1CPNA

Native-like in vivo folding of a circularly permuted jellyroll protein shown by crystal structure analysis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
208
structure length
208
Chain Sequence
FDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGPAHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIKWYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSNGSVFWEPKSYFNPSTWEKADGYSNGGVFNCTWRANNVNFTNDGKLKLGLTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native-like in vivo folding of a circularly permuted jellyroll protein shown by crystal structure analysis.
pubmed doi rcsb
source organism Paenibacillus macerans
molecule tags Hydrolase(glucanase)
molecule keywords CIRCULARLY PERMUTED
total genus 47
structure length 208
sequence length 208
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1994-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cpnA00
1O4ZA 1YRZA 3ZSJA 3N35A 2SLIA 5GZCA 2GNDA 3KQRA 4GWMA 4XIOA 1ULCA 1KQRA 1W0OA 1QDOA 3AX4A 3RRDA 2A75A 1W6QA 4YGBA 2DUPA 3WG3A 4GKXA 2ZA9A 3ASIA 3OY8B 3PVNA 3O0WA 1CR7A 4PBPA 2A70A 2CYFA 5IT6A 4YG6A 5T54A 2NYYA 5IUQA 1Y7BA 3RG0A 2GNBA 5IK8A 1SACA 3RS6A 4BQ1A 1ONAA 1LEMA 1G9BA 1SLIA 2WT1A 1F9KA 3DGTA 3UJQA 5KXEA 3V0AA 1AVBA 4Y20B 2NP0A 4LBJA 4K20A 4Q1RA 2A6WA 3T1MA 1PZ8A 1FV2A 1MS8A 2E6VA 1C57A 4H55A 3V65A 5H9SA 3ZYPA 1ENSA 1WW4A 2JJ6A 1V6MA 3FLPA 1N47A 2UURA 3CNAA 5JOZA 4WVWA 1LECA 2NZ9A 5GZGA 4GALA 1CONA 1DBNA 3AP4A 1LOCA 3AYEA 2OUHA 1JW6A 1LU2A 1LJ7A 4I30A 4YM3A 2JD4A 1LHUA 3A0KA 4Y1VA 1G9DA 4DRRA 2R49A 2W68A 3AYAA 3WG4A 1DQ2A 2GDFA 1G9CA 5T5PA 1DLLA 4PQ9A 1LOFA 4Z8BA 4YZ5A 5KXDA 3AYCA 3FLTA 1SFYA 4XYXA 2ARXA 2R1BA 4XDQA 4Y26A 5JVVA 4AGGA 4DS0A 1GKBA 2ZAAA 3WDTA 4AVVA 4YZ2A 1QOOA 2YZ4A 4P14A 3V0BA 5GLUA 3H0OA 3MEPA 3W59A 3AZWA 1DQ6A 1BYHA 1UZZA 1WCSA 3IKWA 3SH3A 3V64A 1JYCA 3W58A 5T55A 2XB6C 1UPSA 3ILRA 2LTNA 4XBQA 1C1LA 2ERFA 4FPYA 4XE9A 3T1LA 3N3HA 2E51A 4FPFA 4R9AA 1VAVA 4ZXKA 1LGBA 5IK5A 4FOWA 1W6PA 3N7KA 4FOQA 4AWDA 2D6PA 1ENRA 2ZABA 1UN1A 2OVUA 3L2YA 1SBEA 4YW3A 5H9QA 4Y24A 5JOYA 4TYSA 1J1TA 4YM0A 4YFWA 3M3QA 1QF3A 2YMZA 3TAYA 3VKFC 3NV4A 4P9WA 1SLCA 5DUVA 4AGVA 3UJOA 1F31A 1H30A 1LHVA 1SCSA 3BODA 5DXDA 3RSJA 5JDBA 1DZQA 3SH5A 3VKNA 4XBLA 1YIFA 1RITA 3RQ0A 3R05A 1AJOA 3VKMA 3B9CA 1PZ7A 4XHXA 5DZFA 4L8QA 1UKGA 4Y22A 2AUYA 1V6IA 5JOXA 4C1XA 2R16A 4Q8LA 3MPPG 3POSA 1FAYA 2PELA 3POYA 2ZHNA 3RMYA 3OPZA 4CZSA 3JU9A 2HYKA 1WD3A 5CAZA 1N1YA 3IN9A 2WNEA 2D6NA 2V73A 2ZZJA 2VY0A 2OW4A 1I3HA 1KJRA 2YY1A 1GZWA 2CWSA 4FOYA 3WUDA 1VAMA 2JKBA 3OYWB 3WDVA 1APNA 1CESA 1AZDA 2EAKA 5GZFA 1LOFC 1O4YA 5JMCA 2R0HA 3QLQA 1D0HA 1C1FA 4Q26A 5FREA 1GLHA 5GLWA 3WDWA 4HL0A 4WVVA 4Y20A 1V6NA 3WDUA 3V0AB 5DG2A 1GNZA 4YG0A 1DQ4A 3IPVA 3O5SA 4K21A 2AREA 4W65A 5T5OA 2UWBA 4XTMA 4XOGA 4PF5A 5GLZA 4WZFA 4XJ9A 4BM8A 2WJSA 3FUQA 5KXCA 3POWA 1N1VA 2ZMLA 3HMYA 4YW4A 1BKZA 3OY8A 2A6YA 4YG3A 3VKLA 1KITA 1JXNA 3AP7A 3USUB 2A3XA 1AX1A 4M01A 4YGCA 4CRQA 3O0XA 4FQZA 1IKPA 4PBOA 4ITCA 2DTYA 1SLAA 3ATGA 5E8AA 1JUIA 1HQLA 3NWKA 5JLVA 1UL9A 1CJPA 2ARBA 1WUVA 1LEDA 2VUAA 2WT2A 2ZGTA 4FP3A 4XTPA 1N3QA 1AXYA 2WT0A 4FPKA 1PZ9A 3PVEA 4LBKA 1S0FA 2JE9A 4NOTA 2ZGQA 1W6NB 2D7FA 3WNXA 2VXRA 2CWMA 2P3KA 4XJUA 5HCBA 1HKDA 1LHWA 1LOEA 3WV6A 1H9PA 1Q8VA 4XJ8A 3WHTA 5CNAA 2VU9A 1LGCA 2D6OX 1WBFA 2A71A 1QNWA 2DVAA 4XXAA 4AGRA 1MS1A 2A6XA 5IK7A 3D6EA 1AJKA 2AH2A 1HDKA 1SBFA 2AR6A 1VALA 2P2KA 1AF9A 1DFQA 3SLIA 4YW1A 2FHRA 1A8DA 4K1ZA 4FPJA 3SISA 3PMEA 1W6MA 1F5FA 4YM1A 4FPCA 4RA0A 1G86A 1LOBA 1D2SA 1S0EA 1KJLA 4D69A 1IOAA 4YW2A 2SBAA 3R4SA 3R4UA 4Y22B 1CIWA 4LBQA 4JCKA 4YGEA 3ZXFA 3AK0A 3MW2A 4UW4A 1JYIA 2ES3A 1KDMA 3OBTA 1BQPA 1GZ9A 1Q8OA 1KDKA 1WW6A 3M3CA 1IS3A 2GALA 3AZZA 4PCRA 4Y1ZA 5HCAA 1LCLA 2ZGNA 4FPLA 1LENA 2A6VA 2D3SA 2VW2A 2DV9A 2GMPA 2NMNA 1U0AA 4BLIA 3HN1A 3N7JA 1FNYA 5SV8A 2ZGMA 1AXKA 3A0NA 3M1HA 1W6MB 5JOWA 2D3RA 1RINA 2CY6A 2EXKA 3B3QE 1URXA 1QGLA 4ASMB 4DQAA 2PHFA 5AVAA 2TEPA 4LBOA 1V6KA 1ULGA 2C9AA 2AGSA 4GKYA 1N1TA 4FPHA 1FYUA 1V00A 2ZBJA 5EYYA 3I4IA 1G7YA 4P9XA 1S0IA 2ZKNA 1Q8PA 1GYKA 1WW7A 1CPMA 2E7TA 2UWAA 2UU8A 3AYDA 2NM1A 1WLWA 1W6NA 3ZXEA 1SLBA 4LBQB 3I8TA 2WLQA 1BJQA 4ISQA 4CTEA 1Q8QA 5DZEA 2RHPA 3O0VA 5FRAA 1ZA4A 1V6JA 3PVOA 3BOPA 2BQPA 3OBRA 3KM5A 4XJWA 5DG1A 3OYWA 1ENQA 4XBNA 2XG3A 2D43A 1UX6A 3JUUA 1MS5A 4XZPA 3SNMA 2JDZA 4LBMA 1S0CA 2A3YA 3O12A 4Y1YA 2GMMA 1IS4A 5E89A 4F83A 1JN2P 1GV9A 1S0JA 2E7QA 1G9FA 2WSUA 1MS9A 1S0DA 2EIGA 1WW5A 1QMJA 1LODA 1LU1A 1QU0A 2P3IA 1BZWA 4YZ3A 1V6OA 5DUXA 3Q9OA 5T5JA 5LK5A 4Y1UA 2A6ZA 2YV8A 1QKQA 5E88A 1GNHA 4Q27A 3IPVB 4K1YA 3M2MA 2R1DA 2P3JA 1SBDA 4UW3A 1DQ5A 3ZXLA 1QNYA 5HCFA 1ULEA 2W08A 2ZGOA 1VLNA 4P9YA 1ULDA 1WLCA 2GMEA 3AFKA 2ZACA 1N3OA 1XQNA 3VUOA 1EPWA 1Q56A 1VIWB 4M3CB 4BMEA 3ENRA 3N7LA 2DU1A 2D6LX 1SLTA 4FVVA 3OGGA 3AZXA 2JECA 4KBBA 3AJZA 1W6QB 3INAA 1B09A 3WVJA 4UW6A 2DWRA 1GICA 1IKQA 1WBLA 2ZHKA 2FMDA 4BOWA 3ZPYA 4BMBA 3D4KA 1ULFA 3IM0A 2ZMNA 2I2SA 3NV1A 2GN3A 1SLLA 1DIWA 2Q5TA 4U2AA 4ZKTB 3V0BB 2EF6A 2ZMKA 3FLRA 3MW3A 2W52A 3BTAA 5GZEA 3FUOA 3QCWA 3WZ1A 3ILFA 1ZM1A 2EXIA 4Q1PA 3WLUA 1LOGA 4UW5A 3WCRA 1MZ6A 1CN1A 2AENA 3ZSKA 4DRVA 5F9TA 5GLVA 1YXWA 1IS6A 4FPEA 5EXOA 3NV2A 1LTEA 1Z78A 4FOVA 2VH9A 3N36A 1S0GA 3USUA 3M3EA 3ZXKA 1SCRA 2VW0A 2PHWA 3B01A 5CB7A 4XXPA 2G4IA 1NXD1 2D44A 2D3PA 2DYCA 4YGDA 3SH4A 3WHUA 1X50A 5BYNA 1FV3A 4M00A 3WG2A 2PHXA 1A78A 3ZVXA 3NV3A 2PHRA 1S1AA 2GNTA 4BLJA 5IK4A 3WOGA 1FATA 1AXZA 5T5LA 1DQ0A 2ZGUA 1AX2A 1GSLA 2B7YA 4U36A 5DUUA 3AP9A 1G8WA 1CVNA 1UZYA 2A5ZA 3B00A 1BXHA 1GBGA 1LGNA 1DQ1A 2WSVA 1LHOA 1Q8SA 2DUQA 1GZCA 1A3KA 1QOTA 4FQ4A 2ENRA 4GXLA 2DVFA 4M3CE 4YM2A 3TB0A 2WKKA 4WV8A 1FX5A 1CQ9A 3VKOA 3HR9A 3WUCA 3ZXJA 4GWNA 1W0PA 2GNMA 3ZSMA 3AP6A 1YO8A 1AX0A 2ZGKA 5EYXA 1DYPA 4AYUA 1LULA 2VW1A 1OKQA 2DVGA 2PHUA 2NN8A 4R9BA 1UMZA 4AVSA 1W6PB 3AJYA 4Q2FA 1N1SA 2EALA 1FNZA 3GALA 3AXEA 5H9RA 1QDCA 1S0BA 3OJBA 1DYKA 3LSEA 3AXDA 2R0FA 4YLZA 4GA9A 2OUJA 2A3WA 3T2TA 1G9AA 5KXBA 3AZYA 2DURA 5CA6A 2LALA 3WG1A 1HLCA 1I1EA 4YZ4A 1LOAA 4FPGA 2PHTA 2EXHA 3FFZA 4NO4A 1JOJA 1W6OA 1H9WA 4OZXA 4XMIA 5GALA 3APBA 1MZ5A 5T50A 2DVBA 5GM0A 1MS0A 4C1WA 4XJZA 3D5OA 3WDYA 3AZVA 3UL2A 4MYEA 1GANA 2DUOA 2AYHA 5DZGA 1GZWB 3B69A 1NLSA 1OQ1A 5EWSA 4Q8KA 1CPNA 4ISRA 2YROA 4TZDA 4R9DA 4XMAA 4YFZA 1LHNA 1MR5A 4M3CF 1IS5A 2ZGLA 3LSDA 5H9PA 2V5YA 2DU0A 2WQZC 4FP2A 5GZDA 5L73A 2C5DA 2Z42A 3A4UA 1MVQA 4XIKA 1Z0HA 2DVDA 4ATFA 1RIRA 3C2UA 3WDXA 1MVEA 2JE7A 1WLDA 5GLTA 2DTWA 4ATEA 1UAIA 5F5QA 4M3CA 1TEIA 1WD4A 1OFSA 3LCPA 3U4XA 4XJAA 4JRAA 3SITA 2D6MA 2W39A 2P34A 2ZGPA 1KRIA 1R1ZA 2P37A 4YW5A 3M3OA 3RMXA 3N7MA 3PJQA 2EXJA 2H0BA 1MS3A 3GNEA 3ILNA 1JHNA 2UWCA 3MW4A 3ZSLA 4Y1XA 3DUIA 4IQPA 2CTVA 2CL2A 5GJ6A 4XILA 4AVTA 3BIWE 1DHKB 2YXSA 3VV1A 1N3PA 1YI7A 3UK9A 2D6KA 3WCSA 4LBLA 4LBQD 5DUWA 4RL7A 4BPZA 4R9CA 2CNAA 4XHBA 3FBYA 4HANA 1MACA 1DGLA 1YYNA 5T52A 4DPNA 1HQWA 1C4RA 3IMNA 4LBNA 4JC1A 2ZGRA 4SLIA 3ZYRA 1LESA 1W6OB 5CBLA 2KM2A 4YZ1A 2E53A 2NMOA 2ZHMA 2A7AA 1MS4A 1JBCA 1V6LA 1QOSA 4DFSA 2GN7A 2ZGSA 3AP5A 4FPOB 2ZHLA
chains in the Genus database with same CATH superfamily
1YRZA 2ZEYA 5KC6A 5FK8A 3KQRA 1C5IA 2V72A 1QXJA 5FXXA 5F3CA 2MEV1 2RG4A 1DLCA 1KQRA 3AX4A 2HWB3 4GJYA 1KXGA 4HSLA 2A75A 5A6XA 4YGBA 4GKXA 4QXCA 1WMDA 3TBDA 3F95A 3OBAA 1NUKA 1O3RA 1EAH2 4YG6A 3JZVA 4B7EA 1Y7BA 1KEXA 1DGWA 3MUZ1 5KC5A 5IK8A 2RMU2 4E27A 4NHMA 3Q8CA 1VMFA 1F9KA 4NE9A 1UYZA 1ND2A 5D21A 5K0UB 2JKXA 2OZ6A 4DINB 4LBJA 1JH5A 2G9GA 4PLMA 3RPQA 3T1MA 3MV11 3V56A 1PZ8A 4DY5A 4XUTA 4QKFA 2RS11 4AQSA 1H2NA 3HVDA 5F6LB 1V6MA 4CDUA 2ID4A 2ET1A 3NVCA 1N47A 4Y4RA 5BNNB 1NQJA 5GZGA 4CCEA 1LOCA 3AYEA 5ANQA 4AHZA 4BB3A 1LU2A 4I30A 1O7FA 1VBB2 2Z2SB 4WM7B 3MGUA 2GC1A 1OLQA 1LHUA 1YC61 4CPBA 1O8SA 4IGPA 2G1MA 2W46A 5DDJ3 1MPXA 2GDFA 3ACFA 2XONA 3PMSA 4S2HA 4WM7A 2ETEA 3FLTA 1SFYA 2IXJA 4MGYE 5D1IA 4CCDA 4BZ4A 2JEMA 5K8SA 4XDQA 4Y26A 1J59A 2JDMA 4P5YA 4OUEA 1XE0A 1OA2A 4QQOA 4XQDA 3VDBA 4RHV2 4P14A 2QNKA 5DDJ1 4BIOA 2HYXA 4RHV3 5FLJA 1VBA2 5FOBB 2DFCA 3PUAA 1US2A 1PGL2 3TEXA 2ERFA 4EWEA 4FPYA 2Y6KA 3LEMA 5IK5A 5A3OA 3ZFEB 4FOQA 1IG0A 2ZABA 1I9RA 3BUCA 2W2IA 4Y24A 2XOMA 5BNOB 5HXVA 3TAYA 4O9EA 2VBDA 4J1WA 4QHZA 4KWKA 1OOPC 1JYXA 3EBRA 4FAGA 1XU1A 1SLCA 1ZVFA 5FUNA 2Y6GA 2HWE3 2JIJA 3GCWA 2F17A 3ETQA 5EJ1B 2WAAA 3MYXA 4XBLA 3RQ0A 5SV5A 3P1IA 5A6YA 1OBNA 2GU9A 1CAWB 5DZFA 5FYUA 3HQRA 2BNOA 5FPLA 4CXXA 4JTNA 3UKTA 5A6ZA 3VDDC 2R16A 1E5RA 4LE3A 4Q8LA 4OZOA 2PA7A 3HPNA 3AKPA 4G4FA 3T0BA 3BTZA 1E57A 1SHWB 2HWE1 3HT2A 3ZIWA 3POYA 3OPZA 1TME3 5FJHA 4IV1B 3CEWA 5A7WB 3N9PA 3VBOA 2VY0A 2TBVA 4ES8A 1CZVA 3I54A 1RHI3 3ME2A 1GZWA 3IIAA 2WN3A 3NL1A 5FK7A 2JKBA 4IEYA 2VNGA 4N90A 4ZY9A 1CESA 3JD72 3I2GA 2XMLA 4MOAA 5GZFA 3A21A 1O4YA 3QLQA 4FO9A 1D0HA 1WMXA 3PIGA 1UU5A 2BU9A 2DF7A 3AC0A 3N9LA 1GLHA 5A1AA 2ARAA 1O59A 3WDWA 4HL0A 5K0UA 3VBRC 1RHI1 1OF3A 4OHWA 5IJRA 1REDA 2QQIA 2AREA 4MVTA 5IVCA 1IPKA 4BM8A 4PF5A 4CDQA 3K48A 1JOPA 2WJSA 2WAOA 2JDYA 2ZX3A 1YHFA 4RR3C 1GQHA 5C7GA 5KXCA 2QQOA 5LZ6A 5DQ0A 3FN9A 4AEDA 4YG3A 1RUG3 1JXNA 3AP7A 4FXGB 2PXJA 4R4XA 2RS32 2XJRA 4JKKA 1SLAA 3ATGA 1ODMA 1RUNA 5GKAC 4FP3A 2PMWB 1DG6A 2RDRA 4JV4A 1Y4WA 3GCXA 2RDQA 3MBWA 1XOYA 3PVEA 3RFRA 1AR91 2A1XA 4NOTA 2ZGQA 4CCJA 1RUG1 2D7FA 5JXIA 3WNXA 4QXBA 2CWMA 4XJUA 3WT3A 5DAQA 1BEV1 1KGYA 3WV6A 4CCKA 2BEOA 1LGCA 1WBFA 3ZFFC 1MS1A 4NAMA 4BH9A 5FZ3A 2AR6A 1AR93 2V4AA 3HEIA 3CJIA 3C7OA 1H2KA 4JGZB 1PO21 4Q4V2 1A8DA 1AR72 3QOPA 4XFGA 1G86A 1RUF1 3MO4A 4FBFA 1IHMA 4EJRA 3MHZA 4P9LA 3BCWA 1IQDC 3FJSA 1B35C 5FPAA 4CP9B 1JZ8A 1V0AA 4YW2A 5DMYA 2SBAA 5CFDC 2YU1A 1QWRA 1OC1A 2BOJA 4LBQA 4YGEA 1PO23 2EIDA 2RVAA 3KSCA 2WUHA 4MXWB 4UW4A 3TRSB 3WP5A 5FDBA 1CAXB 3E1F1 2WQ8A 4WVMA 4QQ2A 1GZ9A 2XWJB 5FKBA 3VBHA 1RUF3 4QKNA 3K4ZA 3KVBA 2RV9A 3POIA 3I2IA 1GQPA 1H2LA 2J42A 2GALA 1LCLA 4I3PA 4K40A 2CSGA 4FPLA 1W03A 1LENA 2WS91 3KS7A 4QPIC 4XDPA 1W8HA 1FOD2 2RJ2A 4MUVA 1FNYA 5SV8A 2ZGMA 1IQAA 1AXKA 3A0NA 5L7OB 1W6MB 2YDEA 2D3RA 1RINA 2OT7A 4KGQA 2EXKA 1QGLA 4INDA 1F2NA 1L3JA 2QQVA 3MV01 5JZGB 4LBOA 4NRQA 2BP6A 4H14A 2JDKA 5FY1A 3ORJA 4RD7A 4L2NA 3U4SA 2F4LA 5FZIA 5A3LA 2XJTA 5LBCA 5FZ1A 5IHRA 2B45X 2VOXA 3I4IA 5C8CC 4P9XA 4K8RB 2G9ZA 1GP6A 2E7TA 2JG9C 4UF0A 1SLBA 1Y9MA 3KHBA 5JI9A 4B1LA 4CTEA 5DZEA 1ZA4A 2WNUB 3BOPA 2BQPA 2BVVA 3KM5A 3OBRA 4XJWA 2VTFA 1ENQA 5CG8A 4NWVA 4XBNA 1UX6A 4XZPA 5TSWA 1QXPA 3SNMA 2JDZA 4LBMA 1S0CA 2A3YA 4LR4A 3VZOA 5CFCC 2YGMA 5E89A 4AAXA 5JIUA 3S0MA 3FHAA 2E7QA 2Q1MA 1HW5A 4LITA 2EIGA 1S0DA 4WM7C 3SC7X 5CFCB 3VHNA 1BK1A 1BZWA 1O5UA 5T5JA 4DMIA 4ZXEA 4QWNA 3H7JA 1QKQA 5LB6A 5E88A 1MEC1 3I2JA 3PURA 4XFFA 4IV3B 3IPVB 1QH7A 4K1YA 4NJ4A 2VNOA 5J48A 3ZXLA 3ON7A 3OG2A 1QNYA 5HCFA 1X9PA 2W08A 1UU4A 4LQRA 1S4CA 1ULDA 3AFKA 3Q8AA 3F2ZA 2HEVF 1EPWA 3LDBA 5FZOB 1BBT3 5FP3A 4CP9A 4YARA 4KWUA 3N7LA 3TWIA 1RVF1 2H6CA 2JDPA 5C6CA 4Y4YA 5I0UA 2GAUA 2XWBB 1H8TA 1PM7A 4LA2A 4Z82A 1EAH3 4PQQA 2QDNA 2Y33A 4FVVA 4QPIB 3AL5A 1I5ZA 1AL22 3OGGA 2VULA 1ZZCA 5FZHA 3AJZA 1W8NA 1W6QB 2CDPA 1B09A 2RMU3 5F3IA 4QPGB 4UW6A 5J09A 1FI2A 3VD7A 5FPVA 4FFIA 4LHNA 2C0ZA 4NIHA 2FMDA 4KG0A 1BBT1 5C4WA 4RGKA 4BMBA 2BNMA 4CEYB 2QDRA 2YG0A 3K46A 1FMD3 3ZLIA 2WFF2 4DXZA 1NLQA 2EIBA 3VBFC 3TEZA 1VE0A 2ZMKA 3P5BA 4C0HA 2RMU1 5A70A 2W91A 3GGLA 1OD3A 2D93A 4AHWA 2J1SA 1LR5A 1COV3 1RJ7A 2QZ2A 5FY8A 3WCRA 4EE2A 3I49A 3DF0A 2VJXA 3I2KA 2AENA 2XHKA 4A7YA 1FMD1 3ZSEA 5HCHA 2YUEA 3VZNA 1PIV2 3MDPA 4D6QA 1PM4A 3ZYJB 2DCZA 1XBFA 1J84A 2AZ5A 1PIV3 1R081 2VBPA 3M3EA 3AMHA 3S57A 1SCRA 2FCVA 3KD4A 4LPLA 5EZWA 4IV1C 2G4IA 4XURA 2D44A 2VQAA 1H1MA 3ZFEA 2ZEWA 1OQEA 2R063 1HB2A 5BYNA 5BNNA 3WG2A 2VZSA 1U5IA 1OUXA 1A78A 2PHXA 4Y5SA 2TNFA 3KT7A 1S1AA 2R041 1NY72 1S55A 5A1FA 3N9QA 2TUNA 2ZGUA 4UFLA 3NNFA 4XFAA 1ZRRA 1C5HA 3W20A 4Z8BA 1GZCA 4LIUA 3TB0A 1OFNA 2WKKA 5HXMA 1U12A 3BPSA 3UV9A 1UPIA 2B5HA 1HRV1 1W0PA 2R043 4QPGC 3ZSMA 1AX0A 3CO2A 1VMHA 2VNVA 4AYUA 3NJXA 4MGZE 1EUTA 5BNOC 4B29A 4RR3B 2EALA 5JSRA 2BGPA 3LFMA 1VB2A 1AYN2 4QT6A 3U75A 5FP7A 3AXDA 4QGLA 2B4KA 5KHHA 2OUJA 2A3WA 4DXSA 1Y43B 4JHZA 3VBUA 5KHGA 1QIQA 2LALA 3C7FA 1HLCA 3KV6A 2PHDA 1I1EA 5T52A 3VBRB 3WF2A 2FDIA 4P9JA 3FFZA 3ACHA 4E8DA 1W6OA 5FXZA 5FXWA 2DVBA 4HETA 5AVPA 3AMNA 3U1XA 4NIAA 2FZ2A 1VBE2 5EPAA 3RZHA 5LA9A 2OPWA 1G6NA 5FQ0B 2AYHA 4CEYA 1JYTA 4GMP0 4GJZA 1OQ1A 3EHKA 3E5UA 4X8PA 3RJ2X 4PDWC 4Q8KA 1SMVA 1T6GC 1Y9QA 1PX3A 4Q5OA 3UYJA 5BNPA 3KHCA 3VD4A 3ALQA 5A3UA 1ACCA 1LHNA 3EO6A 1OLRA 4KL1A 4RS5C 3SCGA 3DYOA 1IS5A 1OLME 2ZGLA 3MIFA 2Q1FA 5L73A 5M0TA 1S2BA 5IATA 3POJA 5D2AA 1MEC2 3DV8A 4CDQB 1RIRA 1W90A 3WDXA 2QQNA 1BMV2 3PUSA 2JE7A 5CFDA 4DUXA 5F5QA 5A3MA 4M3CA 5FO8B 3H7YA 1ND3B 1OFSA 3B7MA 3VBSA 1EYBA 3HJRA 5BNNC 4XJAA 4BU2A 5LA1A 3USSA 1OUSA 4XUQA 5BPXA 1XXNA 1R1ZA 5FP9A 3RGBA 1HX6A 3N7MA 3ZKYA 4Q0QA 2QE3A 2EXJA 4QU1A 1MS3A 2GP5A 2J1RA 2VUJA 3JB8A 2QKDA 3LPFA 4Y1XA 1UXZA 4LK7A 3LEIA 1CX1A 3BIWE 4UBHA 2Q30A 3KQ4B 4LKEA 2PYTA 2LS6A 1N3PA 1YI7A 3SEPA 1H6XA 4N53A 3IIIA 2D6KA 3K4AA 3O1TA 2WO7A 4R9CA 1EUUA 2BVBA 4XHBA 3M70A 5AC93 1O5LA 2WN2A 1C8M1 1DGLA 2J1AA 1HQWA 4AVCA 4FAHA 1ZZ7A 4EN8B 2FDFA 1PK6C 5FZLA 5BUVA 2FDKA 2OQ6A 1LESA 1UZWA 2BZDA 5LBFA 1UCXA 5CBLA 2W47A 2NMOA 1WLTA 3MFCA 3PUHA 1MS4A 1NYWA 1V6LA 1DF0A 1QOSA 3T2QA 1VJ2A 2XHNA 3MUY1 4OI2A 2VE1A 1C8M3 3ZSJA 4H3WA 5B2GB 4GWMA 1RUJ3 3TOJA 3GHNA 5GZCA 2VM9A 2LRPA 2WIIB 3ZOIA 1W0OA 1QDOA 3ITQA 1Z7S3 4JAAA 4Q4V3 3RRDA 4EROA 1VP6A 2ZA9A 3OY8B 4PBPA 5FR3A 1Q5OA 5AFBA 3OGJA 2A70A 1HV0A 1R091 1FT9A 1RUG2 2XQRA 1JHJA 5T54A 1GOGA 2RDSA 3QD6A 2J1UA 4AFMA 3W5NA 3WINE 2GNBA 2MPFA 3M3IA 1RUJ1 1SACA 4QGMA 3U07A 3MIBA 1ONAA 1YFWA 2Y6JA 2WNVA 5KXEA 1KS5A 3LAGA 2HWC3 4QPYA 1VBD3 4Q1RA 2XGXA 1RUF2 4BJ0A 3V65A 1MS8A 4H55A 1C57A 1W8UA 4IEUA 1R093 2WZR3 4TSVA 2YU2A 1WW4A 4CYDA 4F3JA 1AR71 1DGRA 1WA6X 2PLV2 2ZCWA 3KF5A 2X5IA 5JOZA 5CKMA 4GALA 1CONA 1DBNA 5C5TA 5CG9A 2FD8A 5FZAA 2OUHA 4CDWC 1RUI1 4B4RA 4Q4X1 2R073 4YM3A 1W8ZA 3KZ4C 4A44A 5A32A 1TMF3 4Y1VA 4DRRA 4J1XA 3AYAA 3WG4A 2E32A 1OXCA 3P6BA 4XCAA 1WCDJ 3H1WA 1AR73 1IPSA 3WQBA 2W87A 4YZ5A 2ET7A 4HK9A 4LUKA 4COYA 1RUI3 1RC6A 2R1BA 4Q4X3 4QX5A 4AGGA 1R082 3KT1A 1QY4A 4AVVA 1WZXA 4QHOA 2UYBA 1W3XA 2OYZA 4ET7A 4UFIA 3DKWA 2YZ4A 5GLUA 5FYCA 3WNLA 1O3QA 1YI9A 3IKWA 2WZR2 5T55A 2XB6C 1HRI2 1TVGA 1UPSA 3CMGA 3ILRA 4XBQA 1D2QA 2VBBA 4CEWB 1C1LA 3WNOA 3N3HA 5E1RA 5C4WB 1LGBA 3Q8EA 1QJX3 2MEV2 4V2WA 5C8WA 5FMBA 1U5XA 2HJIA 3GZAA 4JVAA 1SBEA 1RHI2 4TYSA 1J1TA 4YM0A 3VKFC 2Y34A 1PGSA 2P6CA 1SG3A 1GWLA 2QFEA 4P9WA 3FL7A 5FZGA 1OVSA 3PTYA 1W8WA 2HWB1 3JQWA 1F31A 1H30A 1AL21 5ABJC 4Q4X2 3VBFB 1O91A 1RITA 4EN6B 5K7PA 4QX7A 2RE9A 3J4UH 3ZIXA 4LIVA 3T08A 2CAUA 1UOFA 1H6YA 1DGWX 1RVF2 3IB3A 2WO3A 4XPVA 5FFOC 2VVFA 3MPPG 5EJ3A 5C3OA 3BOWA 2ZHNA 2JG8A 2HH9A 1AL23 1FXZA 1W8TA 1XYOA 1JOBA 2W5FA 4N43A 4XCBA 4CXYA 5CAZA 2RS13 2ZZJA 5IFPA 4QDRA 5AC92 1KJRA 4NVPA 1CZSA 3VBUC 4CA9A 1VAMA 2WNUA 4XQWA 4FSJA 2H0VA 5FO9B 3WDVA 1JZ2A 1APNA 2I07B 1W06A 2FQPA 2VQ0A 4QKDA 1W9SA 2WWSA 1J58A 1JUHA 4M4PA 5JMCA 1OF4A 5FYHA 2Y0OA 4CDXA 4UAPA 3MFAA 5FREA 5C8CA 4NIDA 1DDLA 2VR4A 2WR9A 4WVVA 5CISA 3LDRA 2XDVA 5EP9A 4Q4Y3 1ND2B 5JR7B 5K9YA 1Q43A 2K9ZA 1QQP3 5DG2A 1GNZA 4YG0A 1DQ4A 3IPVA 3LIHA 3O5SA 4K21A 1PO12 4MX3A 1NQDA 1VBC2 4SBVA 4XFBA 4AQ6A 4MO3M 2UWBA 4ONUA 2CHHA 2Y38A 5FZBA 4YRDA 1F8VA 2FZ1A 1VR3A 1ZX5A 4GD4A 3PNAA 5LASA 4ZZ5A 1N1VA 1K5MC 3WY6A 4OMCA 1W2OA 4RHV1 2IUWA 3USUB 3O1MA 2RS12 1AX1A 3I97A 4M01A 1RXGA 4Q4Y1 4FQZA 3OPTA 2DTYA 5L9VA 1QQP1 2B8MA 3OD4A 4CEWA 2HBUA 3CLPA 1WUVA 1LEDA 2VUAA 2JG9B 2ZGTA 4GB31 3PVBB 2EIEA 1SDDB 5FZ9A 5FQ0A 4JZRA 3KF3A 3RNSA 3FBMA 4XW3A 4JDMA 1CAUB 2VXRA 1HKDA 1LOEA 2FDJA 4XFIA 3U11A 1Q8VA 5FUIA 4TWTA 1PHMA 1RUH1 2VU9A 5CNAA 2WS92 4BYYA 1HJFA 4CCOA 2D6OX 2DVAA 2A71A 3FX3A 1QNWA 1O3TA 4DNYA 1VBB1 1AJKA 2AH2A 4A7KA 4RFRB 1DYOA 1XU2A 3J7NA 1GU3A 1O4TA 3NJVA 4L11A 4YW1A 5FZEA 2FHRA 5JPNB 1JYVA 3PMEA 1W6MA 4C8DA 4MHRA 2VZQA 1RUH3 4FPCA 2VUDA 3D8CA 5I0RA 3EQEA 4A7ZA 4B7KA 4IE4A 2JG8B 2Z69A 1KJLA 4D69A 3C7GA 4LA3A 1IOAA 3OD0A 3TEWA 1TME1 1U5YA 4HXCA 3H42B 3RI8A 1ZBE2 3R4UA 4Y22B 4OCTA 3ZXDA 1XSQA 3PJYA 2GSYA 3IMMA 1H4GA 2E9QA 4NIIA 4DZGA 3OBTA 3S30A 1F4AA 4QDQA 3NNMA 1Q8OA 4L9BA 3VZKA 4QQPA 1WW6A 1RUD1 5CFDB 1WCUA 2Y6HA 3TN92 1ZZ8A 1ND3A 1IS3A 3FHIB 4XUNA 3AZZA 2FDGA 1X36A 5ACA3 1E5HA 2RS51 3MZHA 2A6VA 5FKCA 4P00B 3O1RA 4LLFA 4ARYA 2WWJA 4RS5B 3S6PA 3N7JA 3ROUA 2D5HA 4OHXA 1ZBA1 1MQTA 5JOWA 2HLEA 3VL8A 3GHMA 4JQRA 2GP3A 3B02A 4QQHA 4YVSC 3B3QE 4I0AA 4ASMB 4DQAA 1RUD3 2GC0A 3I2FA 2EICA 5AVAA 5FYVA 5FLHA 3JD71 5FZ7A 4OHZA 2C9AA 2RS53 4L92A 1QJY2 4FPHA 4E4SA 4JTOA 1NZCA 1V00A 2ZX2A 3KCXA 3K77A 1K3IA 1ZBA3 2ZKNA 2HWB2 5F2WA 3GZTB 5F3EA 3H3ZA 3VDDB 4DB5A 3OGRA 4COVA 2W1WA 4UBGA 2KA3A 1OURA 3AYDA 3S7EA 1WLWA 1W6NA 2NLRA 2YFUA 4LBQB 5I0SA 4MZUA 2CGPA 5BNPC 4NHXA 4AK3A 2WLQA 3C3VA 3LE0A 3VBUB 2Q8OA 4CSWA 2WZEA 2ZKLA 5FRAA 3GZUC 2MHFA 2VMDA 3PVOA 1OH4A 3OYWA 3WF1A 2XG3A 1YFUA 3FWEA 1AR82 4S2FA 1PK6B 5BY5A 1J3QA 5A3TA 2IWGB 3Q8FA 1YQ8A 3OCPA 1OLMA 1JN2P 2YC4A 4CCLA 4XETA 2XQXA 5A7WA 5I8SA 5L9BA 5LATA 3VHRA 2QQPA 1XNAA 1QMJA 1LODA 2W94A 4I0BA 4YZ3A 1ZRFA 3OSDA 2OPKA 3BI3A 3Q9OA 3A7QA 4Y1UA 2YV8A 3T4VA 4BXSV 3O1SA 1RUE3 2XLAA 4IESA 1YJKA 4XF0A 4C91A 2P5BA 4CPBD 4HN1A 4A4AA 1DQ5A 3FE5A 3AMMA 1SPPB 4Z2AA 1F4HA 3WP4A 2ZGOA 1VLNA 2XL9A 2JDAA 2GMEA 2RM23 3OEAA 1UXXX 2VECA 5J37A 1N3OA 4URAA 3VUOA 1Q56A 1Y9GA 4M3CB 3VBHC 1A34A 1W28A 2B9VA 3KGZA 2QQJA 2VL4A 3O1UA 2BGCA 1DCSA 2VTXA 2DU1A 3BIEA 4AI3A 4JGYA 3ZR6A 5J1XA 1P8JA 2XXZA 3AZXA 1BVP1 2JECA 2WA3A 3OBZA 1GUIA 4KBBA 3BYWA 1W39A 2RM21 3WVJA 4AHXA 2WINB 4I0WB 2ZPXA 3GJAA 3ZR5A 3FC0A 5JPMB 4GQ7A 5FZOA 2Q8CA 4LO7A 4IL7A 1CJDA 3B9IA 2Q0AA 3S5QA 1VBA3 3D4KA 3PUIA 4B4PA 3N4MA 2VMEA 2I2SA 3NV1A 3WEZA 1SLLA 1DIWA 1W8OA 3VHPA 3ZX7A 4U2AA 3V0BB 2WLPA 1W2TA 3VBSC 4AI2A 3MW3A 4NAOA 4XDOA 2Z4FA 4IV3A 5IAXA 4IEZA 4QGNA 3WLUA 2W1SA 4N8MA 5FZ0A 4A3ZA 4AI8A 3H8XA 1MZ6A 1VBA1 1CN1A 2JG8C 4DRVA 3GZEA 4NHYA 1AYM2 3THPA 3HQUA 3NV2A 5FPZA 4NHLA 1NAEA 1Z78A 2D5FA 3N36A 1S0GA 4IW3A 4JGZA 3VDCA 1G9AA 2BOIA 3JQXA 4YNIA 3ZXKA 2VW0A 3ES1A 1X82A 4RQPC 3U14A 4XXPA 1OT5A 2ZS6B 1NXD1 4YGDA 1H8TB 2K2SA 3CL1A 4HZFA 3SH4A 4BK5A 1RMU3 1DU3D 4FI9A 4TTGA 3ZVXA 3MLLA 3UNPA 1XSRA 1U5ZA 2JDHA 2GNTA 4BLJA 5JIAA 4C0BA 4QXHA 4OULA 1JZ3A 5T5LA 4ZHNA 1AX2A 1GSLA 3QH7A 5FBJA 3AP9A 2A5ZA 5BV6A 5C3QA 5EQUA 4EZ4A 2VZ3A 1LGNA 1DQ1A 1LHOA 2YYOA 1QOTA 5DAWA 2WNVB 1PGL1 2DVFA 4RGGA 1K45A 5EJZB 1RMU1 1D4M3 4M0NA 1FX5A 4HK8A 3VKOA 2CU5A 4GWNA 1YLLA 2GNMA 3VD5A 1XJAA 5EYXA 3H8OA 4ZONA 2O14A 5IVVA 2YBKA 4QPIA 4CDWA 5J96B 2QQMA 1LULA 2PN5A 4A42A 1NZIA 2DVGA 4R9BA 1W2UA 4X6RB 4Q2FA 3AJYA 5FZKA 3U78A 1FNZA 3GALA 5H9RA 4N43B 2HEWF 4UOJA 1UKRA 2K46A 2WFPA 3T2TA 1RVF3 1QJU1 3LA7A 5BNQA 3RZMA 3RZGA 2DURA 2VG9A 1NCRB 1OKOA 4UFJA 3WG1A 2O8QA 4YZ4A 1PGW2 1POV1 1EAH1 1SDWA 4OUMA 2YC2A 1V9U1 1JYWA 4NO4A 1JOJA 1UZVA 1H9WA 1GOFA 3EMRA 4PLNA 5GALA 3PU3A 5T50A 5GM0A 3ZDVA 1MS0A 3PDQA 4CCCA 4CUGA 3D5OA 3TYJA 4CDXC 1R64A 4ZZ8A 1DP0A 3UL2A 1W9YA 3AFGA 5DZGA 4NIGA 1BHGA 1HV1A 2VMFA 3DCQA 1NLSA 3DKQA 2P6HA 1ZNPA 2YGLA 3CJIC 3MLKA 1POV3 5EWSA 1S2EA 3KWVA 1V9U3 2QZ3A 1X7NA 4S2GA 2GC2A 2ZX4A 1AUYA 5CIRA 5A7SA 4CUBA 3E5XA 3S7IA 2YROA 1HXS3 2BERA 4BQWA 5J3UA 4TZDA 1MR5A 4JGYB 2VGDA 5APAA 2WQZC 2DU0A 4FP2A 3U10A 1F35A 1YFXA 3A4UA 3CHXA 4XIKA 1XPWA 5IWFA 3C2UA 3O1VA 2RS31 3MIDA 4H2AA 1UY1A 1MVEA 3J26N 1OOPA 5GLTA 1TNRA 3ZN5A 1YJLA 3WNMA 1K42A 1ULOA 3LCPA 4Y3OA 3MLJA 4COWA 5CYYA 3ZMOA 5JUVA 3SITA 3THTA 2W39A 4ES9A 2ZGPA 4MXWA 3J9SA 2P37A 5ISLA 1RUC2 2Y0IA 3RMXA 3T0AA 4GH4C 5AFEA 4QAWA 3PJQA 2H0BA 3UKNA 5C9AC 1US3A 2JG9A 4ZS3A 5K4LA 4AFAA 3MW4A 3ZSLA 2R061 3WQ7A 2RS33 4IQPA 1F5JA 1DHKB 2R062 2Y8KA 1PNGA 1OH3A 4KH9A 5FUPA 2WL1A 4JX0A 1O8PA 3OUIA 5JI7A 3VBOC 1JODA 2QQWA 5DUWA 5FZ4A 4AG4A 2PTMA 1UZ0A 5A7PA 1E5SA 2WNOA 4HANA 1BVVA 4PLOA 3BTXA 3SCFA 3I2OA 1UQXA 4IE0A 2FDHA 4HBNA 3BU0A 2RJLA 2PLV3 3BN6A 3G7DA 2ZGRA 4LORA 3VZMA 4QX0A 2AC1A 1HIXA 2H6BA 2W9XA 3DPRB 3TNQA 1W6OB 1WWYA 2KM2A 2QQLA 2XBO1 2OZJA 4YZ1A 2E53A 2ZHMA 5A80A 1ZZ6A 2A7AA 4CXWA 1ZRDA 4DFSA 4W8JA 1RUC3 2ZHLA 5F5AA 4PI2A 1O4ZA 3SEEA 3J8F1 2SLIA 4QQLA 2ORZA 5JSOA 1ULCA 2XLGA 3CQOA 2BV4A 1WGPA 4YW6A 3RZKA 2XUEA 2DUPA 3WG3A 2XBO3 5LY1A 3H3UA 3NAPA 3EYPA 3CJIB 3O0WA 4KU7A 5LCWL 1UMIA 1WMEA 4IE5A 3POBA 4HT1T 5A32B 4EWDA 3JBG3 5IT6A 1MQTC 3LA3A 5IUQA 2ADEA 3R0RA 4QM8A 3SKVA 4E9KA 3WW2A 2ZEZA 1LEMA 1G9BA 2LM3A 2VMHA 3UJQA 2ZJCA 4EQVA 3V0AA 1AVBA 3PL0A 4ARXA 2A6WA 2E6VA 2WZ8A 5IVBA 4IUGA 5H9SA 4DXTA 2BFUL 1ENSA 1UX7A 3M4FA 3VDAA 3FLPA 4KNCA 3OOXA 4BQYA 3CNAA 4WVWA 3VBRA 2NZ9A 1UOJA 3AP4A 5C9AA 1JW6A 1LJ7A 5LEJA 3ZYBA 4E4DX 3UGGA 2JD4A 4LK6A 2W68A 5D8AA 5FBZA 2XJPA 1DQ2A 1QJU2 3KCCA 4GIQA 4DY3A 5CADA 1CIYA 1DLLA 4PQ9A 1LOFA 4CCMA 2VZRA 5KXDA 2D40A 4XYXA 1TE1B 3D0JA 3H1YA 5JVVA 2GZWA 1KFUL 2W3JA 2XJSA 4DS0A 1GKBA 2ZAAA 3WDTA 4BE3A 1KD7A 1NOVA 1POQA 2C9KA 4YZ2A 1QOOA 4YYOA 4CU8A 3OGVA 1NE6A 3K51A 2YB7A 2ZAHA 3MEPA 4FT8A 4XAEA 3AZWA 2HKXA 2QCSB 1DQ6A 1BYHA 1WCSA 4XF1A 3V64A 3O14A 1JYCA 4LHSA 4OI0A 1D7PM 4LO8A 3LPGA 3PLQA 3VD9A 1DZRA 2J1TA 5HBAA 4LO4B 3T1LA 5DAVA 3NNJA 3GYDA 2ZZQA 1W6PA 3N7KA 3VB9A 5ABJB 4G9SB 4RQPB 2MNGA 2D6PA 3ZN6A 4YW3A 1UN1A 4K6BA 4BQXA 4PIZA 1WCQA 5FO7B 4AI1A 1PVXA 4YFWA 4ASLA 1QF3A 3SKJE 5I93A 3ZDSA 5L7OC 4RS5A 3DEMA 1KS4A 4XACA 1IGOA 2VOVA 2W1QA 3M8LA 4META 5DUVA 5KHKA 1LHVA 1QQP2 1SCSA 3BODA 5DXDA 5E6HA 3RSJA 4AXOA 3SH5A 4UI9L 5F5CA 1YIFA 4QDSA 2VXJA 4D7TA 3R05A 2YC0A 4A6SA 1NT0A 3B9CA 3BPZA 1PZ7A 5F37A 5KR7A 1ASJ1 4XHXA 3RZLA 1NG0A 3S5AA 1REEA 5JOXA 4C1XA 1JU3A 4PIYA 2OX0A 4D3WA 2J1EA 3W5MA 1H1IA 4HPKA 2X5IC 2PELA 5FV3A 4HVQA 1FOD1 4CZSA 3IDAA 1K5MB 1UY0A 1XNBA 2HYKA 3JU9A 3LGRA 3MICA 3QACA 1EV12 3IN9A 4QX8A 1ENXA 2G9FA 5DPNA 3VL9A 5A3NA 1ASJ3 1UYYA 4QD2A 2OW4A 3T30A 1UY2A 4G3YC 2DCYA 4FOYA 2CWSA 4NN0A 1HB3A 5D8AC 3OYWB 4KGGA 1COV2 1AZDA 2EAKA 3I2HA 5F39A 1FOD3 2R071 3J7HA 1W0NA 3W21A 3HN3A 4IE6A 3SQOA 2VCAA 2Z5WA 4GWJA 1C1FA 3CBNA 2CAVA 5A7NA 1HQNA 5T3NA 2VQUA 1J83A 2X29A 4B4QA 2ZEXA 4OFGA 2QQUA 5CVRA 3IZOA 3HAGA 3WDUA 3IT8A 4V2VA 1PMJX 5FTTC 5T5OA 4A2UA 4EN0A 2Y26A 3VN4A 1HB1A 4XTMA 4ATEA 4BCUA 3H9AA 1GFF2 1IPJA 1CAVA 1NA1A 2R30A 1SEFA 2VVEA 3FUQA 3POFA 4NR1A 4AEDB 3AKQA 2ZMLA 3HMYA 1BKZA 1UNBA 2FMYA 2A6YA 2PFWA 3IDBB 3OY8A 1WKYA 3VKLA 3RJRA 1EV13 3NJYA 4LMFA 2A3XA 4ZU5A 4CRQA 3O0XA 1IKPA 4PBOA 4ITCA 1JUIA 2VZVA 3GJBA 3I3QA 4JKLA 4BK4A 4UFKA 1HN1A 1OA4A 1AXYA 4H7MA 1QJX1 1RYYA 2WBKA 3M7AA 3TN93 3VGIA 1PZ9A 4LBKA 4AQTA 1RUOA 4O65A 5FZ8A 1QJX2 1S0FA 1YWKA 3DPRC 2VNRA 4UF0B 3HT1A 2IXIA 3HQXA 4ZU7A 4CDXB 3ETPA 1H9PA 1AR61 3OB8A 4XJ8A 4LUMA 3N9OA 3WHTA 3WF0A 2J22A 4IV3C 4AGRA 2A6XA 3D6EA 2X05A 1HRV2 5EV7A 3TN91 4BIFA 5I8TA 4N9IA 4W6WA 1OPOA 1SBFA 4Q0UA 2R6QA 2P2KA 1AF9A 1DFQA 3SLIA 1CZTA 1R1A3 4QU2A 1LB2A 5LBEA 1RTVA 5FXVA 4IV1A 3SISA 4CP0A 3ZYHA 1JMUB 1ZRIA 1AR63 1F5FA 1GWKA 1PX4A 3MIHA 4RA0A 5LRRA 4CEWC 2BRTA 1D2SA 1S0EA 4YWAA 4UWDA 3ZFGC 5C9AB 4RN5A 2WNUC 3C7HA 3R4SA 4GH4B 4NRMA 1CAWA 3ELNA 2UYAA 4CU9A 4XZUG 1CIWA 3WP3A 4JCKA 4CDUB 3MW2A 4IXLA 4EN7B 2EVXA 1JYIA 2ES3A 2DCJA 1CAXA 1BQPA 2DCKA 3VDDA 5KWRA 1VAKA 5EFUA 1KDKA 3K3OA 2VPVA 5DN2A 3UESA 4CEYC 4GH4A 5HCAA 4PCRA 4Y1ZA 5JR2A 2ZXQA 4CU6A 2ZGNA 4PDWA 2BUKA 3LFIA 1OQDA 3LD8A 4EWAA 2DV9A 2VZTA 2GMPA 1U0AA 4AOCA 3M1HA 3SHRA 3G6JB 3MF9A 2Q8DA 3JXSA 2CY6A 2BPA2 5A6QA 4BQ5A 1CX4A 1IG3A 2PHFA 4E4HA 1E5IA 4GKYA 2AGSA 2RM22 1N1TA 4DXRA 5KHIA 1C8M2 4WVMB 5L9RA 3LKJA 1BBT2 5F32A 1WW7A 1NKGA 1CPMA 3POGA 3PU8A 1ODNA 5DABA 5J36A 2UU8A 3GF6A 3VBSB 2NM1A 3ZXEA 1K12A 4HKWA 3I8TA 1ND3C 3AM2A 1BJQA 1SZBA 2F4PA 2J1VA 1Q8QA 4YVWC 5IVFA 1VBC1 1NCRA 1XNDA 1VPHA 2XJVA 1V6JA 4GB33 4JKMA 2D43A 3JUUA 4Y1YA 2CGOA 4LKFA 5FMOL 3T4HB 2GMMA 4F83A 1GV9A 1S0JA 1G9FA 5G04L 4MGTA 1MS9A 1WW5A 4M4RA 1LU1A 1QU0A 2P3IA 3I3BA 2KR2A 4BDVB 4L99A 1V6OA 3H3LA 4ZU4A 1YCIA 1IZ3A 2WQ4A 1VBB3 3P3PA 4MV2A 1GNHA 4Q27A 1ST8A 1XE8A 3NW4A 4DIQA 5C4WC 3WQ0A 4F8AA 2P3YA 1ND2C 2WABA 3M2MA 4NMIA 5A1LA 4E8CA 4W4ZA 2ARCA 3DL3A 2O0OA 3MPBA 3J8F2 3MF6A 2XR4A 4JDOA 1WCKA 4D7YA 1OOPB 4RFT0 1XQNA 2XVKA 2BBVA 4GMP3 5LRSA 2XBO2 5DAPA 3ENRA 3IWZA 1EY2A 3N9NA 2JDNA 1VRH2 2R32A 2VAUA 3JBG2 2XKOA 1MQTB 1SLTA 3LDKA 5L7OA 5JXJA 5F2SA 1AHSA 1RXFA 2KXLA 5FLIA 3INAA 3NJZA 5JAXA 2DWRA 2E33A 1GICA 1PK6A 1IKQA 3C7EA 2ZHKA 5B4NA 2AEZA 5ACA1 4BQ2A 1A6CA 4UYBA 5CEHA 4Q4W1 3T09A 5A33B 2GN3A 2B39A 1FPN3 2Q5TA 4M0HA 4AVBA 2EF6A 2OQ7A 3FLRA 2W52A 2RJKA 3ZYIB 4CDUC 4MXVA 3MIGA 3BTAA 3QCWA 3ILFA 1UO9A 2EXIA 5IAVA 1LOGA 3E5QA 1B35B 2HWF3 1RUD2 3JD73 4UW5A 1TQ5A 2VZPA 3GBFA 3KV9A 3ZSKA 1TMF2 5F9TA 1HRI1 5GLVA 1YXWA 4I09A 1IS6A 1NCRC 1QJY3 4FPEA 4KWLA 3RZZA 2BDRA 1W99A 1FPN1 1LTEA 2VH9A 2BWAA 2B46X 2OKXA 1H0BA 2PHWA 3GDBA 4N53B 2GH8A 2DYCA 5G05L 3ACGA 1ZZ9A 4LTAA 3WHUA 4E4ZA 1TG7A 2IXLA 3MIEA 1HRI3 5E16A 2DBNA 1I5PA 4AVAA 3WOGA 1FATA 1AXZA 2IVIB 4IEPA 4IDZA 2WO2A 2YHJA 3OF1A 1DQ0A 4K9SA 2B7YA 3LEGA 3ZPOA 4D94A 5FPUA 3B00A 1G8WA 1UZYA 3AMQA 4JRLA 1BXHA 1GR3A 1GBGA 4KWJA 2WSVA 1Q8SA 2DUQA 2E63A 4UXAA 4GXLA 2PAMA 2ENRA 2WFF3 4DOUA 4D7SA 4COZA 2UY9A 4WV8A 4KMQA 1MZFA 4IEOA 1CQ9A 1RUE1 1V9U2 3IDEA 3WUCA 3KB5A 3PHMA 1YO8A 4URTA 1HXS2 1DYPA 3E97A 3JB4C 2D97A 1GWMA 2V4VA 1OKQA 3R4DB 4HMZA 1PVC1 4OLLA 1UMZA 4XC9A 4AVSA 4X6QB 4DEQA 4ZPIA 3UETA 5FYMA 4HFSA 2RR13 2WFF1 1CD3G 1QDCA 1RUJ2 3AXEA 5FYBA 1DYKA 5FY7A 3O1PA 2R0FA 4YLZA 1EPZA 4GA9A 4K7JA 4Q4Y2 5FOJB 3AZYA 2B42B 1NCQB 1S2KA 2WYSA 3WR0A 1B35A 5CA6A 1LOAA 2OXBA 2VOTA 2XJQA 2PHTA 1QJEA 2EXHA 4CVUA 1UMHA 4XAAA 3ZYGA 4OZXA 5HV0A 1PVC3 3DXTA 3ZM8A 3APBA 4C1WA 1Y3TA 2XPJA 2G19A 4XJZA 3K2OA 5EIYB 3WDYA 2RR11 3AZVA 4CE8A 3LB9A 3B94A 2LW8A 4NPLA 3J7MA 3WNPA 1GZWB 1VBD2 4P02B 5IVEA 4ORFA 5FY5A 3RI9A 4CDQC 1W8FA 4WM8A 1POV0 2W92A 3ABZA 4ISRA 4OUSA 5J98B 3BTYA 1NX9A 2QBXA 2VUCA 4R9DA 3ZXAC 4YFZA 3KCYA 1W3VA 5H9PA 2JX9A 2V5YA 5GZDA 4J25A 3AVRA 3LOBA 2DVDA 4B8EA 5FYIA 2W0XA 3E6DA 1WLDA 3GM8A 2DTWA 1Q3EA 1LRHA 1UAIA 2R072 3LEKA 1C28A 1WD4A 5F6KA 3RWKX 3U4XA 2XL7A 2IVJA 3WQ1A 4N7UA 4JRAA 2KD7A 4NRPA 2BGOA 3A22A 5FIXA 1KRIA 3BKZA 1UIJA 2E26A 1SPPA 3M3OA 5ABJA 5C8CB 3KV5A 4BQ4A 4MG2A 1RL3A 2CDOA 2IXHA 3ILNA 2UWCA 4AL9A 4AF9A 1H8TC 5GJ6A 4XILA 4MGKE 2YXSA 3VV1A 1CWPA 1GNYA 4Z1VA 2C6SA 3T2PA 4OMDA 1UIKA 3IBMA 4IETA 4RSUA 3D0SA 3WCSA 3B93A 4LBQD 4LHKA 5CFCA 1XNTA 1BMV1 1UD1A 3K3NA 4EYUA 1MACA 4R4ZA 1C8NA 4DPNA 1D4M1 4LEJA 4B1MA 2VCMA 4LBNA 2ZX1A 3POEA 4JC1A 4EN9B 3ZYRA 5FY4A 3VZJA 4AHYA 5FCCA 2JICA 1UW8A 5C3PA 4DEVA 2BW8A 1L7LA 1XE7A 2GN7A 2ZGSA 4NUBA 4GWIA 3AP5A 4FPOB 3ZKUA 3N35A 4MGSA 2GNDA 1AYN3 1VBE1 4P9GA 4QX3A 1QJU3 2F6BA 2O1QA 3I59A 4XIOA 1R1A2 1I6XA 3GBWA 4LXLA 4QM9A 3H8RA 1QJZA 1W6QA 1KFXL 3ASIA 5FMCA 1UY4A 2C1FA 1W05A 1AR62 3PVNA 5IVJA 1CR7A 2WZPP 4QMAA 1REFA 4AFDA 3I3DA 2CYFA 2DCTA 2PAKA 5FMDA 2JENA 3WNNA 2NYYA 4KG8A 3NO8A 4PDWB 3RG0A 1NA1B 3HNMA 1VRBA 4HSJA 1YFYA 1AYN1 1VBE3 4FFGA 3RS6A 2D98A 1V70A 2VO5A 3IDCB 4BQ1A 3WW4A 4TN7A 5F7UA 3MI8A 2WDBA 2ZOEB 1SLIA 2WT1A 5FP4A 3DGTA 4W50A 4MGQA 1PNFA 4Y20B 2NP0A 2ZX0A 4Q0VA 4K20A 1HXS1 2ATFA 1FV2A 2VVDA 3BU7A 3ZYPA 5LA2A 2PHLA 2JJ6A 3DPRA 4AZZA 3THCA 4Z92B 2UURA 4FCAA 4Z07A 3UT0A 5FPBA 1LECA 1RUE2 3WW1A 2NPIA 3GBGA 2NQYA 1JU4A 2IZWA 2QQKA 4P9IA 5JSPA 3T0DA 1H8VA 2JD9A 2WO1A 4D6SA 4PIXA 4YVWA 4Y5Z0 3BALA 5BNOA 3A0KA 1NE4A 1G9DA 2R49A 3KLSA 2Y60A 1RB8G 1VB4A 3NRUA 4BWOA 1ZYBA 5FAXA 1G9CA 5T5PA 5KBFA 1QJFA 2BTVC 4HPKB 3K75B 3AYCA 4P08A 1GP5A 1L7QA 4FFFA 2WC2A 3NMBA 1ZBA2 4OI4A 4QHBA 4OQ9A 4OQ8A 2ARXA 2DDUA 4R8HA 3CJXA 5BNPB 2C24A 4X8NA 4MH0E 3V0BA 3NKTA 2Q1ZB 3H0OA 4PHZA 4QB2A 5FZDA 3W59A 5HV4A 5A7QA 3U0ZA 1UZZA 3A23A 1A8MA 3SH3A 3W58A 1FMD2 2XVGA 1ZZBA 2LTNA 4XFHA 2Z79A 2PLV1 3O1OA 1YNAA 4XE9A 4E2GA 2E51A 2Y6FA 4FPFA 4R9AA 1VAVA 4ZXKA 1H2MA 4FOWA 4YVSB 3VBOB 4LOSA 3AL6A 3SCHA 4AWDA 4AE2A 1ENRA 5JCTA 4HN0A 2OVUA 3L2YA 2R042 2FCTA 5H9QA 3RYKA 5JOYA 1RUC1 5FYYA 3M3QA 2YMZA 5LW9A 4HKOA 4IEVA 1BEV3 3J8F3 1HB4A 3NV4A 4I02A 3ZFFB 4BA6A 4F7ZA 4YVSA 1J3RA 2JE8A 4LJHA 5L19A 1JYNA 1H1AA 4AGVA 2XVLA 3UJOA 4BQ3A 1H4HA 5JDBA 2OA2A 1GQGA 1LKNA 1Z7S2 1DZQA 2RDNA 3NNGA 1TNFA 3VKNA 3ZFGA 1XB9A 1YUDA 3RWNA 1YQ6A 3PUQA 1BLZA 3IAPA 3OUHA 3QH6A 1AJOA 1TZOA 3DYMA 4XABA 4W6XA 3VBFA 3VKMA 3JBG1 4AEKA 5FYTA 1RUH2 4LOTA 4L8QA 1UKGA 2JB8A 2HEYF 4Y22A 2AUYA 1V6IA 5L36A 4IGQA 4RYDA 4S2DA 1ALYA 3POSA 2E7AA 2XLFA 2VCCA 1LNSA 1FAYA 3HOBA 4HVOA 1F15A 4JHTA 4TLFA 5FZFA 3RMYA 5A3PA 2B9UA 3AKSA 1WD3A 1ASJ2 2I74A 3WW3A 2AACA 1N1YA 2OS2A 2JIGA 2BFUS 2WNEA 2YPDA 2D6NA 2V73A 3X29B 4LE4A 4R52A 1JI6A 1I3HA 4CDWB 2YY1A 1D4M2 5FZMA 3WUDA 2X10A 2XH6A 4LO6B 2IC1A 3I7DA 4QXKA 3AB0A 3OTFA 4IEWA 1X8MA 3FFQA 3ZFEC 4KI5M 2FCUA 2P17A 1DZTA 1LOFC 3AKTA 5B4XA 2R0HA 2WS93 5FP8A 4TXWA 2ADDA 3EJKA 4NHKA 4Q26A 3LQCA 1VRH1 5GLWA 4COUA 4XF3A 2YBSA 3RYPA 4Y20A 3WP6A 3WF4A 4O61A 1V6NA 4PF1A 4XF4A 3V0AB 4UFHA 1JZ7A 4J6GA 1YQ5A 2ILMA 1CGPA 4W65A 3SXWA 2GH2A 4N43C 3ZFFA 4XOGA 3I2DA 5GLZA 4WZFA 4XJ9A 1RMU2 4WM8C 4Q0SA 5FPXA 4UT5A 4LT5A 1W2NA 3POWA 1VMJA 1VRH3 4YW4A 2Y6LA 3T2OA 4HVRA 1XYNA 4CUCA 1KITA 3WF3A 1OA3A 2HWD2 1DGRN 4YGCA 3ST7A 3ZYFA 3OUJA 2PAEA 2WNVC 3VLBB 5E8AA 1HQLA 2HWD3 3NWKA 2BYVE 5JLVA 1UL9A 5FJKA 1PGW1 1CJPA 2ARBA 5JWPA 4N9HA 2WT2A 3I59B 3Q8BA 4XTPA 1N3QA 2WT0A 4FPKA 2VQTA 3VBHB 2FBEA 3CU7A 1HJGA 2JE9A 1D4VB 4LHLA 1M4WA 4A6OA 3R6SA 1W6NB 5DAXA 4OVEA 5CKQA 1O6UA 3JCIA 5F8PA 5CZKA 3DYPA 1OPMA 2P3KA 3HNYM 5ANNA 1LHWA 5HCBA 3ZXGA 3AKRA 2E31A 2PQSA 2HWD1 4FFHA 4Y5TA 4A45A 4E2SA 2BWCA 5IK7A 4XXAA 2RR12 1JS9A 5C33A 4YSFA 2V09A 1MEC3 2IFRA 1HDKA 1VALA 3CF6E 3DECA 5JZGA 3AVSA 2VD7A 3LIGA 4OI1A 5DDJ2 2VZ1A 4MSVA 1W04A 4K1ZA 3GXUA 4FPJA 3RYRA 4I01A 3HIFA 4K8FA 4YM1A 4DUWA 4AAPA 1STMA 1LOBA 2R7EB 2WA4A 1OSGA 2V5DA 1SFNA 2W95A 4B3NA 4EV0A 1JZ5A 3QBQA 5HI0A 1GZTA 4AEJA 2DBIA 1PVC2 1UF2C 4PT6A 4I3GA 1XYPA 3K4DA 3ZXFA 3AK0A 3H8UA 4AFCA 3D3AA 3IAQA 4GZ9A 1KDMA 4Q0PA 1UYXA 3ZFGB 2OIIA 1QHDA 1W9WA 4NWWA 1XRUA 5C5UA 3KVAA 5I91A 3M3CA 3OPWA 1WA4A 4NPMA 1AL0G 5LY2A 4A41A 1PMIA 3CIHA 5JXHA 1AYM1 4OYUA 2D3SA 1NLRA 2K0GA 2VW2A 2NMNA 3NNLA 4LO5B 5FWEA 3LZZA 4H7LA 4BLIA 3HN1A 3NAPC 1QXRA 4QPWA 4EZHA 1AR92 3UGFA 5LWBA 1NA1C 2C26A 5I0DA 2VZOA 4NPRA 4JGZC 1L7RA 5F3GA 1URXA 1UY3A 2JWPA 5IYYA 2XJUA 3RVHA 5FMOS 3CZJA 4LNVA 3RDIA 2TEPA 3VZLA 1V6KA 1COV1 3D82A 2HBTA 1ULGA 4BHPA 4XUOA 4C90A 1AYM3 3EXUA 3B5LB 3N9MA 1FYUA 4XVHA 2ZBJA 5EYYA 4TLGA 3L9JT 4CCNA 4GULA 1G7YA 1S0IA 1ZRCA 4ZS2A 1QEXA 1Q8PA 1GYKA 2UWAA 4BISA 1PIV1 1EV11 1R083 1YQCA 4PI0A 5CKNA 1C3HA 3LF7A 1CAUA 1BK0A 4CU7A 1NCQA 4RGAA 4ISQA 4MLOA 2RHPA 2HWC2 2XKPA 3O0VA 4GAZA 2AEYA 2BNNA 3URFA 5J7MA 5DG1A 2VC9A 2QTWB 4OHVA 1ULPA 3P3NA 1MS5A 4AEDC 5KHJA 3O12A 1YEWA 1IS4A 2I45A 4DO0A 1JTZX 2WSUA 5FY9A 1X9TA 3ZMNA 2WWUA 5LK7B 2VCBA 5ACA2 4FTSA 2XUMA 1YIPA 5DUXA 1R092 3BVCA 1CAVB 5LK5A 2O8OA 1UU6A 2A6ZA 3UGHA 2DFBA 3OGSA 2QVSB 4FTEA 2HWF2 1FPN2 1HRV3 3ECQA 2BBAA 1YQ2A 3AMPA 2R1DA 2P3JA 1SBDA 4UW3A 2VOKA 1R1A1 5LBBA 4NROA 2VZUA 4Q29A 3VHOA 1ULEA 5JXGA 3HBZA 4YPJA 4WZCA 4P9YA 1WLCA 1XNKA 2WRAA 1ZA7A 1PMHX 2ZACA 2JXAA 4W6YA 2HWE2 1VIWB 4IEXA 1AR81 4BMEA 5A3WA 4CP1A 5C3RA 4N53C 3KMHA 2JDUA 2P1BA 4LKSA 2YFZA 2VMCA 1RUI2 4IEQA 2D6LX 4KQ7A 5LA0A 3LOIA 5CU1A 3TEYA 3KT4A 3NAPB 4OHYA 3ZN6B 4D0QA 4HG6B 2QJVA 5C3SA 1WBLA 4AW7A 1AR83 4BOWA 3ZPYA 1ULFA 1RJ8A 1TME2 2ORXA 3IM0A 2ZMNA 1GP4A 3LA2A 4P5HA 2LUWA 5FZCA 3U37A 3CKHA 2L9LA 4IE7A 5BXXA 5F5IA 4XF9A 4ZKTB 2JB4A 3ACIA 3HNBM 2EA7A 5GZEA 3FUOA 3WZ1A 1GMMA 1ZM1A 4Q1PA 1OMIA 2EAAA 1J1LA 3T3YA 3ES4A 3SMHA 4V1PA 4XQ4A 1WMFA 4JGYC 5FY0A 4QKBA 2RS52 5I8YA 5EXOA 3E6BA 4XEZA 4QB6A 4O7XA 4FOVA 4JDNA 4QPGA 3BB6A 3USUA 2WYFA 5F1RA 2Q4SA 3B01A 5CB7A 3HBKA 3NQHA 3RZJA 2D3PA 3WX5A 4Y33A 1OD5A 1VBC3 4CUAA 1X50A 1FV3A 4M00A 3WNKA 2VOWA 5FYSA 3WXPA 4GB32 3BGAA 3CZUA 3NV3A 5EHDA 2PHRA 1PO22 4O9GA 4ASKA 3FZ3A 5IK4A 1EP0A 4CP2A 1K5JA 1XNCA 5DUUA 1T2XA 3O7OA 4U36A 4XUPA 5A33A 4E2QA 1CVNA 1M06G 2P4EA 5JMOA 2X8KA 2A73B 4FQ4A 1A3KA 3KGLA 4M3CE 4YM2A 5AC91 5LEKA 1BEV2 1UWWA 1UOGA 1D0GA 2X53S 1X8EA 3HR9A 1SQ4A 2IXCA 5I0TA 3ZXJA 1GOHA 3AP6A 4AFBA 2ZGKA 3H1MA 2C4XA 4BXFA 2VW1A 3CDZB 4LLOA 4RQPA 1RGSA 2NN8A 2PHUA 3C8XA 4K3UA 4KU8A 1W6PB 3ACLA 5IW0A 1N1SA 4WM8B 3HWJA 3FHQA 2YPJA 4FXKB 4HLTA 1UYPA 1S0BA 1OHFA 3OJBA 4AR2A 1MZEA 3LSEA 4YVWB 3H50A 1OVPA 4GMP1 3PTRB 5KXBA 1Z7S1 4DUVA 4Q4V1 4QX1A 1PO13 4LULA 1QH6A 4FPGA 4AQ2A 4JQTA 4HOOA 4XMIA 2YBPA 4D6RA 1MZ5A 4A3XA 5HPOA 3HD8B 4FTBA 5K0UC 3NKGA 4MYEA 1GANA 2DUOA 5JZGC 3I3MA 3B69A 4Q4W3 4YW7A 3OEBA 2VMIA 1O3SA 1NY71 2UY8A 1PO11 2HWC1 1XC6A 1CPNA 1W9TA 3L2HA 1VBD1 1T6BX 4RR3A 4UFMA 2CGNA 2N7GA 4WBBA 3ZN4A 4XMAA 1SFPA 1K5MA 5ERLA 4M3CF 3LSDA 2WZR1 1BCXA 2X09A 3FMGA 2Y64A 2C5DA 2HWF1 2Z42A 1MVQA 5FYZA 1Z0HA 4ATFA 4HKLA 4QB1A 4IGOA 3WD5A 5IFTA 4MADA 3TNPB 2CV6A 1QJY1 2W1UA 1TEIA 1ZREA 2BJSA 3I3EA 1W9FA 4L97A 2GC3A 5C70A 2D6MA 1TMF1 2P34A 4LKDA 4YW5A 3VD3A 4IERA 4AI9A 2LROA 2J7MA 3GNEA 4N7IA 1JHNA 1OI6A 3DUIA 4MGIE 2QUOA 2CTVA 2CL2A 1ZBE3 2VMGA 3NSTA 4AVTA 3DN7A 4PJYA 4Z2WA 4HONA 5IVYA 3J7LA 3UK9A 1JZ6A 4Q4W2 4L0PA 4XFCA 3ZO0B 5FZ6A 1NXMA 4LBLA 4D8MA 5D8AB 4RL7A 3PIJA 4I2OA 4BPZA 3UKVA 3LWCA 2CNAA 3THDA 2IFWA 2ZTNA 3E6CC 1X33A 1LAJA 1JZ4A 3FBYA 3W9AA 2PQQA 5C71A 5FWJA 4AI0A 1YYNA 3KV4A 4MHUA 4QX2A 1ZBE1 1UOBA 2VTXJ 4WVZA 1C4RA 3IMNA 2MEV3 3EB7A 4SLIA 1J3PA 2IXKA 2X5IB 1NCQC 3WSOA 4KBZA 1HN0A 1JBCA 4AEMA 2Q8EA 1W2AX 5A7OA 3DXUA
chains in the Genus database with same CATH topology
1YRZA 5KC6A 3KQRA 1C5IA 1QXJA 2MEV1 1KQRA 3AX4A 2HWB3 1KXGA 4HSLA 2A75A 4YGBA 4GKXA 1WMDA 3TBDA 1O3RA 1EAH2 4YG6A 3JZVA 4B7EA 1Y7BA 1DGWA 5KC5A 5IK8A 2RMU2 4E27A 4NHMA 1F9KA 1ND2A 5K0UB 4DINB 2OZ6A 4LBJA 1JH5A 2G9GA 4PLMA 3T1MA 3V56A 1PZ8A 4DY5A 2RS11 4AQSA 1H2NA 5F6LB 1V6MA 4CDUA 2ET1A 3NVCA 1N47A 5BNNB 1NQJA 5GZGA 1LOCA 3AYEA 4AHZA 1LU2A 4I30A 1O7FA 1VBB2 2Z2SB 4WM7B 3MGUA 2GC1A 1OLQA 1LHUA 5DDJ3 2GDFA 3PMSA 4S2HA 4WM7A 2ETEA 3FLTA 1SFYA 2IXJA 4MGYE 5D1IA 4BZ4A 2JEMA 5K8SA 4XDQA 4Y26A 1J59A 4QQOA 1OA2A 4XQDA 4RHV2 4P14A 2QNKA 5DDJ1 4BIOA 4RHV3 5FLJA 1VBA2 5FOBB 2DFCA 1PGL2 2ERFA 4EWEA 4FPYA 5IK5A 3ZFEB 4FOQA 2ZABA 1I9RA 4Y24A 5BNOB 5HXVA 3TAYA 4O9EA 4J1WA 4KWKA 1OOPC 3EBRA 4FAGA 1XU1A 1SLCA 1ZVFA 2HWE3 3ETQA 3MYXA 4XBLA 3RQ0A 5SV5A 2GU9A 1CAWB 5DZFA 2BNOA 4JTNA 3UKTA 3VDDC 2R16A 4Q8LA 4LE3A 2PA7A 4G4FA 3AKPA 1E57A 2HWE1 3HT2A 3ZIWA 3POYA 3OPZA 1TME3 4IV1B 3CEWA 3VBOA 2VY0A 2TBVA 4ES8A 3I54A 1RHI3 3ME2A 1GZWA 3IIAA 3NL1A 2JKBA 4IEYA 2VNGA 4N90A 1CESA 3JD72 5GZFA 1O4YA 3QLQA 4FO9A 1D0HA 1UU5A 2DF7A 1GLHA 3WDWA 4HL0A 5K0UA 3VBRC 1RHI1 4OHWA 1REDA 2AREA 4MVTA 1IPKA 4BM8A 4PF5A 4CDQA 3K48A 2WJSA 2ZX3A 1YHFA 4RR3C 1GQHA 5KXCA 4AEDA 4YG3A 1RUG3 1JXNA 3AP7A 4FXGB 4R4XA 2RS32 2XJRA 1SLAA 3ATGA 1RUNA 5GKAC 4FP3A 1DG6A 4JV4A 3PVEA 1AR91 4NOTA 2ZGQA 1RUG1 2D7FA 3WNXA 2CWMA 4XJUA 3WT3A 1BEV1 3WV6A 2BEOA 1LGCA 1WBFA 3ZFFC 1MS1A 4BH9A 2AR6A 1AR93 3CJIA 1H2KA 4JGZB 1PO21 4Q4V2 1A8DA 1AR72 3QOPA 4XFGA 1G86A 1RUF1 4FBFA 1IHMA 4EJRA 4P9LA 3BCWA 3FJSA 1B35C 4YW2A 2SBAA 5CFDC 1QWRA 4LBQA 4YGEA 1PO23 3WP5A 4MXWB 3KSCA 3TRSB 4UW4A 5FDBA 1CAXB 4WVMA 4QQ2A 1GZ9A 2XWJB 3VBHA 1RUF3 1H2LA 2GALA 1LCLA 4I3PA 4K40A 4FPLA 1LENA 2WS91 3KS7A 4QPIC 1FOD2 4MUVA 1FNYA 5SV8A 3A0NA 2ZGMA 1IQAA 1AXKA 5L7OB 1W6MB 2YDEA 2D3RA 1RINA 4KGQA 2EXKA 1QGLA 4INDA 1L3JA 1F2NA 5JZGB 4LBOA 4H14A 4RD7A 4L2NA 5A3LA 2XJTA 2B45X 2VOXA 3I4IA 5C8CC 4P9XA 2E7TA 2JG9C 1SLBA 5JI9A 4CTEA 5DZEA 1ZA4A 2WNUB 3BOPA 2BQPA 2BVVA 3KM5A 3OBRA 4XJWA 1ENQA 5CG8A 4NWVA 4XBNA 1UX6A 4XZPA 5TSWA 1QXPA 3SNMA 2JDZA 4LBMA 1S0CA 2A3YA 4LR4A 3VZOA 5CFCC 2YGMA 5E89A 5HI0A 5JIUA 3S0MA 2E7QA 2Q1MA 1HW5A 2EIGA 1S0DA 4WM7C 5CFCB 3VHNA 1BK1A 1BZWA 1O5UA 5T5JA 4DMIA 3H7JA 1QKQA 5E88A 1MEC1 4XFFA 4IV3B 3IPVB 1QH7A 4K1YA 2VNOA 5J48A 3ZXLA 1QNYA 5HCFA 2W08A 1UU4A 1ULDA 3AFKA 2HEVF 1EPWA 1BBT3 4YARA 5C6CA 3TWIA 3N7LA 1RVF1 2H6CA 4Y4YA 5I0UA 2GAUA 2XWBB 1H8TA 1PM7A 4LA2A 4Z82A 1EAH3 2QDNA 4FVVA 4QPIB 1I5ZA 1AL22 3OGGA 2VULA 1ZZCA 3AJZA 2RMU3 1W6QB 1B09A 4QPGB 4UW6A 5J09A 1FI2A 4LHNA 2C0ZA 2FMDA 4KG0A 1BBT1 5C4WA 4BMBA 2BNMA 4CEYB 2QDRA 1FMD3 4DXZA 2WFF2 3VBFC 2ZMKA 4C0HA 2RMU1 2D93A 4AHWA 2QZ2A 1LR5A 1COV3 1RJ7A 3WCRA 3DF0A 2AENA 2XHKA 4A7YA 1FMD1 3ZSEA 2YUEA 3VZNA 1PIV2 3MDPA 3ZYJB 2DCZA 2AZ5A 1PIV3 1R081 3M3EA 3AMHA 1SCRA 3KD4A 5EZWA 4IV1C 2G4IA 2D44A 2VQAA 1H1MA 3ZFEA 1OQEA 2R063 5BYNA 5BNNA 3WG2A 1U5IA 2PHXA 1A78A 2TNFA 3KT7A 1S1AA 2R041 1NY72 1S55A 2TUNA 2ZGUA 4XFAA 1ZRRA 1C5HA 4Z8BA 1GZCA 3TB0A 2WKKA 1OFNA 1U12A 3UV9A 1UPIA 2B5HA 1HRV1 1W0PA 2R043 4QPGC 3ZSMA 1AX0A 3CO2A 4AYUA 4MGZE 5BNOC 4B29A 4RR3B 2EALA 5JSRA 1VB2A 1AYN2 4QT6A 3AXDA 4QGLA 5KHHA 1G9AA 2OUJA 2A3WA 1Y43B 3VBUA 5KHGA 2LALA 1I1EA 1HLCA 2PHDA 3VBRB 4P9JA 3FFZA 1W6OA 2DVBA 4HETA 5AVPA 3AMNA 2FZ2A 1VBE2 1G6NA 5FQ0B 2AYHA 4CEYA 4GMP0 1OQ1A 3EHKA 3E5UA 4X8PA 3RJ2X 4PDWC 4Q8KA 1SMVA 1T6GC 1Y9QA 3ALQA 1LHNA 3EO6A 1OLRA 4KL1A 4RS5C 3SCGA 3MIFA 1IS5A 2ZGLA 5L73A 1S2BA 1MEC2 3DV8A 4CDQB 1RIRA 3WDXA 1BMV2 2JE7A 5CFDA 5F5QA 5A3MA 4M3CA 5FO8B 3H7YA 1ND3B 1OFSA 3B7MA 3VBSA 1EYBA 5BNNC 4XJAA 3USSA 5BPXA 1XXNA 1R1ZA 1HX6A 3N7MA 4Q0QA 2QE3A 2EXJA 1MS3A 2VUJA 3JB8A 2QKDA 4Y1XA 3BIWE 4UBHA 2Q30A 2PYTA 1N3PA 1YI7A 4N53A 2D6KA 4R9CA 2BVBA 4XHBA 3M70A 5AC93 1O5LA 1C8M1 1DGLA 1HQWA 4AVCA 4FAHA 1ZZ7A 4EN8B 1PK6C 5BUVA 1LESA 1UCXA 5CBLA 2NMOA 1WLTA 3MFCA 1MS4A 1NYWA 1V6LA 1DF0A 1QOSA 1VJ2A 4OI2A 1C8M3 3ZSJA 4H3WA 5B2GB 4GWMA 1RUJ3 3TOJA 3GHNA 5GZCA 2WIIB 1W0OA 1QDOA 1Z7S3 4JAAA 4Q4V3 3RRDA 4EROA 1VP6A 2ZA9A 3OY8B 4PBPA 1Q5OA 5AFBA 3OGJA 2A70A 1HV0A 1R091 1FT9A 1RUG2 5T54A 3QD6A 4AFMA 3WINE 2GNBA 2MPFA 3M3IA 1RUJ1 1SACA 4QGMA 3U07A 3MIBA 1ONAA 1YFWA 2WNVA 5KXEA 1KS5A 3LAGA 2HWC3 4QPYA 1VBD3 4Q1RA 2XGXA 1RUF2 3V65A 1MS8A 4H55A 1C57A 4IEUA 1R093 2WZR3 4TSVA 4CYDA 1WW4A 4F3JA 1AR71 1DGRA 2ZCWA 2PLV2 2X5IA 5JOZA 4GALA 1CONA 1DBNA 5CG9A 2OUHA 4CDWC 1RUI1 4B4RA 4Q4X1 2R073 4YM3A 3KZ4C 5A32A 1TMF3 4Y1VA 4DRRA 4J1XA 3AYAA 3WG4A 1WCDJ 3H1WA 1AR73 4YZ5A 2ET7A 4HK9A 4LUKA 1RUI3 1RC6A 2R1BA 4Q4X3 4QX5A 4AGGA 1R082 3KT1A 1QY4A 4AVVA 2UYBA 2OYZA 3DKWA 2YZ4A 5GLUA 1O3QA 1YI9A 3IKWA 2WZR2 5T55A 2XB6C 1HRI2 1UPSA 3ILRA 4XBQA 1D2QA 4CEWB 1C1LA 3N3HA 5E1RA 5C4WB 1LGBA 1QJX3 2MEV2 5C8WA 1U5XA 2HJIA 3GZAA 4JVAA 1SBEA 1RHI2 4TYSA 1J1TA 4YM0A 3VKFC 1PGSA 2QFEA 4P9WA 3PTYA 2HWB1 3JQWA 1F31A 1H30A 1AL21 5ABJC 4Q4X2 3VBFB 1O91A 1RITA 4EN6B 5K7PA 2RE9A 3J4UH 3ZIXA 2CAUA 5FFOC 1DGWX 1RVF2 4XPVA 2VVFA 3MPPG 5EJ3A 3BOWA 2ZHNA 2JG8A 1AL23 1FXZA 4N43A 1XYOA 5CAZA 2RS13 2ZZJA 5AC92 1KJRA 4NVPA 3VBUC 1VAMA 2WNUA 4XQWA 4FSJA 2H0VA 5FO9B 3WDVA 1APNA 2FQPA 2I07B 2VQ0A 2WWSA 1J58A 1JUHA 5JMCA 2Y0OA 4CDXA 3MFAA 5FREA 5C8CA 1DDLA 4WVVA 4Q4Y3 1ND2B 5JR7B 5K9YA 1Q43A 2K9ZA 1QQP3 5DG2A 1GNZA 4YG0A 1DQ4A 3IPVA 3O5SA 4K21A 4MX3A 1PO12 4XFBA 1NQDA 1VBC2 4SBVA 4AQ6A 4COYA 4ONUA 2UWBA 2Y38A 4YRDA 1F8VA 2FZ1A 1VR3A 1ZX5A 3PNAA 1N1VA 1K5MC 3WY6A 4RHV1 3USUB 2RS12 1AX1A 4M01A 4Q4Y1 4FQZA 2DTYA 1QQP1 2B8MA 3OD4A 4CEWA 3CLPA 1WUVA 1LEDA 2VUAA 2JG9B 2ZGTA 4GB31 3PVBB 5FQ0A 3RNSA 3FBMA 4XW3A 4JDMA 1CAUB 2VXRA 1HKDA 1LOEA 4XFIA 3U11A 1Q8VA 4TWTA 1PHMA 1RUH1 2VU9A 5CNAA 2WS92 4BYYA 2D6OX 2DVAA 2A71A 3FX3A 1QNWA 1O3TA 4DNYA 1VBB1 1AJKA 2AH2A 4A7KA 1XU2A 1O4TA 4L11A 4YW1A 2FHRA 5JPNB 3PMEA 1W6MA 4FPCA 1RUH3 5I0RA 3D8CA 3EQEA 4A7ZA 4B7KA 2JG8B 2Z69A 1KJLA 4D69A 4LA3A 1IOAA 3OD0A 1TME1 1U5YA 3RI8A 1ZBE2 3R4UA 4Y22B 3ZXDA 3PJYA 2GSYA 5ABJB 1H4GA 2E9QA 4DZGA 3OBTA 3S30A 1Q8OA 4L9BA 3VZKA 4QQPA 1WW6A 1RUD1 5CFDB 3TN92 1ZZ8A 1ND3A 1IS3A 3FHIB 3AZZA 1X36A 5ACA3 3MZHA 2RS51 2A6VA 4LLFA 4RS5B 3S6PA 3N7JA 3ROUA 2D5HA 4OHXA 1ZBA1 1MQTA 5JOWA 3VL8A 3GHMA 4JQRA 3B02A 4QQHA 4YVSC 3B3QE 4I0AA 4ASMB 4DQAA 1RUD3 2GC0A 5AVAA 5FLHA 3JD71 4OHZA 2C9AA 2RS53 4L92A 1QJY2 4FPHA 4E4SA 4JTOA 1NZCA 1V00A 2ZX2A 3KCXA 1ZBA3 2ZKNA 2HWB2 3VDDB 3GZTB 3H3ZA 4DB5A 4COVA 4UBGA 2KA3A 3AYDA 3S7EA 5I0SA 1WLWA 1W6NA 2NLRA 2CGPA 4LBQB 4MZUA 5BNPC 4AK3A 2WLQA 3C3VA 3VBUB 2Q8OA 2ZKLA 5FRAA 3GZUC 2MHFA 3PVOA 3OYWA 2XG3A 1YFUA 3FWEA 1AR82 4S2FA 1PK6B 5BY5A 1J3QA 2IWGB 3OCPA 1JN2P 4XETA 5I8SA 3VHRA 1QMJA 1LODA 4YZ3A 4I0BA 1ZRFA 2OPKA 3Q9OA 4Y1UA 2YV8A 1RUE3 2XLAA 4IESA 1YJKA 4XF0A 4C91A 4HN1A 1DQ5A 3FE5A 3AMMA 3WP4A 2ZGOA 1VLNA 2XL9A 2RM23 2GMEA 2VECA 5J37A 1N3OA 3VUOA 1Q56A 4M3CB 3VBHC 3KGZA 2BGCA 2DU1A 4AI3A 4JGYA 3AZXA 1BVP1 2JECA 2WA3A 4KBBA 3WVJA 1W39A 2RM21 4AHXA 2WINB 4I0WB 2ZPXA 5JPMB 3FC0A 4GQ7A 4LO7A 4IL7A 1CJDA 3B9IA 2Q0AA 1VBA3 3D4KA 4B4PA 3N4MA 2I2SA 3NV1A 1SLLA 1DIWA 3VHPA 3ZX7A 4U2AA 3V0BB 2WLPA 3VBSC 4AI2A 3MW3A 4IV3A 4IEZA 4QGNA 3WLUA 4AI8A 1MZ6A 1VBA1 1CN1A 2JG8C 4DRVA 1AYM2 3THPA 3NV2A 5FPZA 4NHLA 1Z78A 2D5FA 3N36A 1S0GA 4JGZA 3JQXA 4YNIA 3ZXKA 2VW0A 3ES1A 1X82A 4RQPC 4XXPA 2ZS6B 1NXD1 4YGDA 1H8TB 3CL1A 2K2SA 4HZFA 3SH4A 1RMU3 1DU3D 3ZVXA 3MLLA 1U5ZA 2GNTA 4BLJA 5JIAA 4C0BA 4OULA 5T5LA 1AX2A 1GSLA 3QH7A 3AP9A 2A5ZA 5BV6A 1LGNA 1DQ1A 1LHOA 2YYOA 1QOTA 2WNVB 1PGL1 2DVFA 4RGGA 1RMU1 1D4M3 4M0NA 1FX5A 4HK8A 3VKOA 4GWNA 1YLLA 2GNMA 5EYXA 4QPIA 4CDWA 5J96B 1LULA 2PN5A 2DVGA 4R9BA 1W2UA 4X6RB 4Q2FA 3AJYA 1FNZA 3GALA 5H9RA 4N43B 2HEWF 1UKRA 2WFPA 3T2TA 1RVF3 1QJU1 3LA7A 5BNQA 2DURA 2VG9A 1NCRB 3WG1A 2O8QA 4YZ4A 1PGW2 1POV1 1EAH1 1SDWA