1CP7A

Aminopeptidase from streptomyces griseus
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
277
structure length
274
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETERSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE
publication title Interactions of Streptomyces griseus aminopeptidase with a methionine product analogue: a structural study at 1.53 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 108
structure length 274
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 1999-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1cp7A00
2ZEEA 3K2KA 4MCRA 2CTBA 4CPAA 2EWBA 4JYWA 3KI9A 3LMSA 4NGRA 2PIZA 2PJ3A 4P45A 1YW4A 5IB9A 3GB0A 3FF3A 3K9TA 1IGBA 3WC6A 2ZEMA 1LCPA 3NH4A 4JZ0A 3D67A 2AFUA 2GREA 3IC1A 3IWWA 1M4LA 4MCPA 2C6PA 3D7GA 4F8ZA 4R8FA 2PJ1A 3IFEA 3D4UA 1Y7EA 1LAMA 1TXRA 3BXMA 1AMPA 2EK8A 1VIXA 3FJUA 2PJ5A 2AFXA 4OC2A 3FEDA 1YSJA 4PXDA 5HVHA 2BCOA 1ARMA 4P4JA 2ZELA 5K8NA 2V77A 3SI2A 2ZOGA 2HB6A 3D68A 4NGPA 1XBUA 2BOAA 4DUKA 2ZOFA 3DGVA 3FEEA 2G9DA 1QQ9A 1CG2A 4PXCA 3WABA 3KR4A 3NH8A 2AFZA 1F57A 3CDXA 3CT9A 2PE3A 2GLJA 2QJ8A 2RFHA 3B2YA 5I4MA 1BPNA 2ZENA 3GUXA 2PRQA 3B3VA 4PXBA 1CP6A 2AFOA 3SJFA 3PEIA 4EFDA 2V8VA 3BHXA 3IO1A 5JH9A 3JRUA 3PBBA 2NSMA 2ANPA 2DEAA 4UEFA 2ZEHA 3NA6A 3FX6A 2I3CA 2PJ6A 2V8HA 4PQAA 2PJAA 3D7FA 1EE3P 1PCAA 4X2TA 1ZLIA 4A37A 4FBEA 4TWEA 3IJ3A 1HEEA 3H8GA 1F2OA 2OR4A 3VARA 1FNOA 3KZWA 1Y0RA 2JBJA 4R76A 4IK2A 5HVGA 4OKOA 4P4IA 1Q7LA 5K8OA 2HC9A 2IQ6A 3SJEA 3V7ZA 3FVLA 2PJ7A 2F7VA 2GLFA 3H8EA 4DJLA 2NYQA 1TF9A 1Z2LA 3GLJA 3VH9A 5LYDA 7CPAA 5JGFA 3WC7A 3RBUA 2GU2A 4R6TA 1R3NA 4O23A 1FT7A 1JQGA 2Q51A 4UEEA 1XFOA 3NFZA 1BPMA 1UWYA 1VGYA 2C6CA 2XEFA 2WZNA 1ZG9A 4PXEA 3ISXA 3ISZA 4R7MA 2AFWA 3SI0A 4EMEA 2IMOA 1YLOA 3BI0A 1RTQA 2ZEFA 5LYIA 3I1UA 2PJ4A 4OIWA 4OC4A 3IEHA 4ZX8A 1XMBA 4MXUA 4OC3A 4P4DA 3KASA 4MCQA 2WYRA 4NGQA 4NGSA 4GM5A 2PJ8A 4NFRA 4MCSA 1LFWA 3B7IA 3N5FA 4DYOA 5LRGA 4MRIA 1CX8A 5LYFA 4TNUA 3CPAA 2CIJA 2Q43A 2Q4ZA 1Y0YA 4OIDA 3KGQA 4F9UA 2PJCA 3WC5A 4ZY2A 3PB8X 3V38A 1BLLE 1R43A 3PB7X 4OC5A 1ARLA 3HLPA 1TKFA 1ZLHA 1NSAA 2J9AA 3SJXA 5ELYA 2PVVA 1F2PA 5J1QA 1YMEA 2ZEDA 3BI1A 4ZI6A 1HDQA 3B35A 3KHZA 4Z65A 3PBEA 4NGNA 4OC1A 4IAVA 3MN8A 3L2NA 2POKA 3PB4X 1VHOA 4X3RA 1HDUA 3VATA 4WJBA 3FMCA 4A94A 3PRTA 4PPZA 1CPXA 4FWUA 2F8HA 5F09A 3KR5A 2RB7A 4ZX9A 5HVFA 4BD9A 4MHNA 1ZG7A 2AFMA 2V8DA 2O53A 1TKJA 3RAMA 1OBRA 4MHPA 4P10A 3WT4A 3S9LA 2PCUA 4OMEA 3FH4A 2ABZA 1TKHA 4UIBA 4P4EA 3H8FA 4NGTA 4H2KA 4A39A 2CF4A 2XEIA 1ELLP 1LOKA 1H8LA 1XJOA 3T8WA 4MHYA 4LQGA 2JBKA 3PFOA 3CPXA 5D8NA 1CPSA 3KL9A 2ZEOA 4NJQA 4OC0A 6CPAA 3FECA 1BAVA 3TX8A 5D29A 1AYEA 2C6GA 3PFEA 5CBMA 1TF8A 3D7DA 4YU9A 4UF4A 4OP4A 2O4HA 3SJGA 1DE4C 2OOTA 2XEJA 2ZEPA 4P4FA 3KQZA 1GYTA 4P6YA 4YWYA 5LRKA 4IHMA 5HXDA 2ZEGA 3B3SA 5DS0A 4P4BA 4NJRA 3DLJA 1KWMA 2EK9A 4ONWA 2QYVA 1Z8LA 2AFSA 4MMOA 3S9MA 4FUUA 4G1PA 2FVGA 2CTCA 2PJBA 1CP7A 2PJ2A 2PIYA 1IY7A 2QVPA 3RZAA 1VHEA 3LWUA 2V8GA 2IJZA 2XEGA 4W9YA 2C1CA 5THWA 5LRJA 1CBXA 2JEWA 1ZG8A 2VL1A 3B3TA 1Z5RA 1LANA 1XRYA 3NH5A 4B6ZA 8CPAA 4WWVA 4K3NA 5K8PA 3S9NA 1QMUA 3IIBA 4X8IA 5CPAA 4RUHA 5K8MA 5LYLA 2PJ9A 3PB6X 4NGMA 3SI1A 4KSIA 4Q7AA 4ZY0A 1DTDA 2BO9A 3KQXA 1YW6A 3TC8A 5JM6A 3B3CA 4FAIA 4AXVA 2PVWA 1LAPA 3HUVA 1ELMP 3D7HA 3D66A 4MHZA 4A38A 3QNVA 2PJ0A 4ZY1A 3B3WA 3KHXA 1PYTB 4F9VA 4ZYQA 4P44A 3PB9X 4EWTA 4UEZA 3MRUA 4UIAA
chains in the Genus database with same CATH superfamily
2ZEEA 3K2KA 3RYOA 4MCRA 2CTBA 4CPAA 2YNCA 4GXHA 5A27A 2EWBA 4JYWA 3KI9A 3LMSA 4NGRA 2PIZA 2BUEA 4L89A 3JVNA 2PJ3A 4CRZB 4P45A 1YW4A 5IB9A 4QB9A 3GB0A 3FF3A 4B12A 3K9TA 4CYOA 4KUBA 2P6GA 1IGBA 3T9YA 2HV2A 4JXRA 4MFPA 3WC6A 2ZEMA 1QSOA 1LCPA 3R9GA 3NH4A 1Y7RA 4JZ0A 4E8OA 3D67A 2AFUA 2GREA 3IC1A 3IWWA 1M4LA 1YVOA 4MCPA 4MFKA 1FY7A 4Y49B 2C6PA 3D7GA 5G21A 4F8ZA 4BMHA 3PZJA 5HMNA 2OZHA 4R8FA 2JEVA 2F5IA 5BWAB 2PJ1A 4ZGYB 1R57A 3IFEA 3D4UA 1Y7EA 1LAMA 1TXRA 3BXMA 4I49A 1AMPA 2EK8A 3W6SA 1VIXA 3FJUA 2PJ5A 4L8AA 2AFXA 1JWQA 4OC2A 3UY5A 2YGWA 3FEDA 3GYAA 1YSJA 3F0AA 4PXDA 2OU2A 1XMTA 4CGPA 5HVHA 2BCOA 2VBQA 3DDDA 3TO6A 4B14A 2JLMA 2WPXA 2Q04A 2FXFA 1ARMA 2YNCC 1Z8TA 4P4JA 2ZELA 5K8NA 4LUAA 3R95A 2V77A 3SI2A 2ZOGA 2HB6A 4RS2A 3D68A 4NGPA 1XBUA 2BOAA 4MFQA 4DUKA 4UWJA 5AG5A 2ZOFA 3DGVA 4KOSA 3FEEA 4KOYA 2G3TA 2G9DA 1QQ9A 1CG2A 4PXCA 3WABA 3KR4A 3NH8A 4PK2A 2AFZA 4UFVA 3W91A 2BL1A 5AG4A 1F57A 3A9LA 3CDXA 4MFZA 1KUVA 3CT9A 1MJBA 2PE3A 4CGNA 5DWNA 4UA3A 2GLJA 2QJ8A 3TO7A 2RFHA 4AVCA 2Q4VA 3K9UA 1IIDA 2Z3LA 3B2YA 1BPNA 2BSWA 1Z8XA 2ZENA 3CXPA 2KCWA 3GUXA 4M3SA 2PRQA 3B3VA 4PXBA 1CP6A 2AFOA 3SJFA 3PEIA 2AE6A 2YNDA 4EFDA 2OZUA 4B10A 2V8VA 3IWEA 4UCPA 4A31A 1QSTA 1NMTA 1XOVA 4M6HA 3BHXA 1X10A 3IO1A 5JH9A 3JRUA 3BLNA 2Z3NA 5EMIA 3PBBA 3DR6A 1Z4RA 4XPKA 1YR0A 2NSMA 4ORFA 4MY3A 3DSBA 4R57A 4GS4A 1M4IA 2ANPA 1MJAA 3CXSA 2WUUA 2DEAA 2R98A 2ZEHA 4UEFA 4KUAA 3NA6A 3FX6A 2I3CA 2VI7A 2PJ6A 2V8HA 3FB3A 4Q36A 4A32A 4PQAA 2PJAA 3D7FA 1EE3P 1PCAA 4X2TA 1ZLIA 4A37A 5H86A 4FBEA 5JPHA 2FS5A 4TWEA 2K5TA 3IJ3A 3EXNA 1HEEA 2B4DA 1F2OA 3H8GA 3NE7A 4KORA 2GE3A 3VWEA 1I1DA 1LRZA 3D2MA 3C26A 2OR4A 2EBJA 4CYQA 3VARA 1FNOA 1BO4A 3KZWA 1Y0RA 2JBJA 2G3AA 3TTHA 4R76A 4IK2A 2VZZA 3D3SA 5HVGA 5IX3A 4OKOA 4K30A 4P4IA 5AGEA 5G20A 2OH1A 1Q7LA 4CAVA 5IB0A 5K8OA 2HC9A 4HNXB 3PGPA 1YK3A 3DNSA 2IQ6A 2FIWA 3SJEA 3V7ZA 3FVLA 1N71A 2PJ7A 4KOUA 4KOVA 1A2ZA 5F49A 2F7VA 2GLFA 3H8EA 2PQ8A 4DJLA 2NYQA 1TIQA 4E2AA 1TF9A 4CRYB 4KOWA 1P0HA 4KOTA 4M6IA 4NCZA 3TO9A 1Z2LA 3GLJA 4C7IA 1Q2YA 2Q7BA 3V8IA 5J8FA 3JTKA 3VH9A 3N7ZA 5LYDA 7CPAA 5JGFA 2PRBA 3WC7A 3RBUA 2GU2A 2GANA 3EFAA 4R6TA 4II9A 3LD2A 1R3NA 4LX9A 1L0CA 1IU8A 1QSRA 4O23A 1FT7A 4JD6A 2ZXVA 1JQGA 1X12A 1XE4A 2Z3MA 2Q51A 4NF1A 4UEEA 1IOIA 1XFOA 4RI1A 4NEXA 3NFZA 1BPMA 4R87A 1UWYA 2J8NA 2I00A 1VGYA 2R1IA 2C6CA 3R96A 2XEFA 1V0CA 1ZG9A 2WZNA 4KVME 1S7KA 4PXEA 2JDDA 4XPDC 3CXQA 3ISXA 3ISZA 2Q4YA 4R7MA 2AFWA 3QB8A 5CNPA 3QAYA 4FD6A 4M6GA 3SI0A 1Z9UA 4EMEA 2DXQA 5AG7A 2IMOA 5F46A 1YLOA 1ON0A 5FVJA 4C2YA 3BI0A 1RTQA 2ZEFA 5LYIA 1XF8A 2I79A 3I1UA 5GCNA 5C82A 1M4DA 2PJ4A 4OIWA 4OC4A 3S6FA 3LODA 2NMTA 3IEHA 3TOAA 3FRMA 4ZBGA 4XPLA 4ZX8A 2CNMA 2YNEA 1PU9A 2DF5A 1XMBA 2B5GB 4MXUA 4MJ8A 4OC3A 3R1KA 4P4DA 3KASA 4EVYA 4MCQA 3DR8A 4H6UA 5H84A 4CS0B 2WYRA 1WWZA 1WK4A 2PR8A 4HNWB 4QUSA 4MFLA 1IB1E 4NGQA 4OAEA 4NGSA 4R3LA 2B4DB 4GM5A 3H5ZA 2PJ8A 3R9FA 4NFRA 1P4NA 2VEZA 1LFWA 3B7IA 4MCSA 3N5FA 4DYOA 5LRGA 2P0WA 4MRIA 1CX8A 2FSRA 2REEA 4FD5A 5LYFA 4C68A 1BOBA 4TNUA 2Z3PA 4A95A 2QECA 1VHSA 3ZJ0A 3CPAA 2FIAA 2CIJA 1Z4EA 2Q43A 1Y0YA 2EVNA 2Q4ZA 3BJ7A 4OIDA 4ONUA 4B13A 5KTAA 1GHEA 4A33A 3KGQA 2QMLA 2J8MA 4F9UA 2PJCA 3P2FA 1KUYA 4J3GA 2IL4A 4KLVA 3WC5A 2HUZA 2Z3OA 5AG6A 4ZY2A 3MGDA 1Q2CA 2R8VA 3PB8X 4U5YA 3V38A 1BLLE 4UBRA 3P2HA 2FCKA 2GIVA 1M1DA 1R43A 2BEIA 3ZZIA 3PB7X 4A2ZA 4OC5A 1ARLA 1KZFA 3HLPA 2D4PA 4CAFA 2B5GA 1UFHA 3W6XA 1TKFA 1ZLHA 2FL4A 3IWGA 3EO4A 3NE8A 4MI4A 5G1ZA 1NSAA 1XEBA 1Q2DA 2J9AA 3CZXA 1QSMA 3SJXA 4H6ZA 5ELYA 4UFXA 4CAWA 3S6KA 3TOBA 2PVVA 4MBUA 3FBUA 4PSWA 1F2PA 4CGMA 5J1QA 1YMEA 2B58A 2D4OA 5F47A 1QSNA 1IYLA 2ZEDA 3BI1A 2ZW5A 4C2ZA 5F48A 4ZI6A 1HDQA 4KZTA 3E0KA 2P6FA 1YX0A 4H89A 2QIRA 3B35A 1M44A 2VXKA 3KHZA 4UCNA 4Z65A 4KSFA 1S7NA 3PBEA 2AJ6A 3GKRA 2DPTA 2Q0YA 3B8GA 4NGNA 4OC1A 4KSAA 4AG7A 4KLWA 1I12A 4IAVA 5G22A 2ZW7A 4HNYB 3MN8A 3L2NA 2POKA 2Z3KA 4JJXA 1YQEA 1VHOA 3PB4X 4IF5A 4X3RA 3D2PA 1HDUA 3VATA 3TE4A 2Z11A 4UCMA 4WJBA 5E96A 3FMCA 4A94A 2REFA 3PRTA 3IU2A 4PPZA 5C88A 1S60A 2ATRA 4FD4A 3WR7A 1CPXA 1K4JA 4QBJA 1OZPA 4FWUA 4MFJA 4AB7A 2F8HA 5F09A 3KR5A 3S6GA 2RB7A 3TCVA 4ZX9A 2PDOA 5HVFA 2GFQA 4BD9A 4MHNA 1ZG7A 2AFMA 2CNTA 4R3KA 4AVAA 5ISVA 1CM0A 2V8DA 3QAHA 2O53A 3FXTA 4IUSA 4UWIA 1NE9A 1I21A 1TKJA 3RAMA 4YRHA 3FYNA 1OBRA 2OZGA 4MHPA 4F6AA 1NSLA 2Z0ZA 4MY0A 4P10A 3WT4A 4A30A 1YLEA 3S9LA 1J4JA 2PCUA 4M85A 1S7LA 4R9MA 4OMEA 2HQYA 3FH4A 1Y9KA 2ABZA 4Q38A 1TKHA 2EO8A 4UIBA 4P4EA 3H8FA 4NGTA 2RC4A 4H2KA 4A39A 2CF4A 1U6MA 2JDCA 4CYPA 2XEIA 2R7HA 1ELLP 1IICA 1ZO0A 3H4QA 1S5KA 4AVBA 5J8CA 5IV0A 1IYKA 2B3UA 1LOKA 1H8LA 1XJOA 2Z10A 4OLLA 4KVOE 4MHYA 3T8WA 4LQGA 2EUIA 2C27A 2JBKA 3PFOA 3CPXA 5KTDA 4F0XA 1S3ZA 2ARHA 5D8NA 1CPSA 3KL9A 2ZEOA 4NJQA 4OC0A 4NXYA 6CPAA 5I4MA 3FECA 1BAVA 4KOXA 3TX8A 5D29A 4U9YA 1AYEA 2C6GA 4PSXA 3PFEA 3RO0A 5CBMA 4OADA 1TF8A 3D7DA 3BJ8A 4YU9A 4RN7A 4UF4A 4CAEA 2J8RA 4B11A 4OP4A 2O4HA 4CGOA 3SJGA 1DE4C 2OOTA 3G3SA 2XEJA 2ZEPA 4P4FA 3KQZA 1YREA 4QC6A 1GYTA 2ZPAA 3FIXA 4P6YA 4XPDB 4PV6A 1YGHA 4YWYA 3S6HA 5LRKA 2FE7A 4IHMA 5EC4A 5HXDA 2ZEGA 2ZW4A 2B4BA 5JQ4A 3F8KA 2PC1A 2CXAA 2CY2A 4XNHC 1B87A 3SXOA 3B3SA 2O28A 4P4BA 5DS0A 2A4NA 1Y9WA 4NJRA 1RXTA 3DLJA 1KWMA 3R9EA 3TFYA 2DPSA 2EK9A 2P6EA 3IGRA 4JXQA 4ONWA 2QYVA 4CYNA 3OWCA 1Z8LA 3VWDA 2H5MA 2AFSA 4B5PB 2PR1A 4JWPA 4MMOA 3S9MA 4AG9A 1SQHA 4FUUA 2WSAA 4G1PA 2FVGA 4NSQA 2CTCA 2VZYA 2PJBA 1CP7A 4YFJA 2PJ2A 2PIYA 1IY7A 2QVPA 4PK3A 3LACA 1VHEA 3LWUA 1IOFA 3RZAA 2V8GA 3SXNA 4CGLA 5I0CA 2CNSA 2IJZA 2XEGA 2C1CA 3EC4A 4W9YA 5HH1A 5THWA 3GIUA 3T90A 5LRJA 1CBXA 3F5BA 2JEWA 1ZG8A 4QVTA 2VL1A 3B3TA 4C7HA 1Z5RA 1LANA 1XRYA 3NH5A 4B6ZA 2VQYA 8CPAA 1MJ9A 2G0BA 4LQ6A 4WWVA 4K3NA 1XIXA 5K8PA 3S9NA 1AUGA 1QMUA 3IIBA 4JLYA 2B3VA 4X8IA 5CPAA 4RUHA 5K8MA 2PJ9A 5LYLA 4HPSA 2OB0A 4UFWA 4F0YA 2ZW6A 3PB6X 4NGMA 3SI1A 3EY5A 4X5KA 3FNCA 5EBVA 4XNHB 2ODFA 4KSIA 5A28A 4Q7AA 1MK4A 1RO5A 4KVXA 4U9ZA 4ZY0A 1DTDA 5DWMA 4E0AA 2BO9A 3KQXA 1YW6A 2Q7SA 1PUAA 4BBHA 3RNZA 3TC8A 5JM6A 1CJWA 3B3CA 4FAIA 2Q44A 4C2XA 3D8PA 3I9SA 4AXVA 4BINA 2PVWA 1LAPA 1VKCA 3HUVA 3SHPA 1ELMP 2Y0MA 3D7HA 3PP9A 4HKFA 3G8WA 4CAXA 3D66A 3I3GA 4MHZA 4Y49C 3TT2A 4B5PA 4MHDA 4A38A 3GY9A 3QNVA 5KTCA 2PJ0A 4ZY1A 3B3WA 3KHXA 1PYTB 2FT0A 4F9VA 4ZYQA 2WPWA 1Z8WA 1B6BA 1M4GA 1S7FA 2PSWA 2X7BA 3PB9X 4P44A 4YGOA 3IU1A 4DNCA 3JUWA 4EWTA 1YVKA 4KS9A 4UEZA 4FD7A 4B5OA 1KUXA 3MRUA 4UIAA 3KKWA
chains in the Genus database with same CATH topology
2ZEEA 3K2KA 4MCRA 2CTBA 4CPAA 2EWBA 4JYWA 3KI9A 3LMSA 4NGRA 2PIZA 2PJ3A 4P45A 1YW4A 5IB9A 3GB0A 3FF3A 3K9TA 1IGBA 3WC6A 2ZEMA 1LCPA 3NH4A 4JZ0A 3D67A 2AFUA 2GREA 3IC1A 3IWWA 1M4LA 4MCPA 2C6PA 3D7GA 4F8ZA 4R8FA 2PJ1A 3IFEA 3D4UA 1Y7EA 1LAMA 1TXRA 3BXMA 1AMPA 2EK8A 1VIXA 3FJUA 2PJ5A 2AFXA 4OC2A 3FEDA 1YSJA 4PXDA 5HVHA 2BCOA 1ARMA 4P4JA 2ZELA 5K8NA 2V77A 3SI2A 2ZOGA 2HB6A 3D68A 4NGPA 1XBUA 2BOAA 4DUKA 2ZOFA 3DGVA 3FEEA 2G9DA 1QQ9A 1CG2A 4PXCA 3WABA 3KR4A 3NH8A 2AFZA 1F57A 3CDXA 3CT9A 2PE3A 2GLJA 2QJ8A 2RFHA 3B2YA 5I4MA 1BPNA 2ZENA 3GUXA 2PRQA 3B3VA 4PXBA 1CP6A 2AFOA 3SJFA 3PEIA 4EFDA 2V8VA 3BHXA 3IO1A 5JH9A 3JRUA 3PBBA 2NSMA 2ANPA 2DEAA 4UEFA 2ZEHA 3NA6A 3FX6A 2I3CA 2PJ6A 2V8HA 4PQAA 2PJAA 3D7FA 1EE3P 1PCAA 4X2TA 1ZLIA 4A37A 4FBEA 4TWEA 3IJ3A 1HEEA 3H8GA 1F2OA 2OR4A 3VARA 1FNOA 3KZWA 1Y0RA 2JBJA 4R76A 4IK2A 5HVGA 4OKOA 4P4IA 1Q7LA 5K8OA 2HC9A 2IQ6A 3SJEA 3V7ZA 3FVLA 2PJ7A 2F7VA 2GLFA 3H8EA 4DJLA 2NYQA 1TF9A 1Z2LA 3GLJA 3VH9A 5LYDA 7CPAA 5JGFA 3WC7A 3RBUA 2GU2A 4R6TA 1R3NA 4O23A 1FT7A 1JQGA 2Q51A 4UEEA 1XFOA 3NFZA 1BPMA 1UWYA 1VGYA 2C6CA 2XEFA 2WZNA 1ZG9A 4PXEA 3ISXA 3ISZA 4R7MA 2AFWA 3SI0A 4EMEA 2IMOA 1YLOA 3BI0A 1RTQA 2ZEFA 5LYIA 3I1UA 2PJ4A 4OIWA 4OC4A 3IEHA 4ZX8A 1XMBA 4MXUA 4OC3A 4P4DA 3KASA 4MCQA 2WYRA 4NGQA 4NGSA 4GM5A 2PJ8A 4NFRA 4MCSA 1LFWA 3B7IA 3N5FA 4DYOA 5LRGA 4MRIA 1CX8A 5LYFA 4TNUA 3CPAA 2CIJA 2Q43A 2Q4ZA 1Y0YA 4OIDA 3KGQA 4F9UA 2PJCA 3WC5A 4ZY2A 3PB8X 3V38A 1BLLE 1R43A 3PB7X 4OC5A 1ARLA 3HLPA 1TKFA 1ZLHA 1NSAA 2J9AA 3SJXA 5ELYA 2PVVA 1F2PA 5J1QA 1YMEA 2ZEDA 3BI1A 4ZI6A 1HDQA 3B35A 3KHZA 4Z65A 3PBEA 4NGNA 4OC1A 4IAVA 3MN8A 3L2NA 2POKA 3PB4X 1VHOA 4X3RA 1HDUA 3VATA 4WJBA 3FMCA 4A94A 3PRTA 4PPZA 1CPXA 4FWUA 2F8HA 5F09A 3KR5A 2RB7A 4ZX9A 5HVFA 4BD9A 4MHNA 1ZG7A 2AFMA 2V8DA 2O53A 1TKJA 3RAMA 1OBRA 4MHPA 4P10A 3WT4A 3S9LA 2PCUA 4OMEA 3FH4A 2ABZA 1TKHA 4UIBA 4P4EA 3H8FA 4NGTA 4H2KA 4A39A 2CF4A 2XEIA 1ELLP 1LOKA 1H8LA 1XJOA 3T8WA 4MHYA 4LQGA 2JBKA 3PFOA 3CPXA 5D8NA 1CPSA 3KL9A 2ZEOA 4NJQA 4OC0A 6CPAA 3FECA 1BAVA 3TX8A 5D29A 1AYEA 2C6GA 3PFEA 5CBMA 1TF8A 3D7DA 4YU9A 4UF4A 4OP4A 2O4HA 3SJGA 1DE4C 2OOTA 2XEJA 2ZEPA 4P4FA 3KQZA 1GYTA 4P6YA 4YWYA 5LRKA 4IHMA 5HXDA 2ZEGA 3B3SA 5DS0A 4P4BA 4NJRA 3DLJA 1KWMA 2EK9A 4ONWA 2QYVA 1Z8LA 2AFSA 4MMOA 3S9MA 4FUUA 4G1PA 2FVGA 2CTCA 2PJBA 1CP7A 2PJ2A 2PIYA 1IY7A 2QVPA 3RZAA 1VHEA 3LWUA 2V8GA 2IJZA 2XEGA 4W9YA 2C1CA 5THWA 5LRJA 1CBXA 2JEWA 1ZG8A 2VL1A 3B3TA 1Z5RA 1LANA 1XRYA 3NH5A 4B6ZA 8CPAA 4WWVA 4K3NA 5K8PA 3S9NA 1QMUA 3IIBA 4X8IA 5CPAA 4RUHA 5K8MA 5LYLA 2PJ9A 3PB6X 4NGMA 3SI1A 4KSIA 4Q7AA 4ZY0A 1DTDA 2BO9A 3KQXA 1YW6A 3TC8A 5JM6A 3B3CA 4FAIA 4AXVA 2PVWA 1LAPA 3HUVA 1ELMP 3D7HA 3D66A 4MHZA 4A38A 3QNVA 2PJ0A 4ZY1A 3B3WA 3KHXA 1PYTB 4F9VA 4ZYQA 4P44A 3PB9X 4EWTA 4UEZA 3MRUA 4UIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEE A;  3K2K A;  4MCR A;  2CTB A;  4CPA A;  2EWB A;  4JYW A;  3KI9 A;  3LMS A;  4NGR A;  2PIZ A;  2PJ3 A;  4P45 A;  1YW4 A;  5IB9 A;  3GB0 A;  3FF3 A;  3K9T A;  1IGB A;  3WC6 A;  2ZEM A;  1LCP A;  3NH4 A;  4JZ0 A;  3D67 A;  2AFU A;  2GRE A;  3IC1 A;  3IWW A;  1M4L A;  4MCP A;  2C6P A;  3D7G A;  4F8Z A;  4R8F A;  2PJ1 A;  3IFE A;  3D4U A;  1Y7E A;  1LAM A;  1TXR A;  3BXM A;  1AMP A;  2EK8 A;  1VIX A;  3FJU A;  2PJ5 A;  2AFX A;  4OC2 A;  3FED A;  1YSJ A;  4PXD A;  5HVH A;  2BCO A;  1ARM A;  4P4J A;  2ZEL A;  5K8N A;  2V77 A;  3SI2 A;  2ZOG A;  2HB6 A;  3D68 A;  4NGP A;  1XBU A;  2BOA A;  4DUK A;  2ZOF A;  3DGV A;  3FEE A;  2G9D A;  1QQ9 A;  1CG2 A;  4PXC A;  3WAB A;  3KR4 A;  3NH8 A;  2AFZ A;  1F57 A;  3CDX A;  3CT9 A;  2PE3 A;  2GLJ A;  2QJ8 A;  2RFH A;  3B2Y A;  5I4M A;  1BPN A;  2ZEN A;  3GUX A;  2PRQ A;  3B3V A;  4PXB A;  1CP6 A;  2AFO A;  3SJF A;  3PEI A;  4EFD A;  2V8V A;  3BHX A;  3IO1 A;  5JH9 A;  3JRU A;  3PBB A;  2NSM A;  2ANP A;  2DEA A;  4UEF A;  2ZEH A;  3NA6 A;  3FX6 A;  2I3C A;  2PJ6 A;  2V8H A;  4PQA A;  2PJA A;  3D7F A;  1EE3 P;  1PCA A;  4X2T A;  1ZLI A;  4A37 A;  4FBE A;  4TWE A;  3IJ3 A;  1HEE A;  3H8G A;  1F2O A;  2OR4 A;  3VAR A;  1FNO A;  3KZW A;  1Y0R A;  2JBJ A;  4R76 A;  4IK2 A;  5HVG A;  4OKO A;  4P4I A;  1Q7L A;  5K8O A;  2HC9 A;  2IQ6 A;  3SJE A;  3V7Z A;  3FVL A;  2PJ7 A;  2F7V A;  2GLF A;  3H8E A;  4DJL A;  2NYQ A;  1TF9 A;  1Z2L A;  3GLJ A;  3VH9 A;  5LYD A;  7CPA A;  5JGF A;  3WC7 A;  3RBU A;  2GU2 A;  4R6T A;  1R3N A;  4O23 A;  1FT7 A;  1JQG A;  2Q51 A;  4UEE A;  1XFO A;  3NFZ A;  1BPM A;  1UWY A;  1VGY A;  2C6C A;  2XEF A;  2WZN A;  1ZG9 A;  4PXE A;  3ISX A;  3ISZ A;  4R7M A;  2AFW A;  3SI0 A;  4EME A;  2IMO A;  1YLO A;  3BI0 A;  1RTQ A;  2ZEF A;  5LYI A;  3I1U A;  2PJ4 A;  4OIW A;  4OC4 A;  3IEH A;  4ZX8 A;  1XMB A;  4MXU A;  4OC3 A;  4P4D A;  3KAS A;  4MCQ A;  2WYR A;  4NGQ A;  4NGS A;  4GM5 A;  2PJ8 A;  4NFR A;  4MCS A;  1LFW A;  3B7I A;  3N5F A;  4DYO A;  5LRG A;  4MRI A;  1CX8 A;  5LYF A;  4TNU A;  3CPA A;  2CIJ A;  2Q43 A;  2Q4Z A;  1Y0Y A;  4OID A;  3KGQ A;  4F9U A;  2PJC A;  3WC5 A;  4ZY2 A;  3PB8 X;  3V38 A;  1BLL E;  1R43 A;  3PB7 X;  4OC5 A;  1ARL A;  3HLP A;  1TKF A;  1ZLH A;  1NSA A;  2J9A A;  3SJX A;  5ELY A;  2PVV A;  1F2P A;  5J1Q A;  1YME A;  2ZED A;  3BI1 A;  4ZI6 A;  1HDQ A;  3B35 A;  3KHZ A;  4Z65 A;  3PBE A;  4NGN A;  4OC1 A;  4IAV A;  3MN8 A;  3L2N A;  2POK A;  3PB4 X;  1VHO A;  4X3R A;  1HDU A;  3VAT A;  4WJB A;  3FMC A;  4A94 A;  3PRT A;  4PPZ A;  1CPX A;  4FWU A;  2F8H A;  5F09 A;  3KR5 A;  2RB7 A;  4ZX9 A;  5HVF A;  4BD9 A;  4MHN A;  1ZG7 A;  2AFM A;  2V8D A;  2O53 A;  1TKJ A;  3RAM A;  1OBR A;  4MHP A;  4P10 A;  3WT4 A;  3S9L A;  2PCU A;  4OME A;  3FH4 A;  2ABZ A;  1TKH A;  4UIB A;  4P4E A;  3H8F A;  4NGT A;  4H2K A;  4A39 A;  2CF4 A;  2XEI A;  1ELL P;  1LOK A;  1H8L A;  1XJO A;  3T8W A;  4MHY A;  4LQG A;  2JBK A;  3PFO A;  3CPX A;  5D8N A;  1CPS A;  3KL9 A;  2ZEO A;  4NJQ A;  4OC0 A;  6CPA A;  3FEC A;  1BAV A;  3TX8 A;  5D29 A;  1AYE A;  2C6G A;  3PFE A;  5CBM A;  1TF8 A;  3D7D A;  4YU9 A;  4UF4 A;  4OP4 A;  2O4H A;  3SJG A;  1DE4 C;  2OOT A;  2XEJ A;  2ZEP A;  4P4F A;  3KQZ A;  1GYT A;  4P6Y A;  4YWY A;  5LRK A;  4IHM A;  5HXD A;  2ZEG A;  3B3S A;  5DS0 A;  4P4B A;  4NJR A;  3DLJ A;  1KWM A;  2EK9 A;  4ONW A;  2QYV A;  1Z8L A;  2AFS A;  4MMO A;  3S9M A;  4FUU A;  4G1P A;  2FVG A;  2CTC A;  2PJB A;  1CP7 A;  2PJ2 A;  2PIY A;  1IY7 A;  2QVP A;  3RZA A;  1VHE A;  3LWU A;  2V8G A;  2IJZ A;  2XEG A;  4W9Y A;  2C1C A;  5THW A;  5LRJ A;  1CBX A;  2JEW A;  1ZG8 A;  2VL1 A;  3B3T A;  1Z5R A;  1LAN A;  1XRY A;  3NH5 A;  4B6Z A;  8CPA A;  4WWV A;  4K3N A;  5K8P A;  3S9N A;  1QMU A;  3IIB A;  4X8I A;  5CPA A;  4RUH A;  5K8M A;  5LYL A;  2PJ9 A;  3PB6 X;  4NGM A;  3SI1 A;  4KSI A;  4Q7A A;  4ZY0 A;  1DTD A;  2BO9 A;  3KQX A;  1YW6 A;  3TC8 A;  5JM6 A;  3B3C A;  4FAI A;  4AXV A;  2PVW A;  1LAP A;  3HUV A;  1ELM P;  3D7H A;  3D66 A;  4MHZ A;  4A38 A;  3QNV A;  2PJ0 A;  4ZY1 A;  3B3W A;  3KHX A;  1PYT B;  4F9V A;  4ZYQ A;  4P44 A;  3PB9 X;  4EWT A;  4UEZ A;  3MRU A;  4UIA A; 
#chains in the Genus database with same CATH topology
 2ZEE A;  3K2K A;  3RYO A;  4MCR A;  2CTB A;  4CPA A;  2YNC A;  4GXH A;  5A27 A;  2EWB A;  4JYW A;  3KI9 A;  3LMS A;  4NGR A;  2PIZ A;  2BUE A;  4L89 A;  3JVN A;  2PJ3 A;  4CRZ B;  4P45 A;  1YW4 A;  5IB9 A;  4QB9 A;  3GB0 A;  3FF3 A;  4B12 A;  3K9T A;  4CYO A;  4KUB A;  2P6G A;  1IGB A;  3T9Y A;  2HV2 A;  4JXR A;  4MFP A;  3WC6 A;  2ZEM A;  1QSO A;  1LCP A;  3R9G A;  3NH4 A;  1Y7R A;  4JZ0 A;  4E8O A;  3D67 A;  2AFU A;  2GRE A;  3IC1 A;  3IWW A;  1M4L A;  1YVO A;  4MCP A;  4MFK A;  1FY7 A;  4Y49 B;  2C6P A;  3D7G A;  5G21 A;  4F8Z A;  4BMH A;  3PZJ A;  5HMN A;  2OZH A;  4R8F A;  2JEV A;  2F5I A;  5BWA B;  2PJ1 A;  4ZGY B;  1R57 A;  3IFE A;  3D4U A;  1Y7E A;  1LAM A;  1TXR A;  3BXM A;  4I49 A;  1AMP A;  2EK8 A;  3W6S A;  1VIX A;  3FJU A;  2PJ5 A;  4L8A A;  2AFX A;  1JWQ A;  4OC2 A;  3UY5 A;  2YGW A;  3FED A;  3GYA A;  1YSJ A;  3F0A A;  4PXD A;  2OU2 A;  1XMT A;  4CGP A;  5HVH A;  2BCO A;  2VBQ A;  3DDD A;  3TO6 A;  4B14 A;  2JLM A;  2WPX A;  2Q04 A;  2FXF A;  1ARM A;  2YNC C;  1Z8T A;  4P4J A;  2ZEL A;  5K8N A;  4LUA A;  3R95 A;  2V77 A;  3SI2 A;  2ZOG A;  2HB6 A;  4RS2 A;  3D68 A;  4NGP A;  1XBU A;  2BOA A;  4MFQ A;  4DUK A;  4UWJ A;  5AG5 A;  2ZOF A;  3DGV A;  4KOS A;  3FEE A;  4KOY A;  2G3T A;  2G9D A;  1QQ9 A;  1CG2 A;  4PXC A;  3WAB A;  3KR4 A;  3NH8 A;  4PK2 A;  2AFZ A;  4UFV A;  3W91 A;  2BL1 A;  5AG4 A;  1F57 A;  3A9L A;  3CDX A;  4MFZ A;  1KUV A;  3CT9 A;  1MJB A;  2PE3 A;  4CGN A;  5DWN A;  4UA3 A;  2GLJ A;  2QJ8 A;  3TO7 A;  2RFH A;  4AVC A;  2Q4V A;  3K9U A;  1IID A;  2Z3L A;  3B2Y A;  1BPN A;  2BSW A;  1Z8X A;  2ZEN A;  3CXP A;  2KCW A;  3GUX A;  4M3S A;  2PRQ A;  3B3V A;  4PXB A;  1CP6 A;  2AFO A;  3SJF A;  3PEI A;  2AE6 A;  2YND A;  4EFD A;  2OZU A;  4B10 A;  2V8V A;  3IWE A;  4UCP A;  4A31 A;  1QST A;  1NMT A;  1XOV A;  4M6H A;  3BHX A;  1X10 A;  3IO1 A;  5JH9 A;  3JRU A;  3BLN A;  2Z3N A;  5EMI A;  3PBB A;  3DR6 A;  1Z4R A;  4XPK A;  1YR0 A;  2NSM A;  4ORF A;  4MY3 A;  3DSB A;  4R57 A;  4GS4 A;  1M4I A;  2ANP A;  1MJA A;  3CXS A;  2WUU A;  2DEA A;  2R98 A;  2ZEH A;  4UEF A;  4KUA A;  3NA6 A;  3FX6 A;  2I3C A;  2VI7 A;  2PJ6 A;  2V8H A;  3FB3 A;  4Q36 A;  4A32 A;  4PQA A;  2PJA A;  3D7F A;  1EE3 P;  1PCA A;  4X2T A;  1ZLI A;  4A37 A;  5H86 A;  4FBE A;  5JPH A;  2FS5 A;  4TWE A;  2K5T A;  3IJ3 A;  3EXN A;  1HEE A;  2B4D A;  1F2O A;  3H8G A;  3NE7 A;  4KOR A;  2GE3 A;  3VWE A;  1I1D A;  1LRZ A;  3D2M A;  3C26 A;  2OR4 A;  2EBJ A;  4CYQ A;  3VAR A;  1FNO A;  1BO4 A;  3KZW A;  1Y0R A;  2JBJ A;  2G3A A;  3TTH A;  4R76 A;  4IK2 A;  2VZZ A;  3D3S A;  5HVG A;  5IX3 A;  4OKO A;  4K30 A;  4P4I A;  5AGE A;  5G20 A;  2OH1 A;  1Q7L A;  4CAV A;  5IB0 A;  5K8O A;  2HC9 A;  4HNX B;  3PGP A;  1YK3 A;  3DNS A;  2IQ6 A;  2FIW A;  3SJE A;  3V7Z A;  3FVL A;  1N71 A;  2PJ7 A;  4KOU A;  4KOV A;  1A2Z A;  5F49 A;  2F7V A;  2GLF A;  3H8E A;  2PQ8 A;  4DJL A;  2NYQ A;  1TIQ A;  4E2A A;  1TF9 A;  4CRY B;  4KOW A;  1P0H A;  4KOT A;  4M6I A;  4NCZ A;  3TO9 A;  1Z2L A;  3GLJ A;  4C7I A;  1Q2Y A;  2Q7B A;  3V8I A;  5J8F A;  3JTK A;  3VH9 A;  3N7Z A;  5LYD A;  7CPA A;  5JGF A;  2PRB A;  3WC7 A;  3RBU A;  2GU2 A;  2GAN A;  3EFA A;  4R6T A;  4II9 A;  3LD2 A;  1R3N A;  4LX9 A;  1L0C A;  1IU8 A;  1QSR A;  4O23 A;  1FT7 A;  4JD6 A;  2ZXV A;  1JQG A;  1X12 A;  1XE4 A;  2Z3M A;  2Q51 A;  4NF1 A;  4UEE A;  1IOI A;  1XFO A;  4RI1 A;  4NEX A;  3NFZ A;  1BPM A;  4R87 A;  1UWY A;  2J8N A;  2I00 A;  1VGY A;  2R1I A;  2C6C A;  3R96 A;  2XEF A;  1V0C A;  1ZG9 A;  2WZN A;  4KVM E;  1S7K A;  4PXE A;  2JDD A;  4XPD C;  3CXQ A;  3ISX A;  3ISZ A;  2Q4Y A;  4R7M A;  2AFW A;  3QB8 A;  5CNP A;  3QAY A;  4FD6 A;  4M6G A;  3SI0 A;  1Z9U A;  4EME A;  2DXQ A;  5AG7 A;  2IMO A;  5F46 A;  1YLO A;  1ON0 A;  5FVJ A;  4C2Y A;  3BI0 A;  1RTQ A;  2ZEF A;  5LYI A;  1XF8 A;  2I79 A;  3I1U A;  5GCN A;  5C82 A;  1M4D A;  2PJ4 A;  4OIW A;  4OC4 A;  3S6F A;  3LOD A;  2NMT A;  3IEH A;  3TOA A;  3FRM A;  4ZBG A;  4XPL A;  4ZX8 A;  2CNM A;  2YNE A;  1PU9 A;  2DF5 A;  1XMB A;  2B5G B;  4MXU A;  4MJ8 A;  4OC3 A;  3R1K A;  4P4D A;  3KAS A;  4EVY A;  4MCQ A;  3DR8 A;  4H6U A;  5H84 A;  4CS0 B;  2WYR A;  1WWZ A;  1WK4 A;  2PR8 A;  4HNW B;  4QUS A;  4MFL A;  1IB1 E;  4NGQ A;  4OAE A;  4NGS A;  4R3L A;  2B4D B;  4GM5 A;  3H5Z A;  2PJ8 A;  3R9F A;  4NFR A;  1P4N A;  2VEZ A;  1LFW A;  3B7I A;  4MCS A;  3N5F A;  4DYO A;  5LRG A;  2P0W A;  4MRI A;  1CX8 A;  2FSR A;  2REE A;  4FD5 A;  5LYF A;  4C68 A;  1BOB A;  4TNU A;  2Z3P A;  4A95 A;  2QEC A;  1VHS A;  3ZJ0 A;  3CPA A;  2FIA A;  2CIJ A;  1Z4E A;  2Q43 A;  1Y0Y A;  2EVN A;  2Q4Z A;  3BJ7 A;  4OID A;  4ONU A;  4B13 A;  5KTA A;  1GHE A;  4A33 A;  3KGQ A;  2QML A;  2J8M A;  4F9U A;  2PJC A;  3P2F A;  1KUY A;  4J3G A;  2IL4 A;  4KLV A;  3WC5 A;  2HUZ A;  2Z3O A;  5AG6 A;  4ZY2 A;  3MGD A;  1Q2C A;  2R8V A;  3PB8 X;  4U5Y A;  3V38 A;  1BLL E;  4UBR A;  3P2H A;  2FCK A;  2GIV A;  1M1D A;  1R43 A;  2BEI A;  3ZZI A;  3PB7 X;  4A2Z A;  4OC5 A;  1ARL A;  1KZF A;  3HLP A;  2D4P A;  4CAF A;  2B5G A;  1UFH A;  3W6X A;  1TKF A;  1ZLH A;  2FL4 A;  3IWG A;  3EO4 A;  3NE8 A;  4MI4 A;  5G1Z A;  1NSA A;  1XEB A;  1Q2D A;  2J9A A;  3CZX A;  1QSM A;  3SJX A;  4H6Z A;  5ELY A;  4UFX A;  4CAW A;  3S6K A;  3TOB A;  2PVV A;  4MBU A;  3FBU A;  4PSW A;  1F2P A;  4CGM A;  5J1Q A;  1YME A;  2B58 A;  2D4O A;  5F47 A;  1QSN A;  1IYL A;  2ZED A;  3BI1 A;  2ZW5 A;  4C2Z A;  5F48 A;  4ZI6 A;  1HDQ A;  4KZT A;  3E0K A;  2P6F A;  1YX0 A;  4H89 A;  2QIR A;  3B35 A;  1M44 A;  2VXK A;  3KHZ A;  4UCN A;  4Z65 A;  4KSF A;  1S7N A;  3PBE A;  2AJ6 A;  3GKR A;  2DPT A;  2Q0Y A;  3B8G A;  4NGN A;  4OC1 A;  4KSA A;  4AG7 A;  4KLW A;  1I12 A;  4IAV A;  5G22 A;  2ZW7 A;  4HNY B;  3MN8 A;  3L2N A;  2POK A;  2Z3K A;  4JJX A;  1YQE A;  1VHO A;  3PB4 X;  4IF5 A;  4X3R A;  3D2P A;  1HDU A;  3VAT A;  3TE4 A;  2Z11 A;  4UCM A;  4WJB A;  5E96 A;  3FMC A;  4A94 A;  2REF A;  3PRT A;  3IU2 A;  4PPZ A;  5C88 A;  1S60 A;  2ATR A;  4FD4 A;  3WR7 A;  1CPX A;  1K4J A;  4QBJ A;  1OZP A;  4FWU A;  4MFJ A;  4AB7 A;  2F8H A;  5F09 A;  3KR5 A;  3S6G A;  2RB7 A;  3TCV A;  4ZX9 A;  2PDO A;  5HVF A;  2GFQ A;  4BD9 A;  4MHN A;  1ZG7 A;  2AFM A;  2CNT A;  4R3K A;  4AVA A;  5ISV A;  1CM0 A;  2V8D A;  3QAH A;  2O53 A;  3FXT A;  4IUS A;  4UWI A;  1NE9 A;  1I21 A;  1TKJ A;  3RAM A;  4YRH A;  3FYN A;  1OBR A;  2OZG A;  4MHP A;  4F6A A;  1NSL A;  2Z0Z A;  4MY0 A;  4P10 A;  3WT4 A;  4A30 A;  1YLE A;  3S9L A;  1J4J A;  2PCU A;  4M85 A;  1S7L A;  4R9M A;  4OME A;  2HQY A;  3FH4 A;  1Y9K A;  2ABZ A;  4Q38 A;  1TKH A;  2EO8 A;  4UIB A;  4P4E A;  3H8F A;  4NGT A;  2RC4 A;  4H2K A;  4A39 A;  2CF4 A;  1U6M A;  2JDC A;  4CYP A;  2XEI A;  2R7H A;  1ELL P;  1IIC A;  1ZO0 A;  3H4Q A;  1S5K A;  4AVB A;  5J8C A;  5IV0 A;  1IYK A;  2B3U A;  1LOK A;  1H8L A;  1XJO A;  2Z10 A;  4OLL A;  4KVO E;  4MHY A;  3T8W A;  4LQG A;  2EUI A;  2C27 A;  2JBK A;  3PFO A;  3CPX A;  5KTD A;  4F0X A;  1S3Z A;  2ARH A;  5D8N A;  1CPS A;  3KL9 A;  2ZEO A;  4NJQ A;  4OC0 A;  4NXY A;  6CPA A;  5I4M A;  3FEC A;  1BAV A;  4KOX A;  3TX8 A;  5D29 A;  4U9Y A;  1AYE A;  2C6G A;  4PSX A;  3PFE A;  3RO0 A;  5CBM A;  4OAD A;  1TF8 A;  3D7D A;  3BJ8 A;  4YU9 A;  4RN7 A;  4UF4 A;  4CAE A;  2J8R A;  4B11 A;  4OP4 A;  2O4H A;  4CGO A;  3SJG A;  1DE4 C;  2OOT A;  3G3S A;  2XEJ A;  2ZEP A;  4P4F A;  3KQZ A;  1YRE A;  4QC6 A;  1GYT A;  2ZPA A;  3FIX A;  4P6Y A;  4XPD B;  4PV6 A;  1YGH A;  4YWY A;  3S6H A;  5LRK A;  2FE7 A;  4IHM A;  5EC4 A;  5HXD A;  2ZEG A;  2ZW4 A;  2B4B A;  5JQ4 A;  3F8K A;  2PC1 A;  2CXA A;  2CY2 A;  4XNH C;  1B87 A;  3SXO A;  3B3S A;  2O28 A;  4P4B A;  5DS0 A;  2A4N A;  1Y9W A;  4NJR A;  1RXT A;  3DLJ A;  1KWM A;  3R9E A;  3TFY A;  2DPS A;  2EK9 A;  2P6E A;  3IGR A;  4JXQ A;  4ONW A;  2QYV A;  4CYN A;  3OWC A;  1Z8L A;  3VWD A;  2H5M A;  2AFS A;  4B5P B;  2PR1 A;  4JWP A;  4MMO A;  3S9M A;  4AG9 A;  1SQH A;  4FUU A;  2WSA A;  4G1P A;  2FVG A;  4NSQ A;  2CTC A;  2VZY A;  2PJB A;  1CP7 A;  4YFJ A;  2PJ2 A;  2PIY A;  1IY7 A;  2QVP A;  4PK3 A;  3LAC A;  1VHE A;  3LWU A;  1IOF A;  3RZA A;  2V8G A;  3SXN A;  4CGL A;  5I0C A;  2CNS A;  2IJZ A;  2XEG A;  2C1C A;  3EC4 A;  4W9Y A;  5HH1 A;  5THW A;  3GIU A;  3T90 A;  5LRJ A;  1CBX A;  3F5B A;  2JEW A;  1ZG8 A;  4QVT A;  2VL1 A;  3B3T A;  4C7H A;  1Z5R A;  1LAN A;  1XRY A;  3NH5 A;  4B6Z A;  2VQY A;  8CPA A;  1MJ9 A;  2G0B A;  4LQ6 A;  4WWV A;  4K3N A;  1XIX A;  5K8P A;  3S9N A;  1AUG A;  1QMU A;  3IIB A;  4JLY A;  2B3V A;  4X8I A;  5CPA A;  4RUH A;  5K8M A;  2PJ9 A;  5LYL A;  4HPS A;  2OB0 A;  4UFW A;  4F0Y A;  2ZW6 A;  3PB6 X;  4NGM A;  3SI1 A;  3EY5 A;  4X5K A;  3FNC A;  5EBV A;  4XNH B;  2ODF A;  4KSI A;  5A28 A;  4Q7A A;  1MK4 A;  1RO5 A;  4KVX A;  4U9Z A;  4ZY0 A;  1DTD A;  5DWM A;  4E0A A;  2BO9 A;  3KQX A;  1YW6 A;  2Q7S A;  1PUA A;  4BBH A;  3RNZ A;  3TC8 A;  5JM6 A;  1CJW A;  3B3C A;  4FAI A;  2Q44 A;  4C2X A;  3D8P A;  3I9S A;  4AXV A;  4BIN A;  2PVW A;  1LAP A;  1VKC A;  3HUV A;  3SHP A;  1ELM P;  2Y0M A;  3D7H A;  3PP9 A;  4HKF A;  3G8W A;  4CAX A;  3D66 A;  3I3G A;  4MHZ A;  4Y49 C;  3TT2 A;  4B5P A;  4MHD A;  4A38 A;  3GY9 A;  3QNV A;  5KTC A;  2PJ0 A;  4ZY1 A;  3B3W A;  3KHX A;  1PYT B;  2FT0 A;  4F9V A;  4ZYQ A;  2WPW A;  1Z8W A;  1B6B A;  1M4G A;  1S7F A;  2PSW A;  2X7B A;  3PB9 X;  4P44 A;  4YGO A;  3IU1 A;  4DNC A;  3JUW A;  4EWT A;  1YVK A;  4KS9 A;  4UEZ A;  4FD7 A;  4B5O A;  1KUX A;  3MRU A;  4UIA A;  3KKW A; 
#chains in the Genus database with same CATH homology
 2ZEE A;  3K2K A;  4MCR A;  2CTB A;  4CPA A;  2EWB A;  4JYW A;  3KI9 A;  3LMS A;  4NGR A;  2PIZ A;  2PJ3 A;  4P45 A;  1YW4 A;  5IB9 A;  3GB0 A;  3FF3 A;  3K9T A;  1IGB A;  3WC6 A;  2ZEM A;  1LCP A;  3NH4 A;  4JZ0 A;  3D67 A;  2AFU A;  2GRE A;  3IC1 A;  3IWW A;  1M4L A;  4MCP A;  2C6P A;  3D7G A;  4F8Z A;  4R8F A;  2PJ1 A;  3IFE A;  3D4U A;  1Y7E A;  1LAM A;  1TXR A;  3BXM A;  1AMP A;  2EK8 A;  1VIX A;  3FJU A;  2PJ5 A;  2AFX A;  4OC2 A;  3FED A;  1YSJ A;  4PXD A;  5HVH A;  2BCO A;  1ARM A;  4P4J A;  2ZEL A;  5K8N A;  2V77 A;  3SI2 A;  2ZOG A;  2HB6 A;  3D68 A;  4NGP A;  1XBU A;  2BOA A;  4DUK A;  2ZOF A;  3DGV A;  3FEE A;  2G9D A;  1QQ9 A;  1CG2 A;  4PXC A;  3WAB A;  3KR4 A;  3NH8 A;  2AFZ A;  1F57 A;  3CDX A;  3CT9 A;  2PE3 A;  2GLJ A;  2QJ8 A;  2RFH A;  3B2Y A;  5I4M A;  1BPN A;  2ZEN A;  3GUX A;  2PRQ A;  3B3V A;  4PXB A;  1CP6 A;  2AFO A;  3SJF A;  3PEI A;  4EFD A;  2V8V A;  3BHX A;  3IO1 A;  5JH9 A;  3JRU A;  3PBB A;  2NSM A;  2ANP A;  2DEA A;  4UEF A;  2ZEH A;  3NA6 A;  3FX6 A;  2I3C A;  2PJ6 A;  2V8H A;  4PQA A;  2PJA A;  3D7F A;  1EE3 P;  1PCA A;  4X2T A;  1ZLI A;  4A37 A;  4FBE A;  4TWE A;  3IJ3 A;  1HEE A;  3H8G A;  1F2O A;  2OR4 A;  3VAR A;  1FNO A;  3KZW A;  1Y0R A;  2JBJ A;  4R76 A;  4IK2 A;  5HVG A;  4OKO A;  4P4I A;  1Q7L A;  5K8O A;  2HC9 A;  2IQ6 A;  3SJE A;  3V7Z A;  3FVL A;  2PJ7 A;  2F7V A;  2GLF A;  3H8E A;  4DJL A;  2NYQ A;  1TF9 A;  1Z2L A;  3GLJ A;  3VH9 A;  5LYD A;  7CPA A;  5JGF A;  3WC7 A;  3RBU A;  2GU2 A;  4R6T A;  1R3N A;  4O23 A;  1FT7 A;  1JQG A;  2Q51 A;  4UEE A;  1XFO A;  3NFZ A;  1BPM A;  1UWY A;  1VGY A;  2C6C A;  2XEF A;  2WZN A;  1ZG9 A;  4PXE A;  3ISX A;  3ISZ A;  4R7M A;  2AFW A;  3SI0 A;  4EME A;  2IMO A;  1YLO A;  3BI0 A;  1RTQ A;  2ZEF A;  5LYI A;  3I1U A;  2PJ4 A;  4OIW A;  4OC4 A;  3IEH A;  4ZX8 A;  1XMB A;  4MXU A;  4OC3 A;  4P4D A;  3KAS A;  4MCQ A;  2WYR A;  4NGQ A;  4NGS A;  4GM5 A;  2PJ8 A;  4NFR A;  4MCS A;  1LFW A;  3B7I A;  3N5F A;  4DYO A;  5LRG A;  4MRI A;  1CX8 A;  5LYF A;  4TNU A;  3CPA A;  2CIJ A;  2Q43 A;  2Q4Z A;  1Y0Y A;  4OID A;  3KGQ A;  4F9U A;  2PJC A;  3WC5 A;  4ZY2 A;  3PB8 X;  3V38 A;  1BLL E;  1R43 A;  3PB7 X;  4OC5 A;  1ARL A;  3HLP A;  1TKF A;  1ZLH A;  1NSA A;  2J9A A;  3SJX A;  5ELY A;  2PVV A;  1F2P A;  5J1Q A;  1YME A;  2ZED A;  3BI1 A;  4ZI6 A;  1HDQ A;  3B35 A;  3KHZ A;  4Z65 A;  3PBE A;  4NGN A;  4OC1 A;  4IAV A;  3MN8 A;  3L2N A;  2POK A;  3PB4 X;  1VHO A;  4X3R A;  1HDU A;  3VAT A;  4WJB A;  3FMC A;  4A94 A;  3PRT A;  4PPZ A;  1CPX A;  4FWU A;  2F8H A;  5F09 A;  3KR5 A;  2RB7 A;  4ZX9 A;  5HVF A;  4BD9 A;  4MHN A;  1ZG7 A;  2AFM A;  2V8D A;  2O53 A;  1TKJ A;  3RAM A;  1OBR A;  4MHP A;  4P10 A;  3WT4 A;  3S9L A;  2PCU A;  4OME A;  3FH4 A;  2ABZ A;  1TKH A;  4UIB A;  4P4E A;  3H8F A;  4NGT A;  4H2K A;  4A39 A;  2CF4 A;  2XEI A;  1ELL P;  1LOK A;  1H8L A;  1XJO A;  3T8W A;  4MHY A;  4LQG A;  2JBK A;  3PFO A;  3CPX A;  5D8N A;  1CPS A;  3KL9 A;  2ZEO A;  4NJQ A;  4OC0 A;  6CPA A;  3FEC A;  1BAV A;  3TX8 A;  5D29 A;  1AYE A;  2C6G A;  3PFE A;  5CBM A;  1TF8 A;  3D7D A;  4YU9 A;  4UF4 A;  4OP4 A;  2O4H A;  3SJG A;  1DE4 C;  2OOT A;  2XEJ A;  2ZEP A;  4P4F A;  3KQZ A;  1GYT A;  4P6Y A;  4YWY A;  5LRK A;  4IHM A;  5HXD A;  2ZEG A;  3B3S A;  5DS0 A;  4P4B A;  4NJR A;  3DLJ A;  1KWM A;  2EK9 A;  4ONW A;  2QYV A;  1Z8L A;  2AFS A;  4MMO A;  3S9M A;  4FUU A;  4G1P A;  2FVG A;  2CTC A;  2PJB A;  1CP7 A;  2PJ2 A;  2PIY A;  1IY7 A;  2QVP A;  3RZA A;  1VHE A;  3LWU A;  2V8G A;  2IJZ A;  2XEG A;  4W9Y A;  2C1C A;  5THW A;  5LRJ A;  1CBX A;  2JEW A;  1ZG8 A;  2VL1 A;  3B3T A;  1Z5R A;  1LAN A;  1XRY A;  3NH5 A;  4B6Z A;  8CPA A;  4WWV A;  4K3N A;  5K8P A;  3S9N A;  1QMU A;  3IIB A;  4X8I A;  5CPA A;  4RUH A;  5K8M A;  5LYL A;  2PJ9 A;  3PB6 X;  4NGM A;  3SI1 A;  4KSI A;  4Q7A A;  4ZY0 A;  1DTD A;  2BO9 A;  3KQX A;  1YW6 A;  3TC8 A;  5JM6 A;  3B3C A;  4FAI A;  4AXV A;  2PVW A;  1LAP A;  3HUV A;  1ELM P;  3D7H A;  3D66 A;  4MHZ A;  4A38 A;  3QNV A;  2PJ0 A;  4ZY1 A;  3B3W A;  3KHX A;  1PYT B;  4F9V A;  4ZYQ A;  4P44 A;  3PB9 X;  4EWT A;  4UEZ A;  3MRU A;  4UIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...