1CPNA

Native-like in vivo folding of a circularly permuted jellyroll protein shown by crystal structure analysis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
208
structure length
208
Chain Sequence
FDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGPAHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIKWYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSNGSVFWEPKSYFNPSTWEKADGYSNGGVFNCTWRANNVNFTNDGKLKLGLTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CIRCULARLY PERMUTED
publication title Native-like in vivo folding of a circularly permuted jellyroll protein shown by crystal structure analysis.
pubmed doi rcsb
source organism Paenibacillus macerans
molecule tags Hydrolase(glucanase)
total genus 47
structure length 208
sequence length 208
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1994-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cpnA00
2ZZJA 4P9XA 5T5JA 1MS5A 4HANA 4YG0A 4YFWA 2DURA 1KITA 5EYYA 4XIKA 1HLCA 5T52A 1AXZA 5IK4A 1W6NB 2AENA 1S0IA 1LODA 2VH9A 3O0VA 4WVWA 2ZGPA 2CY6A 3WUDA 2AUYA 2AGSA 1JN2P 1JXNA 1WUVA 2DTWA 1WBFA 2EXKA 3HR9A 1IKQA 2P3JA 4Y22B 3VUOA 4R9CA 1D2SA 1JOJA 4GKYA 1HQLA 1W6MB 2A5ZA 4Y1XA 4ATFA 1VAVA 4XMAA 1DZQA 1YXWA 4LBQB 4YFZA 1D0HA 3WCSA 3ZPYA 4JRAA 2OW4A 5GLTA 3FLTA 1LHNA 2VXRA 4GALA 1DQ4A 1N3OA 1WW6A 5DZGA 2AR6A 5H9PA 4BQ1A 3V65A 3NV1A 3SNMA 4M3CA 4M00A 3AZWA 4Y1UA 1DHKB 5BYNA 3SH5A 1WW7A 1SLTA 2NMNA 1GKBA 1SACA 4XILA 3N7JA 1FATA 2D43A 1CONA 2WNEA 4Q26A 5EWSA 3WDUA 1KRIA 2DVBA 2W68A 1FX5A 3INAA 3N7MA 3AYDA 4FPFA 1CR7A 3OGGA 2DVDA 5FRAA 1S1AA 4AWDA 1LOEA 3POSA 4ASMB 2ZMNA 5DZFA 4XHBA 2JE7A 3BTAA 2YXSA 1KDMA 3QLQA 1IS4A 1JHNA 2PHRA 4AGGA 1G9CA 4ITCA 3AYCA 5E88A 1MVEA 2SLIA 4LBQD 1G9DA 3ILFA 5KXCA 4PBOA 1Q8OA 2W08A 2C9AA 1GZWA 4XJUA 1SLCA 5EYXA 3WG1A 3V0BB 1Q56A 4BOWA 3FUOA 1WW5A 3ZYPA 2ZHLA 3USUA 4LBMA 1V6JA 5HCAA 1QMJA 4F83A 1G7YA 3OPZA 1JYIA 1UX6A 2YV8A 2R0HA 4XJ8A 2GNDA 3VKMA 5CNAA 1UPSA 4FPGA 4YGDA 2UWCA 1JYCA 4FP2A 3WCRA 4M01A 2AREA 3FLRA 1Q8PA 2DUOA 1LJ7A 3BODA 4XBNA 3UJQA 1Q8QA 3M3OA 1V6IA 4YW1A 1UZYA 1AF9A 3CNAA 1WD4A 1APNA 2EALA 4YGCA 4XJWA 1ENSA 1QNWA 3WNXA 4WZFA 4M3CF 1RIRA 3A4UA 5T5PA 4K1YA 3ZXLA 1KDKA 4FOWA 5DUVA 1MS0A 2OUHA 4PBPA 3FFZA 3L2YA 3QCWA 1LCLA 2JE9A 1U0AA 1V6LA 4LBJA 4YG3A 3AZVA 5GZFA 2GMEA 3AP5A 4U36A 2AYHA 4P9YA 2D3PA 3UJOA 4GWMA 1FYUA 1EPWA 2NP0A 1YI7A 2GALA 4U2AA 1GZ9A 3H0OA 4FOVA 1ULGA 2A6WA 3T1LA 1LEMA 1MS3A 5JVVA 4Y1YA 2ZGLA 3AP9A 3AP7A 4AVTA 5E89A 2D6PA 2NM1A 5F9TA 3O12A 1QKQA 3MW2A 3MW4A 3WHTA 4ATEA 1LU2A 2WLQA 2GNTA 2DYCA 5DG1A 5AVAA 1YYNA 3POYA 1W6OB 1QDOA 1QOSA 2DVFA 1MR5A 1F9KA 3R4SA 1DBNA 1LGBA 1KJLA 3N3HA 2DUPA 3B00A 1NXD1 3D6EA 1Z78A 2NN8A 2A6ZA 1A8DA 5KXBA 1IOAA 1N3PA 2CTVA 4Q8LA 4BMEA 2P3KA 4UW5A 1C1FA 4K21A 2ZGTA 2D6NA 4Q1RA 3APBA 4IQPA 2ZHNA 1QNYA 2LALA 5E8AA 1LGNA 1GV9A 2R0FA 2ZGUA 3AYAA 2P3IA 4YLZA 4Z8BA 2NYYA 3AFKA 4Y26A 3U4XA 1MZ5A 2KM2A 2ERFA 3JUUA 5T5OA 4DRRA 4UW3A 5DZEA 1SCSA 4NOTA 5GM0A 2EIGA 5F5QA 3RS6A 1MVQA 3IMNA 1SFYA 1ULCA 1PZ7A 4M3CB 4YZ4A 4XXPA 2A7AA 2YROA 3OY8A 4M3CE 3V0AA 1V00A 2PHXA 1ULDA 1SCRA 1VAMA 3OJBA 3AJYA 4XDQA 4HL0A 3VKOA 4WV8A 3DGTA 5CAZA 4Q1PA 2D6LX 1QGLA 3AP4A 4FPEA 4W65A 3I8TA 2VW0A 1FNZA 2ZMKA 4YW2A 2ZAAA 1LU1A 1W0OA 1CIWA 1ULFA 2BQPA 4P14A 4BLIA 1DFQA 4RL7A 2EF6A 1LOBA 3AK0A 3GALA 3JU9A 5EXOA 3ZSMA 1B09A 2EXJA 4PF5A 1NLSA 3ASIA 3PVNA 1W0PA 5H9RA 2CL2A 2DV9A 3OYWA 5CBLA 1WD3A 1WW4A 1Q8VA 4FPHA 2ZGQA 4Y22A 1LGCA 2D3RA 4GWNA 3SITA 4CRQA 1I3HA 1AX2A 1W6MA 2FHRA 2ZGRA 5T5LA 4LBQA 2PHFA 1DQ5A 4Y24A 4AYUA 3ZSJA 3VKNA 3WHUA 1CPNA 1ZA4A 4I30A 1LTEA 3FBYA 3W59A 2UURA 2YMZA 1W6PB 4XJAA 1BQPA 4JC1A 1DIWA 1G8WA 1N1YA 1SBDA 2CWSA 2SBAA 2V5YA 2WT2A 2RHPA 2AH2A 4XBQA 2DU0A 4BM8A 2WKKA 5JMCA 3GNEA 1GNZA 2ZHMA 3SH3A 3RQ0A 1MS1A 1N1SA 1UL9A 3ATGA 1FV3A 4FPCA 3IM0A 3WDWA 3RSJA 1CJPA 1FAYA 4DPNA 1S0CA 1SBFA 2ZGOA 3R4UA 1AVBA 3MEPA 1S0DA 3ZYRA 1LENA 4YW3A 5H9QA 4LBKA 5HCFA 1DYPA 2HYKA 1S0JA 2W39A 1ULEA 1S0FA 2ZACA 1OKQA 5KXEA 3ZSKA 1GLHA 2DUQA 1KQRA 1N1TA 4XXAA 1HQWA 4FPYA 2JDZA 3WDTA 2GMMA 5FREA 4XJ9A 1LHUA 1DGLA 1SLIA 2ZA9A 3V0BA 2DVGA 5T54A 5GZCA 1I1EA 2ZKNA 3IPVB 4Q8KA 4K20A 3AX4A 4FQ4A 1UAIA 2VU9A 3WOGA 1GZCA 1IKPA 1DQ1A 2WT0A 5JOXA 1F5FA 1W6QB 1LECA 2A3XA 1Z0HA 4UW6A 2VUAA 1S0EA 1FV2A 5IT6A 1GYKA 1YIFA 3KM5A 1JBCA 2P34A 4FP3A 4FPJA 4R9AA 5DG2A 3D4KA 5T55A 3B01A 3N36A 1DQ0A 4PCRA 1N1VA 1BJQA 1KJRA 3WG2A 2GMPA 2P2KA 2ARXA 1OQ1A 3AZZA 4Y20B 1CPMA 1S0GA 2D6KA 1X50A 4YW5A 4C1WA 4YZ5A 1QOTA 2YY1A 2ENRA 1V6NA 4LBLA 4Q2FA 3B69A 3SH4A 4XIOA 4L8QA 3WLUA 1LULA 1WLWA 3PVEA 3PVOA 4D69A 3PJQA 3ZSLA 2ZGMA 2GN7A 3WG4A 4Y1ZA 1CESA 1ONAA 1CQ9A 3I4IA 3WVJA 2E53A 5CA6A 4PQ9A 2LTNA 2PELA 1IS5A 2CNAA 3ZXEA 3FUQA 2ZABA 2UU8A 3AXEA 1AJKA 2OUJA 2OVUA 4XTPA 3PMEA 3AXDA 3MPPG 2A6VA 5T50A 3ZXFA 4DFSA 4FQZA 4XBLA 1DLLA 4GA9A 4XJZA 1UN1A 1PZ8A 2B7YA 5GJ6A 2FMDA 3D5OA 2DVAA 3N35A 1QF3A 1AX0A 4LBNA 1QDCA 5IUQA 1F31A 4AVSA 1VLNA 4YM3A 5JDBA 1UKGA 1ENQA 3O0WA 2PHUA 4DQAA 4AGVA 1LOFC 2XB6C 3WDYA 4YZ2A 3NV4A 3O5SA 4FOQA 4GXLA 1W6OA 1V6MA 2WT1A 3HN1A 5GLUA 1XQNA 1G9BA 2WQZC 4AGRA 2CYFA 3UL2A 1MS4A 4K1ZA 3RRDA 1H9WA 5DXDA 2WSVA 2DWRA 3ZXKA 2R1BA 2W52A 3KQRA 4CTEA 3C2UA 4NO4A 2VY0A 2WSUA 3B9CA 1IS6A 3OYWB 1HDKA 4XYXA 2XG3A 2Q5TA 1W6NA 3ILNA 4MYEA 2E7TA 2Z42A 4H55A 4TYSA 4LBOA 1MZ6A 3Q9OA 5JLVA 5LK5A 1S0BA 1H30A 2C5DA 4OZXA 2ZHKA 5H9SA 3BIWE 3RMYA 1MACA 3HMYA 4DS0A 4P9WA 5IK8A 1LOAA 5JOWA 1GZWB 1WLDA 2E7QA 4YW4A 3A0KA 1JUIA 2PHTA 2GN3A 2ZGSA 2EXIA 4UW4A 3WG3A 5GZDA 2GDFA 3O0XA 3USUB 4ISRA 1GICA 2E51A 2H0BA 1OFSA 2D7FA 4FPKA 1VALA 1DYKA 3WV6A 1H9PA 4XMIA 1QOOA 2A75A 2JD4A 2VW1A 4TZDA 2PHWA 2R1DA 2I2SA 1BYHA 1AXYA 3AZYA 1JW6A 1MS8A 2ES3A 2A3WA 3DUIA 3N7KA 2E6VA 3B3QE 1WBLA 1RINA 1GBGA 3M3QA 1CN1A 2ZGNA 3OBRA 1FNYA 1YO8A 1Q8SA 5GZGA 2EAKA 1GNHA 1AXKA 4Q27A 3M1HA 2EXHA 1N47A 4YM1A 1BXHA 1GSLA 5GLWA 4FPOB 4BPZA 4DRVA 5IK5A 4YZ3A 4YG6A 4SLIA 5IK7A 2JKBA 2A6YA 4ISQA 1BZWA 3TB0A 3ZVXA 4R9DA 4YM0A 3T2TA 3SISA 3WUCA 3A0NA 3RG0A 3BOPA 3IN9A 2R49A 4ZXKA 4JCKA 5SV8A 3UK9A 5GLVA 1W6PA 2D6OX 1IS3A 3R05A 2WJSA 2R16A 1AX1A 2D3SA 3M3CA 1Y7BA 2A6XA 1R1ZA 2G4IA 4XE9A 1LESA 1DQ2A 3SLIA 4BLJA 1VIWB 2CWMA 2NZ9A 3AP6A 1QU0A 1WCSA 1LHVA 5L73A 4AVVA 2UWAA 1LOGA 3FLPA 3M3EA 3POWA 1ENRA 1G9FA 1AJOA 4R9BA 3MW3A 1DQ6A 3ENRA 1HKDA 1RITA 2GNMA 4BMBA 3M2MA 1O4ZA 1J1TA 5JOYA 2NMOA 3N7LA 3ZXJA 3VV1A 3W58A 2A3YA 5GLZA 1UMZA 1O4YA 3LSEA 3AZXA 3ILRA 1BKZA 1G86A 1YRZA 1ZM1A 1LEDA 5JOZA 1TEIA 1SLBA 3NV3A 1CVNA 2GNBA 4Y1VA 1V6OA 4XTMA 1SBEA 1PZ9A 5DUXA 1WLCA 5DUWA 4YZ1A 1LHOA 5GALA 3V64A 3WDVA 4YM2A 2ARBA 2A70A 4GKXA 1V6KA 3IPVA 1A3KA 2TEPA 2D6MA 2ZGKA 2DU1A 2DTYA 4RA0A 3RMXA 4KBBA 4XZPA 3WDXA 1C57A 1W6QA 2ZBJA 4C1XA 1AZDA 3LSDA 4WVVA 1LOFA 1UZZA 2YZ4A 1MS9A 1SLLA 2JJ6A 4CZSA 1GANA 2ZMLA 3AYEA 1C4RA 5DUUA 3WZ1A 3T1MA 5GZEA 2A71A 3AJZA 1C1LA 1LOCA 3TAYA 2VW2A 4Y20A 5HCBA 2UWBA 2V73A 1LHWA 4XOGA 2JECA 4YGBA 3VKFC 3NV2A 3OBTA 3OY8B 3V0AB 1A78A 2P37A 1G9AA 2D44A 5KXDA 5CB7A 3VKLA 1N3QA 1URXA 3IKWA 3LCPA 4FOYA 4YGEA 4ZKTB 4FVVA 4XHXA 3NWKA 4FPLA 1SLAA
chains in the Genus database with same CATH superfamily
4J6GA 1BEV3 4AFCA 5T5JA 3QOPA 4FCAA 5FZLA 4IV1C 1O5UA 4KWUA 4XIKA 4E2GA 5T52A 3A23A 5C9AB 4CP0A 2XLAA 2AENA 3MFCA 1LODA 1H4GA 5A6QA 4A41A 5FZIA 5FR3A 1RYYA 3H8XA 1W9SA 2LRPA 3HQRA 3ZPOA 2PXJA 1LKNA 1HRV1 2C9KA 1EAH3 2RMU3 4QB6A 1HB4A 4A7KA 4EN8B 4CCOA 4ATFA 1ND3B 4TXWA 2VOXA 4CDQB 2VBPA 2IFWA 3ZPYA 1VB4A 3U37A 1DZTA 1ZZBA 3SCGA 2OW4A 5GLTA 3KB5A 1VMJA 3ZR6A 2R062 1JOBA 2VUCA 2VXRA 1WW6A 1N3OA 2AR6A 3THCA 3WEZA 3LA7A 4A6OA 5CU1A 4MG2A 4M00A 2JD9A 2WNUA 5AVPA 3ACHA 2IVIB 5LRRA 3SH5A 1WW7A 1SLTA 1COV1 1GQPA 2Q8OA 1GKBA 4CU8A 4OUSA 1FATA 4Z2AA 4Q26A 5BNQA 2FDJA 2RR11 5EWSA 5BXXA 1PMJX 3ZFGA 4GAZA 3H7JA 3MFAA 2YC2A 3LAGA 1T6GC 3CDZB 1RUF3 4PIZA 5FLJA 3N7MA 4FPFA 2RS52 4TLFA 3UESA 5C5UA 1IG0A 3I2GA 3I2OA 1LOEA 2ZMNA 4XDOA 4N53A 1OH3A 2ZZQA 2YXSA 3QLQA 2OXBA 3IAPA 1JH5A 2IWGB 3OEAA 1TME1 5L9BA 4LBQD 5CKMA 5FZCA 5BNPA 3NAPA 3SEPA 1BMV2 1ZRIA 4AI3A 2YC0A 4EWAA 3KV5A 1GZWA 5FYVA 3VDDB 1FMD1 1Q56A 3MHZA 3FUOA 4NHXA 1WW5A 2ZX0A 3AC0A 4DEQA 2RDNA 4ZZ5A 5HCAA 1G7YA 4YRDA 4GJZA 3OPZA 3NJYA 5IFPA 1UX6A 1AR92 2RS12 2R0HA 1OXCA 1ZBE3 4IE0A 3ZIWA 4GZ9A 3RZJA 2L9LA 3TN91 1FPN1 3KGZA 1FXZA 3BB6A 4FP2A 3WCRA 4M01A 4N7UA 3ES1A 2CAVA 2DUOA 1O3RA 2ZX1A 3OEBA 3M3OA 5G05L 5A32A 1JZ5A 3HOBA 3BTZA 2FDFA 3HPNA 3FX3A 1AF9A 5C6CA 2GP5A 4NAOA 1V70A 1HRI2 5DQ0A 2XKOA 1FOD1 4NIAA 2MEV3 4NIHA 3GZUC 3WT3A 3P5BA 4GB32 2HEYF 1UWWA 2BNNA 3A4UA 5T3NA 4K1YA 1I5PA 4B29A 2FDHA 3TWIA 1OA2A 1V0AA 4NHMA 3OCPA 1BBT3 2R063 4JGZA 4KMQA 2XQXA 5A70A 1LCLA 2JE9A 1U0AA 1V6LA 1GP4A 4LITA 3AZVA 1HJFA 3ZMOA 5L7OA 4BWOA 3AP5A 4U36A 1UY4A 3BTYA 3POBA 1FYUA 2F6BA 5JSOA 1RB8G 3PIJA 1PGW2 1GZ9A 4WVMA 4XAAA 3S30A 5C3OA 2YC4A 3FHQA 2KA3A 4N43A 4QGLA 5JVVA 4TWTA 3AP9A 2XJSA 2RS53 3O12A 3WHTA 4XF3A 2WYSA 3IIIA 2ZPXA 2DYCA 1TVGA 3MUY1 5DG1A 1RVF3 2CDPA 3WQ1A 5AVAA 1JU3A 3CBNA 5C33A 1GOGA 1MR5A 4NIIA 1F9KA 4B1LA 4NRQA 5I8SA 1NXD1 2WLPA 2GSYA 5FPZA 3RDIA 5D8AA 5A3TA 3H3ZA 3MF9A 4BMEA 1C1FA 4K21A 1A6CA 1E57A 2ZGTA 1QJY1 1R081 4JKKA 2VZ1A 4ASKA 1YNAA 4FXKB 5EHDA 1OKOA 4AAXA 1QNYA 4BQ4A 4LT5A 1AR93 1LGNA 1K5JA 2RS13 1GV9A 4AFBA 3LDBA 3CHXA 4PDWB 1NCQA 2C26A 3U4XA 4DY3A 2KM2A 3JUUA 4E4HA 3KCXA 4DRRA 4LK6A 4JDMA 2XKPA 3OBAA 4QPGB 3IBMA 2IXIA 1CIYA 4XW3A 5F5QA 2VBDA 3CJIA 1IG3A 2IXKA 3FJSA 1GUIA 2VZPA 1ULCA 1PZ7A 4YYOA 1C8M1 2QFEA 3OY8A 3UGGA 3WNMA 3CKHA 5FPLA 5D21A 5FYMA 1HRI3 1ULDA 1XNAA 1VAKA 4FFGA 4OUMA 4WM8C 4KNCA 3VKOA 5CAZA 1H0BA 5LY2A 1JYTA 4FPEA 2ETEA 5FXXA 1LU1A 1MZEA 4QPWA 3VBFB 2V4VA 5FQ0B 4YVWC 5A7QA 3I3MA 5CKQA 2O1QA 1CJDA 4P14A 3VD3A 1DFQA 2EF6A 1LOBA 3GALA 3JU9A 5EXOA 1B09A 2HJIA 5LBFA 3VZOA 1NLSA 1MQTB 5ERLA 1J83A 4HOOA 1WD3A 5FP3A 1WW4A 5FZDA 3HN3A 3I2IA 4FPHA 2W87A 2ZGQA 3AKSA 1QQP1 2D3RA 1TMF2 2VNRA 4FFIA 1CAVA 4IV3B 5FZEA 5BPXA 3ZN6B 2FHRA 4CDXA 2JE8A 5K0UB 4LBQA 1NOVA 2F17A 4UFIA 1Q3EA 3WY6A 3ZKUA 4LO7A 1XNDA 1ASJ1 1AR81 3W59A 2R32A 1J1LA 4CCEA 2YMZA 1XNCA 5A1FA 4M4PA 3MLLA 3JBG1 1NCRC 4X8PA 1CX1A 1T6BX 1XE0A 2C4XA 3DECA 1EP0A 4A42A 5I8TA 1ZRDA 3GNEA 4I01A 5JSPA 1JHJA 5FY7A 1KD7A 1N1SA 4FPCA 5IVYA 3Q8AA 3SQOA 2VTXA 4WM7A 3LQCA 1S0CA 3DCQA 1SBFA 2ZGOA 4QXHA 3WR0A 4COUA 4EWDA 3J26N 3S0MA 1VBC1 1S0DA 2Q0AA 3MEPA 3ZYRA 2MHFA 3NKGA 2ARAA 5HBAA 2V72A 3NJXA 4AI9A 2HYKA 3OD0A 1NA1C 2V5DA 2YGMA 1PMIA 5KXEA 2YB7A 1GLHA 4CXYA 1K5MB 1STMA 1HQWA 4FPYA 5KC6A 2JDZA 5FREA 1OF4A 4NIGA 1E5SA 1DGLA 5BNOC 4LKEA 5BNNC 1GWKA 1NZIA 2ZKNA 1ND2A 3I54A 1JZ3A 1W99A 5JXIA 1A34A 1OPMA 3LDRA 4MADA 1PMHX 1PM7A 4AFMA 1BMV1 2HWC2 1GZCA 3ACGA 2WT0A 4R8HA 1F5FA 1VJ2A 1W6QB 5FYUA 5FPVA 3BUCA 1W0NA 1S0EA 1FV2A 1UYXA 5IT6A 2JG9C 1YIFA 4FPJA 4FP3A 2P34A 5DG2A 5T55A 4K6BA 4LO5B 5ANNA 3KT7A 2XGXA 2GMPA 3PTYA 1F4AA 4HK9A 4AEDB 1AYM1 1S0GA 2BGOA 2D6KA 2Z2SB 3B02A 1JZ6A 4C1WA 4YZ5A 2WUHA 1QOTA 1ZZ8A 4TN7A 3O1RA 4NJ4A 3OUIA 3DXUA 3SH4A 3B69A 5LZ6A 2PHLA 4A7YA 5A7WA 3SXWA 3PVOA 3N4MA 5DDJ2 4C0HA 3WP3A 1D0GA 1ZBA3 1TMF3 5JR2A 3WG4A 4RD7A 1CESA 1D2QA 1PK6B 5CFCA 1RUJ1 1CD3G 4QXCA 5ABJC 5CA6A 5FPAA 1HB3A 2XJPA 5ACA2 4WZCA 5F5IA 4MGIE 3FUQA 2ZABA 3I59A 3VBSA 2UU8A 4JZRA 2Q4SA 1O8PA 5ISLA 4XTPA 3PMEA 5FYTA 1TNRA 2DF7A 2WFF3 3MPPG 1DLCA 1YQ5A 1W04A 4XPVA 3QH7A 3NQHA 1VPHA 2FDKA 1DLLA 3RI9A 4AOCA 1UN1A 4LA3A 2FQPA 3CEWA 4DXSA 5FY4A 3H50A 3BCWA 3K46A 3PIGA 4Q4W1 4YARA 4Q4Y3 5GJ6A 5FV3A 3D5OA 1QF3A 5JDBA 4YM3A 1PO22 4ES8A 1F31A 2PFWA 4BZ4A 3KLSA 4D6QA 3O1PA 3E6BA 3O0WA 4G3YC 2JIJA 3EMRA 3I3DA 5F8PA 2WRAA 1AR72 3H9AA 2FCTA 1W6OA 2VAUA 2WNUB 3HN1A 4K40A 4RR3A 1XQNA 1SEFA 1RHI1 3POGA 2VUJA 3T4HB 4B4QA 2CYFA 3UL2A 1G9BA 4K1ZA 1KFXL 1OHFA 2WSVA 1B35A 2WWJA 5I8YA 3VZLA 4YWAA 3ZXKA 2W52A 1H1AA 3KQRA 3R0RA 3ZFGB 4QPIC 4NO4A 2X53S 3NNFA 4QKNA 3C8XA 4XF9A 4Y5Z0 4A2UA 4CDUC 1IS6A 1V9U1 3OYWB 3FE5A 3VDCA 4W8JA 1IGOA 4MYEA 2P4EA 2E7TA 2Z42A 4AHWA 4B3NA 3VZMA 2XMLA 5JLVA 5LA0A 2ZHKA 2QQUA 2XJRA 5H9SA 5BNPB 3RMYA 3AMMA 3HVDA 2QQPA 1LOAA 1UU5A 5FCCA 5JOWA 1GZWB 1VBB3 3TBDA 4CDQA 4MGQA 2R6QA 2EXIA 4UW4A 1QJEA 3KT1A 3WNKA 3ZYBA 2H0BA 4QX7A 3VBHA 2RS33 4HFSA 4LIVA 3S6PA 3GHNA 3NSTA 4XMIA 3PLQA 2PHWA 4QU2A 4AEKA 2I2SA 5FPXA 1C28A 1RUI2 2DCKA 1JYWA 2ES3A 1ZX5A 3DUIA 3N7KA 1QXJA 2XR4A 1XC6A 4CVUA 4QDRA 1VBD3 2LW8A 5KBFA 5ACA3 1GBGA 1UCXA 3IIAA 3M3QA 4PI0A 4Q0SA 2GC1A 5LW9A 3OBRA 1FNYA 3E5UA 3DYPA 4BE3A 5I93A 2EAKA 5A32B 3UETA 4Q27A 1EV11 2EXHA 4M0HA 4BYYA 2Q1MA 3PUSA 1D4M1 1WWYA 5GLWA 2YGLA 1JZ7A 1UOJA 3KSCA 4YVSA 4JVAA 3CJXA 4H7LA 3GF6A 4QB2A 4ZU4A 5FY1A 4MGZE 4SLIA 4CU6A 5FPUA 4MOAA 3Q8EA 4ISQA 3C7HA 1MPXA 2R49A 4AHYA 3ZYGA 4MSVA 1PVC1 3NW4A 1OBNA 1HV0A 4L97A 1XJAA 4GQ7A 2X5IA 3VDDA 4O7XA 2VNOA 4JGZB 1IS3A 5EP9A 2ORXA 3C7GA 5FYBA 1BK1A 2R16A 1YQ8A 1AR73 2ZX3A 2G4IA 2WBKA 4CYDA 3NJZA 2HWD1 3WF2A 1DQ2A 4ASLA 2IXJA 5FZ7A 2VTXJ 1QU0A 1WCSA 1LHVA 3POWA 3WW3A 3M3EA 4R9BA 3U14A 5FZ8A 1HXS1 3MW3A 1DQ6A 4XUQA 4E2SA 4N43B 3HJRA 3B9IA 1J1TA 4R52A 5JOYA 1YFYA 3N7LA 1NLQA 2WO3A 4CP1A 3VV1A 4N9IA 1QJU1 4P9IA 2PLV1 4AEMA 4DUVA 3OBZA 1UMZA 4XFAA 2YYOA 1RUC3 2XBO3 3ILRA 1BKZA 2W47A 2VZOA 5JOZA 5IVEA 3NV3A 5A7PA 3UV9A 5F2SA 2YFZA 4CDWA 5D8AB 4YZ1A 3K4AA 5F5CA 3V64A 2JG8C 5FYYA 2ARBA 3NNJA 4QQ2A 3WQBA 3JD71 5FBJA 4CPBA 2D6MA 1W8WA 5EFUA 2QUOA 3LEMA 2DU1A 2YDEA 4Q4X2 4RSUA 3P3PA 2DTYA 4CXWA 4KBBA 1C57A 4IERA 3LSDA 2PAKA 1R092 5DAPA 1MS9A 3AB0A 1NCQB 2JJ6A 3W5NA 1GANA 2VZQA 5C8CA 4LNVA 2Y64A 1XE7A 2NQYA 4Q4V1 1LOCA 4CP9A 2A1XA 4Y20A 4COWA 4YVWB 3CJIB 2YU1A 4I02A 5FJKA 3H1MA 3RZKA 3OY8B 1AL22 3F2ZA 1XU1A 5TSWA 1W9YA 1G9AA 5FDBA 3DEMA 1LR5A 2D44A 3EXUA 4ES9A 4OZOA 2WFPA 1US2A 4YGEA 4QD2A 4COZA 4ZU7A 3AVSA 2ILMA 2RV9A 2VMEA 2BBAA 3DL3A 2G9ZA 4XABA 4XCAA 1AYN1 4HANA 5F6KA 4AQSA 2DURA 4OFGA 2VZSA 1OLRA 1HLCA 1ZRFA 1AXZA 4HVOA 2XVLA 2W95A 2PHDA 5AC92 3IB3A 3O0VA 1RUOA 2C1FA 2CY6A 3WUDA 3IT8A 5FOJB 4ORFA 1WUVA 4L0PA 1QJFA 2G9GA 2WQ8A 1ENXA 3PUHA 1IKQA 1L7LA 3MI8A 5KHKA 5J37A 4GJYA 3R6SA 3IZOA 1D2SA 1IPSA 4PDWA 2E63A 4XMAA 4LBQB 1YXWA 2MNGA 4Y4RA 1HRV3 2E26A 4UI9L 1D4VB 4JRAA 4RFT0 1UOFA 4AW7A 3WP6A 4GALA 4HMZA 5C4WA 3SKVA 4BQ1A 1F5JA 1TQ5A 3GJAA 1DG6A 3UKNA 4PJYA 2XONA 4AHZA 2HWC1 5IVVA 4AF9A 1MEC2 3C7EA 4NR1A 4Y4YA 1H2LA 2HEWF 1RUD2 2VM9A 5CVRA 5DN2A 3ZFFA 5FO9B 5LY1A 2PN5A 4BQWA 1SACA 3ZXDA 2VXJA 4ZY9A 1OSGA 1I5ZA 2KR2A 2WNEA 1Y9QA 3WXPA 1EPZA 3G6JB 1COV3 4OHZA 2DVBA 2P17A 1X82A 3INAA 1RMU2 1S2EA 3VBFA 5FQ0A 5FRAA 2RR13 2WZR2 3EBRA 4XF4A 4QM8A 5FZFA 2I45A 5JUVA 4ASMB 1YQ2A 4KWJA 3LA3A 4MVTA 4XHBA 4HBNA 4GIQA 1J3RA 1L7QA 4LEJA 3DPRC 4Q29A 3AYCA 4O61A 5F7UA 2DCTA 1SPPB 2JG9B 1Q8OA 1YC61 3ZN6A 4FTEA 1SLCA 1X8EA 4BOWA 4UF0A 1TME3 1SMVA 2VZVA 3ETPA 4LBMA 1ND2B 5G04L 5KHHA 5A80A 3USUA 4UBHA 3OUJA 5F32A 3HNMA 3VGIA 4AFDA 1AL23 4Z2WA 1JYIA 4S2DA 2OS2A 1FMD3 2YV8A 5C5TA 4XUPA 2VQ0A 3BPZA 2GNDA 4EN9B 3VKMA 3GM8A 4EQVA 3USSA 3G7DA 2LROA 1JYCA 1SDWA 1Q8PA 4KG8A 4Q0PA 2D5FA 3R4DB 4CEYA 1LJ7A 2QQIA 3BODA 1CAWB 4RS5A 3UJQA 4Q0QA 5FO7B 1Q8QA 3TN93 2WZ8A 3LA2A 3MO4A 4XAEA 4YW1A 4MGYE 3U0ZA 4P02B 4N90A 1OUXA 2YFUA 4XFFA 1WD4A 2Q8DA 4AR2A 3KS7A 5C8WA 4ARYA 4WZFA 4M3CF 1IQAA 1LAJA 5CFCB 2OZ6A 1J3QA 2OUHA 4PBPA 3QCWA 2OZJA 4LHSA 4B4RA 3VBSB 3I59B 4L2NA 1RUG1 4LBJA 4YG3A 2CU5A 3RNSA 3RYRA 1RUF2 3ZMNA 1Y43B 4OQ9A 4GH4A 5FLHA 2D3PA 1RUD3 1OLMA 3WNNA 4I0BA 4O65A 1ZNPA 2GALA 3H3UA 2HWE2 4U2AA 3H0OA 2A6WA 1UU4A 5FMDA 3RZZA 3T1LA 1LEMA 3T4VA 4E4SA 3VHPA 2ZGLA 1GP6A 5E89A 3WF0A 4EN7B 3E6DA 5F9TA 2BOJA 1UU6A 1RUE2 1QKQA 1VBA1 4HETA 2WZR3 4AI8A 2WLQA 2VZUA 2CGNA 1XSQA 3Q8CA 4IV1A 1UIJA 2VZ3A 5C3QA 1W6OB 4AVAA 3C3VA 1QDOA 3NMBA 2DVFA 3GZEA 2RM22 4RR3B 4UBGA 3W9AA 5CFDC 2DUPA 3J7HA 3B00A 1PO13 2NN8A 5A3PA 3QBQA 1A8DA 1DGRA 2XJUA 3MIHA 4Q8LA 3F95A 2P3KA 2HBTA 1X9TA 2FDIA 4IEOA 2YBKA 1QH7A 4OUEA 2FDGA 1HB2A 2LALA 5E8AA 4HKLA 2R0FA 2OA2A 4YLZA 5JAXA 3EJKA 4D7SA 2QKDA 3U78A 3AFKA 4Y26A 2MEV2 4JAAA 2Y26A 5T5OA 2QCSB 4AG4A 4UW3A 2VVEA 1GNYA 5DZEA 3THDA 4EN6B 3WW4A 2EIGA 3IMNA 4B8EA 2YPDA 4YZ4A 5JSRA 3EB7A 3WNPA 3V0AA 1FI2A 1XYPA 2PHXA 1H1MA 3VBHB 1BBT2 4HL0A 4I0WB 5I0TA 3DGTA 1AHSA 1ZRRA 1C8M3 3DYOA 2D6LX 3AP4A 1RC6A 4J25A 1WA4A 2KD7A 4BQYA 5A1AA 4CEWC 3T0AA 4CA9A 4IGQA 3BGAA 4IETA 1W0OA 3KD4A 5JPNB 1EY2A 1ULFA 2BQPA 3FWEA 3TEYA 5C3SA 3AK0A 2HWB1 3ASIA 3PVNA 1MZFA 3ZOIA 4OHVA 2DFCA 5H9RA 2CL2A 3OYWA 4HKWA 3MGUA 1C5IA 3A22A 4QB1A 5HPOA 3KWVA 5J1XA 4YVSB 4JGYC 4Y22A 4E27A 1LGCA 2W5FA 1ZRCA 1RVF2 3SITA 4CRQA 2JENA 4AE2A 5IAXA 2HWF1 2HWE3 2ZGRA 4LO8A 4XACA 4LKFA 2PHFA 3TRSB 1DQ5A 4Y24A 1TG7A 3VD5A 3ZSJA 4BIFA 5L36A 4XFIA 1CPNA 3DXTA 4I30A 1QQP3 1VBE2 3FBYA 2X5IB 5JIAA 4AI0A 1RUE3 1ZZ6A 3VD7A 2TUNA 4JC1A 4OI2A 1G8WA 1N1YA 2CWSA 2J1EA 2VTFA 2JICA 3T0DA 2DU0A 2RM23 5EZWA 1GNZA 2ZHMA 1CAUA 3SH3A 3RQ0A 1OVPA 1MS1A 3JBG3 4MGTA 1QJX1 1UL9A 2BWAA 1O5LA 2WO1A 1G6NA 4NHLA 3DV8A 1R1A1 2BNOA 1HJGA 3S5QA 2W46A 5HCFA 4PT6A 4EJRA 3DN7A 1DYPA 1HV1A 2J22A 2VUDA 3RYPA 1OC1A 4C90A 3KGLA 1S0FA 2ZACA 3ZSKA 4CUCA 2JDAA 4GMP0 2OT7A 1O3QA 2GMMA 4FT8A 4XCBA 2R072 2BV4A 1XE8A 2Z4FA 2GAUA 2I07B 4CDWB 3GGLA 3OD4A 5A33A 1KGYA 4EYUA 2BZDA 5JZGC 1W9FA 4R4ZA 5GZCA 1X36A 1XPWA 4Q8KA 2UY8A 2Z5WA 1UNBA 2VU9A 2VJXA 3J7NA 4XURA 4TLGA 1DQ1A 3W20A 5AFBA 5JCTA 4NMIA 4PHZA 2XHNA 2A3XA 4A44A 4K3UA 1QWRA 4UW6A 5DAQA 2OYZA 4E9KA 2VQAA 4R9AA 2QZ2A 3JB4C 2XDVA 3N36A 4B7KA 3GDBA 5C8CB 1DYOA 1N1VA 4MX3A 3AZZA 1OQ1A 2D5HA 4Y20B 1CPMA 3VBUC 4QHZA 3VZKA 4CP9B 4EV0A 4YW5A 1W3VA 3TEZA 1KS5A 2ENRA 2ZKLA 4Q2FA 2GU9A 1C3HA 2JDKA 4TSVA 4XIOA 2QZ3A 5F3GA 3JQWA 3PVEA 2IXCA 4IE7A 3D0JA 4FFHA 3OGVA 2BBVA 3BVCA 4D94A 3I4IA 1NLRA 2QQWA 3VBOC 2E53A 5A7OA 3WVJA 2W0XA 3PNAA 4PQ9A 1OF3A 1POQA 1SFPA 2VCBA 1OLQA 2X10A 1IZ3A 1RUH1 1VBE3 2WS91 4MXVA 5IATA 3DKWA 5CG8A 3AXEA 2J42A 1AJKA 2OUJA 2OVUA 2QDNA 3RWNA 2Y6JA 4HVRA 4NROA 2JDUA 3LIHA 1QEXA 3AXDA 5FUNA 3POIA 5F37A 2A6VA 2ZEXA 5KWRA 1NUKA 2R041 3I3QA 3NRUA 2P6HA 4FQZA 5EQUA 4D7TA 4WM8A 1PZ8A 5K9YA 3POEA 2IZWA 4GMP1 4DXRA 4XEZA 2FMDA 2CHHA 2HLEA 3N35A 2DVAA 4AVSA 1AX0A 1QDCA 3PVBB 1UKGA 1BEV1 1RGSA 4M4RA 3O1VA 1S4CA 4YVWA 5C4WB 3WDYA 3LEKA 4HSJA 4CXXA 1OT5A 2ZEWA 3O5SA 4QMAA 5HCHA 4FOQA 4RQPC 1OOPC 1V6MA 2DCJA 3ZFFB 1XRUA 3DPRB 4OCTA 4IEXA 1MS4A 1YQ6A 2HKXA 4QQPA 4UAPA 5DAXA 5A3NA 2R073 4RHV1 1CZSA 3ECQA 1EAH1 2RMU1 2R1BA 3C2UA 1GWMA 2VY0A 1BVVA 1XU2A 2VMFA 2WSUA 3LEIA 4SBVA 3MIBA 3V56A 2YU2A 1BK0A 3J7MA 3MIGA 4CUBA 4LE4A 1JS9A 4E8DA 1UY3A 2X8KA 4RFRB 2J1TA 3GCWA 3ZYFA 2VCCA 4H55A 1HX6A 1V9U3 4BB3A 3S7EA 1MZ6A 3Q9OA 1Y3TA 1NCRA 1H30A 1S0BA 2C5DA 2OPKA 4OZXA 1ZVFA 4X8NA 3ZFEC 4S2GA 3WF4A 5IHRA 2BNMA 3HMYA 1ZBA2 5LBEA 1W03A 1GQHA 1SZBA 1WLDA 3U07A 3A0KA 3WSOA 4NE9A 3Q8BA 4UF0B 3WG3A 1C5HA 3I49A 2GDFA 3USUB 5C71A 3LZZA 4ISRA 5IW0A 3NNLA 1OFSA 1H9PA 2BERA 3VL8A 3BU7A 2VW1A 5J7MA 1VB2A 4ZPIA 2WFF2 3ZYJB 2E32A 2DFBA 1EUTA 3LEGA 3M3IA 1WA6X 1YIPA 2D98A 1Y4WA 5I0DA 1UXZA 3CZUA 1WBLA 2BP6A 5F39A 3TNPB 3OB8A 4CEYB 2WA3A 4RS5B 1VRH2 2QVSB 4Q4Y2 5HXVA 1Q8SA 5GZGA 5BNOA 5BNNA 4NUBA 1GNHA 4QX3A 3M1HA 4AL9A 4UT5A 1O4TA 3P6BA 2GH2A 4BPZA 1JUHA 2BJSA 1Z7S1 2GC3A 3BALA 4DRVA 4FTBA 5IK5A 4YZ3A 4AXOA 4CUGA 2B9UA 5J09A 1FT9A 3MIDA 5JMOA 2JKBA 4S2HA 4XDPA 5IK7A 3ZVXA 3J8F1 3T2TA 3WUCA 1D4M3 1ZBE1 3W21A 3BOPA 3IN9A 1LRHA 1SPPA 1W2OA 2IXHA 2O0OA 1H1IA 2JG9A 3UK9A 2IFRA 3BN6A 1CX4A 2JDHA 5GLVA 1OFNA 2BPA2 1WCUA 3HQUA 4Q5OA 2OQ7A 1QXPA 1DZRA 3BPSA 1W39A 1PVC3 2VZTA 3EHKA 4A7ZA 4BLJA 4GH4B 5FYSA 4DNYA 2WNVC 1DGWA 2NZ9A 3AL5A 3AP6A 5CYYA 2R30A 4IW3A 1PNFA 4MLOA 5E6HA 1OPOA 5L73A 4AVVA 1G9FA 2WO2A 1AJOA 1W2UA 3LB9A 3ENRA 1HKDA 1RITA 2GNMA 3A21A 3GBGA 3M2MA 4LHKA 5DMYA 5ABJA 2VG9A 1WMXA 3VN4A 3RZHA 4QHOA 3ZXJA 1CAWA 1EYBA 4HT1T 3W58A 1VBB2 2A3YA 4GWIA 4E4DX 1UZ0A 4KBZA 4WM7C 4IV1B 1XNTA 4BQ2A 2R061 5LASA 1OA4A 2V09A 4BXFA 2B45X 1U5YA 2RS32 1POV3 2VOKA 1G86A 1ZM1A 1LEDA 3BOWA 1CVNA 1VRBA 4Y1VA 4MO3M 2WZPP 2PLV3 2RJKA 3NNGA 1W8FA 4LULA 5DUXA 1HN0A 3WDVA 4I3GA 5FP9A 2I74A 4C91A 1V6KA 2JDPA 2TEPA 3I2FA 1VBD2 1RJ8A 1X9PA 3GXUA 1U5ZA 2XVKA 3NVCA 4A6SA 4CU9A 4MHRA 5FMCA 4XUNA 3WDXA 2ZBJA 4CCMA 5KC5A 2RS51 4LOSA 4WVVA 4YW7A 1NE6A 1UZZA 2YZ4A 4MXWA 4AFAA 5BUVA 5JWPA 1SLLA 2ZMLA 3T09A 1OI6A 3I97A 1UYZA 5DUUA 1W28A 2CDOA 1BVP1 4ET7A 1K12A 3HT1A 4BDVB 5IFTA 5K8SA 4J1WA 4UOJA 3AMQA 1LHWA 1VMHA 1VRH3 2JECA 4YGBA 4G4FA 4G9SB 4KL1A 5JI7A 2XH6A 3OBTA 3VKFC 4FBFA 2DBNA 5A6XA 3V0AB 1A78A 4CDUA 2P37A 1AR62 2ZOEB 3B94A 1N3QA 5CZKA 2VE1A 3ZKYA 4ZKTB 4FOYA 3RZLA 2JWPA 4XHXA 3KHBA 1AR91 1SLAA 2RS11 4P9XA 3WINE 5L19A 1JI6A 4I2OA 1ACCA 4UXAA 3RVHA 4OMDA 5FXZA 4YFWA 4A3XA 4FI9A 1GFF2 3WW1A 1REEA 5E1RA 3VLBB 2JB4A 1X7NA 2VH9A 4FTSA 1AYN3 4PLNA 3EO6A 2ZGPA 1CZTA 4CCKA 1PGL2 2AUYA 2AGSA 3MF6A 1JXNA 4NN0A 2DTWA 4QX0A 5JI9A 1W9WA 2EIEA 4Y22B 1HRI1 2UYAA 2VOWA 4R9CA 4GKYA 1JOJA 4QX1A 4E8CA 1RUC2 2A5ZA 1PIV2 2XBO2 1VAVA 4Y1XA 4YFZA 1UOGA 2JX9A 4GB31 1W8TA 2E7AA 2RE9A 1F4HA 1P8JA 4PIYA 1LHNA 3VHNA 2FCVA 1DQ4A 5DZGA 4LUKA 3HQXA 4NVPA 1DHKB 2PAEA 5BYNA 4A4AA 2NMNA 1H8TC 3O1SA 4XILA 3JCIA 3N7JA 3PUIA 3AKTA 1W8NA 3UGHA 5IYYA 1CAUB 4LPLA 4NPLA 4QM9A 4DIQA 3DKQA 2BVBA 5DPNA 3O7OA 4LMFA 2W68A 1KRIA 4JTOA 4LKDA 1PGW1 4AEJA 2Y34A 1CR7A 3KV9A 5FP4A 2VGDA 4YPJA 2DVDA 2DDUA 3SCHA 3T3YA 2JEMA 3MLJA 1S1AA 4AWDA 5JXJA 3P3NA 1PNGA 2EIDA 5I0SA 4JDOA 5FKCA 1KDMA 2HYXA 3DYMA 3K4DA 2PHRA 4AGGA 4META 4ITCA 4QX2A 1G9CA 1E5HA 3ILFA 5KXCA 1JU4A 2ZS6B 5C9AC 2WO7A 2W08A 5FUIA 2H6CA 5A7NA 4XQ4A 4XJUA 5EYXA 5F6LB 5A33B 3ZYPA 3CO2A 2VMCA 1JOPA 1V6JA 1QMJA 2VMIA 4F83A 1ALYA 1AR63 1F35A 3H8OA 2WAOA 4KWKA 1ZZ9A 1ND3C 2B42B 1UIKA 4XJ8A 3PUQA 5D2AA 4QXKA 3KCCA 2CV6A 1UPSA 2D40A 3FBMA 4FPGA 3OG2A 3AVRA 4OHYA 2AREA 5LCWL 3VBOB 4URTA 2X05A 3RZMA 2ADDA 1UPIA 2JB8A 2W1WA 1UY1A 5L9VA 4AI1A 4IEQA 5LWBA 1JODA 1HRV2 2OIIA 2NPIA 3LPFA 5J36A 2JG8A 4ZU5A 4QQLA 3GBFA 2VC9A 2VQTA 3WNXA 4Y3OA 3UYJA 2XWJB 4QX5A 1RIRA 5T5PA 4QHBA 3RGBA 1PIV3 3NNMA 5DUVA 4HSLA 1MS0A 4HXCA 2Y60A 3LDKA 3Q8FA 3ACLA 3GYDA 4OI4A 5IVJA 1CWPA 1M4WA 1O91A 3FFQA 1YFWA 5FP8A 2WWUA 5HXMA 1COV2 5GZFA 1H4HA 3POJA 2GMEA 4LO4B 1WMDA 2EAAA 3KZ4C 1NQJA 1TZOA 2WN3A 2RR12 3LFIA 5CG9A 3UJOA 4BQ3A 5FFOC 4GWMA 1RUG3 1LB2A 1EPWA 4BCUA 4IEYA 2BDRA 4FOVA 4WM8B 5LB6A 1ULGA 1UX7A 3LE0A 1GMMA 1S2BA 5IWFA 3SHRA 1IPKA 3J4UH 4PF1A 1TMF1 3AP7A 4XETA 5EJZB 4AVTA 1OURA 2D6PA 2J1SA 5FUPA 3RZGA 4I3PA 3MW2A 3MW4A 1XSRA 5DABA 2GNTA 5FYIA 3AMHA 1TME2 3ZSEA 5F5AA 5C3PA 4UFHA 4NHYA 3AL6A 1YYNA 3NL1A 1QOSA 5ANQA 3H3LA 4IUGA 1VBA3 1WCDJ 4D6RA 1FMD2 2J1UA 5FXWA 1LGBA 1KJLA 3FL7A 4N8MA 3NO8A 5LEKA 3UGFA 5J98B 4ONUA 3QH6A 4CCDA 5FWEA 1IOAA 5KXBA 1N3PA 3QACA 3WP4A 1GP5A 3OPTA 4Y5SA 3T30A 1WMEA 2WC2A 3T2PA 3WNLA 4FXGB 2D6NA 4Q1RA 2RG4A 3APBA 2VVFA 1H6YA 1RL3A 2ZHNA 3TN92 3UKTA 5FZGA 3EYPA 1FPN2 1OD5A 1US3A 1RJ7A 2P3IA 4Z8BA 2NYYA 2XXZA 1MZ5A 1NCRB 3J9SA 2ERFA 4QKFA 3QD6A 2Y6LA 3LIGA 1NY72 1SCSA 4NOTA 3H1YA 2AEYA 4ZS2A 5F3EA 5FK7A 5GM0A 1JZ2A 3RS6A 1REDA 1MVQA 1FOD2 1PX3A 1SFYA 4M3CB 4XXPA 2A7AA 4F7ZA 1TNFA 1V00A 1JYXA 1SCRA 4XDQA 1WCQA 2PMWB 4WV8A 4Q1PA 3M4FA 1QGLA 3IDBB 4W65A 2XUMA 1OH4A 2VW0A 3GZAA 3X29B 5DAVA 4QKBA 3AKRA 1FNZA 1NA1B 2ZMKA 4UWDA 1E5RA 2ZAAA 3DPRA 3H8UA 1CIWA 5HV0A 4BLIA 1UO9A 2Q1FA 2QQMA 4IGPA 3ZSMA 2EXJA 4PF5A 5BNOB 5BNNB 2B46X 1VBB1 2VMGA 4HVQA 4B7EA 3I2DA 4L92A 1DGRN 3HEIA 2J7MA 4TTGA 1CAXA 5FAXA 5KHJA 4AK3A 4RGAA 1D7PM 4EWEA 1I3HA 2HWB3 2VOTA 1W6MA 4KGQA 2Q8EA 4F3JA 2WA4A 5T5LA 1O6UA 5DDJ1 1QY4A 4AYUA 2WIIB 3ELNA 3WHUA 1W90A 4MH0E 2X09A 2B8MA 1PO12 4CE8A 3MBWA 3MICA 1WCKA 2HWF3 4X6RB 4XJAA 1BQPA 4XUOA 5ACA1 1DIWA 2XPJA 1SBDA 3O1MA 3CLPA 2SBAA 3L9JT 1ZYBA 2BGPA 2V5YA 3KT4A 3A7QA 4XBQA 2ZEZA 1JYNA 4NPRA 4KQ7A 4OHXA 4QPGC 5JMCA 1UQXA 4K9SA 1AUYA 3KF5A 1FV3A 2Y0OA 1QJY2 1R082 1VP6A 3IM0A 2ADEA 1NZCA 3RSJA 1CJPA 3WDWA 3S57A 4DPNA 5JPMB 4BQ5A 4HLTA 4LOTA 2QJVA 3VBRC 5EPAA 2WQ4A 3ES4A 4QGNA 4AHXA 5ABJB 4YW3A 1QJX3 2AZ5A 4LBKA 3ZN5A 4QU1A 3AMPA 1PO21 1W2NA 2W39A 1FPN3 4QXBA 5SV5A 2EA7A 1Q5OA 1OKQA 5KHGA 3PL0A 3ZXAC 1KQRA 4Z92B 2WDBA 1N1TA 3VBFC 4OLLA 2IVJA 3E1F1 1AR71 3BKZA 3WDTA 3M8LA 2ARCA 3MZHA 1C8M2 1LHUA 3V0BA 1C8NA 1MQTC 4JRLA 4Z82A 5T54A 1FOD3 1RUNA 4K20A 4MGSA 1VR3A 2P5BA 3K51A 4FQ4A 4F8AA 5FZ6A 4I0AA 4IV3C 3WOGA 2CGPA 5K0UC 4GWJA 2EIBA 4BIOA 5JOXA 1YJLA 1LECA 3E5QA 5L9RA 1Z0HA 2VUAA 4MXWB 2XLGA 1GYKA 3KM5A 1JBCA 4FSJA 1JZ4A 5CADA 2JDMA 3B01A 4PCRA 3U10A 1BJQA 3WG2A 5CFDA 2P2KA 2OX0A 1U5XA 2ARXA 4JKMA 1YEWA 4PI2A 3FMGA 3CQOA 5D1IA 2YY1A 1QQP2 4XQWA 4LBLA 4QPIB 4XF0A 2P3YA 4CDUB 4L8QA 2Y33A 1LULA 3HD8B 4EZHA 1UD1A 3ON7A 3PJQA 2Y6KA 4KG0A 2YHJA 4V2WA 3ZSLA 4W50A 5LBBA 4Y5TA 1UXXX 1ONAA 3GBWA 1ASJ2 1AR82 1CQ9A 1YQCA 3JB8A 3K3NA 3ACIA 3LWCA 2LTNA 2DCYA 1IS5A 1RUI1 3JBG2 3B5LB 4LUMA 1XYNA 4HG6B 3GJBA 4I09A 1K5MC 2OKXA 2F4LA 1PX4A 2XOMA 2QQVA 4ZHNA 1UZVA 2WS93 2W1QA 3KQ4B 2H0VA 4GA9A 1F15A 1GZTA 4XFHA 3S5AA 1VBC2 2B7YA 3POFA 1QJY3 1R083 5FZMA 4LBNA 4CEWA 5FZBA 3K75B 5IUQA 2ZAHA 5A3LA 1VLNA 2EICA 3DF0A 4COVA 1ENQA 2B4KA 2PHUA 3VD4A 1LOFC 2XB6C 4GMP3 5FMOS 2Z79A 4YZ2A 3NV4A 5I91A 4GXLA 1ZA7A 2WT1A 4H2AA 4UFJA 2FCUA 3JZVA 1W2TA 4K8FA 2WQZC 4LLFA 2WZEA 4AEDC 5C7GA 1H9WA 2AC1A 3CU7A 5DXDA 3RWKX 4BA6A 4JGYA 1KEXA 4DO0A 4AI2A 3JXSA 1QIQA 1HIXA 3IDEA 4RHV3 2Q1ZB 5FZ3A 5I0RA 5FZOA 2XG3A 2Q5TA 4DB5A 1PK6C 4W6WA 3ST7A 4TYSA 1L3JA 4QKDA 3N9PA 1W3XA 2Y6FA 4LBOA 4LHNA 5LK5A 1AYM2 4DEVA 2GC2A 5AFEA 1MACA 2PAMA 4CCJA 4V2VA 3OSDA 3K4ZA 5A6YA 2W3JA 3D8CA 4YW4A 1JUIA 2GN3A 2ZGSA 3ETQA 4MUVA 1WKYA 3UT0A 3TNQA 2E51A 3TEWA 2D7FA 4FPKA 2PQSA 1VALA 4QAWA 4QT6A 1OMIA 3LF7A 3E6CC 1RUJ2 1QOOA 2JD4A 4FFFA 5APAA 2R1DA 4LLOA 1BYHA 1AXYA 1H2KA 1IHMA 4Q4X1 4BH9A 2BYVE 3AZYA 2EVXA 3HNYM 1MS8A 2MPFA 1UOBA 3IDCB 1ASJ3 1AR83 2A3WA 2K2SA 4HN1A 3D3AA 3OUHA 4OHWA 1R091 1VE0A 3B3QE 3VDBA 1RINA 3VZJA 5A6ZA 2QE3A 5FTTC 2XL9A 1S55A 2E31A 2WNUC 1XNKA 5FY8A 1W06A 5JZGA 1AXKA 4R4XA 1N47A 2JG8B 2FMYA 1GSLA 4FPOB 2RJ2A 4Q4W2 3WD5A 3HIFA 2Y38A 1AL21 5T50A 4YG6A 3VHOA 3ZFGC 1WMFA 2A6YA 1BZWA 1H2NA 3SISA 2WAAA 1Y9GA 3A0NA 5JXGA 1VBC3 1Z7S3 4ZXKA 3T08A 3ZR5A 3FN9A 5FP7A 1OA3A 1HQNA 4N53C 1NQDA 1W6PA 3J8F3 2HBUA 2YPJA 2D6OX 4LIUA 3KHCA 2WJSA 3MPBA 1RHI2 2ORZA 3VBUA 2D3SA 3T0BA 1U12A 1UYYA 1JYVA 1R1ZA 1H8VA 5BNPC 3NAPC 2UY9A 3MV01 3OOXA 4NHKA 4NAMA 4XFCA 4MV2A 5FMOL 5AC91 1OLME 3PUAA 2ET1A 1SG3A 1V9U2 4M0NA 1OVSA 1NY71 1BCXA 1ULOA 4D6SA 4BMBA 3M70A 2VECA 1O4ZA 3VBOA 4P9JA 4CP2A 3ALQA 2NMOA 1YUDA 3K48A 3ZYHA 1NAEA 4Z07A 2PYTA 4Q0VA 4QWNA 2ZXQA 2VULA 2WR9A 1O4YA 3LSEA 2VMHA 3AZXA 3D0SA 2VPVA 1M06G 4LE3A 1YRZA 1TEIA 1SLBA 4DMIA 1AYM3 2GNBA 3KVAA 1MEC1 1V6OA 3GHMA 1SBEA 1RUD1 1VMFA 3LKJA 4S2FA 4B4PA 5C70A 3ACFA 4OI0A 2A70A 2PQQA 4GKXA 2ZEYA 3H42B 3IPVA 4AQTA 1A3KA 3O14A 2OPWA 2JIGA 2ET7A 2ZGKA 2VL4A 3PURA 3BI3A 4N9HA 2ZX4A 4RA0A 3RMXA 2WL1A 2XL7A 3N9QA 4C1XA 1RMU1 1RUJ3 2WZR1 2AACA 5M0TA 2BFUS 4AQ2A 1W8ZA 4RQPA 1OOPA 3HWJA 4IGOA 1DDLA 4BJ0A 1PGSA 4JGZC 4YW6A 1C1LA 1EV12 3GZTB 5L7OC 3O1UA 5EJ3A 5HCBA 5A3OA 3THTA 4NWVA 2UWBA 2V73A 1D4M2 1ODNA 2ATFA 2WNOA 1PO11 1UYPA 4MHUA 2XJQA 4YNIA 2JKXA 3B93A 1YWKA 3U1XA 3U11A 4P5YA 1ODMA 4H7MA 4COYA 5K7PA 1URXA 1XXNA 4Q4W3 2E9QA 3M7AA 3LCPA 1NT0A 2TNFA 4EE2A 2K0GA 4QPYA 3HBZA 5B4NA 4N43C 1PVC2 4OMCA 3RJRA 3VZNA 5LEJA 1PM4A 3RFRA 2ZZJA 3K77A 1MS5A 2ZX2A 3K3OA 4YG0A 5DAWA 2FD8A 3ZFEA 1KITA 5EYYA 1W8UA 3OTFA 2Y6GA 3GCXA 2HWD2 5IK4A 1W6NB 1S0IA 2BU9A 4L99A 3SCFA 1RHI3 4WVWA 3ZXGA 2VMDA 1JN2P 4XFBA 2EXKA 1J59A 1WBFA 1HXS2 4LA2A 2DBIA 3HR9A 2FZ1A 5D8AC 1CAXB 2P3JA 4BXSV 1ZZCA 4C0BA 4B1MA 3VUOA 1HQLA 1W6MB 1HN1A 2XLFA 1DZQA 3N9LA 4HONA 1D0HA 4LK7A 1CZVA 4KI5M 3FLTA 1QJU2 5F3CA 2BW8A 2PLV2 5FZAA 2BTVC 3T2QA 2Z69A 4DZGA 5H9PA 3VBRB 2LUWA 5A3MA 3V65A 3AKQA 3NV1A 2N7GA 4M3CA 4JHTA 3SNMA 1K45A 1NCQC 4GB33 3AZWA 5FLIA 4FAHA 4Y1UA 2IC1A 5FO8B 2G1MA 2HH9A 2W1SA 1RUF1 5JR7B 3KV6A 3UKVA 2D43A 1CONA 2QQNA 3CJIC 3JD72 4MGKE 5BV6A 2YBSA 3HT2A 3MIEA 3WDUA 1NA1A 1FX5A 2VOVA 2F4PA 2HWE1 4LJHA 3AYDA 3OGGA 1DGWX 3SKJE 4OQ8A 3POSA 1I6XA 2C0ZA 5DZFA 3SC7X 4BK5A 5KHIA 2JE7A 3BTAA 1RUE1 1IS4A 4E2QA 1JHNA 2ID4A 1H6XA 4Q4V2 1BHGA 4IE6A 5E88A 1MVEA 2SLIA 1G9DA 3WW2A 4PBOA 3OGSA 3WF1A 1YI9A 2C9AA 2BVVA 2WNVA 2BFUL 2RM21 3HNBM 1EV13 3WG1A 3V0BB 5I0UA 1E5IA 4CCNA 3ZDVA 1WGPA 5LBCA 4DINB 1QJZA 2ZHLA 2G9FA 5FJHA 5A3UA 4OI1A 4Q0UA 1SDDB 4CDXC 3J7LA 1BLZA 1AYN2 5CNAA 1O3TA 2QQLA 5FY9A 4YGDA 1YJKA 4MZUA 2UWCA 4OYUA 5A3WA 3KV4A 3FLRA 4ZZ8A 5F3IA 4O9GA 3ME2A 4LO6B 4XBNA 3TEXA 2MEV1 5CFDB 1V6IA 2HWD3 1UZYA 3I2HA 3CNAA 1APNA 4KWLA 1QHDA 2EALA 4YGCA 4XJWA 4HN0A 1ENSA 1QNWA 1HXS3 1O59A 2VNGA 2WWSA 1BBT1 4HPKA 1YCIA 3JQXA 1AL0G 4WVZA 3ZXLA 1KDKA 4FOWA 4PLMA 4HKOA 4N7IA 2C24A 1QJU3 3FFZA 3L2YA 4AZZA 2D97A 1W2AX 3MV11 5EJ1B 3E5XA 1UZWA 2HEVF 4BHPA 2QQOA 4LORA 2O8QA 2AYHA 3NJVA 4P9YA 4JHZA 3H7YA 2NP0A 5HV4A 1YI7A 3JD73 1ND2C 1MS3A 4LXLA 4Y1YA 1RVF1 2BGCA 1JMUB 4CEWB 4JKLA 4RYDA 1O3SA 1IPJA 4BK4A 2NM1A 3PMSA 1NG0A 4RGGA 5KR7A 4J1XA 4ATEA 3E97A 1LU2A 3B7MA 5FZ1A 5CEHA 1VBE1 4ARXA 3POYA 5CKNA 5FPBA 4D0QA 4QPIA 4Q4V3 5LA2A 5FKBA 3R4SA 1UMHA 1DBNA 3N3HA 1GOHA 3CZJA 4CPBD 2RVAA 1SFNA 3D6EA 1K42A 1Z78A 4JQRA 4JGYB 2A6ZA 4PIXA 4XZUG 1EUUA 2CTVA 2X29A 4IEWA 3I3EA 3LPGA 3MIFA 1W8HA 4UW5A 1GQGA 4XF1A 3ZYIB 4DUXA 1O8SA 2P1BA 4IQPA 4YSFA 3AFGA 5FZOB 1UKRA 2J1RA 5CFCC 2ZGUA 1CGPA 5E16A 3AYAA 5LK7B 5FY0A 3ZDSA 3RPQA 5FOBB 3MLKA 2VVDA 4QDQA 2LS6A 4IEPA 3VBSC 1H8TA 3ITQA 3PJYA 3NKTA 1NKGA 2R071 2Q8CA 2VCMA 2YROA 4K8RB 4M3CE 5CISA 1IQDC 3OJBA 1VAMA 4LR4A 4W4ZA 3WX5A 3AJYA 2IXLA 1ST8A 5J3UA 3WQ7A 3LFMA 3RYKA 3IWZA 2AEZA 3I8TA 3OGRA 4H14A 4A45A 4BU2A 4YW2A 3O1OA 1RUG2 2W2IA 1S2KA 1L7RA 4CCLA 4RL7A 2B39A 2HWC3 5C9AA 4K7JA 3FHAA 4N53B 4RR3C 4DY5A 4HZFA 5JZGB 1W0PA 2DV9A 5CBLA 4IEZA 1Q8VA 4IEUA 1B35C 3NAPB 4QQHA 1DP0A 1POV0 2VNVA 3PHMA 4GWNA 1AX2A 3KVBA 4ZXEA 4C8DA 1ND3A 3BIEA 2RDSA 4AQ6A 1VBA2 1YLLA 2GZWA 3VKNA 1ZA4A 3FZ3A 2QDRA 2XHKA 2FZ2A 1LTEA 5IAVA 3FHIB 3K2OA 2UURA 4URAA 2D93A 3D82A 2CSGA 1W6PB 3IAQA 5FYZA 5DDJ3 5LATA 1PHMA 1YHFA 2O14A 2W92A 3H8RA 3VBUB 2WT2A 3S7IA 2RHPA 1NE4A 2AH2A 4BM8A 1ZREA 1JZ8A 2YUEA 2WKKA 1ULPA 4PQQA 5FZ0A 5IVCA 4CDQC 3LOBA 3ATGA 4Z1VA 2PTMA 1RTVA 3VBHC 1FAYA 3PTRB 4KU7A 2GC0A 4Y33A 1GR3A 1AVBA 1Q43A 3R4UA 1NXMA 4AVCA 1LENA 2QBXA 5H9QA 4IESA 1S0JA 1ULEA 4IXLA 4D3WA 2DUQA 2VR4A 4QDSA 3MUZ1 4XXAA 5B4XA 2VZRA 4XVHA 4KH9A 4D7YA 5B2GB 1PO23 1XB9A 2H6BA 2W91A 4XJ9A 5CIRA 1QXRA 1SLIA 1YFXA 2ZA9A 3P1IA 3I2KA 3I3BA 4X6QB 4AVBA 2DVGA 4WBBA 5L7OB 2LM3A 1I1EA 1XNBA 2WYFA 3VD9A 3IPVB 3U4SA 4YVSC 3AX4A 1UAIA 5FY5A 4EZ4A 3RI8A 1HB1A 1WZXA 4P00B 4XQDA 1IKPA 2ZTNA 4LKSA 3VHRA 1HW5A 2JDYA 2BWCA 4HK8A 4WVMB 4DXTA 3WCSA 2DCZA 4RQPB 1OOPB 2X5IC 3D4KA 3VDDC 1J3PA 1F8VA 3ZLIA 1DQ0A 1POV1 3C7OA 2HWB2 1KJRA 3IMMA 1KS4A 3WF3A 4L9BA 4A3ZA 1X50A 2Y6HA 1PVXA 1ZBA1 4JQTA 4RGKA 5IVFA 2YBPA 4H3WA 2A73B 4W6YA 1V6NA 1DCSA 2HWF2 3WLUA 3AMNA 1WLWA 4D69A 4IE5A 5F1RA 3FC0A 4IE4A 2ZGMA 2GN7A 4CCCA 4Y1ZA 4D8MA 2QQKA 1KXGA 2PELA 2E33A 2YG0A 2CNAA 2WFF1 3PU3A 3ZFEB 3ZXEA 3BYWA 2Y8KA 2G19A 4QX8A 1OQEA 4JX0A 1OUSA 2VD7A 2W9XA 2RDQA 4BQXA 3N9MA 1RUI3 4GD4A 1VRH1 4Q4Y1 5JXHA 3UNPA 3ZXFA 1QJX2 2GH8A 2OQ6A 2QQJA 1O7FA 1WLTA 3CIHA 4NRPA 4XBLA 5FMBA 4XJZA 4CDWC 4DFSA 5J48A 1XOYA 5K4LA 4JDNA 1R1A2 3T2OA 4DXZA 3IDAA 5FYCA 3N9OA 2BEOA 1K3IA 3HAGA 1J58A 3BTXA 4XC9A 1OD3A 4FAGA 1U5IA 3N9NA 2PA7A 4DQAA 4AGVA 4FO9A 3SMHA 2CGOA 4W6XA 4DUWA 2B5HA 3LD8A 4O9EA 2XJVA 4EROA 4KGGA 5C8CC 5GLUA 5FK8A 2NLRA 3KMHA 1H2MA 4AGRA 3SEEA 3RRDA 3VB9A 1YFUA 4P9LA 3HBKA 3KF3A 2V4AA 2DWRA 3H1WA 4IDZA 4UFKA 2XVGA 4CTEA 2UYBA 4P08A 5A1LA 3B9CA 5LA1A 1HDKA 4XYXA 3ROUA 4QGMA 1W6NA 3ILNA 1CAVB 2JXAA 4LQRA 4CDXB 5IVBA 1SQ4A 3VDAA 3THPA 2ZJCA 2K9ZA 1ZZ7A 5A7SA 5BY5A 5EIYB 4NWWA 1UY0A 3BIWE 4DS0A 5J96B 4QPGA 5FZHA 1LNSA 4P9WA 2RS31 5IK8A 1RXGA 2WNVB 3CMGA 1X33A 2E7QA 4IEVA 2PHTA 1RXFA 2O8OA 5GZDA 3O0XA 4OVEA 1GICA 2QTWB 2XUEA 1DYKA 1A8MA 3VBRA 3WV6A 3ZO0B 2A75A 1VBD1 4TZDA 4PDWC 4DOUA 3W5MA 2ZCWA 4NIDA 4UFMA 4ZS3A 5FWJA 1JW6A 1RUH2 2WS92 4WM7B 1J84A 3LOIA 2E6VA 4KU8A 5C4WC 2C6SA 1UMIA 4Q4X3 3WNOA 1CN1A 2ZGNA 2VCAA 4JTNA 3KCYA 5FXVA 1YO8A 5FZKA 1QH6A 1W8OA 4P9GA 2K46A 5FZ9A 3ZFFC 1MQTA 2R042 2TBVA 3I2JA 4JV4A 1R093 4YM1A 5LA9A 1BXHA 4OULA 5FZ4A 2WN2A 2Q30A 1DU3D 2RJLA 4PLOA 1GU3A 4IV3A 1W9TA 5K0UA 4P5HA 2W94A 4INDA 4AAPA 4CU7A 3TB0A 1AR61 3EQEA 4R9DA 1R1A3 3OPWA 4HPKB 1BEV2 4YM0A 1GOFA 3RG0A 3ZM8A 3TYJA 2P6CA 5LRSA 1R64A 4JCKA 5SV8A 3ZN4A 5C3RA 5F2WA 4NPMA 2BRTA 1UY2A 2VO5A 3R05A 2WINB 1AX1A 3M3CA 5JIUA 1Y7BA 2A6XA 4XE9A 4RHV2 2J1VA 1LESA 3SLIA 3WP5A 3MYXA 1EAH2 1VIWB 1NYWA 1SHWB 1Y9MA 2B9VA 1UW8A 2CAUA 2CWMA 2RMU2 4XFGA 3BU0A 1PGL1 2KXLA 5EV7A 2UWAA 1LOGA 3FLPA 3ABZA 1ENRA 2W1UA 2VBBA 3RJ2X 2XJTA 2RDRA 3L2HA 5AC93 4IL7A 2JDNA 3I7DA 1RUC1 3CL1A 1PIV1 2XBO1 4QQOA 5FYHA 5IJRA 5A7WB 4LHLA 4BISA 5GLZA 1W05A 3AM2A 3OF1A 4V1PA 1TE1B 1K5MA 1XBFA 2XWBB 3U75A 1XYOA 3AKPA 4EN0A 2FBEA 4CEYC 4RS5C 3ORJA 4XTMA 4CUAA 1PZ9A 3MDPA 1WLCA 5DUWA 1LHOA 5GALA 4YM2A 4GULA 3O1TA 4LTAA 1MEC3 3PDQA 3ZX7A 3CF6E 4XZPA 4UYBA 1W6QA 3VL9A 1AZDA 1LOFA 4XUTA 2IUWA 3TOJA 1KFUL 2J1AA 2BOIA 3C7FA 3OGJA 1NX9A 4CZSA 1RUH3 1X8MA 5HI0A 3AYEA 1C4RA 4RN5A 3WZ1A 3T1MA 1RMU3 5GZEA 1I9RA 2A71A 2VQUA 1H8TB 3AJZA 5FIXA 2VW2A 2QNKA 1OQDA 3TAYA 4AEDA 5FBZA 2R7EB 3ZIXA 4NRMA 4XOGA 1DF0A 1Z7S2 3URFA 1GWLA 3NV2A 4GH4C 5GKAC 4E4ZA 1UF2C 2R043 2XQRA 4ZONA 1REFA 2Y0IA 1JTZX 3PU8A 3LGRA 4L11A 2BUKA 3J8F2 5CB7A 3VKLA 3WQ0A 4CSWA 5KXDA 1ZBE2 3IKWA 1F2NA 4UFLA 1B35B 1T2XA 2WABA 1PK6A 4FVVA 3NWKA 4FPLA 2GP3A
chains in the Genus database with same CATH topology
4J6GA 1BEV3 4AFCA 5T5JA 3QOPA 4FCAA 4IV1C 1O5UA 4XIKA 4E2GA 5T52A 5C9AB 4CP0A 2XLAA 2AENA 3MFCA 1LODA 1H4GA 1LKNA 1HRV1 1EAH3 2RMU3 4A7KA 4EN8B 4ATFA 1ND3B 2VOXA 4CDQB 2IFWA 3ZPYA 1VB4A 1DZTA 1ZZBA 2OW4A 5GLTA 3KB5A 2R062 2VXRA 1WW6A 1N3OA 2AR6A 3LA7A 5CU1A 4M00A 2WNUA 5AVPA 5LRRA 3SH5A 1WW7A 1SLTA 1COV1 2Q8OA 1GKBA 4OUSA 1FATA 5BNQA 4Q26A 2RR11 5EWSA 5BXXA 3ZFGA 3H7JA 3MFAA 3LAGA 1T6GC 1RUF3 4PIZA 5FLJA 3N7MA 4FPFA 2RS52 4TLFA 1LOEA 2ZMNA 4N53A 2ZZQA 2YXSA 3QLQA 1JH5A 2IWGB 1TME1 4LBQD 5BNPA 3NAPA 1BMV2 4AI3A 2YC0A 4EWAA 3VDDB 1GZWA 1FMD1 1Q56A 3FUOA 1WW5A 2ZX0A 5HCAA 1G7YA 4YRDA 3OPZA 1UX6A 1AR92 2RS12 2R0HA 1ZBE3 3ZIWA 3TN91 1FPN1 3KGZA 1FXZA 3BB6A 4FP2A 3WCRA 4M01A 4N7UA 3ES1A 2CAVA 2DUOA 1O3RA 2ZX1A 3M3OA 5A32A 3FX3A 1AF9A 5C6CA 1V70A 1HRI2 2XKOA 1FOD1 2MEV3 3GZUC 3WT3A 4GB32 2HEYF 2BNNA 3A4UA 5T3NA 4K1YA 4B29A 3TWIA 1OA2A 3OCPA 1BBT3 2R063 4JGZA 1LCLA 2JE9A 1U0AA 1V6LA 5L7OA 3AZVA 3ZMOA 4BWOA 3AP5A 4U36A 1FYUA 2F6BA 5JSOA 1RB8G 1PGW2 1GZ9A 4WVMA 3S30A 5JVVA 2KA3A 4N43A 4QGLA 4TWTA 3AP9A 2XJSA 2RS53 3O12A 3WHTA 4XF3A 2ZPXA 2DYCA 5DG1A 1RVF3 3WQ1A 5AVAA 5C33A 1MR5A 1F9KA 5I8SA 1NXD1 2WLPA 2GSYA 5FPZA 3RDIA 5D8AA 3H3ZA 3MF9A 4BMEA 1C1FA 4K21A 1A6CA 1E57A 2ZGTA 1QJY1 1R081 1YNAA 4FXKB 1QNYA 4LT5A 1AR93 1LGNA 2RS13 1GV9A 4AFBA 4PDWB 1NCQA 3U4XA 4DY3A 2KM2A 3JUUA 3KCXA 4DRRA 4JDMA 2XKPA 4QPGB 3IBMA 2IXIA 4XW3A 5F5QA 3FJSA 3CJIA 2IXKA 1ULCA 1PZ7A 4YYOA 1C8M1 2QFEA 3OY8A 1HRI3 1ULDA 1VAKA 4OUMA 4WM8C 4KNCA 3VKOA 5CAZA 1H0BA 4FPEA 2ETEA 1LU1A 1MZEA 3VBFB 5FQ0B 4YVWC 2O1QA 1CJDA 4P14A 1DFQA 2EF6A 1LOBA 3GALA 3JU9A 5EXOA 1B09A 2HJIA 3VZOA 1NLSA 1MQTB 1WD3A 1WW4A 4FPHA 2ZGQA 3AKSA 1QQP1 2D3RA 1TMF2 2VNRA 4IV3B 1CAVA 5BPXA 3ZN6B 4CDXA 5K0UB 2FHRA 4LBQA 1NOVA 1Q3EA 3WY6A 4LO7A 1XNDA 1ASJ1 1AR81 3W59A 2R32A 1J1LA 2YMZA 1XNCA 3MLLA 3JBG1 1NCRC 4X8PA 1EP0A 5I8TA 1ZRDA 3GNEA 4I01A 5JSPA 1KD7A 1N1SA 4FPCA 4WM7A 1S0CA 1SBFA 2ZGOA 3WR0A 4COUA 4EWDA 3S0MA 3J26N 1VBC1 1S0DA 2Q0AA 3MEPA 3ZYRA 2MHFA 3NKGA 5HBAA 2HYKA 3OD0A 1NA1C 2YGMA 1PMIA 5KXEA 1GLHA 1K5MB 1HQWA 4FPYA 5KC6A 2JDZA 5FREA 1DGLA 5BNOC 5BNNC 2ZKNA 1ND2A 3I54A 1OPMA 4AFMA 1PM7A 1BMV1 2HWC2 1GZCA 2WT0A 4R8HA 1F5FA 1VJ2A 1W6QB 1S0EA 1FV2A 5IT6A 2JG9C 1YIFA 4FPJA 4FP3A 2P34A 5DG2A 5T55A 4K6BA 4LO5B 3KT7A 2XGXA 2GMPA 3PTYA 4HK9A 4AEDB 1AYM1 1S0GA 2D6KA 2Z2SB 3B02A 4C1WA 4YZ5A 1QOTA 1ZZ8A 3SH4A 3B69A 2PHLA 4A7YA 3SXWA 3PVOA 3N4MA 5DDJ2 4C0HA 3WP3A 1D0GA 1ZBA3 1TMF3 3WG4A 4RD7A 1CESA 1D2QA 1PK6B 5CFCA 1RUJ1 1CD3G 5ABJC 5CA6A 2XJPA 5ACA2 4WZCA 4MGIE 3FUQA 2ZABA 3I59A 3VBSA 2UU8A 2Q4SA 4XTPA 3PMEA 1TNRA 2DF7A 2WFF3 3MPPG 4XPVA 3QH7A 1DLLA 3RI9A 1UN1A 4LA3A 2FQPA 3CEWA 3H50A 3BCWA 4Q4W1 4YARA 4Q4Y3 5GJ6A 3D5OA 1QF3A 5JDBA 4YM3A 1PO22 4ES8A 1F31A 2PFWA 4BZ4A 3KLSA 3E6BA 3O0WA 4G3YC 1AR72 3H9AA 1W6OA 2WNUB 3HN1A 4K40A 4RR3A 1XQNA 1SEFA 1RHI1 4B4QA 2VUJA 1G9BA 2CYFA 3UL2A 4K1ZA 1KFXL 1OHFA 2WSVA 1B35A 5I8YA 3VZLA 3ZXKA 2W52A 1H1AA 3KQRA 3R0RA 3ZFGB 4QPIC 4NO4A 2X53S 4CDUC 4XF9A 4Y5Z0 4A2UA 1IS6A 1V9U1 3OYWB 3FE5A 1IGOA 4MYEA 2E7TA 2Z42A 4AHWA 4B3NA 3VZMA 5JLVA 2ZHKA 5H9SA 2XJRA 5BNPB 3RMYA 3AMMA 2QQPA 1LOAA 1UU5A 5FCCA 5JOWA 1GZWB 1VBB3 3TBDA 4CDQA 4UW4A 2R6QA 2EXIA 3KT1A 2H0BA 3VBHA 2RS33 4HFSA 3S6PA 3GHNA 3NSTA 4XMIA 3PLQA 2PHWA 4QU2A 4AEKA 2I2SA 5FPXA 1C28A 1RUI2 2DCKA 1ZX5A 2ES3A 3DUIA 3N7KA 1QXJA 1VBD3 5KBFA 5ACA3 1GBGA 1UCXA 3IIAA 3M3QA 4Q0SA 2GC1A 3OBRA 1FNYA 3E5UA 5I93A 4BE3A 2EAKA 5A32B 4Q27A 1EV11 2EXHA 4M0HA 4BYYA 2Q1MA 5GLWA 1D4M1 2YGLA 3KSCA 4YVSA 4JVAA 3CJXA 4H7LA 3GF6A 4ZU4A 4MGZE 4SLIA 4ISQA 2R49A 4AHYA 3ZYGA 4MSVA 1PVC1 3NW4A 1HV0A 4L97A 4GQ7A 2X5IA 3VDDA 2VNOA 4JGZB 1IS3A 1BK1A 2R16A 1AR73 2ZX3A 2G4IA 4CYDA 3NJZA 2HWD1 1DQ2A 4ASLA 2IXJA 1QU0A 1WCSA 1LHVA 3POWA 3WW3A 3M3EA 4R9BA 1HXS1 3MW3A 1DQ6A 4E2SA 4N43B 3B9IA 1J1TA 4R52A 5JOYA 1YFYA 3N7LA 4CP1A 3VV1A 4N9IA 1QJU1 4P9IA 2PLV1 4AEMA 1UMZA 4XFAA 2YYOA 1RUC3 2XBO3 3ILRA 1BKZA 5JOZA 3NV3A 3UV9A 4CDWA 5D8AB 4YZ1A 3V64A 2JG8C 2ARBA 4QQ2A 3JD71 2D6MA 5EFUA 2QUOA 2DU1A 2YDEA 4Q4X2 4RSUA 3P3PA 2DTYA 4KBBA 1C57A 4IERA 3LSDA 2PAKA 1R092 1MS9A 3AB0A 1NCQB 2JJ6A 1GANA 5C8CA 4LNVA 1XE7A 2NQYA 4Q4V1 1LOCA 4Y20A 4COWA 4YVWB 3CJIB 4I02A 3H1MA 3OY8B 1AL22 1XU1A 5TSWA 1G9AA 5FDBA 1LR5A 2D44A 3EXUA 4ES9A 2WFPA 4YGEA 4QD2A 4COZA 4ZU7A 2ILMA 3DL3A 1AYN1 4HANA 5F6KA 4AQSA 2DURA 4OFGA 1OLRA 1HLCA 1ZRFA 1AXZA 4HVOA 2XVLA 2PHDA 5AC92 3O0VA 1RUOA 2C1FA 2CY6A 3WUDA 3IT8A 5FOJB 4ORFA 1WUVA 2G9GA 1ENXA 1IKQA 3MI8A 5KHKA 5J37A 3R6SA 1D2SA 4PDWA 2E63A 4XMAA 4LBQB 1YXWA 2MNGA 1HRV3 1D4VB 4JRAA 4RFT0 4AW7A 3WP6A 4GALA 4HMZA 5C4WA 4BQ1A 1F5JA 1TQ5A 1DG6A 3UKNA 4PJYA 4AHZA 2HWC1 4AF9A 1MEC2 4NR1A 4Y4YA 1H2LA 2HEWF 1RUD2 5CVRA 3ZFFA 5FO9B 2PN5A 1SACA 3ZXDA 1OSGA 1I5ZA 2WNEA 1Y9QA 3WXPA 1EPZA 3G6JB 1COV3 4OHZA 2DVBA 2P17A 1X82A 3INAA 1RMU2 3VBFA 5FQ0A 5FRAA 2RR13 2WZR2 3EBRA 4XF4A 4QM8A 2I45A 4ASMB 4KWJA 3LA3A 4MVTA 4XHBA 4HBNA 4GIQA 1J3RA 4LEJA 3DPRC 4Q29A 3AYCA 2DCTA 2JG9B 1Q8OA 3ZN6A 4FTEA 1SLCA 1X8EA 4BOWA 1TME3 1SMVA 5KHHA 3USUA 4LBMA 1ND2B 3VGIA 4UBHA 4AFDA 1AL23 4Z2WA 1JYIA 4S2DA 1FMD3 2YV8A 2VQ0A 3BPZA 2GNDA 4EN9B 3VKMA 3USSA 3G7DA 1JYCA 1SDWA 1Q8PA 4KG8A 4Q0PA 2D5FA 3R4DB 4CEYA 1LJ7A 3BODA 4RS5A 1CAWB 3UJQA 4Q0QA 5FO7B 1Q8QA 3TN93 3U0ZA 3LA2A 4YW1A 4MGYE 4N90A 4XFFA 1WD4A 3KS7A 5C8WA 4WZFA 4M3CF 1IQAA 5CFCB 2OZ6A 1J3QA 2OUHA 4PBPA 3QCWA 2OZJA 4B4RA 3VBSB 3I59B 4L2NA 1RUG1 4LBJA 4YG3A 3RNSA 3RYRA 1RUF2 3ZMNA 1Y43B 4GH4A 5FLHA 2D3PA 1RUD3 4I0BA 1ZNPA 2GALA 3H3UA 2HWE2 4U2AA 3H0OA 2A6WA 1UU4A 3RZZA 3T1LA 1LEMA 4E4SA 3VHPA 2ZGLA 5E89A 4EN7B 3E6DA 5F9TA 1UU6A 1RUE2 1QKQA 1VBA1 4HETA 2WZR3 4AI8A 2WLQA 2CGNA 4IV1A 1UIJA 1W6OB 4AVAA 3C3VA 1QDOA 2DVFA 2RM22 4RR3B 4UBGA 3W9AA 5CFDC 2DUPA 3B00A 1PO13 2NN8A 3QBQA 1A8DA 1DGRA 2XJUA 3MIHA 4Q8LA 2P3KA 4IEOA 1QH7A 2LALA 5E8AA 4HKLA 2R0FA 2OA2A 4YLZA 5JAXA 3EJKA 4D7SA 2QKDA 3AFKA 4Y26A 2MEV2 4JAAA 2Y26A 5T5OA 2QCSB 4AG4A 4UW3A 2VVEA 5DZEA 4EN6B 3WW4A 2EIGA 3IMNA 4B8EA 4YZ4A 5JSRA 3V0AA 1FI2A 1XYPA 2PHXA 1H1MA 3VBHB 1BBT2 4HL0A 4I0WB 5I0TA 3DGTA 1AHSA 1ZRRA 1C8M3 2D6LX 3AP4A 1RC6A 1WA4A 4CEWC 4IETA 1W0OA 3KD4A 5JPNB 1EY2A 1ULFA 2BQPA 3FWEA 3AK0A 2HWB1 3ASIA 3PVNA 1MZFA 4OHVA 2DFCA 5H9RA 2CL2A 3OYWA 4HKWA 3MGUA 1C5IA 1ZRCA 4YVSB 4JGYC 4Y22A 4E27A 1LGCA 1RVF2 3SITA 4CRQA 2JENA 4AE2A 2HWF1 2HWE3 2ZGRA 4LO8A 2PHFA 3TRSB 1DQ5A 4Y24A 4BIFA 3ZSJA 5L36A 4XFIA 1CPNA 4I30A 1QQP3 1VBE2 3FBYA 2X5IB 5JIAA 4AI0A 1RUE3 1ZZ6A 2TUNA 4JC1A 4OI2A 1G8WA 1N1YA 2CWSA 2JICA 2DU0A 2RM23 5EZWA 1GNZA 2ZHMA 1CAUA 3SH3A 3RQ0A 3JBG3 1MS1A 1QJX1 1UL9A 2BWAA 1O5LA 1G6NA 4NHLA 3DV8A 1R1A1 2BNOA 5HCFA 4EJRA 3DN7A 1DYPA 1HV1A 4C90A 3RYPA 3KGLA 1S0FA 2ZACA 3ZSKA 4GMP0 1O3QA 2GMMA 4FT8A 2R072 1XE8A 2GAUA 2I07B 4CDWB 5JZGC 3OD4A 5A33A 4R4ZA 5GZCA 1X36A 4Q8KA 2UY8A 2Z5WA 2VU9A 1DQ1A 5AFBA 5JCTA 2A3XA 4K3UA 1QWRA 4UW6A 2OYZA 4E9KA 2VQAA 4R9AA 2QZ2A 3JB4C 5C8CB 3N36A 4B7KA 1N1VA 4MX3A 3AZZA 1OQ1A 2D5HA 4Y20B 1CPMA 3VBUC 3VZKA 4EV0A 4YW5A 1KS5A 2ENRA 2ZKLA 4Q2FA 2GU9A 1C3HA 4TSVA 4XIOA 2QZ3A 3JQWA 3PVEA 2IXCA 3D0JA 2BBVA 4D94A 3I4IA 1NLRA 3VBOC 3WVJA 2E53A 2W0XA 3PNAA 4PQ9A 1OLQA 1IZ3A 1RUH1 1VBE3 2WS91 4MXVA 5CG8A 3DKWA 3AXEA 1AJKA 2OUJA 2OVUA 2QDNA 3RWNA 4HVRA 3AXDA 2A6VA 5KWRA 2R041 4FQZA 4D7TA 4WM8A 1PZ8A 5K9YA 2IZWA 4GMP1 4XEZA 2FMDA 3N35A 2DVAA 4AVSA 1AX0A 1QDCA 3PVBB 1UKGA 1BEV1 1RGSA 4YVWA 5C4WB 3WDYA 4HSJA 3O5SA 4QMAA 4FOQA 4RQPC 1OOPC 1V6MA 2DCJA 3ZFFB 1XRUA 3DPRB 4QQPA 4IEXA 1MS4A 2HKXA 2R073 4RHV1 3ECQA 1EAH1 2RMU1 2R1BA 3C2UA 2VY0A 1BVVA 1XU2A 2WSUA 4SBVA 3MIBA 3V56A 3MIGA 4LE4A 2X8KA 4H55A 1HX6A 1V9U3 3S7EA 1MZ6A 3Q9OA 1Y3TA 1NCRA 1H30A 1S0BA 2C5DA 2OPKA 4OZXA 1ZVFA 4X8NA 3ZFEC 4S2GA 2BNMA 3HMYA 1ZBA2 1GQHA 1WLDA 3U07A<