1CP7A

Aminopeptidase from streptomyces griseus
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
277
structure length
274
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETERSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of Streptomyces griseus aminopeptidase with a methionine product analogue: a structural study at 1.53 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE
total genus 108
structure length 274
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 1999-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1cp7A00
2AFXA 2ZEDA 3D7GA 4MHZA 4ZY0A 2HB6A 3BI0A 2V8HA 1HEEA 3RZAA 1CBXA 1ZG7A 3IWWA 4MCRA 2F7VA 1FNOA 1XBUA 4R6TA 1FT7A 3KHXA 1BPNA 1BPMA 1JQGA 2JEWA 1BLLE 1ARLA 5K8PA 4PXCA 4DJLA 2AFSA 4FBEA 3QNVA 4A94A 2EK9A 3B7IA 3BXMA 3PBEA 4GM5A 2ZELA 1Z8LA 2XEJA 1XMBA 2PIYA 4MXUA 2C6CA 5D8NA 1YW6A 2QYVA 1CP6A 2ZOFA 5I4MA 4PXBA 5HXDA 2PJCA 3KQZA 4RUHA 3N5FA 4Q7AA 3PB6X 1KWMA 2V77A 5LRGA 5ELYA 3BI1A 4P6YA 2GLJA 4NGNA 1LFWA 2PJ5A 1TKJA 1F2OA 2ZENA 2PJ3A 1CPXA 2PJ2A 4F9UA 3B35A 2XEFA 3CT9A 2V8VA 4ZYQA 4WWVA 1VHEA 2AFWA 1CPSA 1YLOA 3MRUA 3IJ3A 3D67A 4IK2A 4MHNA 3NH8A 4NFRA 2RFHA 3GLJA 4P4IA 2JBJA 2IMOA 3NH5A 2FVGA 4P4FA 2PRQA 3D7DA 3SI2A 3TC8A 4MRIA 1R43A 2DEAA 4G1PA 4OC1A 4ZX8A 4TNUA 5JM6A 4TWEA 1CX8A 4LQGA 1QMUA 5JGFA 4P10A 2EK8A 1EE3P 1XFOA 1F57A 1TF8A 4K3NA 3CPXA 2PJ0A 4PXEA 3SI0A 1DTDA 1TF9A 1OBRA 3SJEA 4P4DA 4O23A 1BAVA 1Q7LA 3PB7X 4F9VA 1LAMA 3B3SA 1F2PA 4OC5A 3V38A 4EFDA 2XEGA 2BCOA 4UEEA 2PJ6A 5K8OA 4FAIA 4P4BA 1PCAA 2PJAA 2NYQA 2AFMA 1ARMA 2ZEMA 3NA6A 1Y0YA 3IEHA 4ZY1A 1ELLP 5LRJA 3RAMA 3PB9X 4ZI6A 3IFEA 1ZLHA 1NSAA 4MCSA 3B3TA 1LAPA 1HDQA 3T8WA 4IHMA 4OP4A 5LYIA 1QQ9A 1H8LA 2IQ6A 2O53A 3FF3A 4H2KA 5CPAA 4UIAA 2AFZA 2RB7A 3LMSA 4F8ZA 1HDUA 1Z5RA 4P45A 3S9LA 3WC6A 5K8MA 4P44A 2ZEGA 2ANPA 2PIZA 3PFEA 3VATA 2JBKA 1LOKA 3VARA 3SJXA 3H8EA 3I1UA 1Z2LA 3FJUA 2PVVA 4UIBA 4MHYA 4OMEA 3KL9A 2OR4A 2GU2A 5LRKA 3LWUA 2PE3A 2C6PA 2ZEOA 1R3NA 2BOAA 4NGQA 5THWA 3FECA 4KSIA 2G9DA 7CPAA 4UF4A 3CDXA 4MMOA 1IGBA 3RBUA 5IB9A 3KZWA 1GYTA 5HVHA 2F8HA 3ISXA 1ZLIA 4YU9A 4ZY2A 3KQXA 3KR4A 2CTBA 4PXDA 3HUVA 3D66A 2AFOA 3H8FA 3PBBA 3VH9A 1RTQA 2GLFA 2Q43A 3S9NA 4OKOA 4R8FA 1LANA 3WABA 1CG2A 2V8DA 2IJZA 2QJ8A 3NFZA 1Y7EA 1TKFA 4NGMA 3PB4X 4EWTA 2OOTA 4MHPA 3DGVA 1ZG8A 2WZNA 1TKHA 4DYOA 4PQAA 3KGQA 1M4LA 2Q4ZA 5J1QA 2ZEHA 1AYEA 2CF4A 4BD9A 4A39A 3D7HA 2O4HA 4X2TA 3WC5A 4P4JA 4X8IA 4P4EA 5JH9A 2EWBA 2PJ1A 3NH4A 4OC3A 3D7FA 3FEEA 2Q51A 4OC0A 4NJRA 2CIJA 2POKA 4OIWA 1XJOA 4WJBA 4X3RA 5LYDA 2V8GA 4Z65A 2PJ8A 4NGTA 4R76A 4B6ZA 3ISZA 4FUUA 3K2KA 4UEFA 5LYLA 2C6GA 2BO9A 2ABZA 2ZEPA 3KI9A 4UEZA 3CPAA 3D4UA 5HVFA 1PYTB 1VIXA 3SI1A 4OC2A 5DS0A 1ZG9A 1XRYA 8CPAA 5D29A 3KR5A 2XEIA 3PB8X 3L2NA 3KASA 3WT4A 3B2YA 4A37A 2WYRA 1VGYA 3GUXA 2GREA 4ONWA 3S9MA 2PVWA 3IIBA 3FEDA 1DE4C 2C1CA 4PPZA 3HLPA 4W9YA 2QVPA 3BHXA 3SJGA 3JRUA 5CBMA 1IY7A 2ZOGA 3FX6A 3WC7A 3FVLA 4JZ0A 1Y0RA 2NSMA 3SJFA 3K9TA 6CPAA 1VHOA 4AXVA 4EMEA 4JYWA 3H8GA 2CTCA 3PEIA 1TXRA 5LYFA 4NGPA 4A38A 2PCUA 2PJ7A 2HC9A 2PJBA 3MN8A 3PFOA 3PRTA 1YSJA 3IO1A 4NJQA 4ZX9A 5K8NA 1AMPA 3B3VA 1ELMP 2PJ9A 4FWUA 4CPAA 3KHZA 4OC4A 4R7MA 5HVGA 4NGSA 3FH4A 3TX8A 4IAVA 4MCQA 2J9AA 2ZEFA 2ZEEA 5F09A 3V7ZA 2VL1A 2PJ4A 3D68A 3DLJA 4DUKA 2AFUA 3IC1A 4MCPA 1YMEA 4YWYA 1CP7A 1UWYA 3FMCA 1LCPA 2I3CA 3GB0A 1YW4A 3B3CA 4OIDA 3B3WA 4NGRA
chains in the Genus database with same CATH superfamily
2AFXA 2ZEDA 5H86A 5EBVA 4F6AA 1IIDA 3D7GA 3FRMA 2P6GA 3RO0A 4KUAA 2WPWA 1Z8WA 4MFQA 4A32A 4MHZA 4ZY0A 2HB6A 3W6XA 4CS0B 2HQYA 3BI0A 2V8HA 1HEEA 3RZAA 5I0CA 1CBXA 1NMTA 2VZYA 1ZG7A 3IWWA 1XMTA 5GCNA 4MCRA 2A4NA 2F7VA 3T9YA 4CGOA 1FNOA 1XBUA 4R6TA 1P4NA 3ZZIA 1FT7A 5G1ZA 4M85A 4MBUA 3KHXA 1BPNA 1BPMA 1JQGA 2JEWA 1BLLE 1ARLA 5K8PA 2Z3OA 3TOBA 4H89A 2BL1A 2Q4VA 4PXCA 2AJ6A 4IUSA 1JWQA 5AGEA 4DJLA 2AFSA 3VWDA 4MFPA 2I79A 4FBEA 5A27A 1YLEA 4KSFA 4C7HA 3QNVA 1MJBA 3S6GA 2PDOA 4Y49B 4AG7A 4F0YA 4A94A 4B14A 4KVME 2EK9A 3B7IA 3BXMA 1YQEA 3PBEA 2ZELA 4GM5A 4CAXA 3TE4A 1Z8LA 2XEJA 1XMBA 2PIYA 4MXUA 2B4DB 2C6CA 3GY9A 5D8NA 3LACA 5EMIA 1MJAA 1YW6A 2QYVA 1CJWA 1CP6A 2ZOFA 5I4MA 4PK2A 4PXBA 5HXDA 2PJCA 4AVCA 3E0KA 3CXQA 2FE7A 3KQZA 1I1DA 4CRZB 4RUHA 3FB3A 3N5FA 4Q7AA 3IU2A 4UCNA 4HNWB 1OZPA 3D3SA 1XOVA 3PB6X 1KWMA 2HV2A 4KUBA 2V77A 3R96A 1IICA 2OB0A 2Q7SA 4YGOA 5ELYA 3BI1A 5LRGA 4U5YA 1K4JA 4JJXA 4P6YA 2OZHA 2VBQA 3TOAA 4AG9A 2GLJA 4R57A 2YNDA 2G3TA 4NGNA 4B10A 2PJ5A 1LFWA 1M4DA 1TKJA 1F2OA 2GANA 3EY5A 2EBJA 4RI1A 1L0CA 1M4IA 3DSBA 2ZENA 2PJ3A 4MFJA 4OLLA 1CPXA 2PJ2A 4F9UA 2Z11A 3B35A 4B11A 2XEFA 3CT9A 2V8VA 4PV6A 4U9ZA 4KORA 4B5PA 4ZYQA 4WWVA 2PC1A 4B12A 1XIXA 3FNCA 1YREA 1Z9UA 1VHEA 3DR8A 2Q04A 2AFWA 2Q44A 1CPSA 2CY2A 3FXTA 2BEIA 2B5GA 4KOTA 1YLOA 3MRUA 3IJ3A 3D67A 4IK2A 4MHNA 4UFWA 3UY5A 3NH8A 1IU8A 4CAWA 1GHEA 4NFRA 3N7ZA 2RFHA 3GLJA 4P4IA 5HH1A 1WK4A 2JBJA 2IMOA 3NH5A 4JD6A 3S6KA 4A95A 4C68A 3DDDA 4LX9A 2FVGA 4P4FA 2PRQA 1LRZA 3D7DA 4MY3A 3SI2A 1QSOA 4KOSA 3BLNA 3TC8A 4Q38A 1N71A 5H84A 4E2AA 3IGRA 1Y7RA 4MRIA 4OAEA 1R43A 2DEAA 4G1PA 2OU2A 4OC1A 4ZX8A 4TNUA 1FY7A 5JM6A 4TWEA 1CX8A 4A33A 2JEVA 4LQGA 1QMUA 5JGFA 4P10A 2EK8A 3R9FA 1EE3P 1XFOA 2R8VA 3NE7A 4NXYA 4EVYA 1MK4A 1F57A 1A2ZA 1TF8A 3QAYA 1Z8XA 4K3NA 2WUUA 3CPXA 4JLYA 2GE3A 2GIVA 2PJ0A 2FIAA 4PXEA 4R3KA 3SI0A 1DTDA 4KOWA 1TF9A 2P6EA 4MFKA 1OBRA 2JDCA 3SJEA 2WPXA 4P4DA 5AG4A 1P0HA 4O23A 1BAVA 4BMHA 4A31A 1Q7LA 3PB7X 4F9VA 1LAMA 1X10A 2DPSA 2DXQA 3I9SA 3B3SA 1F2PA 2H5MA 2G3AA 4OC5A 3V38A 5C88A 3BJ7A 1WWZA 3SHPA 1Z4RA 3VWEA 4EFDA 2XEGA 2BCOA 2B4DA 3QB8A 4UEEA 4H6ZA 2PJ6A 5K8OA 2IL4A 4FAIA 4P4BA 1PCAA 2PJAA 2NYQA 5J8CA 2AFMA 2ZW6A 1MJ9A 4MY0A 1ARMA 2ZEMA 5IX3A 3NA6A 3JUWA 4XPDB 1Y0YA 3IEHA 4ZY1A 3TTHA 1YR0A 1ELLP 4NSQA 5LRJA 3RAMA 3PB9X 4ZI6A 3PGPA 1V0CA 2I00A 4XNHB 3IFEA 1Y9KA 5G20A 1YVKA 1ZLHA 1NSAA 1XF8A 4KLWA 4MCSA 4UFVA 5IV0A 1R57A 3P2HA 3B3TA 1LAPA 1BO4A 1HDQA 2ZW4A 4R3LA 5EC4A 3R95A 1RXTA 3SXNA 3T8WA 4BINA 1BOBA 4IHMA 2DF5A 2QMLA 2Y0MA 3FYNA 4CGLA 4OP4A 1PUAA 4XPKA 2PR1A 1M44A 4NF1A 5LYIA 1QQ9A 1KUVA 2VXKA 2FCKA 1H8LA 2IQ6A 2O53A 3FF3A 4KLVA 4H2KA 2VI7A 5CPAA 4UIAA 3JVNA 5KTDA 1IB1E 2AFZA 5F47A 2B5GB 5F46A 3R1KA 2RB7A 4LUAA 3LMSA 4F8ZA 1QSMA 1HDUA 4J3GA 5G21A 3W91A 1Z5RA 4C7IA 4P45A 3FBUA 1S3ZA 4CAFA 1TIQA 2Q0YA 3S9LA 3WC6A 1S7FA 5K8MA 3D2PA 3D8PA 2ZPAA 5F49A 4UBRA 4C2YA 4P44A 2ZEGA 3F8KA 3EXNA 2ANPA 2PIZA 4CAVA 4QUSA 2Z3NA 2J8MA 4M6IA 3TFYA 3PFEA 1XE4A 2REEA 3VATA 2JBKA 3PZJA 1LOKA 5CNPA 3VARA 3SJXA 2EUIA 1NE9A 1VKCA 3H8EA 4KOXA 2ARHA 3MGDA 2R7HA 4X5KA 3ZJ0A 3I1UA 5KTCA 1YVOA 1Z2LA 3FJUA 2PVVA 2B4BA 4UIBA 2Z10A 4MHYA 5AG6A 3DR6A 1M4GA 2PSWA 4OMEA 4K30A 1Z8TA 3KL9A 2OR4A 2GU2A 5LRKA 4LQ6A 3GYAA 5JQ4A 3LWUA 2PE3A 5E96A 2C6PA 2ZEOA 1R3NA 2BOAA 4NGQA 5THWA 1KUXA 3H4QA 3OWCA 3FECA 4KSIA 4OADA 2G9DA 4QB9A 1U6MA 2FSRA 7CPAA 4UF4A 3CDXA 4MMOA 4MFLA 1IGBA 2AE6A 4HNYB 3RBUA 4F0XA 5IB9A 3KZWA 1GYTA 3EO4A 4M6GA 5HVHA 2F8HA 3CXPA 4R9MA 2YNCA 3ISXA 2J8RA 1ZLIA 4YU9A 4ZY2A 1PU9A 3JTKA 3KQXA 5G22A 3KR4A 2CTBA 4PXDA 4AB7A 3HUVA 2Z3PA 3D66A 2AFOA 4KZTA 3TO6A 4B13A 4CYNA 3H8FA 1X12A 3PBBA 3VH9A 1UFHA 1RTQA 2VEZA 2GLFA 2Q43A 3S9NA 1NSLA 2Z0ZA 4I49A 4R87A 4KVOE 5JPHA 2ZW5A 2K5TA 2PRBA 4OKOA 4R8FA 2VQYA 1LANA 1M1DA 2P0WA 4RS2A 4ORFA 1CG2A 2V8DA 3WABA 2CNMA 2Q7BA 2IJZA 2ZXVA 3A9LA 2QJ8A 3NFZA 5BWAB 1Y7EA 1TKFA 4GXHA 4NGMA 4KOUA 3CXSA 3PB4X 4EWTA 1QSRA 2OOTA 4NCZA 1I21A 4MHPA 2CNSA 3DGVA 4ZGYB 1ZG8A 2WZNA 2R98A 2Z3KA 1YK3A 2D4PA 4QBJA 4YFJA 5HMNA 4PSXA 1I12A 1ZO0A 3W6SA 1TKHA 4DYOA 2X7BA 1B87A 4PQAA 3G8WA 3GKRA 3KGQA 3G3SA 1M4LA 2Q4ZA 4C2ZA 5J1QA 3LD2A 2ZEHA 1AYEA 2BSWA 2CF4A 4BD9A 4FD4A 4A39A 2FIWA 3D7HA 2O4HA 2YNEA 4X2TA 3IU1A 5DWNA 2F5IA 3WC5A 4DNCA 4P4JA 4X8IA 2VZZA 5DWMA 4P4EA 5JH9A 4JXRA 2JLMA 1Z4EA 2EWBA 4KVXA 2PJ1A 3NH4A 2JDDA 3D7FA 3FEEA 3PP9A 4OC3A 2Q51A 4OC0A 4NJRA 2CIJA 2POKA 4RN7A 4KSAA 4XPLA 4A2ZA 3C26A 4CYPA 1S7NA 2BUEA 4KOVA 4UA3A 4OIWA 1XJOA 4WJBA 4X3RA 5LYDA 2REFA 2V8GA 4Z65A 3F5BA 2PJ8A 1S7LA 4NGTA 4R76A 3RNZA 4PSWA 2PR8A 4B6ZA 3TT2A 3ISZA 4FUUA 3K2KA 4GS4A 4UEFA 3S6FA 5LYLA 2GFQA 4B5OA 3R9EA 2C6GA 4BBHA 2BO9A 2Q4YA 2B3VA 2ABZA 2ZEPA 3KI9A 4NEXA 4UEZA 2YNCC 3B8GA 3CPAA 3D4UA 5HVFA 1PYTB 2OZUA 1VIXA 3SI1A 4MJ8A 4OC2A 5DS0A 1ZG9A 1XRYA 4UCMA 1VHSA 2C27A 2DPTA 2QIRA 5D29A 3KR5A 2R1IA 8CPAA 4JXQA 4Y49C 2XEIA 2RC4A 3PB8X 2ZW7A 3L2NA 3KASA 4L89A 2CNTA 1RO5A 3WT4A 3F0AA 3B2YA 4FD6A 4A37A 5FVJA 2WYRA 3GIUA 1VGYA 1S60A 4MFZA 4FD5A 3GUXA 4UCPA 2J8NA 2P6FA 2GREA 1XEBA 4ONWA 3S9MA 2PVWA 1Y9WA 1Q2YA 4HNXB 1YGHA 3I3GA 3IIBA 4Q36A 5F48A 3FEDA 1DE4C 2C1CA 3D2MA 5IB0A 4CGNA 4PPZA 5KTAA 3HLPA 4W9YA 4II9A 2QVPA 4A30A 2B58A 2EVNA 1YX0A 3BHXA 3P2FA 4FD7A 2O28A 3JRUA 3S6HA 3SJGA 4CGMA 5CBMA 1IY7A 1KZFA 2FL4A 2ZOGA 3FX6A 3WC7A 4CAEA 4CYOA 3KKWA 1S5KA 3FVLA 1CM0A 4KS9A 2CXAA 2WSAA 4JWPA 4JZ0A 1B6BA 2ATRA 2QECA 4ZBGA 1Y0RA 4PK3A 1SQHA 2NSMA 3SJFA 5AG7A 3K9TA 1IOIA 6CPAA 3IWGA 3TCVA 2Z3LA 1VHOA 3RYOA 4AXVA 3K9UA 4L8AA 4HKFA 2FS5A 3CZXA 2HUZA 4JYWA 3H8GA 4IF5A 4AVAA 2CTCA 4EMEA 1J4JA 4UFXA 3TO7A 2OH1A 3H5ZA 1TXRA 2D4OA 3PEIA 4QC6A 5LYFA 4QVTA 2YGWA 4XPDC 4NGPA 5AG5A 2PCUA 2PJ7A 4A38A 4U9YA 2HC9A 2EO8A 2PJBA 4HPSA 2FXFA 3MN8A 3PFOA 4XNHC 3V8IA 3PRTA 5A28A 1YSJA 3IO1A 4NJQA 4ZX9A 5K8NA 1AMPA 3T90A 3EFAA 4AVBA 2G0BA 3B3VA 1ELMP 3BJ8A 2PJ9A 2KCWA 3WR7A 4FWUA 4CPAA 4M6HA 4E8OA 3KHZA 1AUGA 4OC4A 1ON0A 1S7KA 4R7MA 5ISVA 4KOYA 2Z3MA 5HVGA 4NGSA 2OZGA 3FH4A 4CRYB 4UWJA 4ONUA 3TX8A 5J8FA 2FT0A 4IAVA 4MCQA 1Q2CA 2J9AA 2NMTA 2ZEFA 2ODFA 3R9GA 3LODA 2ZEEA 5F09A 4UWIA 1IYKA 3V7ZA 2B3UA 4E0AA 1Q2DA 2VL1A 4MI4A 2PJ4A 5C82A 4CGPA 3D68A 1KUYA 1QSTA 3DLJA 3EC4A 4DUKA 2AFUA 4M3SA 3IWEA 4MHDA 1IOFA 3FIXA 4B5PB 2PQ8A 3IC1A 4MCPA 1YMEA 4C2XA 3NE8A 4YWYA 1CP7A 1UWYA 3FMCA 3QAHA 4CYQA 3TO9A 1LCPA 2I3CA 1QSNA 3GB0A 3SXOA 1YW4A 3B3CA 4H6UA 4OIDA 3B3WA 4YRHA 3DNSA 4NGRA 1IYLA
chains in the Genus database with same CATH topology
2AFXA 2ZEDA 3D7GA 4MHZA 4ZY0A 2HB6A 3BI0A 2V8HA 1HEEA 3RZAA 1CBXA 1ZG7A 3IWWA 4MCRA 2F7VA 1FNOA 1XBUA 4R6TA 1FT7A 3KHXA 1BPNA 1BPMA 1JQGA 2JEWA 1BLLE 1ARLA 5K8PA 4PXCA 4DJLA 2AFSA 4FBEA 3QNVA 4A94A 2EK9A 3B7IA 3BXMA 3PBEA 4GM5A 2ZELA 1Z8LA 2XEJA 1XMBA 2PIYA 4MXUA 2C6CA 5D8NA 1YW6A 2QYVA 1CP6A 2ZOFA 5I4MA 4PXBA 5HXDA 2PJCA 3KQZA 4RUHA 3N5FA 4Q7AA 3PB6X 1KWMA 2V77A 5LRGA 5ELYA 3BI1A 4P6YA 2GLJA 4NGNA 1LFWA 2PJ5A 1TKJA 1F2OA 2ZENA 2PJ3A 1CPXA 2PJ2A 4F9UA 3B35A 2XEFA 3CT9A 2V8VA 4ZYQA 4WWVA 1VHEA 2AFWA 1CPSA 1YLOA 3MRUA 3IJ3A 3D67A 4IK2A 4MHNA 3NH8A 4NFRA 2RFHA 3GLJA 4P4IA 2JBJA 2IMOA 3NH5A 2FVGA 4P4FA 2PRQA 3D7DA 3SI2A 3TC8A 4MRIA 1R43A 2DEAA 4G1PA 4OC1A 4ZX8A 4TNUA 5JM6A 4TWEA 1CX8A 4LQGA 1QMUA 5JGFA 4P10A 2EK8A 1EE3P 1XFOA 1F57A 1TF8A 4K3NA 3CPXA 2PJ0A 4PXEA 3SI0A 1DTDA 1TF9A 1OBRA 3SJEA 4P4DA 4O23A 1BAVA 1Q7LA 3PB7X 4F9VA 1LAMA 3B3SA 1F2PA 4OC5A 3V38A 4EFDA 2XEGA 2BCOA 4UEEA 2PJ6A 5K8OA 4FAIA 4P4BA 1PCAA 2PJAA 2NYQA 2AFMA 1ARMA 2ZEMA 3NA6A 1Y0YA 3IEHA 4ZY1A 1ELLP 5LRJA 3RAMA 3PB9X 4ZI6A 3IFEA 1ZLHA 1NSAA 4MCSA 3B3TA 1LAPA 1HDQA 3T8WA 4IHMA 4OP4A 5LYIA 1QQ9A 1H8LA 2IQ6A 2O53A 3FF3A 4H2KA 5CPAA 4UIAA 2AFZA 2RB7A 3LMSA 4F8ZA 1HDUA 1Z5RA 4P45A 3S9LA 3WC6A 5K8MA 4P44A 2ZEGA 2ANPA 2PIZA 3PFEA 3VATA 2JBKA 1LOKA 3VARA 3SJXA 3H8EA 3I1UA 1Z2LA 3FJUA 2PVVA 4UIBA 4MHYA 4OMEA 3KL9A 2OR4A 2GU2A 5LRKA 3LWUA 2PE3A 2C6PA 2ZEOA 1R3NA 2BOAA 4NGQA 5THWA 3FECA 4KSIA 2G9DA 7CPAA 4UF4A 3CDXA 4MMOA 1IGBA 3RBUA 5IB9A 3KZWA 1GYTA 5HVHA 2F8HA 3ISXA 1ZLIA 4YU9A 4ZY2A 3KQXA 3KR4A 2CTBA 4PXDA 3HUVA 3D66A 2AFOA 3H8FA 3PBBA 3VH9A 1RTQA 2GLFA 2Q43A 3S9NA 4OKOA 4R8FA 1LANA 3WABA 1CG2A 2V8DA 2IJZA 2QJ8A 3NFZA 1Y7EA 1TKFA 4NGMA 3PB4X 4EWTA 2OOTA 4MHPA 3DGVA 1ZG8A 2WZNA 1TKHA 4DYOA 4PQAA 3KGQA 1M4LA 2Q4ZA 5J1QA 2ZEHA 1AYEA 2CF4A 4BD9A 4A39A 3D7HA 2O4HA 4X2TA 3WC5A 4P4JA 4X8IA 4P4EA 5JH9A 2EWBA 2PJ1A 3NH4A 4OC3A 3D7FA 3FEEA 2Q51A 4OC0A 4NJRA 2CIJA 2POKA 4OIWA 1XJOA 4WJBA 4X3RA 5LYDA 2V8GA 4Z65A 2PJ8A 4NGTA 4R76A 4B6ZA 3ISZA 4FUUA 3K2KA 4UEFA 5LYLA 2C6GA 2BO9A 2ABZA 2ZEPA 3KI9A 4UEZA 3CPAA 3D4UA 5HVFA 1PYTB 1VIXA 3SI1A 4OC2A 5DS0A 1ZG9A 1XRYA 8CPAA 5D29A 3KR5A 2XEIA 3PB8X 3L2NA 3KASA 3WT4A 3B2YA 4A37A 2WYRA 1VGYA 3GUXA 2GREA 4ONWA 3S9MA 2PVWA 3IIBA 3FEDA 1DE4C 2C1CA 4PPZA 3HLPA 4W9YA 2QVPA 3BHXA 3SJGA 3JRUA 5CBMA 1IY7A 2ZOGA 3FX6A 3WC7A 3FVLA 4JZ0A 1Y0RA 2NSMA 3SJFA 3K9TA 6CPAA 1VHOA 4AXVA 4EMEA 4JYWA 3H8GA 2CTCA 3PEIA 1TXRA 5LYFA 4NGPA 4A38A 2PCUA 2PJ7A 2HC9A 2PJBA 3MN8A 3PFOA 3PRTA 1YSJA 3IO1A 4NJQA 4ZX9A 5K8NA 1AMPA 3B3VA 1ELMP 2PJ9A 4FWUA 4CPAA 3KHZA 4OC4A 4R7MA 5HVGA 4NGSA 3FH4A 3TX8A 4IAVA 4MCQA 2J9AA 2ZEFA 2ZEEA 5F09A 3V7ZA 2VL1A 2PJ4A 3D68A 3DLJA 4DUKA 2AFUA 3IC1A 4MCPA 1YMEA 4YWYA 1CP7A 1UWYA 3FMCA 1LCPA 2I3CA 3GB0A 1YW4A 3B3CA 4OIDA 3B3WA 4NGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFX A;  2ZED A;  3D7G A;  4MHZ A;  4ZY0 A;  2HB6 A;  3BI0 A;  2V8H A;  1HEE A;  3RZA A;  1CBX A;  1ZG7 A;  3IWW A;  4MCR A;  2F7V A;  1FNO A;  1XBU A;  4R6T A;  1FT7 A;  3KHX A;  1BPN A;  1BPM A;  1JQG A;  2JEW A;  1BLL E;  1ARL A;  5K8P A;  4PXC A;  4DJL A;  2AFS A;  4FBE A;  3QNV A;  4A94 A;  2EK9 A;  3B7I A;  3BXM A;  3PBE A;  4GM5 A;  2ZEL A;  1Z8L A;  2XEJ A;  1XMB A;  2PIY A;  4MXU A;  2C6C A;  5D8N A;  1YW6 A;  2QYV A;  1CP6 A;  2ZOF A;  5I4M A;  4PXB A;  5HXD A;  2PJC A;  3KQZ A;  4RUH A;  3N5F A;  4Q7A A;  3PB6 X;  1KWM A;  2V77 A;  5LRG A;  5ELY A;  3BI1 A;  4P6Y A;  2GLJ A;  4NGN A;  1LFW A;  2PJ5 A;  1TKJ A;  1F2O A;  2ZEN A;  2PJ3 A;  1CPX A;  2PJ2 A;  4F9U A;  3B35 A;  2XEF A;  3CT9 A;  2V8V A;  4ZYQ A;  4WWV A;  1VHE A;  2AFW A;  1CPS A;  1YLO A;  3MRU A;  3IJ3 A;  3D67 A;  4IK2 A;  4MHN A;  3NH8 A;  4NFR A;  2RFH A;  3GLJ A;  4P4I A;  2JBJ A;  2IMO A;  3NH5 A;  2FVG A;  4P4F A;  2PRQ A;  3D7D A;  3SI2 A;  3TC8 A;  4MRI A;  1R43 A;  2DEA A;  4G1P A;  4OC1 A;  4ZX8 A;  4TNU A;  5JM6 A;  4TWE A;  1CX8 A;  4LQG A;  1QMU A;  5JGF A;  4P10 A;  2EK8 A;  1EE3 P;  1XFO A;  1F57 A;  1TF8 A;  4K3N A;  3CPX A;  2PJ0 A;  4PXE A;  3SI0 A;  1DTD A;  1TF9 A;  1OBR A;  3SJE A;  4P4D A;  4O23 A;  1BAV A;  1Q7L A;  3PB7 X;  4F9V A;  1LAM A;  3B3S A;  1F2P A;  4OC5 A;  3V38 A;  4EFD A;  2XEG A;  2BCO A;  4UEE A;  2PJ6 A;  5K8O A;  4FAI A;  4P4B A;  1PCA A;  2PJA A;  2NYQ A;  2AFM A;  1ARM A;  2ZEM A;  3NA6 A;  1Y0Y A;  3IEH A;  4ZY1 A;  1ELL P;  5LRJ A;  3RAM A;  3PB9 X;  4ZI6 A;  3IFE A;  1ZLH A;  1NSA A;  4MCS A;  3B3T A;  1LAP A;  1HDQ A;  3T8W A;  4IHM A;  4OP4 A;  5LYI A;  1QQ9 A;  1H8L A;  2IQ6 A;  2O53 A;  3FF3 A;  4H2K A;  5CPA A;  4UIA A;  2AFZ A;  2RB7 A;  3LMS A;  4F8Z A;  1HDU A;  1Z5R A;  4P45 A;  3S9L A;  3WC6 A;  5K8M A;  4P44 A;  2ZEG A;  2ANP A;  2PIZ A;  3PFE A;  3VAT A;  2JBK A;  1LOK A;  3VAR A;  3SJX A;  3H8E A;  3I1U A;  1Z2L A;  3FJU A;  2PVV A;  4UIB A;  4MHY A;  4OME A;  3KL9 A;  2OR4 A;  2GU2 A;  5LRK A;  3LWU A;  2PE3 A;  2C6P A;  2ZEO A;  1R3N A;  2BOA A;  4NGQ A;  5THW A;  3FEC A;  4KSI A;  2G9D A;  7CPA A;  4UF4 A;  3CDX A;  4MMO A;  1IGB A;  3RBU A;  5IB9 A;  3KZW A;  1GYT A;  5HVH A;  2F8H A;  3ISX A;  1ZLI A;  4YU9 A;  4ZY2 A;  3KQX A;  3KR4 A;  2CTB A;  4PXD A;  3HUV A;  3D66 A;  2AFO A;  3H8F A;  3PBB A;  3VH9 A;  1RTQ A;  2GLF A;  2Q43 A;  3S9N A;  4OKO A;  4R8F A;  1LAN A;  3WAB A;  1CG2 A;  2V8D A;  2IJZ A;  2QJ8 A;  3NFZ A;  1Y7E A;  1TKF A;  4NGM A;  3PB4 X;  4EWT A;  2OOT A;  4MHP A;  3DGV A;  1ZG8 A;  2WZN A;  1TKH A;  4DYO A;  4PQA A;  3KGQ A;  1M4L A;  2Q4Z A;  5J1Q A;  2ZEH A;  1AYE A;  2CF4 A;  4BD9 A;  4A39 A;  3D7H A;  2O4H A;  4X2T A;  3WC5 A;  4P4J A;  4X8I A;  4P4E A;  5JH9 A;  2EWB A;  2PJ1 A;  3NH4 A;  4OC3 A;  3D7F A;  3FEE A;  2Q51 A;  4OC0 A;  4NJR A;  2CIJ A;  2POK A;  4OIW A;  1XJO A;  4WJB A;  4X3R A;  5LYD A;  2V8G A;  4Z65 A;  2PJ8 A;  4NGT A;  4R76 A;  4B6Z A;  3ISZ A;  4FUU A;  3K2K A;  4UEF A;  5LYL A;  2C6G A;  2BO9 A;  2ABZ A;  2ZEP A;  3KI9 A;  4UEZ A;  3CPA A;  3D4U A;  5HVF A;  1PYT B;  1VIX A;  3SI1 A;  4OC2 A;  5DS0 A;  1ZG9 A;  1XRY A;  8CPA A;  5D29 A;  3KR5 A;  2XEI A;  3PB8 X;  3L2N A;  3KAS A;  3WT4 A;  3B2Y A;  4A37 A;  2WYR A;  1VGY A;  3GUX A;  2GRE A;  4ONW A;  3S9M A;  2PVW A;  3IIB A;  3FED A;  1DE4 C;  2C1C A;  4PPZ A;  3HLP A;  4W9Y A;  2QVP A;  3BHX A;  3SJG A;  3JRU A;  5CBM A;  1IY7 A;  2ZOG A;  3FX6 A;  3WC7 A;  3FVL A;  4JZ0 A;  1Y0R A;  2NSM A;  3SJF A;  3K9T A;  6CPA A;  1VHO A;  4AXV A;  4EME A;  4JYW A;  3H8G A;  2CTC A;  3PEI A;  1TXR A;  5LYF A;  4NGP A;  4A38 A;  2PCU A;  2PJ7 A;  2HC9 A;  2PJB A;  3MN8 A;  3PFO A;  3PRT A;  1YSJ A;  3IO1 A;  4NJQ A;  4ZX9 A;  5K8N A;  1AMP A;  3B3V A;  1ELM P;  2PJ9 A;  4FWU A;  4CPA A;  3KHZ A;  4OC4 A;  4R7M A;  5HVG A;  4NGS A;  3FH4 A;  3TX8 A;  4IAV A;  4MCQ A;  2J9A A;  2ZEF A;  2ZEE A;  5F09 A;  3V7Z A;  2VL1 A;  2PJ4 A;  3D68 A;  3DLJ A;  4DUK A;  2AFU A;  3IC1 A;  4MCP A;  1YME A;  4YWY A;  1CP7 A;  1UWY A;  3FMC A;  1LCP A;  2I3C A;  3GB0 A;  1YW4 A;  3B3C A;  4OID A;  3B3W A;  4NGR A; 
#chains in the Genus database with same CATH topology
 2AFX A;  2ZED A;  5H86 A;  5EBV A;  4F6A A;  1IID A;  3D7G A;  3FRM A;  2P6G A;  3RO0 A;  4KUA A;  2WPW A;  1Z8W A;  4MFQ A;  4A32 A;  4MHZ A;  4ZY0 A;  2HB6 A;  3W6X A;  4CS0 B;  2HQY A;  3BI0 A;  2V8H A;  1HEE A;  3RZA A;  5I0C A;  1CBX A;  1NMT A;  2VZY A;  1ZG7 A;  3IWW A;  1XMT A;  5GCN A;  4MCR A;  2A4N A;  2F7V A;  3T9Y A;  4CGO A;  1FNO A;  1XBU A;  4R6T A;  1P4N A;  3ZZI A;  1FT7 A;  5G1Z A;  4M85 A;  4MBU A;  3KHX A;  1BPN A;  1BPM A;  1JQG A;  2JEW A;  1BLL E;  1ARL A;  5K8P A;  2Z3O A;  3TOB A;  4H89 A;  2BL1 A;  2Q4V A;  4PXC A;  2AJ6 A;  4IUS A;  1JWQ A;  5AGE A;  4DJL A;  2AFS A;  3VWD A;  4MFP A;  2I79 A;  4FBE A;  5A27 A;  1YLE A;  4KSF A;  4C7H A;  3QNV A;  1MJB A;  3S6G A;  2PDO A;  4Y49 B;  4AG7 A;  4F0Y A;  4A94 A;  4B14 A;  4KVM E;  2EK9 A;  3B7I A;  3BXM A;  1YQE A;  3PBE A;  2ZEL A;  4GM5 A;  4CAX A;  3TE4 A;  1Z8L A;  2XEJ A;  1XMB A;  2PIY A;  4MXU A;  2B4D B;  2C6C A;  3GY9 A;  5D8N A;  3LAC A;  5EMI A;  1MJA A;  1YW6 A;  2QYV A;  1CJW A;  1CP6 A;  2ZOF A;  5I4M A;  4PK2 A;  4PXB A;  5HXD A;  2PJC A;  4AVC A;  3E0K A;  3CXQ A;  2FE7 A;  3KQZ A;  1I1D A;  4CRZ B;  4RUH A;  3FB3 A;  3N5F A;  4Q7A A;  3IU2 A;  4UCN A;  4HNW B;  1OZP A;  3D3S A;  1XOV A;  3PB6 X;  1KWM A;  2HV2 A;  4KUB A;  2V77 A;  3R96 A;  1IIC A;  2OB0 A;  2Q7S A;  4YGO A;  5ELY A;  3BI1 A;  5LRG A;  4U5Y A;  1K4J A;  4JJX A;  4P6Y A;  2OZH A;  2VBQ A;  3TOA A;  4AG9 A;  2GLJ A;  4R57 A;  2YND A;  2G3T A;  4NGN A;  4B10 A;  2PJ5 A;  1LFW A;  1M4D A;  1TKJ A;  1F2O A;  2GAN A;  3EY5 A;  2EBJ A;  4RI1 A;  1L0C A;  1M4I A;  3DSB A;  2ZEN A;  2PJ3 A;  4MFJ A;  4OLL A;  1CPX A;  2PJ2 A;  4F9U A;  2Z11 A;  3B35 A;  4B11 A;  2XEF A;  3CT9 A;  2V8V A;  4PV6 A;  4U9Z A;  4KOR A;  4B5P A;  4ZYQ A;  4WWV A;  2PC1 A;  4B12 A;  1XIX A;  3FNC A;  1YRE A;  1Z9U A;  1VHE A;  3DR8 A;  2Q04 A;  2AFW A;  2Q44 A;  1CPS A;  2CY2 A;  3FXT A;  2BEI A;  2B5G A;  4KOT A;  1YLO A;  3MRU A;  3IJ3 A;  3D67 A;  4IK2 A;  4MHN A;  4UFW A;  3UY5 A;  3NH8 A;  1IU8 A;  4CAW A;  1GHE A;  4NFR A;  3N7Z A;  2RFH A;  3GLJ A;  4P4I A;  5HH1 A;  1WK4 A;  2JBJ A;  2IMO A;  3NH5 A;  4JD6 A;  3S6K A;  4A95 A;  4C68 A;  3DDD A;  4LX9 A;  2FVG A;  4P4F A;  2PRQ A;  1LRZ A;  3D7D A;  4MY3 A;  3SI2 A;  1QSO A;  4KOS A;  3BLN A;  3TC8 A;  4Q38 A;  1N71 A;  5H84 A;  4E2A A;  3IGR A;  1Y7R A;  4MRI A;  4OAE A;  1R43 A;  2DEA A;  4G1P A;  2OU2 A;  4OC1 A;  4ZX8 A;  4TNU A;  1FY7 A;  5JM6 A;  4TWE A;  1CX8 A;  4A33 A;  2JEV A;  4LQG A;  1QMU A;  5JGF A;  4P10 A;  2EK8 A;  3R9F A;  1EE3 P;  1XFO A;  2R8V A;  3NE7 A;  4NXY A;  4EVY A;  1MK4 A;  1F57 A;  1A2Z A;  1TF8 A;  3QAY A;  1Z8X A;  4K3N A;  2WUU A;  3CPX A;  4JLY A;  2GE3 A;  2GIV A;  2PJ0 A;  2FIA A;  4PXE A;  4R3K A;  3SI0 A;  1DTD A;  4KOW A;  1TF9 A;  2P6E A;  4MFK A;  1OBR A;  2JDC A;  3SJE A;  2WPX A;  4P4D A;  5AG4 A;  1P0H A;  4O23 A;  1BAV A;  4BMH A;  4A31 A;  1Q7L A;  3PB7 X;  4F9V A;  1LAM A;  1X10 A;  2DPS A;  2DXQ A;  3I9S A;  3B3S A;  1F2P A;  2H5M A;  2G3A A;  4OC5 A;  3V38 A;  5C88 A;  3BJ7 A;  1WWZ A;  3SHP A;  1Z4R A;  3VWE A;  4EFD A;  2XEG A;  2BCO A;  2B4D A;  3QB8 A;  4UEE A;  4H6Z A;  2PJ6 A;  5K8O A;  2IL4 A;  4FAI A;  4P4B A;  1PCA A;  2PJA A;  2NYQ A;  5J8C A;  2AFM A;  2ZW6 A;  1MJ9 A;  4MY0 A;  1ARM A;  2ZEM A;  5IX3 A;  3NA6 A;  3JUW A;  4XPD B;  1Y0Y A;  3IEH A;  4ZY1 A;  3TTH A;  1YR0 A;  1ELL P;  4NSQ A;  5LRJ A;  3RAM A;  3PB9 X;  4ZI6 A;  3PGP A;  1V0C A;  2I00 A;  4XNH B;  3IFE A;  1Y9K A;  5G20 A;  1YVK A;  1ZLH A;  1NSA A;  1XF8 A;  4KLW A;  4MCS A;  4UFV A;  5IV0 A;  1R57 A;  3P2H A;  3B3T A;  1LAP A;  1BO4 A;  1HDQ A;  2ZW4 A;  4R3L A;  5EC4 A;  3R95 A;  1RXT A;  3SXN A;  3T8W A;  4BIN A;  1BOB A;  4IHM A;  2DF5 A;  2QML A;  2Y0M A;  3FYN A;  4CGL A;  4OP4 A;  1PUA A;  4XPK A;  2PR1 A;  1M44 A;  4NF1 A;  5LYI A;  1QQ9 A;  1KUV A;  2VXK A;  2FCK A;  1H8L A;  2IQ6 A;  2O53 A;  3FF3 A;  4KLV A;  4H2K A;  2VI7 A;  5CPA A;  4UIA A;  3JVN A;  5KTD A;  1IB1 E;  2AFZ A;  5F47 A;  2B5G B;  5F46 A;  3R1K A;  2RB7 A;  4LUA A;  3LMS A;  4F8Z A;  1QSM A;  1HDU A;  4J3G A;  5G21 A;  3W91 A;  1Z5R A;  4C7I A;  4P45 A;  3FBU A;  1S3Z A;  4CAF A;  1TIQ A;  2Q0Y A;  3S9L A;  3WC6 A;  1S7F A;  5K8M A;  3D2P A;  3D8P A;  2ZPA A;  5F49 A;  4UBR A;  4C2Y A;  4P44 A;  2ZEG A;  3F8K A;  3EXN A;  2ANP A;  2PIZ A;  4CAV A;  4QUS A;  2Z3N A;  2J8M A;  4M6I A;  3TFY A;  3PFE A;  1XE4 A;  2REE A;  3VAT A;  2JBK A;  3PZJ A;  1LOK A;  5CNP A;  3VAR A;  3SJX A;  2EUI A;  1NE9 A;  1VKC A;  3H8E A;  4KOX A;  2ARH A;  3MGD A;  2R7H A;  4X5K A;  3ZJ0 A;  3I1U A;  5KTC A;  1YVO A;  1Z2L A;  3FJU A;  2PVV A;  2B4B A;  4UIB A;  2Z10 A;  4MHY A;  5AG6 A;  3DR6 A;  1M4G A;  2PSW A;  4OME A;  4K30 A;  1Z8T A;  3KL9 A;  2OR4 A;  2GU2 A;  5LRK A;  4LQ6 A;  3GYA A;  5JQ4 A;  3LWU A;  2PE3 A;  5E96 A;  2C6P A;  2ZEO A;  1R3N A;  2BOA A;  4NGQ A;  5THW A;  1KUX A;  3H4Q A;  3OWC A;  3FEC A;  4KSI A;  4OAD A;  2G9D A;  4QB9 A;  1U6M A;  2FSR A;  7CPA A;  4UF4 A;  3CDX A;  4MMO A;  4MFL A;  1IGB A;  2AE6 A;  4HNY B;  3RBU A;  4F0X A;  5IB9 A;  3KZW A;  1GYT A;  3EO4 A;  4M6G A;  5HVH A;  2F8H A;  3CXP A;  4R9M A;  2YNC A;  3ISX A;  2J8R A;  1ZLI A;  4YU9 A;  4ZY2 A;  1PU9 A;  3JTK A;  3KQX A;  5G22 A;  3KR4 A;  2CTB A;  4PXD A;  4AB7 A;  3HUV A;  2Z3P A;  3D66 A;  2AFO A;  4KZT A;  3TO6 A;  4B13 A;  4CYN A;  3H8F A;  1X12 A;  3PBB A;  3VH9 A;  1UFH A;  1RTQ A;  2VEZ A;  2GLF A;  2Q43 A;  3S9N A;  1NSL A;  2Z0Z A;  4I49 A;  4R87 A;  4KVO E;  5JPH A;  2ZW5 A;  2K5T A;  2PRB A;  4OKO A;  4R8F A;  2VQY A;  1LAN A;  1M1D A;  2P0W A;  4RS2 A;  4ORF A;  1CG2 A;  2V8D A;  3WAB A;  2CNM A;  2Q7B A;  2IJZ A;  2ZXV A;  3A9L A;  2QJ8 A;  3NFZ A;  5BWA B;  1Y7E A;  1TKF A;  4GXH A;  4NGM A;  4KOU A;  3CXS A;  3PB4 X;  4EWT A;  1QSR A;  2OOT A;  4NCZ A;  1I21 A;  4MHP A;  2CNS A;  3DGV A;  4ZGY B;  1ZG8 A;  2WZN A;  2R98 A;  2Z3K A;  1YK3 A;  2D4P A;  4QBJ A;  4YFJ A;  5HMN A;  4PSX A;  1I12 A;  1ZO0 A;  3W6S A;  1TKH A;  4DYO A;  2X7B A;  1B87 A;  4PQA A;  3G8W A;  3GKR A;  3KGQ A;  3G3S A;  1M4L A;  2Q4Z A;  4C2Z A;  5J1Q A;  3LD2 A;  2ZEH A;  1AYE A;  2BSW A;  2CF4 A;  4BD9 A;  4FD4 A;  4A39 A;  2FIW A;  3D7H A;  2O4H A;  2YNE A;  4X2T A;  3IU1 A;  5DWN A;  2F5I A;  3WC5 A;  4DNC A;  4P4J A;  4X8I A;  2VZZ A;  5DWM A;  4P4E A;  5JH9 A;  4JXR A;  2JLM A;  1Z4E A;  2EWB A;  4KVX A;  2PJ1 A;  3NH4 A;  2JDD A;  3D7F A;  3FEE A;  3PP9 A;  4OC3 A;  2Q51 A;  4OC0 A;  4NJR A;  2CIJ A;  2POK A;  4RN7 A;  4KSA A;  4XPL A;  4A2Z A;  3C26 A;  4CYP A;  1S7N A;  2BUE A;  4KOV A;  4UA3 A;  4OIW A;  1XJO A;  4WJB A;  4X3R A;  5LYD A;  2REF A;  2V8G A;  4Z65 A;  3F5B A;  2PJ8 A;  1S7L A;  4NGT A;  4R76 A;  3RNZ A;  4PSW A;  2PR8 A;  4B6Z A;  3TT2 A;  3ISZ A;  4FUU A;  3K2K A;  4GS4 A;  4UEF A;  3S6F A;  5LYL A;  2GFQ A;  4B5O A;  3R9E A;  2C6G A;  4BBH A;  2BO9 A;  2Q4Y A;  2B3V A;  2ABZ A;  2ZEP A;  3KI9 A;  4NEX A;  4UEZ A;  2YNC C;  3B8G A;  3CPA A;  3D4U A;  5HVF A;  1PYT B;  2OZU A;  1VIX A;  3SI1 A;  4MJ8 A;  4OC2 A;  5DS0 A;  1ZG9 A;  1XRY A;  4UCM A;  1VHS A;  2C27 A;  2DPT A;  2QIR A;  5D29 A;  3KR5 A;  2R1I A;  8CPA A;  4JXQ A;  4Y49 C;  2XEI A;  2RC4 A;  3PB8 X;  2ZW7 A;  3L2N A;  3KAS A;  4L89 A;  2CNT A;  1RO5 A;  3WT4 A;  3F0A A;  3B2Y A;  4FD6 A;  4A37 A;  5FVJ A;  2WYR A;  3GIU A;  1VGY A;  1S60 A;  4MFZ A;  4FD5 A;  3GUX A;  4UCP A;  2J8N A;  2P6F A;  2GRE A;  1XEB A;  4ONW A;  3S9M A;  2PVW A;  1Y9W A;  1Q2Y A;  4HNX B;  1YGH A;  3I3G A;  3IIB A;  4Q36 A;  5F48 A;  3FED A;  1DE4 C;  2C1C A;  3D2M A;  5IB0 A;  4CGN A;  4PPZ A;  5KTA A;  3HLP A;  4W9Y A;  4II9 A;  2QVP A;  4A30 A;  2B58 A;  2EVN A;  1YX0 A;  3BHX A;  3P2F A;  4FD7 A;  2O28 A;  3JRU A;  3S6H A;  3SJG A;  4CGM A;  5CBM A;  1IY7 A;  1KZF A;  2FL4 A;  2ZOG A;  3FX6 A;  3WC7 A;  4CAE A;  4CYO A;  3KKW A;  1S5K A;  3FVL A;  1CM0 A;  4KS9 A;  2CXA A;  2WSA A;  4JWP A;  4JZ0 A;  1B6B A;  2ATR A;  2QEC A;  4ZBG A;  1Y0R A;  4PK3 A;  1SQH A;  2NSM A;  3SJF A;  5AG7 A;  3K9T A;  1IOI A;  6CPA A;  3IWG A;  3TCV A;  2Z3L A;  1VHO A;  3RYO A;  4AXV A;  3K9U A;  4L8A A;  4HKF A;  2FS5 A;  3CZX A;  2HUZ A;  4JYW A;  3H8G A;  4IF5 A;  4AVA A;  2CTC A;  4EME A;  1J4J A;  4UFX A;  3TO7 A;  2OH1 A;  3H5Z A;  1TXR A;  2D4O A;  3PEI A;  4QC6 A;  5LYF A;  4QVT A;  2YGW A;  4XPD C;  4NGP A;  5AG5 A;  2PCU A;  2PJ7 A;  4A38 A;  4U9Y A;  2HC9 A;  2EO8 A;  2PJB A;  4HPS A;  2FXF A;  3MN8 A;  3PFO A;  4XNH C;  3V8I A;  3PRT A;  5A28 A;  1YSJ A;  3IO1 A;  4NJQ A;  4ZX9 A;  5K8N A;  1AMP A;  3T90 A;  3EFA A;  4AVB A;  2G0B A;  3B3V A;  1ELM P;  3BJ8 A;  2PJ9 A;  2KCW A;  3WR7 A;  4FWU A;  4CPA A;  4M6H A;  4E8O A;  3KHZ A;  1AUG A;  4OC4 A;  1ON0 A;  1S7K A;  4R7M A;  5ISV A;  4KOY A;  2Z3M A;  5HVG A;  4NGS A;  2OZG A;  3FH4 A;  4CRY B;  4UWJ A;  4ONU A;  3TX8 A;  5J8F A;  2FT0 A;  4IAV A;  4MCQ A;  1Q2C A;  2J9A A;  2NMT A;  2ZEF A;  2ODF A;  3R9G A;  3LOD A;  2ZEE A;  5F09 A;  4UWI A;  1IYK A;  3V7Z A;  2B3U A;  4E0A A;  1Q2D A;  2VL1 A;  4MI4 A;  2PJ4 A;  5C82 A;  4CGP A;  3D68 A;  1KUY A;  1QST A;  3DLJ A;  3EC4 A;  4DUK A;  2AFU A;  4M3S A;  3IWE A;  4MHD A;  1IOF A;  3FIX A;  4B5P B;  2PQ8 A;  3IC1 A;  4MCP A;  1YME A;  4C2X A;  3NE8 A;  4YWY A;  1CP7 A;  1UWY A;  3FMC A;  3QAH A;  4CYQ A;  3TO9 A;  1LCP A;  2I3C A;  1QSN A;  3GB0 A;  3SXO A;  1YW4 A;  3B3C A;  4H6U A;  4OID A;  3B3W A;  4YRH A;  3DNS A;  4NGR A;  1IYL A; 
#chains in the Genus database with same CATH homology
 2AFX A;  2ZED A;  3D7G A;  4MHZ A;  4ZY0 A;  2HB6 A;  3BI0 A;  2V8H A;  1HEE A;  3RZA A;  1CBX A;  1ZG7 A;  3IWW A;  4MCR A;  2F7V A;  1FNO A;  1XBU A;  4R6T A;  1FT7 A;  3KHX A;  1BPN A;  1BPM A;  1JQG A;  2JEW A;  1BLL E;  1ARL A;  5K8P A;  4PXC A;  4DJL A;  2AFS A;  4FBE A;  3QNV A;  4A94 A;  2EK9 A;  3B7I A;  3BXM A;  3PBE A;  4GM5 A;  2ZEL A;  1Z8L A;  2XEJ A;  1XMB A;  2PIY A;  4MXU A;  2C6C A;  5D8N A;  1YW6 A;  2QYV A;  1CP6 A;  2ZOF A;  5I4M A;  4PXB A;  5HXD A;  2PJC A;  3KQZ A;  4RUH A;  3N5F A;  4Q7A A;  3PB6 X;  1KWM A;  2V77 A;  5LRG A;  5ELY A;  3BI1 A;  4P6Y A;  2GLJ A;  4NGN A;  1LFW A;  2PJ5 A;  1TKJ A;  1F2O A;  2ZEN A;  2PJ3 A;  1CPX A;  2PJ2 A;  4F9U A;  3B35 A;  2XEF A;  3CT9 A;  2V8V A;  4ZYQ A;  4WWV A;  1VHE A;  2AFW A;  1CPS A;  1YLO A;  3MRU A;  3IJ3 A;  3D67 A;  4IK2 A;  4MHN A;  3NH8 A;  4NFR A;  2RFH A;  3GLJ A;  4P4I A;  2JBJ A;  2IMO A;  3NH5 A;  2FVG A;  4P4F A;  2PRQ A;  3D7D A;  3SI2 A;  3TC8 A;  4MRI A;  1R43 A;  2DEA A;  4G1P A;  4OC1 A;  4ZX8 A;  4TNU A;  5JM6 A;  4TWE A;  1CX8 A;  4LQG A;  1QMU A;  5JGF A;  4P10 A;  2EK8 A;  1EE3 P;  1XFO A;  1F57 A;  1TF8 A;  4K3N A;  3CPX A;  2PJ0 A;  4PXE A;  3SI0 A;  1DTD A;  1TF9 A;  1OBR A;  3SJE A;  4P4D A;  4O23 A;  1BAV A;  1Q7L A;  3PB7 X;  4F9V A;  1LAM A;  3B3S A;  1F2P A;  4OC5 A;  3V38 A;  4EFD A;  2XEG A;  2BCO A;  4UEE A;  2PJ6 A;  5K8O A;  4FAI A;  4P4B A;  1PCA A;  2PJA A;  2NYQ A;  2AFM A;  1ARM A;  2ZEM A;  3NA6 A;  1Y0Y A;  3IEH A;  4ZY1 A;  1ELL P;  5LRJ A;  3RAM A;  3PB9 X;  4ZI6 A;  3IFE A;  1ZLH A;  1NSA A;  4MCS A;  3B3T A;  1LAP A;  1HDQ A;  3T8W A;  4IHM A;  4OP4 A;  5LYI A;  1QQ9 A;  1H8L A;  2IQ6 A;  2O53 A;  3FF3 A;  4H2K A;  5CPA A;  4UIA A;  2AFZ A;  2RB7 A;  3LMS A;  4F8Z A;  1HDU A;  1Z5R A;  4P45 A;  3S9L A;  3WC6 A;  5K8M A;  4P44 A;  2ZEG A;  2ANP A;  2PIZ A;  3PFE A;  3VAT A;  2JBK A;  1LOK A;  3VAR A;  3SJX A;  3H8E A;  3I1U A;  1Z2L A;  3FJU A;  2PVV A;  4UIB A;  4MHY A;  4OME A;  3KL9 A;  2OR4 A;  2GU2 A;  5LRK A;  3LWU A;  2PE3 A;  2C6P A;  2ZEO A;  1R3N A;  2BOA A;  4NGQ A;  5THW A;  3FEC A;  4KSI A;  2G9D A;  7CPA A;  4UF4 A;  3CDX A;  4MMO A;  1IGB A;  3RBU A;  5IB9 A;  3KZW A;  1GYT A;  5HVH A;  2F8H A;  3ISX A;  1ZLI A;  4YU9 A;  4ZY2 A;  3KQX A;  3KR4 A;  2CTB A;  4PXD A;  3HUV A;  3D66 A;  2AFO A;  3H8F A;  3PBB A;  3VH9 A;  1RTQ A;  2GLF A;  2Q43 A;  3S9N A;  4OKO A;  4R8F A;  1LAN A;  3WAB A;  1CG2 A;  2V8D A;  2IJZ A;  2QJ8 A;  3NFZ A;  1Y7E A;  1TKF A;  4NGM A;  3PB4 X;  4EWT A;  2OOT A;  4MHP A;  3DGV A;  1ZG8 A;  2WZN A;  1TKH A;  4DYO A;  4PQA A;  3KGQ A;  1M4L A;  2Q4Z A;  5J1Q A;  2ZEH A;  1AYE A;  2CF4 A;  4BD9 A;  4A39 A;  3D7H A;  2O4H A;  4X2T A;  3WC5 A;  4P4J A;  4X8I A;  4P4E A;  5JH9 A;  2EWB A;  2PJ1 A;  3NH4 A;  4OC3 A;  3D7F A;  3FEE A;  2Q51 A;  4OC0 A;  4NJR A;  2CIJ A;  2POK A;  4OIW A;  1XJO A;  4WJB A;  4X3R A;  5LYD A;  2V8G A;  4Z65 A;  2PJ8 A;  4NGT A;  4R76 A;  4B6Z A;  3ISZ A;  4FUU A;  3K2K A;  4UEF A;  5LYL A;  2C6G A;  2BO9 A;  2ABZ A;  2ZEP A;  3KI9 A;  4UEZ A;  3CPA A;  3D4U A;  5HVF A;  1PYT B;  1VIX A;  3SI1 A;  4OC2 A;  5DS0 A;  1ZG9 A;  1XRY A;  8CPA A;  5D29 A;  3KR5 A;  2XEI A;  3PB8 X;  3L2N A;  3KAS A;  3WT4 A;  3B2Y A;  4A37 A;  2WYR A;  1VGY A;  3GUX A;  2GRE A;  4ONW A;  3S9M A;  2PVW A;  3IIB A;  3FED A;  1DE4 C;  2C1C A;  4PPZ A;  3HLP A;  4W9Y A;  2QVP A;  3BHX A;  3SJG A;  3JRU A;  5CBM A;  1IY7 A;  2ZOG A;  3FX6 A;  3WC7 A;  3FVL A;  4JZ0 A;  1Y0R A;  2NSM A;  3SJF A;  3K9T A;  6CPA A;  1VHO A;  4AXV A;  4EME A;  4JYW A;  3H8G A;  2CTC A;  3PEI A;  1TXR A;  5LYF A;  4NGP A;  4A38 A;  2PCU A;  2PJ7 A;  2HC9 A;  2PJB A;  3MN8 A;  3PFO A;  3PRT A;  1YSJ A;  3IO1 A;  4NJQ A;  4ZX9 A;  5K8N A;  1AMP A;  3B3V A;  1ELM P;  2PJ9 A;  4FWU A;  4CPA A;  3KHZ A;  4OC4 A;  4R7M A;  5HVG A;  4NGS A;  3FH4 A;  3TX8 A;  4IAV A;  4MCQ A;  2J9A A;  2ZEF A;  2ZEE A;  5F09 A;  3V7Z A;  2VL1 A;  2PJ4 A;  3D68 A;  3DLJ A;  4DUK A;  2AFU A;  3IC1 A;  4MCP A;  1YME A;  4YWY A;  1CP7 A;  1UWY A;  3FMC A;  1LCP A;  2I3C A;  3GB0 A;  1YW4 A;  3B3C A;  4OID A;  3B3W A;  4NGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...