4 A;  1QMU A;  2G9D A;  4PXC A;  4UIB A;  3KZW A;  1XRY A;  2GU2 A;  2ZEO A;  4OME A;  4P44 A;  2JBJ A;  3B3T A;  2PJ8 A;  3B35 A;  2ZOF A;  5D29 A;  4P4J A;  5CBM A;  1LAN A;  4IHM A;  4F8Z A;  2RB7 A;  4WWV A;  2ZEG A;  4MCQ A;  4EFD A;  4LQG A;  2C6C A;  3VH9 A;  4YU9 A;  5LYF A;  1AMP A;  3SJF A;  2EK8 A;  1XBU A;  2Q4Z A;  1LCP A;  4UEE A;  3MRU A;  4P4B A;  4UIA A;  3T8W A;  2GRE A;  5K8O A;  4P4E A;  4MHP A;  4TWE A;  3D7H A;  4OC1 A;  4W9Y A;  4FUU A;  4OC4 A;  2IJZ A;  1F2P A;  1LOK A;  3SJG A;  3GUX A;  2PCU A;  5THW A;  1TKF A;  2PIY A;  1BAV A;  5HVF A;  3MN8 A;  3PB8 X;  2V8D A;  4OIW A;  7CPA A;  3D68 A;  2VL1 A;  2AFU A;  2I3C A;  5LYD A;  2V8H A;  2CIJ A;  2CTC A;  3KQZ A;  2ZEN A;  1Q7L A;  3BI0 A;  3JRU A;  4MXU A;  2HC9 A;  2CTB A;  2PJ7 A;  4F9V A;  4ZY0 A;  5HVG A;  3RBU A;  3B7I A;  2POK A;  3DGV A;  1F2O A;  3PFE A;  4MHY A;  3NH8 A;  4FAI A;  2F7V A;  3CT9 A;  1Z8L A;  4NJR A;  3PB6 X;  4PQA A;  2HB6 A;  1BPM A;  4MCR A;  2QVP A;  3H8E A;  5K8N A;  1VHO A;  3V7Z A;  2ZEF A;  3PBE A;  1BPN A;  3IWW A;  3FVL A;  3FED A;  3VAR A;  4X2T A;  1YME A;  4ZX9 A;  3D7G A;  4A37 A;  3KGQ A;  2C1C A;  3SI1 A;  5LRK A;  5LRG A;  1CP7 A;  1YW6 A;  4PPZ A;  2AFZ A;  5JH9 A;  3K9T A;  1ZG9 A;  4Z65 A;  3IFE A;  3WAB A;  4MRI A;  3FMC A;  2PJ2 A;  3D7F A;  3I1U A;  2QJ8 A;  2J9A A;  4TNU A;  1PCA A;  1BLL E;  4MMO A;  1EE3 P;  4P4F A;  3NFZ A;  2ZED A;  1CG2 A;  2BCO A;  3WC7 A;  1NSA A;  1R3N A;  4IAV A;  4ZYQ A;  3PEI A;  1XJO A;  1LFW A;  4OC3 A;  3HUV A;  1ELL P;  3RZA A;  5F09 A;  2O53 A;  4K3N A;  2PJ3 A;  2Q51 A;  1CX8 A;  2ZOG A;  2V8V A;  2AFO A;  4H2K A;  2PVV A;  3K2K A;  4NGP A;  4MCP A;  1R43 A;  4R8F A;  1ZLI A;  3GB0 A;  3CDX A;  4PXD A;  2V8G A;  3NH4 A;  3IEH A;  5LRJ A;  3FH4 A;  1FT7 A;  1CP6 A;  2JBK A;  2BOA A;  2AFX A;  1AYE A;  2PJB A;  4EME A;  4NGM A;  3RAM A;  4FBE A;  4YWY A;  4NFR A;  3NA6 A;  2PE3 A;  1M4L A;  1VHE A;  3B3W A;  4NGQ A;  4R6T A;  5I4M A;  2ZEM A;  3ISZ A;  4DJL A;  1UWY A;  1Z2L A;  3B3C A;  4NGT A;  4ZI6 A;  2ZEE A;  4P4D A;  2NSM A;  4PXE A;  1YLO A;  3IC1 A;  4P6Y A;  3WT4 A;  3BXM A;  5JM6 A;  1TKH A;  2O4H A;  3D66 A;  1YSJ A;  4P4I A;  3PFO A;  4GM5 A;  2DEA A;  3CPA A;  1JQG A;  2C6G A;  1ARL A;  1ZLH A;  3KHZ A;  1Y0R A;  4G1P A;  1TF8 A;  4Q7A A;  3BI1 A;  4A94 A;  4WJB A;  5JGF A;  1CBX A;  2PJ9 A;  3H8F A;  1HDQ A;  3PB7 X;  4OC2 A;  1DTD A;  4F9U A;  2FVG A;  1OBR A;  1TXR A;  1QQ9 A;  1LAM A;  5CPA A;  3S9N A;  2GLJ A;  2AFW A;  4ZY1 A;  3S9M A;  1KWM A;  2PJ0 A;  3KR5 A;  4FWU A;  1HDU A;  2Q43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...