1CP6A

1-butaneboronic acid binding to aeromonas proteolytica aminopeptidase
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (AMINOPEPTIDASE)
publication title 1-Butaneboronic acid binding to Aeromonas proteolytica aminopeptidase: a case of arrested development.
pubmed doi rcsb
molecule tags Hydrolase
total genus 114
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 1999-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1cp6A00
2QYVA 3IO1A 3FECA 5LYDA 2C1CA 3RZAA 5LYFA 4FWUA 1BPNA 2DEAA 4PQAA 4NGSA 3T8WA 2ZOFA 4P4JA 4R6TA 2PVWA 2XEFA 2F7VA 5JGFA 5HVGA 4JZ0A 4YWYA 3IFEA 5K8MA 4YU9A 1NSAA 2CTCA 3KR4A 4GM5A 5K8PA 4P4IA 1TKJA 3D7GA 1ELLP 3V38A 3TC8A 2PJ7A 1VGYA 4NJRA 5CBMA 3V7ZA 2JBKA 2JBJA 1UWYA 1TKHA 3N5FA 3KQZA 4MHYA 2PCUA 4UEZA 1FNOA 3BI1A 1GYTA 5JM6A 2GLFA 4K3NA 4F9VA 2AFUA 3K2KA 4TNUA 2PJ5A 3H8EA 3B3SA 4BD9A 4EMEA 3TX8A 3PFOA 4PPZA 3RBUA 3CT9A 4R7MA 1BLLE 3KQXA 1M4LA 5J1QA 3PB9X 4JYWA 4A94A 3H8FA 3VH9A 4RUHA 4P6YA 2ZEMA 2ZEOA 3KASA 5LRJA 3B35A 1DTDA 3D66A 2V8HA 3JRUA 2PJAA 1BPMA 4O23A 1LAPA 2IJZA 3S9LA 4MHNA 5ELYA 1DE4C 1Z8LA 1F2PA 3ISXA 3IIBA 4X3RA 2AFSA 3KHZA 2GU2A 2OOTA 3WC7A 4P4FA 4ZY2A 4FAIA 4WJBA 2C6PA 4UEEA 4W9YA 1Y0YA 5HXDA 4R8FA 3MN8A 1XBUA 3FEEA 3KI9A 3L2NA 2XEIA 4UEFA 2C6CA 4X8IA 3FMCA 3WC5A 3IJ3A 1OBRA 4Z65A 2ZOGA 3KR5A 2V8GA 3B3WA 4MCPA 1LAMA 4ZI6A 2PJ3A 5D29A 2PJBA 4NGPA 3IEHA 2ZEEA 5LRGA 3IWWA 4G1PA 3PB6X 3BXMA 4NGMA 1F2OA 3HLPA 2HC9A 3KL9A 5HVFA 2NSMA 4OC4A 5CPAA 2VL1A 2PJ1A 2PJ4A 4MCRA 3CPAA 1ZG7A 1HDUA 2ZEGA 4P4DA 1R43A 1TXRA 1ZG9A 2AFMA 2PVVA 4PXBA 2IQ6A 4UIBA 3VATA 4OIWA 3DGVA 4AXVA 4OC0A 2ZEFA 2Q43A 1TF8A 2XEJA 3PB7X 1IGBA 2PJ8A 3B2YA 5DS0A 4A38A 3FX6A 1Z5RA 4H2KA 2RFHA 3IC1A 1CP6A 1TKFA 2EK9A 3PB8X 1YSJA 2OR4A 1HEEA 4PXCA 1XFOA 2V8VA 5K8NA 3FJUA 1QQ9A 4ZX8A 4P10A 3WABA 1BAVA 2BO9A 3QNVA 2Q4ZA 3SJXA 3PB4X 3NFZA 3D67A 4A37A 1EE3P 1ZG8A 1F57A 1XRYA 2PJCA 1XMBA 1AYEA 2XEGA 4LQGA 3SJFA 3FVLA 1QMUA 2GREA 2CTBA 1Y7EA 4ZY1A 2AFOA 3ISZA 4EWTA 4PXEA 3GLJA 3PBBA 5THWA 2G9DA 3GUXA 4A39A 2ZEHA 4F9UA 1YW4A 3NA6A 1ELMP 2ANPA 3I1UA 1HDQA 1ARMA 3D7DA 1KWMA 4NFRA 6CPAA 3H8GA 4UF4A 3SJEA 1ZLIA 4OP4A 4MXUA 3HUVA 4NGRA 1TF9A 4NJQA 4P44A 3FH4A 1H8LA 5F09A 2AFWA 2CIJA 1LANA 1YLOA 1CPSA 3FEDA 1VHEA 1CG2A 4B6ZA 4OC5A 1ZLHA 4IAVA 2V77A 1CP7A 2IMOA 3SJGA 4FBEA 3D4UA 4OC1A 1VHOA 4ZY0A 3S9NA 4TWEA 2GLJA 3D7HA 1Q7LA 4KSIA 1XJOA 4P4BA 4R76A 1CX8A 4NGNA 3K9TA 3LMSA 3LWUA 1R3NA 3S9MA 4OIDA 4PXDA 2ZEDA 2CF4A 3B7IA 2V8DA 5LYIA 4Q7AA 3DLJA 2PIYA 4DUKA 4IHMA 2PJ6A 4F8ZA 3PRTA 1PCAA 5I4MA 2EK8A 4NGQA 3BI0A 2BCOA 4ZX9A 4MRIA 2QVPA 2EWBA 2PRQA 2POKA 4IK2A 4ZYQA 2ZELA 3VARA 2ABZA 4MCQA 3NH4A 3B3TA 3KGQA 2PE3A 2Q51A 3D68A 2BOAA 2FVGA 3PEIA 3D7FA 3PFEA 2JEWA 1LFWA 1AMPA 4MCSA 4EFDA 4P4EA 5K8OA 3CPXA 3SI1A 1CBXA 2J9AA 4OC2A 2O4HA 3WC6A 2PJ0A 1LOKA 3SI2A 4DYOA 4MMOA 3GB0A 4ONWA 5HVHA 5D8NA 5LRKA 3FF3A 5LYLA 2RB7A 3BHXA 2I3CA 3KHXA 8CPAA 3SI0A 2PJ9A 3NH5A 2QJ8A 2F8HA 5IB9A 2O53A 3B3CA 1Y0RA 4FUUA 1Z2LA 1FT7A 4OMEA 4OC3A 2NYQA 2AFZA 3PBEA 2PIZA 1PYTB 3KZWA 1YMEA 4MHPA 7CPAA 3RAMA 2ZEPA 4X2TA 2WYRA 1VIXA 2WZNA 3NH8A 5JH9A 2AFXA 1IY7A 2HB6A 4DJLA 1YW6A 4MHZA 1CPXA 2C6GA 3MRUA 3B3VA 4UIAA 4OKOA 2ZENA 4WWVA 4P45A 3WT4A 4NGTA 3CDXA 1RTQA 4CPAA 1JQGA 2PJ2A 1LCPA 1ARLA
chains in the Genus database with same CATH superfamily
2QYVA 3A9LA 3CXPA 3IO1A 3FECA 4ZBGA 2C1CA 1P0HA 2PC1A 5LYDA 4A31A 4AB7A 4KOSA 4C7HA 5JQ4A 3RZAA 5LYFA 4MI4A 4FWUA 1BPNA 5G22A 2DEAA 3RO0A 4PQAA 3RNZA 4MBUA 4NGSA 1XE4A 5F49A 3T8WA 2ZOFA 4P4JA 2CXAA 3W6SA 2CY2A 2O28A 5HH1A 4C2ZA 4R87A 3V8IA 4R6TA 1KUYA 1MJAA 2BSWA 2B3VA 3JUWA 4UA3A 2PR1A 1ON0A 2PVWA 5GCNA 2XEFA 1B6BA 2F7VA 2F5IA 4ZGYB 2AE6A 5JGFA 3S6KA 1YQEA 4RS2A 2PSWA 4FD5A 5HVGA 2B5GA 4JZ0A 2Q4YA 2IL4A 3IFEA 4YWYA 4YU9A 4QUSA 1NSAA 4KSFA 3WR7A 2CTCA 3KR4A 2ZW4A 4GM5A 5K8PA 4P4IA 5KTAA 1TKJA 3D7GA 4QC6A 1ELLP 2YNCA 2GE3A 1X12A 3DSBA 3V38A 3TC8A 2PJ7A 1VGYA 1IYLA 2PRBA 4M6GA 4NJRA 2REEA 5CBMA 3V7ZA 2JBKA 2JBJA 1CM0A 5AG5A 2FT0A 1UWYA 5K8MA 1TKHA 3R9FA 5AG6A 3N5FA 5HMNA 1ZO0A 3KQZA 4F0XA 4MHYA 4KZTA 2OU2A 2PCUA 4UEZA 1FNOA 4RI1A 3BI1A 4OLLA 1I21A 4B13A 1SQHA 1P4NA 1GYTA 5JM6A 1S7FA 2GLFA 4K3NA 4KVXA 4F9VA 1RO5A 4MFJA 2AFUA 3K2KA 3QAYA 4HNYB 4A30A 4TNUA 3IGRA 4CAXA 2PJ5A 4MY3A 2FS5A 3F5BA 3B3SA 3H8EA 4BD9A 1YR0A 4JXQA 4EMEA 2A4NA 3S6GA 2OH1A 3TX8A 4B11A 3PFOA 4CGMA 4B10A 4PPZA 1S3ZA 4CGOA 4H6UA 1NMTA 2G3AA 4HPSA 3RBUA 3CT9A 4R7MA 1BLLE 1PUAA 3IWEA 4BMHA 4FD4A 3KQXA 1J4JA 4CYQA 1M4LA 5J1QA 3PB9X 3EY5A 4UFXA 2VXKA 4JYWA 4A94A 3D8PA 1Z8TA 2BEIA 2I79A 3H8FA 3VH9A 2J8NA 4RUHA 1YVKA 4P6YA 2ZEMA 2ZEOA 3KASA 5LRJA 3B35A 1DTDA 3TCVA 1XMTA 3OWCA 2FIAA 1M4DA 2J8RA 4KLWA 1YREA 3D66A 4R57A 2V8HA 3JRUA 2D4OA 4CAEA 2PJAA 2Q0YA 4YFJA 1BPMA 4O23A 5H84A 4PSXA 1LAPA 2ATRA 4PK3A 2IJZA 2ARHA 5C82A 3S9LA 4F6AA 4MHNA 5ELYA 2ZW5A 4JJXA 1DE4C 1Z8LA 5ISVA 4KOYA 1F2PA 3FBUA 3DR8A 3ISXA 5IB0A 3IIBA 4X3RA 5J8FA 2AFSA 2OZGA 3KHZA 2GU2A 4MFQA 2OOTA 4B12A 3WC7A 4DNCA 1YK3A 2B5GB 4P4FA 5CNPA 4LQ6A 4ZY2A 4CAVA 4FAIA 3LACA 4WJBA 2C6PA 2Z3MA 3BJ8A 4UEEA 1Y0YA 3DDDA 2Q4VA 4W9YA 3KKWA 5HXDA 4R8FA 1NE9A 1Z8WA 1JWQA 3MN8A 1XBUA 3FEEA 3KI9A 4KORA 3L2NA 2XEIA 4UEFA 2C6CA 4FD7A 1IB1E 4X8IA 2YNEA 1IICA 3VWEA 4A95A 3GKRA 3FMCA 3WC5A 1BO4A 1OBRA 3IJ3A 4Z65A 4JWPA 4UCMA 4CGPA 4UCPA 4CYPA 2ZOGA 2C27A 3FXTA 2J8MA 3GYAA 2Z0ZA 4KOXA 4MJ8A 3R95A 4MHDA 2D4PA 3KR5A 4XPLA 2V8GA 3SXNA 5IX3A 3B3WA 4EVYA 1Q2CA 4MCPA 2CNTA 4XPKA 1LAMA 4ZI6A 2PJ3A 5D29A 2Z3NA 3LD2A 2WPWA 2PJBA 1B87A 4NGPA 3T90A 3IEHA 4M3SA 2DPTA 2ZEEA 3D2PA 3NE7A 5LRGA 4L89A 3IWWA 1NSLA 2Q44A 4G1PA 3PB6X 1XEBA 3DNSA 1YVOA 1X10A 3BXMA 4JD6A 4IF5A 4II9A 2Z3LA 4LUAA 4AG7A 4NGMA 1F2OA 3HLPA 3ZZIA 4KSAA 4PV6A 4PSWA 5A27A 1YLEA 2HC9A 3KL9A 5HVFA 2NSMA 3TOAA 4OC4A 5CPAA 5KTDA 4UWIA 2VL1A 2PJ1A 4X5KA 2EO8A 3UY5A 2PJ4A 4MCRA 3CPAA 1ZG7A 1HDUA 2FE7A 4MY0A 2ZEGA 1YGHA 4P4DA 1R43A 1TXRA 4KOWA 1ZG9A 2AFMA 2PVVA 3R1KA 4PXBA 3H5ZA 3RYOA 4GXHA 2IQ6A 4UIBA 2HQYA 3VATA 4OIWA 1I1DA 1LRZA 3DGVA 4AXVA 4OC0A 2VI7A 2ZEFA 3R9GA 2BL1A 3B8GA 1FY7A 4RN7A 2Q43A 1TF8A 2VZZA 2XEJA 3PB7X 1IGBA 3DR6A 2PJ8A 4J3GA 3B2YA 2JDDA 5DS0A 4C2YA 1GHEA 4A38A 4KVME 5J8CA 2P0WA 3FX6A 2B3UA 1Z5RA 1BOBA 3EO4A 4H2KA 2G3TA 2RFHA 2ZXVA 4H6ZA 2P6FA 4NF1A 4B5PB 4BINA 1M44A 4PK2A 2FXFA 3IC1A 1CP6A 4IUSA 1TKFA 1IU8A 4A32A 1PU9A 2EK9A 2X7BA 2Z3OA 3PB8X 1KUXA 2WPXA 1YSJA 2B4BA 3CXQA 2OR4A 1HEEA 4B5OA 2PQ8A 4PXCA 5EBVA 2CNSA 3TO9A 1XFOA 2RC4A 2JLMA 2V8VA 4BBHA 4C2XA 5K8NA 3FJUA 1QQ9A 2FCKA 4C7IA 2QMLA 4ZX8A 3W91A 5AG7A 1S7KA 2R7HA 3JVNA 4P10A 4QB9A 1K4JA 2REFA 3SXOA 3WABA 1BAVA 1M1DA 3R9EA 2B4DA 1XIXA 4QVTA 2BO9A 3QNVA 4Y49C 3QAHA 2GANA 2B58A 2Q4ZA 3SJXA 4U9YA 3PB4X 3I3GA 3NFZA 1QSOA 3D67A 1R57A 2DF5A 3R96A 1EE3P 1MJ9A 1ZG8A 3I9SA 1MJBA 4A37A 1F57A 4K30A 4HNXB 1XRYA 2PJCA 1XMBA 1AYEA 2XEGA 4LQGA 3SJFA 2DXQA 3FVLA 5KTCA 1Q2YA 4Y49B 1QMUA 2GREA 4AVAA 2YNCC 3GY9A 4CRYB 2CTBA 1QSNA 1Y7EA 4ZY1A 2AFOA 3ISZA 4ORFA 4B14A 5C88A 5F46A 4YGOA 4EWTA 3SHPA 4PXEA 3GLJA 3PBBA 2P6GA 5THWA 1L0CA 2G9DA 2KCWA 3GUXA 4A39A 2ZEHA 4F9UA 2EBJA 1YW4A 5AG4A 2FL4A 2Z10A 3N7ZA 3NA6A 5G1ZA 1ELMP 4I49A 2ANPA 3I1UA 2FIWA 1HDQA 1ARMA 3D7DA 1KWMA 1CJWA 4NFRA 3F8KA 3H8GA 4HKFA 4UF4A 3SJEA 4A2ZA 6CPAA 2HV2A 1ZLIA 4OP4A 3TO6A 1QSMA 2P6EA 3HUVA 4MXUA 4NGRA 5JPHA 1TF9A 2ODFA 4NJQA 2R8VA 1WWZA 4NCZA 1YX0A 3C26A 4P44A 3FH4A 2PR8A 2Z11A 1H8LA 3FNCA 3CXSA 5F09A 2AFWA 5G21A 1Y7RA 2CIJA 1LANA 1V0CA 3P2HA 1YLOA 4MFPA 3G8WA 4R9MA 5I0CA 1CPSA 3FEDA 4LX9A 1VHEA 4NEXA 2FSRA 1M4IA 1CG2A 4B6ZA 4OC5A 3GIUA 1U6MA 2QIRA 3ZJ0A 1ZLHA 1Y9WA 2V77A 2VBQA 4IAVA 4KOTA 4CS0B 4YRHA 3TT2A 1CP7A 2IMOA 3SJGA 4FBEA 3D4UA 4OC1A 1Z4EA 1VHOA 1S5KA 4ZY0A 3S9NA 4TWEA 3FIXA 2GLJA 3D7HA 4R3KA 2VEZA 1QSRA 1XOVA 2ZW6A 1N71A 1IOIA 1Z8XA 1Q7LA 2CNMA 1XJOA 3LODA 4KSIA 4M6IA 4P4BA 1Q2DA 1WK4A 3TO7A 4R76A 1CX8A 3F0AA 4NGNA 2EUIA 3K9TA 3LMSA 3LWUA 3MGDA 1R3NA 4XPDC 3S9MA 3TFYA 2AJ6A 3TTHA 3FB3A 4OIDA 5E96A 4PXDA 2HUZA 2ZEDA 2CF4A 5IV0A 3B7IA 2B4DB 2OZUA 2V8DA 4AVCA 5LYIA 4Q7AA 3DLJA 5G20A 2PIYA 4DUKA 4IHMA 2PJ6A 4NXYA 4UBRA 4F8ZA 3PRTA 4CAWA 1PCAA 2JEVA 5I4MA 4XPDB 4NSQA 2EK8A 1S7NA 4NGQA 4C68A 3BI0A 1UFHA 3IU2A 5A28A 2VQYA 3BLNA 2BCOA 1IOFA 4ZX9A 1OZPA 4MRIA 2Z3PA 2OZHA 1Y9KA 2NMTA 4E8OA 2QVPA 2EWBA 2PRQA 2POKA 1A2ZA 4OADA 4KOUA 4IK2A 5BWAB 4ZYQA 2ZELA 3VARA 2ABZA 4MCQA 3NH4A 4HNWB 2YNDA 3B3TA 3KGQA 5F48A 1Z4RA 2PE3A 2Q51A 3D68A 1IYKA 2BOAA 3BJ7A 2R98A 1S60A 1QSTA 2FVGA 5F47A 3S6HA 2EVNA 3PEIA 3D7FA 3PFEA 2JEWA 1LFWA 1AMPA 4MCSA 4R3LA 4P4EA 4EFDA 5K8OA 3CPXA 3EXNA 2I00A 1I12A 2Q04A 2Y0MA 3QB8A 3SI1A 1CBXA 2J9AA 4OC2A 3NE8A 3P2FA 4M6HA 3EC4A 4CGNA 2K5TA 2O4HA 3G3SA 4E0AA 3TOBA 3WC6A 2PJ0A 2GFQA 1LOKA 3SI2A 4DYOA 2G0BA 1RXTA 5AGEA 4MMOA 4U5YA 3GB0A 4ONWA 1VKCA 5HVHA 5D8NA 4AVBA 1KZFA 5LRKA 3D3SA 3FF3A 5LYLA 1IIDA 2RB7A 2Q7SA 3BHXA 2I3CA 3KHXA 8CPAA 2R1IA 2Z3KA 4MFZA 3SI0A 3K9UA 4KUAA 4GS4A 2PJ9A 3NH5A 2QJ8A 2JDCA 4U9ZA 1S7LA 1Z9UA 2F8HA 5DWMA 5IB9A 1XF8A 1MK4A 4KLVA 3T9YA 4CYNA 5EC4A 2O53A 5EMIA 3B3CA 1Y0RA 3PZJA 1VHSA 4XNHC 4CAFA 4JXRA 4FUUA 3H4QA 1Z2LA 4QBJA 2DPSA 4F0YA 4CRZB 2WSAA 1FT7A 2YGWA 4OMEA 4OC3A 2NYQA 2AFZA 3PBEA 4Q38A 4H89A 4Q36A 2QECA 4A33A 4KVOE 5DWNA 2PIZA 4CGLA 4UFVA 1PYTB 1KUVA 1TIQA 4UWJA 2H5MA 3KZWA 1YMEA 4MHPA 4KOVA 4JLYA 4L8AA 7CPAA 4FD6A 4KUBA 3RAMA 2WUUA 2ZEPA 3FRMA 4M85A 3W6XA 3CZXA 3FYNA 4X2TA 4XNHB 3E0KA 2WYRA 4MFKA 1VIXA 4KS9A 2Q7BA 2WZNA 3IU1A 3NH8A 5JH9A 2AFXA 4AG9A 1IY7A 2HB6A 4OAEA 3D2MA 4DJLA 1YW6A 4MHZA 3VWDA 4E2AA 1CPXA 3S6FA 2C6GA 4B5PA 3MRUA 4CYOA 3PGPA 3B3VA 4UIAA 4OKOA 4MFLA 2ZPAA 2VZYA 3JTKA 5H86A 2BUEA 2ZENA 4ONUA 4WWVA 4P45A 3WT4A 3EFAA 2OB0A 2ZW7A 4NGTA 2GIVA 2PDOA 3CDXA 1RTQA 1M4GA 4CPAA 1AUGA 4UFWA 4UCNA 3PP9A 5FVJA 1JQGA 2PJ2A 1LCPA 3IWGA 1ARLA 3TE4A
chains in the Genus database with same CATH topology
2QYVA 3IO1A 3FECA 5LYDA 2C1CA 3RZAA 5LYFA 4FWUA 1BPNA 2DEAA 4PQAA 4NGSA 3T8WA 2ZOFA 4P4JA 4R6TA 2PVWA 2XEFA 2F7VA 5JGFA 5HVGA 4JZ0A 4YWYA 3IFEA 5K8MA 4YU9A 1NSAA 2CTCA 3KR4A 4GM5A 5K8PA 4P4IA 1TKJA 3D7GA 1ELLP 3V38A 3TC8A 2PJ7A 1VGYA 4NJRA 5CBMA 3V7ZA 2JBKA 2JBJA 1UWYA 1TKHA 3N5FA 3KQZA 4MHYA 2PCUA 4UEZA 1FNOA 3BI1A 1GYTA 5JM6A 2GLFA 4K3NA 4F9VA 2AFUA 3K2KA 4TNUA 2PJ5A 3H8EA 3B3SA 4BD9A 4EMEA 3TX8A 3PFOA 4PPZA 3RBUA 3CT9A 4R7MA 1BLLE 3KQXA 1M4LA 5J1QA 3PB9X 4JYWA 4A94A 3H8FA 3VH9A 4RUHA 4P6YA 2ZEMA 2ZEOA 3KASA 5LRJA 3B35A 1DTDA 3D66A 2V8HA 3JRUA 2PJAA 1BPMA 4O23A 1LAPA 2IJZA 3S9LA 4MHNA 5ELYA 1DE4C 1Z8LA 1F2PA 3ISXA 3IIBA 4X3RA 2AFSA 3KHZA 2GU2A 2OOTA 3WC7A 4P4FA 4ZY2A 4FAIA 4WJBA 2C6PA 4UEEA 4W9YA 1Y0YA 5HXDA 4R8FA 3MN8A 1XBUA 3FEEA 3KI9A 3L2NA 2XEIA 4UEFA 2C6CA 4X8IA 3FMCA 3WC5A 3IJ3A 1OBRA 4Z65A 2ZOGA 3KR5A 2V8GA 3B3WA 4MCPA 1LAMA 4ZI6A 2PJ3A 5D29A 2PJBA 4NGPA 3IEHA 2ZEEA 5LRGA 3IWWA 4G1PA 3PB6X 3BXMA 4NGMA 1F2OA 3HLPA 2HC9A 3KL9A 5HVFA 2NSMA 4OC4A 5CPAA 2VL1A 2PJ1A 2PJ4A 4MCRA 3CPAA 1ZG7A 1HDUA 2ZEGA 4P4DA 1R43A 1TXRA 1ZG9A 2AFMA 2PVVA 4PXBA 2IQ6A 4UIBA 3VATA 4OIWA 3DGVA 4AXVA 4OC0A 2ZEFA 2Q43A 1TF8A 2XEJA 3PB7X 1IGBA 2PJ8A 3B2YA 5DS0A 4A38A 3FX6A 1Z5RA 4H2KA 2RFHA 3IC1A 1CP6A 1TKFA 2EK9A 3PB8X 1YSJA 2OR4A 1HEEA 4PXCA 1XFOA 2V8VA 5K8NA 3FJUA 1QQ9A 4ZX8A 4P10A 3WABA 1BAVA 2BO9A 3QNVA 2Q4ZA 3SJXA 3PB4X 3NFZA 3D67A 4A37A 1EE3P 1ZG8A 1F57A 1XRYA 2PJCA 1XMBA 1AYEA 2XEGA 4LQGA 3SJFA 3FVLA 1QMUA 2GREA 2CTBA 1Y7EA 4ZY1A 2AFOA 3ISZA 4EWTA 4PXEA 3GLJA 3PBBA 5THWA 2G9DA 3GUXA 4A39A 2ZEHA 4F9UA 1YW4A 3NA6A 1ELMP 2ANPA 3I1UA 1HDQA 1ARMA 3D7DA 1KWMA 4NFRA 6CPAA 3H8GA 4UF4A 3SJEA 1ZLIA 4OP4A 4MXUA 3HUVA 4NGRA 1TF9A 4NJQA 4P44A 3FH4A 1H8LA 5F09A 2AFWA 2CIJA 1LANA 1YLOA 1CPSA 3FEDA 1VHEA 1CG2A 4B6ZA 4OC5A 1ZLHA 4IAVA 2V77A 1CP7A 2IMOA 3SJGA 4FBEA 3D4UA 4OC1A 1VHOA 4ZY0A 3S9NA 4TWEA 2GLJA 3D7HA 1Q7LA 4KSIA 1XJOA 4P4BA 4R76A 1CX8A 4NGNA 3K9TA 3LMSA 3LWUA 1R3NA 3S9MA 4OIDA 4PXDA 2ZEDA 2CF4A 3B7IA 2V8DA 5LYIA 4Q7AA 3DLJA 2PIYA 4DUKA 4IHMA 2PJ6A 4F8ZA 3PRTA 1PCAA 5I4MA 2EK8A 4NGQA 3BI0A 2BCOA 4ZX9A 4MRIA 2QVPA 2EWBA 2PRQA 2POKA 4IK2A 4ZYQA 2ZELA 3VARA 2ABZA 4MCQA 3NH4A 3B3TA 3KGQA 2PE3A 2Q51A 3D68A 2BOAA 2FVGA 3PEIA 3D7FA 3PFEA 2JEWA 1LFWA 1AMPA 4MCSA 4EFDA 4P4EA 5K8OA 3CPXA 3SI1A 1CBXA 2J9AA 4OC2A 2O4HA 3WC6A 2PJ0A 1LOKA 3SI2A 4DYOA 4MMOA 3GB0A 4ONWA 5HVHA 5D8NA 5LRKA 3FF3A 5LYLA 2RB7A 3BHXA 2I3CA 3KHXA 8CPAA 3SI0A 2PJ9A 3NH5A 2QJ8A 2F8HA 5IB9A 2O53A 3B3CA 1Y0RA 4FUUA 1Z2LA 1FT7A 4OMEA 4OC3A 2NYQA 2AFZA 3PBEA 2PIZA 1PYTB 3KZWA 1YMEA 4MHPA 7CPAA 3RAMA 2ZEPA 4X2TA 2WYRA 1VIXA 2WZNA 3NH8A 5JH9A 2AFXA 1IY7A 2HB6A 4DJLA 1YW6A 4MHZA 1CPXA 2C6GA 3MRUA 3B3VA 4UIAA 4OKOA 2ZENA 4WWVA 4P45A 3WT4A 4NGTA 3CDXA 1RTQA 4CPAA 1JQGA 2PJ2A 1LCPA 1ARLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYV A;  3IO1 A;  3FEC A;  5LYD A;  2C1C A;  3RZA A;  5LYF A;  4FWU A;  1BPN A;  2DEA A;  4PQA A;  4NGS A;  3T8W A;  2ZOF A;  4P4J A;  4R6T A;  2PVW A;  2XEF A;  2F7V A;  5JGF A;  5HVG A;  4JZ0 A;  4YWY A;  3IFE A;  5K8M A;  4YU9 A;  1NSA A;  2CTC A;  3KR4 A;  4GM5 A;  5K8P A;  4P4I A;  1TKJ A;  3D7G A;  1ELL P;  3V38 A;  3TC8 A;  2PJ7 A;  1VGY A;  4NJR A;  5CBM A;  3V7Z A;  2JBK A;  2JBJ A;  1UWY A;  1TKH A;  3N5F A;  3KQZ A;  4MHY A;  2PCU A;  4UEZ A;  1FNO A;  3BI1 A;  1GYT A;  5JM6 A;  2GLF A;  4K3N A;  4F9V A;  2AFU A;  3K2K A;  4TNU A;  2PJ5 A;  3H8E A;  3B3S A;  4BD9 A;  4EME A;  3TX8 A;  3PFO A;  4PPZ A;  3RBU A;  3CT9 A;  4R7M A;  1BLL E;  3KQX A;  1M4L A;  5J1Q A;  3PB9 X;  4JYW A;  4A94 A;  3H8F A;  3VH9 A;  4RUH A;  4P6Y A;  2ZEM A;  2ZEO A;  3KAS A;  5LRJ A;  3B35 A;  1DTD A;  3D66 A;  2V8H A;  3JRU A;  2PJA A;  1BPM A;  4O23 A;  1LAP A;  2IJZ A;  3S9L A;  4MHN A;  5ELY A;  1DE4 C;  1Z8L A;  1F2P A;  3ISX A;  3IIB A;  4X3R A;  2AFS A;  3KHZ A;  2GU2 A;  2OOT A;  3WC7 A;  4P4F A;  4ZY2 A;  4FAI A;  4WJB A;  2C6P A;  4UEE A;  4W9Y A;  1Y0Y A;  5HXD A;  4R8F A;  3MN8 A;  1XBU A;  3FEE A;  3KI9 A;  3L2N A;  2XEI A;  4UEF A;  2C6C A;  4X8I A;  3FMC A;  3WC5 A;  3IJ3 A;  1OBR A;  4Z65 A;  2ZOG A;  3KR5 A;  2V8G A;  3B3W A;  4MCP A;  1LAM A;  4ZI6 A;  2PJ3 A;  5D29 A;  2PJB A;  4NGP A;  3IEH A;  2ZEE A;  5LRG A;  3IWW A;  4G1P A;  3PB6 X;  3BXM A;  4NGM A;  1F2O A;  3HLP A;  2HC9 A;  3KL9 A;  5HVF A;  2NSM A;  4OC4 A;  5CPA A;  2VL1 A;  2PJ1 A;  2PJ4 A;  4MCR A;  3CPA A;  1ZG7 A;  1HDU A;  2ZEG A;  4P4D A;  1R43 A;  1TXR A;  1ZG9 A;  2AFM A;  2PVV A;  4PXB A;  2IQ6 A;  4UIB A;  3VAT A;  4OIW A;  3DGV A;  4AXV A;  4OC0 A;  2ZEF A;  2Q43 A;  1TF8 A;  2XEJ A;  3PB7 X;  1IGB A;  2PJ8 A;  3B2Y A;  5DS0 A;  4A38 A;  3FX6 A;  1Z5R A;  4H2K A;  2RFH A;  3IC1 A;  1CP6 A;  1TKF A;  2EK9 A;  3PB8 X;  1YSJ A;  2OR4 A;  1HEE A;  4PXC A;  1XFO A;  2V8V A;  5K8N A;  3FJU A;  1QQ9 A;  4ZX8 A;  4P10 A;  3WAB A;  1BAV A;  2BO9 A;  3QNV A;  2Q4Z A;  3SJX A;  3PB4 X;  3NFZ A;  3D67 A;  4A37 A;  1EE3 P;  1ZG8 A;  1F57 A;  1XRY A;  2PJC A;  1XMB A;  1AYE A;  2XEG A;  4LQG A;  3SJF A;  3FVL A;  1QMU A;  2GRE A;  2CTB A;  1Y7E A;  4ZY1 A;  2AFO A;  3ISZ A;  4EWT A;  4PXE A;  3GLJ A;  3PBB A;  5THW A;  2G9D A;  3GUX A;  4A39 A;  2ZEH A;  4F9U A;  1YW4 A;  3NA6 A;  1ELM P;  2ANP A;  3I1U A;  1HDQ A;  1ARM A;  3D7D A;  1KWM A;  4NFR A;  6CPA A;  3H8G A;  4UF4 A;  3SJE A;  1ZLI A;  4OP4 A;  4MXU A;  3HUV A;  4NGR A;  1TF9 A;  4NJQ A;  4P44 A;  3FH4 A;  1H8L A;  5F09 A;  2AFW A;  2CIJ A;  1LAN A;  1YLO A;  1CPS A;  3FED A;  1VHE A;  1CG2 A;  4B6Z A;  4OC5 A;  1ZLH A;  4IAV A;  2V77 A;  1CP7 A;  2IMO A;  3SJG A;  4FBE A;  3D4U A;  4OC1 A;  1VHO A;  4ZY0 A;  3S9N A;  4TWE A;  2GLJ A;  3D7H A;  1Q7L A;  4KSI A;  1XJO A;  4P4B A;  4R76 A;  1CX8 A;  4NGN A;  3K9T A;  3LMS A;  3LWU A;  1R3N A;  3S9M A;  4OID A;  4PXD A;  2ZED A;  2CF4 A;  3B7I A;  2V8D A;  5LYI A;  4Q7A A;  3DLJ A;  2PIY A;  4DUK A;  4IHM A;  2PJ6 A;  4F8Z A;  3PRT A;  1PCA A;  5I4M A;  2EK8 A;  4NGQ A;  3BI0 A;  2BCO A;  4ZX9 A;  4MRI A;  2QVP A;  2EWB A;  2PRQ A;  2POK A;  4IK2 A;  4ZYQ A;  2ZEL A;  3VAR A;  2ABZ A;  4MCQ A;  3NH4 A;  3B3T A;  3KGQ A;  2PE3 A;  2Q51 A;  3D68 A;  2BOA A;  2FVG A;  3PEI A;  3D7F A;  3PFE A;  2JEW A;  1LFW A;  1AMP A;  4MCS A;  4EFD A;  4P4E A;  5K8O A;  3CPX A;  3SI1 A;  1CBX A;  2J9A A;  4OC2 A;  2O4H A;  3WC6 A;  2PJ0 A;  1LOK A;  3SI2 A;  4DYO A;  4MMO A;  3GB0 A;  4ONW A;  5HVH A;  5D8N A;  5LRK A;  3FF3 A;  5LYL A;  2RB7 A;  3BHX A;  2I3C A;  3KHX A;  8CPA A;  3SI0 A;  2PJ9 A;  3NH5 A;  2QJ8 A;  2F8H A;  5IB9 A;  2O53 A;  3B3C A;  1Y0R A;  4FUU A;  1Z2L A;  1FT7 A;  4OME A;  4OC3 A;  2NYQ A;  2AFZ A;  3PBE A;  2PIZ A;  1PYT B;  3KZW A;  1YME A;  4MHP A;  7CPA A;  3RAM A;  2ZEP A;  4X2T A;  2WYR A;  1VIX A;  2WZN A;  3NH8 A;  5JH9 A;  2AFX A;  1IY7 A;  2HB6 A;  4DJL A;  1YW6 A;  4MHZ A;  1CPX A;  2C6G A;  3MRU A;  3B3V A;  4UIA A;  4OKO A;  2ZEN A;  4WWV A;  4P45 A;  3WT4 A;  4NGT A;  3CDX A;  1RTQ A;  4CPA A;  1JQG A;  2PJ2 A;  1LCP A;  1ARL A; 
#chains in the Genus database with same CATH topology
 2QYV A;  3A9L A;  3CXP A;  3IO1 A;  3FEC A;  4ZBG A;  2C1C A;  1P0H A;  2PC1 A;  5LYD A;  4A31 A;  4AB7 A;  4KOS A;  4C7H A;  5JQ4 A;  3RZA A;  5LYF A;  4MI4 A;  4FWU A;  1BPN A;  5G22 A;  2DEA A;  3RO0 A;  4PQA A;  3RNZ A;  4MBU A;  4NGS A;  1XE4 A;  5F49 A;  3T8W A;  2ZOF A;  4P4J A;  2CXA A;  3W6S A;  2CY2 A;  2O28 A;  5HH1 A;  4C2Z A;  4R87 A;  3V8I A;  4R6T A;  1KUY A;  1MJA A;  2BSW A;  2B3V A;  3JUW A;  4UA3 A;  2PR1 A;  1ON0 A;  2PVW A;  5GCN A;  2XEF A;  1B6B A;  2F7V A;  2F5I A;  4ZGY B;  2AE6 A;  5JGF A;  3S6K A;  1YQE A;  4RS2 A;  2PSW A;  4FD5 A;  5HVG A;  2B5G A;  4JZ0 A;  2Q4Y A;  2IL4 A;  3IFE A;  4YWY A;  4YU9 A;  4QUS A;  1NSA A;  4KSF A;  3WR7 A;  2CTC A;  3KR4 A;  2ZW4 A;  4GM5 A;  5K8P A;  4P4I A;  5KTA A;  1TKJ A;  3D7G A;  4QC6 A;  1ELL P;  2YNC A;  2GE3 A;  1X12 A;  3DSB A;  3V38 A;  3TC8 A;  2PJ7 A;  1VGY A;  1IYL A;  2PRB A;  4M6G A;  4NJR A;  2REE A;  5CBM A;  3V7Z A;  2JBK A;  2JBJ A;  1CM0 A;  5AG5 A;  2FT0 A;  1UWY A;  5K8M A;  1TKH A;  3R9F A;  5AG6 A;  3N5F A;  5HMN A;  1ZO0 A;  3KQZ A;  4F0X A;  4MHY A;  4KZT A;  2OU2 A;  2PCU A;  4UEZ A;  1FNO A;  4RI1 A;  3BI1 A;  4OLL A;  1I21 A;  4B13 A;  1SQH A;  1P4N A;  1GYT A;  5JM6 A;  1S7F A;  2GLF A;  4K3N A;  4KVX A;  4F9V A;  1RO5 A;  4MFJ A;  2AFU A;  3K2K A;  3QAY A;  4HNY B;  4A30 A;  4TNU A;  3IGR A;  4CAX A;  2PJ5 A;  4MY3 A;  2FS5 A;  3F5B A;  3B3S A;  3H8E A;  4BD9 A;  1YR0 A;  4JXQ A;  4EME A;  2A4N A;  3S6G A;  2OH1 A;  3TX8 A;  4B11 A;  3PFO A;  4CGM A;  4B10 A;  4PPZ A;  1S3Z A;  4CGO A;  4H6U A;  1NMT A;  2G3A A;  4HPS A;  3RBU A;  3CT9 A;  4R7M A;  1BLL E;  1PUA A;  3IWE A;  4BMH A;  4FD4 A;  3KQX A;  1J4J A;  4CYQ A;  1M4L A;  5J1Q A;  3PB9 X;  3EY5 A;  4UFX A;  2VXK A;  4JYW A;  4A94 A;  3D8P A;  1Z8T A;  2BEI A;  2I79 A;  3H8F A;  3VH9 A;  2J8N A;  4RUH A;  1YVK A;  4P6Y A;  2ZEM A;  2ZEO A;  3KAS A;  5LRJ A;  3B35 A;  1DTD A;  3TCV A;  1XMT A;  3OWC A;  2FIA A;  1M4D A;  2J8R A;  4KLW A;  1YRE A;  3D66 A;  4R57 A;  2V8H A;  3JRU A;  2D4O A;  4CAE A;  2PJA A;  2Q0Y A;  4YFJ A;  1BPM A;  4O23 A;  5H84 A;  4PSX A;  1LAP A;  2ATR A;  4PK3 A;  2IJZ A;  2ARH A;  5C82 A;  3S9L A;  4F6A A;  4MHN A;  5ELY A;  2ZW5 A;  4JJX A;  1DE4 C;  1Z8L A;  5ISV A;  4KOY A;  1F2P A;  3FBU A;  3DR8 A;  3ISX A;  5IB0 A;  3IIB A;  4X3R A;  5J8F A;  2AFS A;  2OZG A;  3KHZ A;  2GU2 A;  4MFQ A;  2OOT A;  4B12 A;  3WC7 A;  4DNC A;  1YK3 A;  2B5G B;  4P4F A;  5CNP A;  4LQ6 A;  4ZY2 A;  4CAV A;  4FAI A;  3LAC A;  4WJB A;  2C6P A;  2Z3M A;  3BJ8 A;  4UEE A;  1Y0Y A;  3DDD A;  2Q4V A;  4W9Y A;  3KKW A;  5HXD A;  4R8F A;  1NE9 A;  1Z8W A;  1JWQ A;  3MN8 A;  1XBU A;  3FEE A;  3KI9 A;  4KOR A;  3L2N A;  2XEI A;  4UEF A;  2C6C A;  4FD7 A;  1IB1 E;  4X8I A;  2YNE A;  1IIC A;  3VWE A;  4A95 A;  3GKR A;  3FMC A;  3WC5 A;  1BO4 A;  1OBR A;  3IJ3 A;  4Z65 A;  4JWP A;  4UCM A;  4CGP A;  4UCP A;  4CYP A;  2ZOG A;  2C27 A;  3FXT A;  2J8M A;  3GYA A;  2Z0Z A;  4KOX A;  4MJ8 A;  3R95 A;  4MHD A;  2D4P A;  3KR5 A;  4XPL A;  2V8G A;  3SXN A;  5IX3 A;  3B3W A;  4EVY A;  1Q2C A;  4MCP A;  2CNT A;  4XPK A;  1LAM A;  4ZI6 A;  2PJ3 A;  5D29 A;  2Z3N A;  3LD2 A;  2WPW A;  2PJB A;  1B87 A;  4NGP A;  3T90 A;  3IEH A;  4M3S A;  2DPT A;  2ZEE A;  3D2P A;  3NE7 A;  5LRG A;  4L89 A;  3IWW A;  1NSL A;  2Q44 A;  4G1P A;  3PB6 X;  1XEB A;  3DNS A;  1YVO A;  1X10 A;  3BXM A;  4JD6 A;  4IF5 A;  4II9 A;  2Z3L A;  4LUA A;  4AG7 A;  4NGM A;  1F2O A;  3HLP A;  3ZZI A;  4KSA A;  4PV6 A;  4PSW A;  5A27 A;  1YLE A;  2HC9 A;  3KL9 A;  5HVF A;  2NSM A;  3TOA A;  4OC4 A;  5CPA A;  5KTD A;  4UWI A;  2VL1 A;  2PJ1 A;  4X5K A;  2EO8 A;  3UY5 A;  2PJ4 A;  4MCR A;  3CPA A;  1ZG7 A;  1HDU A;  2FE7 A;  4MY0 A;  2ZEG A;  1YGH A;  4P4D A;  1R43 A;  1TXR A;  4KOW A;  1ZG9 A;  2AFM A;  2PVV A;  3R1K A;  4PXB A;  3H5Z A;  3RYO A;  4GXH A;  2IQ6 A;  4UIB A;  2HQY A;  3VAT A;  4OIW A;  1I1D A;  1LRZ A;  3DGV A;  4AXV A;  4OC0 A;  2VI7 A;  2ZEF A;  3R9G A;  2BL1 A;  3B8G A;  1FY7 A;  4RN7 A;  2Q43 A;  1TF8 A;  2VZZ A;  2XEJ A;  3PB7 X;  1IGB A;  3DR6 A;  2PJ8 A;  4J3G A;  3B2Y A;  2JDD A;  5DS0 A;  4C2Y A;  1GHE A;  4A38 A;  4KVM E;  5J8C A;  2P0W A;  3FX6 A;  2B3U A;  1Z5R A;  1BOB A;  3EO4 A;  4H2K A;  2G3T A;  2RFH A;  2ZXV A;  4H6Z A;  2P6F A;  4NF1 A;  4B5P B;  4BIN A;  1M44 A;  4PK2 A;  2FXF A;  3IC1 A;  1CP6 A;  4IUS A;  1TKF A;  1IU8 A;  4A32 A;  1PU9 A;  2EK9 A;  2X7B A;  2Z3O A;  3PB8 X;  1KUX A;  2WPX A;  1YSJ A;  2B4B A;  3CXQ A;  2OR4 A;  1HEE A;  4B5O A;  2PQ8 A;  4PXC A;  5EBV A;  2CNS A;  3TO9 A;  1XFO A;  2RC4 A;  2JLM A;  2V8V A;  4BBH A;  4C2X A;  5K8N A;  3FJU A;  1QQ9 A;  2FCK A;  4C7I A;  2QML A;  4ZX8 A;  3W91 A;  5AG7 A;  1S7K A;  2R7H A;  3JVN A;  4P10 A;  4QB9 A;  1K4J A;  2REF A;  3SXO A;  3WAB A;  1BAV A;  1M1D A;  3R9E A;  2B4D A;  1XIX A;  4QVT A;  2BO9 A;  3QNV A;  4Y49 C;  3QAH A;  2GAN A;  2B58 A;  2Q4Z A;  3SJX A;  4U9Y A;  3PB4 X;  3I3G A;  3NFZ A;  1QSO A;  3D67 A;  1R57 A;  2DF5 A;  3R96 A;  1EE3 P;  1MJ9 A;  1ZG8 A;  3I9S A;  1MJB A;  4A37 A;  1F57 A;  4K30 A;  4HNX B;  1XRY A;  2PJC A;  1XMB A;  1AYE A;  2XEG A;  4LQG A;  3SJF A;  2DXQ A;  3FVL A;  5KTC A;  1Q2Y A;  4Y49 B;  1QMU A;  2GRE A;  4AVA A;  2YNC C;  3GY9 A;  4CRY B;  2CTB A;  1QSN A;  1Y7E A;  4ZY1 A;  2AFO A;  3ISZ A;  4ORF A;  4B14 A;  5C88 A;  5F46 A;  4YGO A;  4EWT A;  3SHP A;  4PXE A;  3GLJ A;  3PBB A;  2P6G A;  5THW A;  1L0C A;  2G9D A;  2KCW A;  3GUX A;  4A39 A;  2ZEH A;  4F9U A;  2EBJ A;  1YW4 A;  5AG4 A;  2FL4 A;  2Z10 A;  3N7Z A;  3NA6 A;  5G1Z A;  1ELM P;  4I49 A;  2ANP A;  3I1U A;  2FIW A;  1HDQ A;  1ARM A;  3D7D A;  1KWM A;  1CJW A;  4NFR A;  3F8K A;  3H8G A;  4HKF A;  4UF4 A;  3SJE A;  4A2Z A;  6CPA A;  2HV2 A;  1ZLI A;  4OP4 A;  3TO6 A;  1QSM A;  2P6E A;  3HUV A;  4MXU A;  4NGR A;  5JPH A;  1TF9 A;  2ODF A;  4NJQ A;  2R8V A;  1WWZ A;  4NCZ A;  1YX0 A;  3C26 A;  4P44 A;  3FH4 A;  2PR8 A;  2Z11 A;  1H8L A;  3FNC A;  3CXS A;  5F09 A;  2AFW A;  5G21 A;  1Y7R A;  2CIJ A;  1LAN A;  1V0C A;  3P2H A;  1YLO A;  4MFP A;  3G8W A;  4R9M A;  5I0C A;  1CPS A;  3FED A;  4LX9 A;  1VHE A;  4NEX A;  2FSR A;  1M4I A;  1CG2 A;  4B6Z A;  4OC5 A;  3GIU A;  1U6M A;  2QIR A;  3ZJ0 A;  1ZLH A;  1Y9W A;  2V77 A;  2VBQ A;  4IAV A;  4KOT A;  4CS0 B;  4YRH A;  3TT2 A;  1CP7 A;  2IMO A;  3SJG A;  4FBE A;  3D4U A;  4OC1 A;  1Z4E A;  1VHO A;  1S5K A;  4ZY0 A;  3S9N A;  4TWE A;  3FIX A;  2GLJ A;  3D7H A;  4R3K A;  2VEZ A;  1QSR A;  1XOV A;  2ZW6 A;  1N71 A;  1IOI A;  1Z8X A;  1Q7L A;  2CNM A;  1XJO A;  3LOD A;  4KSI A;  4M6I A;  4P4B A;  1Q2D A;  1WK4 A;  3TO7 A;  4R76 A;  1CX8 A;  3F0A A;  4NGN A;  2EUI A;  3K9T A;  3LMS A;  3LWU A;  3MGD A;  1R3N A;  4XPD C;  3S9M A;  3TFY A;  2AJ6 A;  3TTH A;  3FB3 A;  4OID A;  5E96 A;  4PXD A;  2HUZ A;  2ZED A;  2CF4 A;  5IV0 A;  3B7I A;  2B4D B;  2OZU A;  2V8D A;  4AVC A;  5LYI A;  4Q7A A;  3DLJ A;  5G20 A;  2PIY A;  4DUK A;  4IHM A;  2PJ6 A;  4NXY A;  4UBR A;  4F8Z A;  3PRT A;  4CAW A;  1PCA A;  2JEV A;  5I4M A;  4XPD B;  4NSQ A;  2EK8 A;  1S7N A;  4NGQ A;  4C68 A;  3BI0 A;  1UFH A;  3IU2 A;  5A28 A;  2VQY A;  3BLN A;  2BCO A;  1IOF A;  4ZX9 A;  1OZP A;  4MRI A;  2Z3P A;  2OZH A;  1Y9K A;  2NMT A;  4E8O A;  2QVP A;  2EWB A;  2PRQ A;  2POK A;  1A2Z A;  4OAD A;  4KOU A;  4IK2 A;  5BWA B;  4ZYQ A;  2ZEL A;  3VAR A;  2ABZ A;  4MCQ A;  3NH4 A;  4HNW B;  2YND A;  3B3T A;  3KGQ A;  5F48 A;  1Z4R A;  2PE3 A;  2Q51 A;  3D68 A;  1IYK A;  2BOA A;  3BJ7 A;  2R98 A;  1S60 A;  1QST A;  2FVG A;  5F47 A;  3S6H A;  2EVN A;  3PEI A;  3D7F A;  3PFE A;  2JEW A;  1LFW A;  1AMP A;  4MCS A;  4R3L A;  4P4E A;  4EFD A;  5K8O A;  3CPX A;  3EXN A;  2I00 A;  1I12 A;  2Q04 A;  2Y0M A;  3QB8 A;  3SI1 A;  1CBX A;  2J9A A;  4OC2 A;  3NE8 A;  3P2F A;  4M6H A;  3EC4 A;  4CGN A;  2K5T A;  2O4H A;  3G3S A;  4E0A A;  3TOB A;  3WC6 A;  2PJ0 A;  2GFQ A;  1LOK A;  3SI2 A;  4DYO A;  2G0B A;  1RXT A;  5AGE A;  4MMO A;  4U5Y A;  3GB0 A;  4ONW A;  1VKC A;  5HVH A;  5D8N A;  4AVB A;  1KZF A;  5LRK A;  3D3S A;  3FF3 A;  5LYL A;  1IID A;  2RB7 A;  2Q7S A;  3BHX A;  2I3C A;  3KHX A;  8CPA A;  2R1I A;  2Z3K A;  4MFZ A;  3SI0 A;  3K9U A;  4KUA A;  4GS4 A;  2PJ9 A;  3NH5 A;  2QJ8 A;  2JDC A;  4U9Z A;  1S7L A;  1Z9U A;  2F8H A;  5DWM A;  5IB9 A;  1XF8 A;  1MK4 A;  4KLV A;  3T9Y A;  4CYN A;  5EC4 A;  2O53 A;  5EMI A;  3B3C A;  1Y0R A;  3PZJ A;  1VHS A;  4XNH C;  4CAF A;  4JXR A;  4FUU A;  3H4Q A;  1Z2L A;  4QBJ A;  2DPS A;  4F0Y A;  4CRZ B;  2WSA A;  1FT7 A;  2YGW A;  4OME A;  4OC3 A;  2NYQ A;  2AFZ A;  3PBE A;  4Q38 A;  4H89 A;  4Q36 A;  2QEC A;  4A33 A;  4KVO E;  5DWN A;  2PIZ A;  4CGL A;  4UFV A;  1PYT B;  1KUV A;  1TIQ A;  4UWJ A;  2H5M A;  3KZW A;  1YME A;  4MHP A;  4KOV A;  4JLY A;  4L8A A;  7CPA A;  4FD6 A;  4KUB A;  3RAM A;  2WUU A;  2ZEP A;  3FRM A;  4M85 A;  3W6X A;  3CZX A;  3FYN A;  4X2T A;  4XNH B;  3E0K A;  2WYR A;  4MFK A;  1VIX A;  4KS9 A;  2Q7B A;  2WZN A;  3IU1 A;  3NH8 A;  5JH9 A;  2AFX A;  4AG9 A;  1IY7 A;  2HB6 A;  4OAE A;  3D2M A;  4DJL A;  1YW6 A;  4MHZ A;  3VWD A;  4E2A A;  1CPX A;  3S6F A;  2C6G A;  4B5P A;  3MRU A;  4CYO A;  3PGP A;  3B3V A;  4UIA A;  4OKO A;  4MFL A;  2ZPA A;  2VZY A;  3JTK A;  5H86 A;  2BUE A;  2ZEN A;  4ONU A;  4WWV A;  4P45 A;  3WT4 A;  3EFA A;  2OB0 A;  2ZW7 A;  4NGT A;  2GIV A;  2PDO A;  3CDX A;  1RTQ A;  1M4G A;  4CPA A;  1AUG A;  4UFW A;  4UCN A;  3PP9 A;  5FVJ A;  1JQG A;  2PJ2 A;  1LCP A;  3IWG A;  1ARL A;  3TE4 A; 
#chains in the Genus database with same CATH homology
 2QYV A;  3IO1 A;  3FEC A;  5LYD A;  2C1C A;  3RZA A;  5LYF A;  4FWU A;  1BPN A;  2DEA A;  4PQA A;  4NGS A;  3T8W A;  2ZOF A;  4P4J A;  4R6T A;  2PVW A;  2XEF A;  2F7V A;  5JGF A;  5HVG A;  4JZ0 A;  4YWY A;  3IFE A;  5K8M A;  4YU9 A;  1NSA A;  2CTC A;  3KR4 A;  4GM5 A;  5K8P A;  4P4I A;  1TKJ A;  3D7G A;  1ELL P;  3V38 A;  3TC8 A;  2PJ7 A;  1VGY A;  4NJR A;  5CBM A;  3V7Z A;  2JBK A;  2JBJ A;  1UWY A;  1TKH A;  3N5F A;  3KQZ A;  4MHY A;  2PCU A;  4UEZ A;  1FNO A;  3BI1 A;  1GYT A;  5JM6 A;  2GLF A;  4K3N A;  4F9V A;  2AFU A;  3K2K A;  4TNU A;  2PJ5 A;  3H8E A;  3B3S A;  4BD9 A;  4EME A;  3TX8 A;  3PFO A;  4PPZ A;  3RBU A;  3CT9 A;  4R7M A;  1BLL E;  3KQX A;  1M4L A;  5J1Q A;  3PB9 X;  4JYW A;  4A94 A;  3H8F A;  3VH9 A;  4RUH A;  4P6Y A;  2ZEM A;  2ZEO A;  3KAS A;  5LRJ A;  3B35 A;  1DTD A;  3D66 A;  2V8H A;  3JRU A;  2PJA A;  1BPM A;  4O23 A;  1LAP A;  2IJZ A;  3S9L A;  4MHN A;  5ELY A;  1DE4 C;  1Z8L A;  1F2P A;  3ISX A;  3IIB A;  4X3R A;  2AFS A;  3KHZ A;  2GU2 A;  2OOT A;  3WC7 A;  4P4F A;  4ZY2 A;  4FAI A;  4WJB A;  2C6P A;  4UEE A;  4W9Y A;  1Y0Y A;  5HXD A;  4R8F A;  3MN8 A;  1XBU A;  3FEE A;  3KI9 A;  3L2N A;  2XEI A;  4UEF A;  2C6C A;  4X8I A;  3FMC A;  3WC5 A;  3IJ3 A;  1OBR A;  4Z65 A;  2ZOG A;  3KR5 A;  2V8G A;  3B3W A;  4MCP A;  1LAM A;  4ZI6 A;  2PJ3 A;  5D29 A;  2PJB A;  4NGP A;  3IEH A;  2ZEE A;  5LRG A;  3IWW A;  4G1P A;  3PB6 X;  3BXM A;  4NGM A;  1F2O A;  3HLP A;  2HC9 A;  3KL9 A;  5HVF A;  2NSM A;  4OC4 A;  5CPA A;  2VL1 A;  2PJ1 A;  2PJ4 A;  4MCR A;  3CPA A;  1ZG7 A;  1HDU A;  2ZEG A;  4P4D A;  1R43 A;  1TXR A;  1ZG9 A;  2AFM A;  2PVV A;  4PXB A;  2IQ6 A;  4UIB A;  3VAT A;  4OIW A;  3DGV A;  4AXV A;  4OC0 A;  2ZEF A;  2Q43 A;  1TF8 A;  2XEJ A;  3PB7 X;  1IGB A;  2PJ8 A;  3B2Y A;  5DS0 A;  4A38 A;  3FX6 A;  1Z5R A;  4H2K A;  2RFH A;  3IC1 A;  1CP6 A;  1TKF A;  2EK9 A;  3PB8 X;  1YSJ A;  2OR4 A;  1HEE A;  4PXC A;  1XFO A;  2V8V A;  5K8N A;  3FJU A;  1QQ9 A;  4ZX8 A;  4P10 A;  3WAB A;  1BAV A;  2BO9 A;  3QNV A;  2Q4Z A;  3SJX A;  3PB4 X;  3NFZ A;  3D67 A;  4A37 A;  1EE3 P;  1ZG8 A;  1F57 A;  1XRY A;  2PJC A;  1XMB A;  1AYE A;  2XEG A;  4LQG A;  3SJF A;  3FVL A;  1QMU A;  2GRE A;  2CTB A;  1Y7E A;  4ZY1 A;  2AFO A;  3ISZ A;  4EWT A;  4PXE A;  3GLJ A;  3PBB A;  5THW A;  2G9D A;  3GUX A;  4A39 A;  2ZEH A;  4F9U A;  1YW4 A;  3NA6 A;  1ELM P;  2ANP A;  3I1U A;  1HDQ A;  1ARM A;  3D7D A;  1KWM A;  4NFR A;  6CPA A;  3H8G A;  4UF4 A;  3SJE A;  1ZLI A;  4OP4 A;  4MXU A;  3HUV A;  4NGR A;  1TF9 A;  4NJQ A;  4P44 A;  3FH4 A;  1H8L A;  5F09 A;  2AFW A;  2CIJ A;  1LAN A;  1YLO A;  1CPS A;  3FED A;  1VHE A;  1CG2 A;  4B6Z A;  4OC5 A;  1ZLH A;  4IAV A;  2V77 A;  1CP7 A;  2IMO A;  3SJG A;  4FBE A;  3D4U A;  4OC1 A;  1VHO A;  4ZY0 A;  3S9N A;  4TWE A;  2GLJ A;  3D7H A;  1Q7L A;  4KSI A;  1XJO A;  4P4B A;  4R76 A;  1CX8 A;  4NGN A;  3K9T A;  3LMS A;  3LWU A;  1R3N A;  3S9M A;  4OID A;  4PXD A;  2ZED A;  2CF4 A;  3B7I A;  2V8D A;  5LYI A;  4Q7A A;  3DLJ A;  2PIY A;  4DUK A;  4IHM A;  2PJ6 A;  4F8Z A;  3PRT A;  1PCA A;  5I4M A;  2EK8 A;  4NGQ A;  3BI0 A;  2BCO A;  4ZX9 A;  4MRI A;  2QVP A;  2EWB A;  2PRQ A;  2POK A;  4IK2 A;  4ZYQ A;  2ZEL A;  3VAR A;  2ABZ A;  4MCQ A;  3NH4 A;  3B3T A;  3KGQ A;  2PE3 A;  2Q51 A;  3D68 A;  2BOA A;  2FVG A;  3PEI A;  3D7F A;  3PFE A;  2JEW A;  1LFW A;  1AMP A;  4MCS A;  4EFD A;  4P4E A;  5K8O A;  3CPX A;  3SI1 A;  1CBX A;  2J9A A;  4OC2 A;  2O4H A;  3WC6 A;  2PJ0 A;  1LOK A;  3SI2 A;  4DYO A;  4MMO A;  3GB0 A;  4ONW A;  5HVH A;  5D8N A;  5LRK A;  3FF3 A;  5LYL A;  2RB7 A;  3BHX A;  2I3C A;  3KHX A;  8CPA A;  3SI0 A;  2PJ9 A;  3NH5 A;  2QJ8 A;  2F8H A;  5IB9 A;  2O53 A;  3B3C A;  1Y0R A;  4FUU A;  1Z2L A;  1FT7 A;  4OME A;  4OC3 A;  2NYQ A;  2AFZ A;  3PBE A;  2PIZ A;  1PYT B;  3KZW A;  1YME A;  4MHP A;  7CPA A;  3RAM A;  2ZEP A;  4X2T A;  2WYR A;  1VIX A;  2WZN A;  3NH8 A;  5JH9 A;  2AFX A;  1IY7 A;  2HB6 A;  4DJL A;  1YW6 A;  4MHZ A;  1CPX A;  2C6G A;  3MRU A;  3B3V A;  4UIA A;  4OKO A;  2ZEN A;  4WWV A;  4P45 A;  3WT4 A;  4NGT A;  3CDX A;  1RTQ A;  4CPA A;  1JQG A;  2PJ2 A;  1LCP A;  1ARL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...