1CPNA

Native-like in vivo folding of a circularly permuted jellyroll protein shown by crystal structure analysis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
208
structure length
208
Chain Sequence
FDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGPAHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIKWYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSNGSVFWEPKSYFNPSTWEKADGYSNGGVFNCTWRANNVNFTNDGKLKLGLTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CIRCULARLY PERMUTED
publication title Native-like in vivo folding of a circularly permuted jellyroll protein shown by crystal structure analysis.
pubmed doi rcsb
source organism Paenibacillus macerans
molecule tags Hydrolase(glucanase)
total genus 47
structure length 208
sequence length 208
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1994-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cpnA00
4AGVA 3A0NA 1DZQA 1Q56A 3ZPYA 2CWSA 1MVEA 3PJQA 4FP3A 1W6NB 5T52A 1G86A 1AX1A 3RMXA 3USUB 1GZ9A 2DUPA 5JMCA 2KM2A 1SLLA 1FATA 5L73A 4AVSA 3AX4A 4R9BA 3OJBA 4HL0A 4Y22B 1FAYA 1JHNA 1WW7A 3IKWA 1AJOA 1BXHA 1UZZA 2R0HA 2VW1A 4Q8LA 4XILA 1ULGA 3ASIA 4ZKTB 2ZGRA 5GLWA 2YXSA 3VKNA 3BIWE 5JOZA 3I4IA 3T1LA 1LHOA 2A6XA 3FLPA 1O4YA 1JYCA 2EF6A 2ZGPA 1W6QB 4HANA 2E7TA 2D6OX 1OFSA 1WBFA 4Y1XA 1QNWA 1Q8QA 3PVOA 4M01A 5DUVA 1G9BA 1QGLA 1IS5A 1RINA 1G7YA 2PHXA 1LHVA 1DYPA 2E51A 5CAZA 1GZWB 2CWMA 3AZXA 4M3CE 5FRAA 2AYHA 1SLTA 4XBLA 3ATGA 4XJ9A 3B9CA 4TZDA 1LGCA 1LENA 1KDKA 1SLAA 1Z78A 3M1HA 1SBDA 4BLIA 3RMYA 2GNMA 3QCWA 1N3OA 1IKPA 2Z42A 2DUQA 4UW3A 3WUDA 4UW6A 2D43A 1DQ4A 3OGGA 3BTAA 2ZGTA 4YGDA 5KXEA 4YZ3A 5FREA 3CNAA 1NLSA 2W08A 3QLQA 3R05A 3ZSMA 2WT1A 5DG1A 3UK9A 3OBTA 1MS1A 2R1BA 4PCRA 3PVNA 1G8WA 4WV8A 3APBA 3GALA 4JCKA 1MS9A 3B00A 3ILNA 4YFWA 5E89A 5HCAA 5DZFA 4YW2A 4ATFA 3GNEA 1QKQA 2D44A 5DZEA 2DVGA 3NV3A 5IUQA 5T5JA 4F83A 1CN1A 1GNHA 2LALA 2ZGSA 3Q9OA 1MS0A 5EYYA 1FNZA 3OYWA 4NO4A 2YY1A 1ZM1A 4XZPA 1V6OA 4M00A 1BZWA 1SLIA 1MS5A 4FPOB 1BJQA 5DZGA 4YFZA 1WW4A 1OQ1A 4AGGA 3U4XA 4FQ4A 4XJ8A 4YM1A 1CPMA 4XE9A 4Y1UA 1CR7A 2JECA 4WVVA 4ATEA 1UAIA 3O0XA 2WT2A 1A3KA 1W6MA 4AVTA 4K1YA 4LBMA 3WZ1A 1MR5A 4FOVA 1CQ9A 4Q1RA 4BM8A 5H9PA 3SH4A 4AWDA 2A75A 2V73A 3H0OA 3IPVA 4DPNA 2EAKA 4GWNA 1G9DA 5GZGA 1HQWA 1UPSA 2AGSA 3FBYA 1URXA 3BOPA 4LBLA 1SCRA 2ZBJA 4BMEA 4UW4A 3R4UA 4P9YA 5KXCA 3D6EA 5LK5A 1SCSA 2P3KA 4Y20A 4R9DA 4R9CA 1F31A 3AJYA 3LSDA 1Q8SA 4UW5A 3N7MA 2C9AA 3INAA 1FV2A 3AZWA 1V00A 2DVAA 2JDZA 4XXAA 2DWRA 4XYXA 4FPCA 1W6PB 4GXLA 3WDYA 3NWKA 1UL9A 1WBLA 3NV4A 4PF5A 4ZXKA 3M3OA 1QMJA 3UJOA 2D6PA 1S0IA 2EXIA 1JYIA 5HCBA 4M3CA 3V64A 3WHUA 1BYHA 2ZHKA 4I30A 3FUOA 3V0BB 1GANA 1LOBA 4XJUA 1GV9A 1GYKA 2ZGOA 1W6OA 4OZXA 3L2YA 1B09A 2GDFA 1Q8OA 3M3EA 2WNEA 5BYNA 1W6NA 2EIGA 5T5PA 5EXOA 1U0AA 2CTVA 1WD4A 3O0VA 5GLVA 1TEIA 3IM0A 3ZSKA 2JD4A 4ISQA 1J1TA 1CESA 5E88A 2UWCA 4XBQA 1G9AA 1V6KA 3D4KA 4YGEA 3RG0A 4ASMB 2DVDA 5GLUA 4GA9A 1DQ2A 1YO8A 3M2MA 1BQPA 1V6NA 4KBBA 1A78A 1H9WA 2XG3A 1S0CA 2VXRA 1QDOA 3WHTA 3N35A 2PELA 3VKLA 2D6NA 4XDQA 5DXDA 1YIFA 4DRVA 1CJPA 1N3PA 2E6VA 3W59A 1LEMA 2OW4A 4W65A 4YW1A 1WLWA 3N7JA 4LBQB 1IOAA 1CIWA 3O5SA 3HMYA 4C1WA 2A5ZA 5JDBA 3ZYPA 5KXBA 2W68A 2ZHMA 2CY6A 2ZGQA 1LCLA 3AYDA 3VKOA 2NN8A 4C1XA 2D3SA 2SBAA 3SITA 1PZ7A 3ZYRA 4BOWA 1QNYA 2R1DA 3NV1A 2WJSA 1LOGA 5CBLA 5SV8A 1GSLA 4YM0A 3WDWA 2VUAA 1Z0HA 5GLTA 4YG6A 3B01A 2P37A 1ULCA 1LJ7A 1N1TA 2GNTA 2ZZJA 1R1ZA 1N1VA 4XTPA 3RS6A 2A6WA 2AREA 5KXDA 1I3HA 3FUQA 3JU9A 4FPLA 2DVFA 3V65A 3ZXLA 4XHXA 2DV9A 5IK5A 4Z8BA 3HN1A 5T55A 3WCRA 1MS4A 1IS6A 3LCPA 3AP7A 4RA0A 4TYSA 1LOFA 1C1LA 3N7KA 2DVBA 1AXZA 1IS4A 2CNAA 4AVVA 2W39A 5IK7A 3VKFC 5DUWA 3NV2A 4FPGA 1D2SA 2VW0A 1O4ZA 1QOTA 4FPHA 3WDXA 1S0JA 3D5OA 3ZXFA 3ZSLA 5T54A 1C4RA 4U2AA 1WD3A 1ZA4A 3AXEA 2OUJA 1S0EA 3AXDA 4XMIA 3WNXA 1Q8PA 3DUIA 5GALA 1N1SA 3KQRA 4IQPA 4XIKA 3DGTA 3SH3A 3KM5A 2EALA 2JE7A 3W58A 1QF3A 3VV1A 1CONA 2JKBA 1S0FA 3B69A 1LGBA 5H9QA 1UZYA 3WDVA 2NP0A 4AGRA 1MVQA 1I1EA 1HLCA 4L8QA 3WDTA 3POWA 3HR9A 2ZGNA 4YZ2A 3WVJA 1JOJA 1YI7A 2AUYA 2NM1A 2ZGUA 3OBRA 4LBJA 5JVVA 3RRDA 1IS3A 1LECA 2GN7A 3AP4A 1UMZA 4D69A 1MZ5A 3IN9A 3M3CA 1C1FA 1AF9A 1SLCA 3OY8A 2Q5TA 3AYEA 4PQ9A 3A0KA 1HDKA 2BQPA 5T50A 1DQ6A 1APNA 2UWAA 4YW3A 5EYXA 1H30A 4FQZA 5AVAA 5GZEA 1GICA 1LTEA 2ARBA 1X50A 1W6PA 1DBNA 4XJZA 4K1ZA 3OYWB 4YW5A 2WLQA 2D7FA 1ULDA 2ZMNA 4PBPA 1G9CA 1UKGA 2YV8A 3AFKA 3AZVA 2YROA 4YZ1A 1KJLA 1DQ1A 2P3IA 1LGNA 3WG3A 3SH5A 2PHWA 1V6IA 4Y24A 1LULA 1LHWA 2EXKA 3V0BA 3PMEA 3FLTA 4H55A 1W0PA 1N47A 1YXWA 4XBNA 4Q8KA 2LTNA 2WKKA 1W6MB 1WW6A 1LOFC 2D3PA 2V5YA 2D6MA 3AP5A 4FP2A 4M3CF 2VY0A 3SLIA 2ENRA 2AR6A 2EXHA 4Y1YA 1G9FA 2D6LX 1GBGA 4LBQD 5HCFA 4YG0A 3AP9A 3IPVB 1HQLA 1FX5A 1LHUA 1ENQA 5JOWA 2JJ6A 2YZ4A 4DS0A 1MZ6A 1JXNA 2C5DA 1DHKB 1ONAA 4NOTA 1GKBA 4XMAA 3USUA 1SBFA 2D3RA 2B7YA 1JUIA 4ISRA 5F5QA 1A8DA 1Q8VA 2JE9A 2OUHA 1AX2A 4Y22A 1S1AA 2UU8A 1RIRA 3M3QA 1DLLA 2UURA 2A3XA 1S0GA 1CVNA 4CZSA 2A6VA 4LBQA 5DG2A 4YZ4A 2OVUA 1S0DA 2VH9A 3AYCA 3IMNA 3V0AB 1DYKA 4LBNA 3ZXEA 4Q1PA 5JLVA 3SNMA 3WLUA 2WT0A 2PHTA 4XOGA 5CNAA 3JUUA 1LOAA 1W6QA 3WOGA 4CRQA 1W0OA 3N36A 1F5FA 1VAVA 2DU1A 4XXPA 3R4SA 3AZZA 2AENA 5IK8A 1W6OB 2DTWA 1GZWA 4P9WA 1LHNA 2GMMA 4RL7A 1LESA 1EPWA 2DTYA 2ZGLA 1GNZA 2G4IA 1XQNA 2XB6C 3WG2A 2WQZC 2YMZA 5GZCA 3AZYA 3AP6A 3B3QE 1QOSA 3ILRA 2PHUA 5E8AA 1DIWA 1GZCA 1S0BA 4XHBA 1CPNA 5GZFA 5CB7A 4K21A 2UWBA 2D6KA 1FYUA 1DFQA 1YYNA 5IT6A 1HKDA 2ZABA 1JW6A 1KJRA 3MW2A 3UL2A 1UX6A 4YZ5A 3FLRA 2ZKNA 3A4UA 1ENRA 1LOCA 4FPKA 5H9RA 4DQAA 3VUOA 2A6YA 2FHRA 2ZACA 2VU9A 4FPYA 3ZVXA 4Q26A 1KQRA 2NMOA 2ZMKA 3RSJA 1LOEA 2E7QA 4LBKA 1AVBA 4GWMA 2GN3A 3POYA 3MPPG 1YRZA 2ZHNA 4FPFA 2ZMLA 5T5LA 2R16A 3WDUA 3T1MA 3AYAA 1GLHA 4DRRA 4FOQA 2DURA 4PBOA 2A71A 1D0HA 1SLBA 2ES3A 3BODA 4FPJA 3TAYA 4FPEA 5JOXA 1VIWB 4P14A 3ILFA 1WW5A 3O12A 4Q27A 1ENSA 1RITA 2WSVA 4AYUA 4CTEA 2NMNA 2W52A 4FVVA 4WZFA 4YLZA 1KRIA 1ULEA 1AXYA 4YGCA 2PHRA 2ZGMA 2GALA 1MS3A 2GMEA 3MEPA 3T2TA 5F9TA 1KDMA 2VW2A 3PVEA 4Y26A 2AH2A 2H0BA 1DQ5A 1JBCA 2CYFA 3UJQA 1C57A 3VKMA 1SACA 4GKXA 1MACA 1PZ8A 3WCSA 3WV6A 3WG4A 4U36A 5CA6A 2P3JA 4XJAA 2DYCA 2A3YA 1IKQA 4FOWA 3ENRA 1DGLA 1LU2A 1V6JA 2DUOA 5GM0A 1LODA 1VAMA 1PZ9A 4XTMA 1H9PA 4YM2A 1LU1A 3POSA 4Y1VA 1BKZA 3MW4A 4MYEA 1NXD1 3LSEA 1KITA 4K20A 5T5OA 1N3QA 2WSUA 1WLDA 2PHFA 5IK4A 3O0WA 2GMPA 1UN1A 3SISA 4YG3A 4WVWA 5JOYA 3I8TA 2ARXA 1AZDA 4BQ1A 1VALA 2A3WA 5DUUA 5DUXA 3AK0A 2R0FA 5EWSA 1FV3A 2NYYA 3N7LA 1VLNA 3ZXKA 3ZXJA 4YW4A 4DFSA 1JN2P 1LEDA 1SFYA 4JC1A 4Q2FA 1AX0A 1WUVA 1WCSA 2ZHLA 1Y7BA 3OY8B 3TB0A 2A6ZA 4LBOA 5GZDA 1V6MA 4Y1ZA 2GNBA 4P9XA 1FNYA 3C2UA 1AJKA 1QU0A 4R9AA 1V6LA 3AJZA 3MW3A 3FFZA 3ZSJA 1QOOA 5H9SA 3V0AA 1SBEA 4Y20B 4BMBA 2RHPA 2A7AA 2GNDA 4GKYA 2NZ9A 3OPZA 1WLCA 2I2SA 4YM3A 1N1YA 2A70A 5GLZA 3WG1A 2SLIA 4BPZA 1ULFA 2P2KA 1OKQA 2P34A 2R49A 5GJ6A 3RQ0A 2FMDA 2DU0A 4XIOA 1F9KA 3N3HA 1QDCA 2EXJA 4ITCA 2ZAAA 2ZGKA 1DQ0A 4SLIA 1MS8A 2TEPA 2CL2A 2E53A 2ZA9A 4JRAA 4M3CB 4FOYA 3WUCA 2HYKA 4GALA 4YGBA 1AXKA 2ERFA 4BLJA 4XJWA
chains in the Genus database with same CATH superfamily
1DZQA 1W3VA 4BQ4A 3ZPYA 5FYHA 2CWSA 5FYYA 1OSGA 3POGA 2ZEZA 3PJQA 3VBFA 4ZZ8A 1AX1A 1O7FA 3DKWA 2QQUA 2DUPA 4A4AA 2KM2A 5L73A 3KT1A 3J7NA 5ABJC 4CXXA 3OUHA 5DQ0A 3AX4A 3IMMA 3KGZA 2VTXJ 2IFWA 3WF1A 2PMWB 3MLKA 5FKCA 4XILA 1O8SA 4TTGA 5A33A 2WYFA 3LDBA 2ZGRA 2HYXA 2QQJA 4F8AA 3N9LA 1S55A 5A6ZA 3ZXGA 1K5MC 1OFNA 2WO2A 2O8QA 3RJRA 2I07B 4B1LA 3M7AA 4QX5A 2EF6A 2XMLA 2VR4A 4OI1A 1Z7S1 2OZ6A 2O8OA 1OFSA 1K3IA 3H3LA 3POBA 4Y1XA 3R6SA 5EJ3A 3ORJA 1RVF3 2AC1A 2RS13 1G7YA 2YHJA 1RUC1 1OMIA 5DDJ3 4PI0A 1FMD2 1SLTA 3ATGA 3B9CA 3CU7A 1Z78A 4BLIA 4DXSA 5D8AC 1WCUA 3RMYA 3LAGA 4L97A 1NY72 3LEMA 3WF0A 5A7OA 4B1MA 3G7DA 4UW3A 1OOPB 3WNMA 3AMNA 2D43A 3OGGA 5FP4A 4AW7A 1ZRDA 4TWTA 2W1WA 4UFKA 3ZKYA 2HKXA 2WT1A 5DG1A 4Q29A 3OBTA 3VZJA 1OKOA 3H1YA 3NAPB 1O5LA 3AMHA 5F8PA 4XUTA 3VLBB 1QJZA 3P6BA 2ZEXA 5HCAA 4JDMA 3EYPA 5CEHA 5DPNA 4P9GA 3MIBA 3Q8CA 3EO6A 4CE8A 2OS2A 4WVMA 1GNHA 4B3NA 3PVBB 4F83A 2HWF2 5FYIA 5EYYA 2WN2A 3MICA 1TNRA 4OLLA 4OHZA 3ZM8A 5JIUA 5BNPC 3VZMA 1DGRN 1Q5OA 5FZ7A 3H9AA 1ND2A 4CSWA 1GWMA 4FQ4A 5JZGC 2P1BA 1CPMA 4KG8A 4PDWA 1CR7A 4QQLA 1YQ6A 2HWD2 4GWIA 4MX3A 4CDWC 2WT2A 4AOCA 4AVTA 1US3A 5G05L 3JCIA 4QX3A 1MR5A 2ARAA 4Z07A 2ZXQA 4COUA 5FPXA 1RUNA 2BFUS 1H2NA 3H0OA 4GWNA 1FOD2 5GZGA 1HQWA 5A3LA 2JB4A 1RMU1 3FBYA 2VQUA 1URXA 3BOPA 1YFXA 3GHNA 3KSCA 4LBLA 4LO5B 4AVCA 5C5TA 1RUE2 3ZFFC 3THDA 4COVA 1JHJA 3R4UA 5KXCA 2HWD3 2JG8B 4GQ7A 3ACLA 1SCSA 2P3KA 2W2IA 3N9PA 2WNUA 4Z2AA 5AVPA 5FYUA 3VDAA 1SFPA 4RHV3 4BXSV 3NNGA 5FMBA 2JDPA 1IQAA 1HXS3 3K2OA 5ABJB 3INAA 1FV2A 3AZWA 3NL1A 3O1TA 3MGUA 1CAUA 4XYXA 3H1WA 3EJKA 2FMYA 2CAUA 1WBLA 1PNFA 4A7YA 1W28A 1X9PA 4PF5A 2WC2A 4ZXKA 4NWVA 1VBA3 2Q4SA 2XQRA 3LA3A 3ZLIA 3OPWA 1K5MB 3WHUA 1BYHA 3SEPA 4I30A 3V0BB 5IFPA 4JKKA 4AFMA 1UW8A 1POQA 2ZGOA 4OZXA 3MLLA 4QU1A 1GR3A 2GDFA 3O1OA 3M4FA 5BYNA 5T5PA 5EXOA 1U0AA 1AR72 4MXVA 1TQ5A 3DEMA 5GLVA 3IM0A 3FHAA 5JR7B 1OH3A 1J1TA 3I2GA 4JHZA 4P02B 5E88A 4DXRA 3RG0A 3KZ4C 2MNGA 3ACHA 5LBEA 5BNNA 1NXMA 1YO8A 3LEIA 2D5FA 4LHNA 1UY2A 1V6NA 4Q4V2 1A78A 1H9WA 3AMPA 5D8AB 1EV12 1RUJ1 5K0UA 1OXCA 3DF0A 3OBZA 4CCLA 3VKLA 2D6NA 1BHGA 1ZBA1 3VDDC 4DRVA 3I59A 2Y0OA 1EAH2 1MQTC 3UNPA 1VBC2 3WSOA 1RL3A 1AR73 2WNOA 4LR4A 4NPRA 4DXTA 5BNOA 4C1WA 3O5SA 4URTA 1JYXA 3RGBA 4JQTA 2W68A 2ZHMA 3AFGA 1LCLA 5HV4A 3AYDA 3AM2A 4C1XA 1VBB1 3SITA 1PZ7A 4FI9A 1QJX3 1PGL1 1XNDA 5I0RA 3NV1A 1LOGA 4GULA 2VBPA 5SV8A 1DZRA 1GSLA 4UFLA 4YM0A 1VBC3 5GLTA 4BK4A 3RZJA 3B01A 2QQWA 2P37A 1R1ZA 5BNPB 4XTPA 4JRLA 3MIFA 2A6WA 2LROA 5KXDA 1I3HA 2WNVA 2ZPXA 2OQ7A 2DVFA 3JU9A 3WP4A 5JZGB 2WFF2 5IK5A 2WZR2 3HN1A 4IGPA 1DDLA 1RHI1 3GYDA 1HRI1 4IEPA 1PIV3 3LCPA 1J3QA 4CDWB 3AP7A 5ACA1 1C1LA 1NX9A 5M0TA 4A42A 1W39A 4K40A 4AVVA 5IK7A 3T30A 4QX2A 1H2KA 1IGOA 4FPGA 2VW0A 3VZKA 1AR82 1JZ3A 1QIQA 2W94A 3LDRA 4OQ8A 3D5OA 3R0RA 4HETA 3ZXFA 2OPKA 5FXXA 2WZR3 4LHKA 3BPSA 1WD3A 3ZFFB 3AXDA 2D97A 3VBHC 4MGKE 2ET1A 3UKVA 1HB4A 3NW4A 3VDCA 5A1AA 4O9EA 3DGTA 4QDRA 3SH3A 4Q0SA 4CEWC 4MGSA 4MHRA 5AFBA 2EALA 3K46A 1ODNA 3SCHA 5KHKA 1YFUA 5FYCA 2PLV1 2JKBA 1HV0A 4KU8A 4Q4Y3 5EPAA 4QPWA 3WDVA 2BW8A 1MZEA 3AKPA 4Y3OA 4ZS2A 1MVQA 5L19A 4AQ6A 4CUCA 4JGYA 1W8OA 2VO5A 5CFDA 4BIFA 3RZHA 1X8MA 4AEDC 4AI2A 1YI7A 3OBRA 4LBJA 5F6LB 1IS3A 2GN7A 1REFA 3VD3A 1UMZA 4IV1C 1RUG1 3VBUB 4WM8A 4H3WA 5EJZB 3X29B 1AF9A 2Q5TA 2Z2SB 5K8SA 4IEWA 4FFHA 5FY9A 1ZYBA 5T50A 2QQMA 5CFDC 3UGFA 5FZAA 5GZEA 1ZRFA 1X50A 1LTEA 5JIAA 1Y9GA 3AKTA 5KWRA 5K4LA 3OYWB 1W03A 2WLQA 4LQRA 1R1A2 2QDNA 3F2ZA 4PBPA 4DB5A 1MEC1 1VB2A 1UKGA 3AFKA 4XUPA 4YZ1A 5LBFA 4LOSA 3CJIA 1ND3C 3SH5A 4URAA 3VDDB 1PO11 4A7ZA 4LKEA 3IT8A 4Y24A 1LHWA 1MQTB 3CL1A 3OGRA 4PIXA 4WBBA 4Q8KA 1N47A 4N53C 4OCTA 1W6MB 1WW6A 3N9MA 4AYUA 4L11A 3SLIA 2AR6A 5LK7B 1GBGA 5FYTA 2Y6GA 1D4VB 4G4FA 4V1PA 1PVC2 1XJAA 1H8VA 3IPVB 4C90A 1L7LA 1HQLA 4ZXEA 1UOJA 4LPLA 1LHUA 3QD6A 3WP6A 2YZ4A 3E5QA 1H4HA 3PHMA 4DS0A 2FDHA 2DCTA 1EY2A 4KWUA 4QKFA 1XOYA 4I0BA 1PVXA 2C5DA 3OUIA 1ONAA 2UYBA 2Q8CA 4YVWC 3E5UA 4ISRA 3VHPA 4OULA 3O1PA 1H1AA 1LNSA 3DXTA 2E33A 3CZJA 3GDBA 3U78A 4CDUA 5KBFA 1DF0A 2X8KA 1KEXA 4ONUA 3M3QA 3WQ1A 1QH7A 1W9WA 1COV3 1H2MA 2A3XA 1CVNA 3K4ZA 4Q5OA 4CZSA 5JSRA 1PNGA 4YZ4A 1S0DA 2VH9A 3V0AB 2V5DA 4LBNA 5EV7A 3GXUA 4Q1PA 5FZDA 1ZBE2 5C8WA 4XUQA 2WT0A 4QKBA 4ZY9A 1RVF1 4QXBA 3U37A 2RS11 1OD5A 2CSGA 3JUUA 1LOAA 5CNAA 3W5NA 2RJKA 5FYVA 4EROA 2VQTA 3PLQA 2OKXA 1I9RA 3R4SA 2AENA 5IK8A 3AMQA 4B29A 1O3TA 1OLRA 4IW3A 2ARCA 3IZOA 1LHNA 4OI4A 2ZGLA 4QD2A 2VCCA 4JDNA 3VHOA 4H7MA 2PTMA 3HN3A 2YMZA 4CEWB 1GZTA 5I0SA 4CCOA 1D2QA 3FZ3A 3UT0A 1VRBA 3MHZA 3Q8EA 1CZVA 4UWDA 1DIWA 5E8AA 1FMD1 4NWWA 3TN92 3LPGA 2W95A 1QJU2 5C3OA 4K21A 4D6QA 2CGOA 1DFQA 1NY71 5LEJA 5TSWA 1XNAA 3MO4A 2ZABA 4EJRA 1AYM2 1VRH2 4AEDB 3M8LA 5AFEA 2QZ2A 4GIQA 5H9RA 1GQPA 5A7SA 2FHRA 4HKLA 4G9SB 4FTSA 3LPFA 4IV1B 1KQRA 1OBNA 1PX4A 4FFIA 3MBWA 1LOEA 3EMRA 5IJRA 2BOJA 1UXXX 3TN93 4BJ0A 2RDNA 3MDPA 4KU7A 5A3UA 2XKPA 4AHWA 3CF6E 4OHWA 3MPPG 2JIJA 4LKFA 2GSYA 2B5HA 3DL3A 4ZU5A 3AYAA 5JCTA 4DRRA 1XNBA 2DURA 1HB3A 2XLGA 3KT4A 2ES3A 3I49A 2CV6A 2VOTA 5KHJA 1F35A 5JMOA 1ND3B 2WSVA 4HN1A 2NMNA 4XVHA 4E4ZA 5FO8B 4UT5A 3JQXA 1JUHA 4YLZA 3W20A 4N53B 5JR2A 1AXYA 4IE5A 2PHRA 1MS3A 1NCRC 2HWD1 3MEPA 4CU8A 1ZRIA 2WZEA 5FZ1A 1AR92 1BBT3 2H0BA 4D7YA 1DQ5A 1CAVB 5LA2A 1JBCA 4EN8B 5A1LA 4I01A 2WWSA 1I5ZA 1L3JA 2VL4A 3UJQA 2TNFA 1MACA 1PZ8A 2JG8A 3H7YA 3WCSA 2DDUA 4U36A 1FOD1 1JZ5A 2QFEA 5CA6A 2ZX3A 3W21A 1PGSA 3KD4A 3A23A 3DYPA 1YLLA 1VJ2A 3O14A 4CEYC 3WF4A 2XJTA 2H6CA 1JYVA 1RUE1 1LODA 4X6QB 4YVWB 4ARYA 3LQCA 3M70A 5ABJA 4Y1VA 2ID4A 5B4NA 3H8XA 1ACCA 3VZLA 4YW6A 1N3QA 1ZRCA 1WLDA 3H1MA 5ISLA 2GMPA 5I91A 4DIQA 4YG3A 2ZX1A 4DOUA 5IVJA 1F2NA 1VMJA 2IVJA 4K9SA 3UGHA 5ANNA 2R063 4IE0A 1K5MA 5DUUA 3K51A 3LEGA 3FBMA 3OTFA 4CP9A 3Q8FA 2XGXA 5EWSA 2RMU2 3ALQA 3ZXKA 2WIIB 5FZOB 3LD8A 3HT2A 3WQBA 2G9ZA 3DKQA 3ZXJA 4YW4A 4PLMA 2BGOA 5FWEA 4R52A 1DU3D 4JC1A 4LHLA 3L2HA 2YBKA 4NAMA 4N43C 4ZZ5A 1CX4A 2A6ZA 3LFIA 5BNQA 3MF6A 1V6MA 3MUZ1 4UYBA 5KC5A 5I0DA 2CDPA 2UYAA 1QU0A 2VNRA 1SHWB 4I09A 4R9AA 5D8AA 4A44A 1AR71 3FFZA 5IHRA 5KC6A 1SBEA 1IZ3A 2JDAA 3TNQA 5T3NA 2OYZA 2VCMA 5IVFA 2QQKA 1ZZCA 4B8EA 3PTYA 4YM3A 4CU9A 1BMV2 4AQSA 1H1IA 2SLIA 1EV11 1YI9A 2P2KA 5HPOA 1HX6A 1JYWA 1QQP2 2R49A 3B93A 3H8UA 4XFHA 5GJ6A 2XL9A 4MGQA 2DU0A 1EAH1 4J1XA 3CZUA 1VBC1 1F9KA 3E6CC 3N3HA 4YRDA 5FZHA 1QDCA 4AI0A 1RJ8A 1UIJA 2VVFA 3OEAA 3ZN5A 4LK7A 4CPBD 4SLIA 2V4VA 4OZOA 1GWKA 3PURA 4JRAA 3ABZA 2R6QA 3J8F2 4XZUG 2FQPA 1W04A 4Y5TA 3TOJA 4BLJA 5BNPA 4ZHNA 4IE4A 4CCKA 1MVEA 3I2JA 4FP3A 4LO8A 5T52A 5JZGA 3RMXA 5FYZA 5HBAA 2VJXA 3BGAA 1W2UA 3ZN4A 1RUOA 1IG3A 3WXPA 4HL0A 4CDWA 4Y22B 5LBBA 1FAYA 4E4SA 2RS53 1BXHA 4D8MA 1UZZA 4QQOA 1UYPA 2VMDA 2WL1A 5FPVA 2HEYF 2W1SA 3J8F3 2WFF1 5A32B 2WZR1 3U75A 5C3QA 5K0UB 2JKXA 3A22A 1NLRA 3LFMA 3NKGA 2YXSA 3VBRC 3BIWE 2ATFA 2FD8A 1NCRB 4KGGA 5LCWL 2GU9A 4LUMA 1REEA 2KXLA 4NHKA 5FZKA 2C4XA 2VG9A 4RYDA 4CXYA 1RUJ3 3RWKX 3DXUA 3ZFFA 4QPYA 3VN4A 4YSFA 1AR81 2LM3A 1QNWA 1Q8QA 3T09A 4M01A 5DUVA 2EVXA 1QGLA 4Q4Y1 3KCXA 4AHXA 4CEYB 1LHVA 4IV3C 1JODA 1GZWB 4M3CE 3AZXA 3OB8A 2AYHA 2EICA 4PLOA 4XJ9A 5C9AC 4TZDA 1LGCA 5A7QA 3M1HA 5A6QA 3W9AA 1JOBA 4RFRB 3RWNA 1HRV3 2VZ3A 3QCWA 4JV4A 1IKPA 3FJSA 1WCDJ 1DQ4A 3HJRA 2ZGTA 4EWDA 4YZ3A 5FREA 3LWCA 4AI3A 3ZSMA 3GJAA 4D3WA 2HWB2 1TME2 4JQRA 1ZZ6A 5C5UA 5DAWA 1MS1A 2R1BA 3GGLA 3IDEA 1G8WA 3PVNA 4WV8A 2VZUA 4Y5SA 1SMVA 5IVVA 1MS9A 3B00A 4ASKA 5E89A 1RHI3 5DZFA 1HRI3 4LMFA 4D0QA 3OG2A 3D3AA 1YCIA 5E16A 5DZEA 3P3PA 4EQVA 5T5JA 3Q9OA 4N43B 2ZGSA 5LZ6A 1FNZA 3OYWA 2BERA 1TME3 1ZM1A 2J7MA 4XZPA 1V6OA 1BZWA 5F1RA 1MS5A 1BJQA 4QHOA 1WW4A 2E26A 4NVPA 4P5HA 4AGGA 4XJ8A 1CAWA 3USSA 3VDDA 5FY5A 3HOBA 4KWLA 1MQTA 3ZYBA 2Y60A 2JWPA 4WVVA 1UAIA 3O0XA 4QDQA 1A3KA 1W6MA 5FP7A 4ZPIA 4GWJA 1ZZ7A 2J1AA 2E9QA 3KCYA 4FOVA 1CQ9A 2JICA 2VC9A 4XCBA 2ZTNA 5H9PA 4AWDA 2V73A 3IPVA 4PHZA 4QQHA 5FZ8A 1J59A 1Y9MA 5CFDB 5FLJA 4UI9L 1SCRA 3UKNA 4BMEA 3H8RA 4UW4A 1PVC1 4DXZA 4FFGA 4XC9A 1OA4A 4HK8A 2WA4A 2Z69A 4R9CA 3SKVA 3LSDA 3AJYA 2E7AA 4NIDA 4EZHA 5CKNA 2D5HA 1XU2A 1XC6A 2XLAA 3KF3A 3DECA 5F2WA 2C9AA 4MG2A 3UGGA 1RUG3 4IEOA 5FZ0A 1V00A 1JZ6A 1UO9A 3PMSA 2DWRA 2FDGA 4A3ZA 3BTXA 5F3GA 5JWPA 5FKBA 3BYWA 3WDYA 3T08A 3POEA 3NV4A 1A8MA 2QZ3A 4MGIE 3M3OA 3WX5A 1QMJA 4XF4A 4ZU4A 4ARXA 3UJOA 2VZPA 3ACIA 1ENXA 2D6PA 4DEQA 1TVGA 2BJSA 3VBRB 3LIHA 1JYIA 5A1FA 4M3CA 3V64A 1MEC3 2WBKA 3FMGA 1E57A 1ZBE1 1D4M3 4BHPA 1GV9A 4CVUA 1KS5A 3U10A 2F4LA 4NJ4A 1PO13 3VBHA 3M3EA 3TEXA 2WNEA 4QDSA 3E1F1 1W6NA 3Q8AA 2RG4A 2Y0IA 3JZVA 1WD4A 4CEWA 4IV3B 1TEIA 5FFOC 3RDIA 1RUH2 2JD4A 4MADA 4NN0A 1CESA 1A6CA 1V6KA 3D4KA 3K3NA 1JI6A 4IDZA 4NUBA 5FMOS 4ASMB 5C9AB 2DVDA 4GA9A 5LRSA 3M2MA 1UZWA 4KBBA 5FZEA 2XG3A 1S0CA 1YFYA 2VXRA 2VAUA 3N35A 2PELA 4K8RB 3SHRA 4CDUB 4XFIA 5F5IA 1ZVFA 2E6VA 2JE8A 3EQEA 4AEDA 5FJKA 1LEMA 1O59A 2OW4A 3VHNA 3JQWA 4YW1A 3ZR6A 1OA2A 3FHQA 2VZSA 4NRPA 3RI8A 3TN91 3HMYA 1HJFA 4IV1A 2WWUA 3ZYPA 3N4MA 1RGSA 2VUJA 2CY6A 2ZGQA 1Q43A 3RZMA 4LXLA 1AYM1 2VGDA 1J84A 1VRH1 1JH5A 1XYNA 2NN8A 2NQYA 4GAZA 5FXWA 3HEIA 1FPN2 3A21A 1J3RA 3K77A 2VCAA 4BOWA 2GC3A 1QNYA 2WO3A 4E2GA 5FZ6A 3WNKA 2JDMA 3RI9A 1XSQA 3WDWA 2VUAA 4LA2A 4AF9A 3PUHA 2J1TA 3WD5A 2VNOA 1JYTA 3WY6A 1ULCA 2RDRA 1LJ7A 2GNTA 5I8TA 5K7PA 4LO6B 1N1VA 3OGVA 3RS6A 3T3YA 3WR0A 4YWAA 2C0ZA 4DUXA 3Q8BA 5A6XA 4B7EA 1ND3A 2PHDA 4XHXA 2DV9A 3CDZB 4Z8BA 1OC1A 5FXZA 5T55A 1BBT1 2ZKLA 1MS4A 1FPN3 1IS6A 4N53A 4NPLA 4TYSA 1IHMA 3PIJA 2PA7A 3N7KA 4A7KA 4E8CA 4EV0A 2Y6LA 3VKFC 1CAVA 1JYNA 3NV2A 4KWJA 4RSUA 1O4ZA 1QOTA 3WDXA 4IGQA 1X33A 5FAXA 1FMD3 1OPOA 1WLTA 4AZZA 4QX7A 4BQ2A 1UNBA 4CUGA 4CP2A 3AXEA 1ULPA 4FFFA 3WNXA 4BZ4A 3HBZA 4YVWA 1PMIA 1QXPA 3RYPA 3O1RA 3KQRA 4IQPA 4XIKA 2RV9A 2WLPA 3KM5A 3KVAA 3WP5A 4GD4A 2RS32 2BWAA 3W58A 1CONA 2R061 3EHKA 3VBOC 4CCEA 1YQ8A 2VBBA 4UFHA 5IWFA 3ACFA 3B69A 2AEZA 4QU2A 1UZYA 5CYYA 2Q8EA 2VUCA 3WDTA 2GP3A 5FZ9A 3HR9A 2VXJA 3HIFA 3HWJA 5FZOA 4Z1VA 4FTEA 4Q4X2 2IUWA 4HVRA 5B4XA 2HWF3 2VOXA 3DN7A 3JB8A 2RS33 2C6SA 1OQDA 1WA6X 4D69A 1X9TA 1MZ5A 2W46A 4FBFA 1UPIA 4Y4YA 1QJFA 3UV9A 3KHBA 3AYEA 3KWVA 3CHXA 1O5UA 2E31A 4PQQA 1HDKA 4BXFA 5FPUA 2XBO2 2ARBA 2V72A 1W6PA 5HXVA 5JSOA 4YW5A 5FPZA 3ZFEC 2PFWA 2P5BA 3QACA 4N8MA 1TE1B 2J1VA 1R092 2JENA 1KJLA 5FUIA 1FOD3 3U11A 1RC6A 4QKDA 2PHWA 1V6IA 3D8CA 1JMUB 3LEKA 2O1QA 2C26A 3J7LA 3PMEA 4H55A 1RUE3 2HBUA 3UYJA 2LTNA 1LAJA 2QQNA 5LATA 2EXHA 3ITQA 1G9FA 4LBQD 5A3NA 1W06A 3I2IA 2MEV2 5HCFA 1QQP1 3AP9A 1W9FA 4CP9B 5A3WA 2W3JA 4EN0A 2VOWA 1DHKB 2J42A 2RS51 1RJ7A 1EYBA 1S2EA 4QGLA 5FO7B 3J8F1 2A1XA 1Q8VA 4AHYA 4B4RA 5LWBA 1AX2A 1AL22 4WM7C 4Y22A 1RIRA 3PNAA 4QXCA 4XABA 1DLLA 2XVGA 4AL9A 3I7DA 1S0GA 5FZIA 3UKTA 2JG9C 5A32A 1NOVA 3IMNA 5E6HA 1VB4A 1DYKA 2DCZA 4HVOA 4XW3A 1Y4WA 3RZLA 5JLVA 1NCRA 1XNKA 3MIEA 3O1UA 5EFUA 4LITA 1NE4A 4B4QA 5LBCA 3N36A 3A7QA 2CU5A 3S7EA 1AL23 1VAVA 2QVSB 3AZZA 2WABA 1D7PM 2OT7A 3RZZA 4CEYA 1LKNA 4Q4V3 1EV13 1W6OB 5FBZA 1GZWA 1HRV1 3BTZA 3OOXA 2GMMA 4RL7A 1RUI2 5IVBA 4RN5A 1EAH3 1GNZA 2G4IA 4RS5C 1TMF2 2WQZC 1UOGA 4MLOA 4QB6A 1YQCA 3IWZA 1R64A 2QQPA 4XF9A 3VBOB 2PHUA 4NIIA 5J96B 1GZCA 1S0BA 4XETA 4XHBA 2QUOA 4RGKA 3JXSA 4MVTA 5CB7A 4DUVA 3VGIA 2UWBA 2D6KA 2PAMA 1HKDA 4OI2A 1RUI3 1STMA 4LULA 4NHLA 2R042 1UX6A 3KHCA 3I3DA 4YZ5A 2ZKNA 1ENRA 4QHZA 3VUOA 1CAXB 3HPNA 1TME1 2QQLA 2VU9A 4Y5Z0 5A3PA 3MFCA 4PLNA 4QM9A 1TZOA 2PN5A 5FDBA 4N43A 3RSJA 1W0NA 4YNIA 2IFRA 4LBKA 2WFF3 4E27A 1UY1A 4GWMA 4KH9A 1BEV2 3I2OA 2XVKA 4XCAA 2ZHNA 2ZMLA 4R8HA 2R16A 1ZZ8A 3T1MA 4CCNA 1UF2C 3KV5A 1GOHA 3ZFEB 2VMCA 3M3IA 1QWRA 2A71A 1SLBA 2PXJA 3BODA 3LA7A 4FPEA 1AR83 2XJSA 1WW5A 1BK1A 1KFXL 3O12A 1BCXA 4LA3A 1S2BA 4PIZA 4Q27A 2Q1ZB 2Q0AA 3H3ZA 2W52A 3ETPA 4AEKA 4AFBA 3MUY1 3ZDVA 1JOPA 1ULEA 3SCGA 3J7MA 5F9TA 2ORXA 2BYVE 4BCUA 2VW2A 3PVEA 2AH2A 4J1WA 2CYFA 3TYJA 1C57A 3VKMA 3ZKUA 2G1MA 2J1UA 4W6WA 3ECQA 4AK3A 3WG4A 3ZXAC 4XEZA 4UOJA 4XJAA 2VOVA 2DYCA 1R082 3MPBA 3BUCA 1RUD2 1VMHA 3ENRA 1DGLA 2QQVA 1LU2A 4BWOA 1V6JA 1H9PA 4QPIC 2UY8A 3POSA 4CCCA 4K3UA 4GMP0 1BKZA 4P5YA 1PGW2 4WM7B 3F95A 2BVBA 3U07A 2YDEA 4KQ7A 4CXWA 4IETA 5IK4A 2JG9B 1X36A 1D4M1 5DAQA 5FYMA 2Y6JA 3WINE 5C3PA 3I8TA 3VBRA 2ARXA 1CAWB 1ZZBA 4Y33A 4MXWB 4OUMA 3BU7A 3KQ4B 5FOBB 3MIDA 3J26N 2JDYA 1VE0A 4EWEA 1OLME 3EBRA 1FV3A 2NYYA 3N7LA 3NNLA 2WA3A 3AL5A 2ET7A 1C5IA 3HD8B 4AQ2A 1R1A3 2BDRA 4W6YA 1LEDA 3WNPA 2J1RA 4IV3A 4CA9A 2F17A 2G19A 3DCQA 1A34A 1WUVA 2ZHLA 5D2AA 4X6RB 3SQOA 5C9AA 4Y1ZA 4P9XA 4JZRA 4XDPA 3TEWA 4RS5B 2VZRA 4AFCA 3MW3A 2J1SA 4O61A 5H9SA 3D0JA 4IESA 1RUH1 2RHPA 2A7AA 4GKYA 5FY7A 2YPJA 2NZ9A 3OPZA 5CIRA 4IE7A 5C33A 1CWPA 2HBTA 3AVRA 3JD72 1PVC3 1WWYA 4NIGA 5CZKA 4BK5A 4JGZC 4BPZA 3VDBA 3NJZA 4RGAA 1WKYA 4QXHA 2Y6HA 5C4WC 1JZ4A 2IXHA 2XJUA 4ZU7A 4BQ3A 5FWJA 2GC1A 4LK6A 4RGGA 5L7OC 4FAHA 3S5QA 1VR3A 4M3CB 4OVEA 1BVVA 5APAA 4QX8A 3JD73 1W8ZA 1UYXA 3BALA 4UAPA 4CP0A 2ERFA 4ES9A 5EIYB 4HBNA 1XXNA 3MI8A 3W5MA 3BIEA 1FPN1 2LW8A 1L7RA 3A0NA 4AGVA 3VBHB 1W6NB 1G86A 1ZBE3 2CAVA 3USUB 5JMCA 1SLLA 1OH4A 3OCPA 3GZUC 4BB3A 4C0BA 3OJBA 4A45A 2VULA 1M4WA 1QJY2 4OYUA 4Q8LA 5CFCC 2JEMA 4CDQC 4ZKTB 4KI5M 4D94A 5GLWA 2VBDA 2WS92 1DCSA 4IEXA 3VKNA 2GP5A 1AUYA 2VUDA 3T1LA 5FZBA 4L9BA 3ZFGC 3K4DA 4RQPC 2ZGPA 1LB2A 1EP0A 5HI0A 1W6QB 1UX7A 1NCQA 5EP9A 4HANA 2D6OX 2K0GA 1WBFA 4XURA 2MHFA 1G9BA 1OUXA 1QJY3 2RVAA 3GBFA 1RINA 5EHDA 2PHXA 3VL8A 1NT0A 5A70A 5BY5A 2XWJB 2V09A 5F5AA 1Q3EA 1QJU3 1OLQA 2CWMA 3CIHA 1UIKA 2JDUA 5GKAC 4XBLA 1XSRA 3HQRA 4NPMA 4QPIB 1OLMA 1AYM3 2YC0A 5F37A 1LENA 1VRH3 3LF7A 2FDIA 1O6UA 2VQ0A 3FL7A 2HWF1 1EUUA 3FFQA 1X82A 1N3OA 2RS31 2Z42A 2DUQA 5FJHA 3V0BA 4AHZA 1H6XA 4YGDA 3WW4A 3BTAA 1NZIA 3HT1A 5JSPA 1Z7S2 3CNAA 1NLSA 1IPKA 2W08A 3QLQA 3TBDA 3NQHA 2F4PA 4QGNA 5J3UA 5FY1A 4JKMA 4LT5A 2Y38A 4PCRA 2Q8DA 1PO22 4IGOA 1RUC2 4JCKA 5CKMA 5EZWA 3ILNA 4YFWA 4XF3A 4Z2WA 3HBKA 3RYKA 2OZJA 3PTRB 3AB0A 1E5IA 2XVLA 2QKDA 3CJXA 2D44A 5IUQA 3NV3A 3D0SA 5DAXA 5A7NA 2PHLA 1CN1A 4MH0E 4DY5A 1SG3A 2P17A 3ZR5A 4QPGC 2VNVA 3LB9A 4EE2A 4YFZA 1SLIA 5DZGA 4IL7A 3BTYA 4CDXC 1OQ1A 4ZONA 1PO23 3U4XA 4YM1A 1JZ8A 4A3XA 1AR93 4O65A 4XE9A 1H0BA 1S4CA 4AI1A 1IQDC 3POJA 1NG0A 2IZWA 4META 2OXBA 5JI7A 1R091 4RD7A 5EQUA 4JGZB 4K1YA 1XE8A 2K9ZA 2QCSB 4I0AA 5FY4A 4FSJA 4Q1RA 2Y6KA 5C4WB 4BM8A 1VBD2 1RUF2 2A75A 3LE0A 1ALYA 1D0GA 2EAKA 1G9DA 2YG0A 3ZPOA 1F15A 1UPSA 4ORFA 5FLIA 4AVBA 2AGSA 3SC7X 5L7OB 4FXGB 3GBWA 3GM8A 2ZBJA 1LR5A 3VBSC 3T0DA 3AL6A 1L7QA 3H7JA 3WQ7A 2MEV1 3KS7A 2BPA2 1QHDA 4P9YA 2N7GA 4Y20A 4R9DA 1VP6A 4BU2A 1E5HA 4LEJA 3N7MA 1RUF3 4D7TA 2P6CA 2Q8OA 2YBSA 2JDZA 2DVAA 2RMU3 4XXAA 5DAPA 2Y26A 1XBFA 2VMFA 1W6PB 2NLRA 5A6YA 2CHHA 3NWKA 5FZMA 1AR62 1AL21 2WO1A 2PAEA 1H8TC 5JUVA 3ES1A 3KGLA 4CDQB 3KF5A 2ZJCA 3GF6A 4Q4V1 1S0IA 3ZSEA 3BN6A 5HCBA 2WZ8A 4IXLA 2ZHKA 3ZFGB 3FUOA 3KLSA 4XJUA 4RQPB 3JBG2 2B9VA 1FXZA 3DYOA 1GYKA 1EPZA 1VBE2 1W6OA 2OA2A 4NR1A 1B09A 2YYOA 1Q8OA 1K12A 2EIGA 1AR63 4MZUA 2O0OA 1W99A 1GUIA 1F4AA 4IEUA 1OF4A 4HLTA 3ZDSA 2UWCA 4E4DX 1G9AA 3C7GA 3VBOA 5JXHA 3GJBA 1F5JA 1C3HA 1QQP3 2HWE2 4XF1A 1RUI1 4E4HA 1DP0A 5FLHA 3TEZA 3WHTA 1TMF1 3MYXA 3POIA 4AAXA 5DXDA 3PU8A 1YIFA 3HVDA 4YYOA 5EJ1B 1FI2A 1N3PA 4PT6A 3W59A 3WNOA 2X5IC 3P5BA 3CQOA 4QB1A 3DPRC 4W65A 2Y64A 1OVSA 1W8TA 1WLWA 2Q1FA 1CIWA 1KFUL 2XWBB 4HK9A 1CAXA 2A5ZA 4W4ZA 1QH6A 5JDBA 3LOBA 2BV4A 5KXBA 4HPKB 2W0XA 5DAVA 4D6SA 3S6PA 2IWGB 1XPWA 3I97A 2FCUA 2TUNA 3BKZA 3T2OA 4MGYE 2VZ1A 5FZ3A 5F2SA 2R1DA 2LS6A 3VD4A 1Z0HA 3OBAA 4UF0B 4YG6A 1WMDA 1ZBA2 3ZFEA 3MIGA 1RB8G 4FXKB 2QDRA 4LLFA 1UY4A 5FV3A 5IVYA 1BEV1 4E2SA 1P8JA 4CDXB 3FUQA 3SMHA 3V65A 2WO7A 5FXVA 2GZWA 4HT1T 1WA4A 4DZGA 3ST7A 3HNBM 4XFAA 3MV01 4AEMA 3IDBB 1DGWA 3AC0A 5FMDA 1JZ7A 3GBGA 4RA0A 2W1UA 3ZIWA 2DVBA 5LB6A 1UYYA 3I2HA 1AXZA 1IS4A 2CNAA 4HFSA 4LUKA 1NE6A 3OGJA 5L9VA 4FPHA 4IEYA 2HH9A 1YJLA 3ZYJB 2P6HA 3LGRA 3JB4C 1S0JA 2WZPP 3VBSB 2W1QA 1C4RA 4U2AA 1AHSA 1ZA4A 2OUJA 2GC0A 4P08A 2BWCA 2EIEA 1NUKA 3K75B 1XNTA 2JDHA 2ADDA 3FX3A 2ZEWA 4I3PA 2VD7A 1LRHA 4S2GA 3ES4A 3WW1A 2BNOA 1R081 4WM7A 1RUD1 2W91A 2JE7A 3VD9A 2HWB3 3C7FA 2JG9A 2WN3A 4GMP3 1JU3A 1W2OA 2BNMA 2YGLA 4Q0VA 1LGBA 1ZRRA 3OEBA 2K2SA 4LOTA 4MXWA 4AGRA 1PGW1 1I1EA 4L8QA 1H8TB 4LIUA 1ZA7A 4ET7A 1R1A1 5F39A 4YZ2A 2R072 3HNYM 1JOJA 2ZGUA 5I0UA 4OI0A 2VNGA 3RRDA 4O7XA 2DBNA 1LECA 3AP4A 2DFCA 3VL9A 4COYA 2Z5WA 1UD1A 2X10A 1E5SA 4C91A 1KS4A 3ZN6B 1SLCA 4PQ9A 3TWIA 2J1EA 3A0KA 1W9SA 1OUSA 4Q4W2 1NYWA 5JXJA 2BQPA 2P4EA 1APNA 4RS5A 1NCQC 2QBXA 4GB32 1H30A 1OVPA 5AVAA 2MPFA 4N90A 1GICA 4CUAA 1DBNA 5ERLA 1W8FA 5I8YA 1XYOA 1ULDA 2D7FA 4PJYA 3WF2A 1G9CA 1OOPC 3OD0A 3PL0A 2WRAA 4K6BA 2D93A 2VE1A 1DQ1A 2XLFA 1LGNA 3WG3A 5LW9A 2TBVA 4Q4W3 5C8CC 4P9JA 2EXKA 3NAPC 4HSLA 1YXWA 4HKOA 4XBNA 3ZXDA 3DPRB 2WKKA 4GB33 3JD71 1LOFC 2JDNA 2V5YA 1YNAA 2D6MA 1ODMA 3ZVXA 4XPVA 1HV1A 1OI6A 4Y1YA 5J48A 3TRSB 4YG0A 5E1RA 2BP6A 3VHRA 2VM9A 3OF1A 2BOIA 1FX5A 1ZREA 4V2VA 1HN0A 3U4SA 5F3CA 2W47A 3J7HA 4B7KA 4FT8A 4UFJA 3NSTA 3ACGA 1UCXA 4XUNA 5A3OA 5KHHA 5A3TA 3S57A 3K48A 2W9XA 1GKBA 3USUA 4KBZA 2B7YA 3WNNA 5J37A 2RR12 5L9BA 5F5QA 4B4PA 1A8DA 4A6OA 1C28A 2OUHA 1W3XA 3NO8A 3T4VA 2UU8A 2BNNA 3WW2A 2QJVA 2I45A 1W2AX 2A6VA 4LBQA 2XONA 2OVUA 3G6JB 4A2UA 4MGZE 4HVQA 3K3OA 5DN2A 1B35C 2PHTA 5FZCA 3MIHA 5J09A 1J83A 1QJY1 1RTVA 3E5XA 4P9LA 4CCMA 2WFPA 1W6QA 2RR13 5FOJB 1RUH3 1OA3A 1QJU1 1W2NA 1F5FA 1UZ0A 1GWLA 4DEVA 3S30A 1SFNA 4N7UA 4OMCA 1S2KA 1YIPA 2FDFA 1SZBA 4P9WA 2DTYA 4MHUA 3I2KA 4QPIA 1XQNA 2GC2A 3U14A 5JI9A 3WG2A 3AZYA 3AP6A 1PHMA 4JAAA 4XACA 4UFIA 2VPVA 3N9NA 1RVF2 2RS12 2W87A 4XFBA 1NA1C 4G3YC 4W8JA 1DG6A 1CIYA 1O91A 4HZFA 5DDJ2 2WQ8A 5IAXA 1FYUA 2X29A 3ELNA 4AQTA 1JW6A 1KJRA 2BVVA 2BFUL 2IC1A 2RDSA 4DINB 3FLRA 3A4UA 5FUNA 1DGWX 4AI9A 4DQAA 3ZYHA 5I8SA 1H6YA 2ZACA 3CLPA 3S7IA 4PI2A 4FPYA 4Q26A 5FZGA 3WT3A 2NMOA 2ZMKA 5FY8A 5IATA 2WYSA 4C0HA 1PO21 1AVBA 4LHSA 2GN3A 2YFUA 1AR91 2WQ4A 2RJLA 1NCQB 1FT9A 2B4KA 3POYA 1OT5A 4QX0A 1OF3A 3AVSA 5T5LA 2UY9A 3WDUA 2X53S 3T4HB 4ASLA 1I5PA 1GLHA 4FOQA 2XUEA 2BU9A 1JS9A 3TAYA 4FPJA 1GP4A 1GOFA 2CGNA 2GAUA 2XOMA 3ILFA 2K46A 1DZTA 4JGZA 3IDCB 4P14A 5IVEA 1ENSA 5HXMA 2HWC2 4CTEA 4CU6A 5C4WA 5F6KA 5C8CB 1GU3A 5F7UA 4M0NA 4AXOA 1KRIA 4JX0A 2D98A 2ZGMA 3T2TA 5IYYA 1U5IA 2G9FA 2JDKA 1U12A 5L7OA 4Y26A 3C7HA 4N7IA 1G6NA 4PF1A 2OPWA 1VBD1 1RUF1 5A80A 1K45A 4JTNA 2X05A 2VZTA 2P3JA 4INDA 4AFDA 3O7OA 2A3YA 2RMU1 1IKQA 2HWC3 4O9GA 4FOWA 2VCBA 4OUSA 2DUOA 2XJQA 4W50A 5D1IA 5GM0A 1PZ9A 4RR3C 1HN1A 4XTMA 3RPQA 4YARA 4HONA 4YM2A 1NKGA 4FCAA 1KXGA 2KR2A 3MW4A 3SXWA 4MYEA 1NXD1 5T5OA 1KITA 2A73B 4K20A 4GH4A 4KL1A 2WSUA 1BVP1 2PHFA 2B39A 3CKHA 1WCQA 4YPJA 5J7MA 5CFCA 4CDQA 1UN1A 3OPTA 2FCTA 5JOYA 3SKJE 2VZQA 4RHV2 4BQ1A 4YVSA 1HXS2 2AZ5A 1B35B 1QEXA 5DUXA 1AR61 2QQOA 3AK0A 4OHVA 2R0FA 4RQPA 2XJRA 3GCWA 5ANQA 2KD7A 3ZFGA 4UXAA 4LIVA 4Q4X3 5LY1A 5FQ0B 2XBO3 1BMV1 3LOIA 1V9U2 3PIGA 2V4AA 3NNMA 4OMDA 5FY0A 3ZMOA 4DFSA 1W05A 5F32A 4LE3A 2FZ2A 3NJYA 1JN2P 4HOOA 1VBA2 1R093 4QX1A 2IXKA 4QQ2A 4Q2FA 3JBG1 1O3SA 1AX0A 3OY8B 1WCSA 5CKQA 1Y7BA 1VBE1 2YC4A 3TB0A 3KVBA 3MLJA 4LBOA 3IIAA 3GZAA 4A41A 5KHIA 2P3YA 3SCFA 1UOBA 4MV2A 1MZFA 2Q1MA 1AJKA 4HN0A 4R4XA 1JZ2A 4L2NA 1V6LA 3AJZA 2XKOA 3EXUA 3ZSJA 1RXFA 4Y20B 3I54A 1WCKA 3ZX7A 1V9U3 4F3JA 3H42B 1WMFA 5F3IA 3FWEA 1NA1B 2MEV3 2ZEYA 1W8UA 2HWE1 2I2SA 5SV5A 2EIDA 5FO9B 2A70A 5FCCA 4LLOA 1O3RA 1OKQA 4XAEA 4WVZA 4NMIA 2VTXA 4H2AA 5J1XA 2XUMA 1PK6C 4HPKA 5FR3A 2FDKA 1V0AA 3BB6A 3ZYGA 2E32A 3QH7A 3VBUC 5LASA 1CZTA 1SPPB 2DCYA 2JD9A 2EXJA 4ITCA 4C8DA 2ZGKA 4IE6A 5I0TA 2PQQA 1MS8A 2TEPA 5LY2A 2CL2A 2ZA9A 4NIAA 4DY3A 5FPLA 4UF0A 2HYKA 3NNFA 3H50A 4YGBA 1AXKA 2VVDA 4QPGA 5FK7A 4XJWA 4MSVA 2X09A 3OUJA 2RDQA 1Q56A 4P00B 4M4RA 4QGMA 4CDXA 2R32A 1U5YA 1GZ9A 2BUKA 1FATA 4AVSA 1QJX2 1C8NA 2ETEA 3HAGA 4R9BA 2BGCA 4M4PA 1ASJ2 5LEKA 1JHNA 1WW7A 3IKWA 1AJOA 2R0HA 2VW1A 3VV1A 2NPIA 2QQIA 1ULGA 3ASIA 5J36A 4TSVA 5A7WB 5JOZA 3I4IA 4BDVB 1LHOA 2A6XA 2WWJA 2XJVA 3FLPA 1O4YA 1JYCA 3VBSA 4S2FA 2ZCWA 1TMF3 1PIV2 5CADA 3DYMA 1BK0A 1PM7A 2E7TA 2LUWA 2HWB1 3QOPA 4MUVA 4S2HA 1ASJ3 1GFF2 3B5LB 4QAWA 4GMP1 1UMIA 2XJPA 4LO4B 3PVOA 4XQDA 1K42A 1MPXA 1IS5A 4H14A 1NQJA 1DYPA 2E51A 5CAZA 5FRAA 4EWAA 4RR3B 4OFGA 3ROUA 1POV1 5FUPA 1KDKA 1SLAA 1YWKA 2DCKA 1SBDA 2R043 4NHYA 2GNMA 1K5JA 3T2QA 4IERA 5JPMB 3B9IA 4AVAA 1H8TA 2C1FA 4RFT0 1HB2A 2DCJA 2FDJA 2VZVA 3WUDA 5IAVA 4UW6A 3HNMA 4DUWA 5KXEA 1UMHA 1UU5A 3R05A 5FYSA 2F6BA 3J9SA 4NRMA 3UK9A 1VAKA 1BEV3 1W9YA 4BH9A 4Q4Y2 1CGPA 3THTA 5C7GA 4GJZA 3APBA 3GALA 3ZN6A 2RM22 3AKQA 2R071 3PUSA 3WF3A 4YW2A 4A6SA 4ATFA 5B2GB 3GNEA 2EIBA 3H3UA 4QXKA 4WZCA 4NHXA 3VZNA 1QKQA 1CX1A 2R30A 3I3QA 2DVGA 4NRQA 4V2WA 4CCDA 2LALA 1T2XA 5FPBA 1MS0A 4K8FA 5FTTC 1WZXA 4NO4A 3TEYA 3E6BA 4M0HA 5LA0A 2YY1A 4Q4W1 4M00A 1Y3TA 4FPOB 1Y9QA 3T0BA 3U1XA 4MGTA 3OD4A 3VBFC 2IXLA 1X7NA 4GB31 4AAPA 4LNVA 2RM23 2E63A 4Y1UA 3EB7A 2JECA 2X5IA 1QXRA 3BOWA 2OX0A 3KMHA 3C7EA 3E6DA 4ATEA 2QNKA 2WAAA 3DPRA 4OHXA 2DBIA 4LBMA 4E8DA 4KG0A 3WZ1A 2OQ6A 2VTFA 1PK6B 1R083 2JX9A 1AYN2 1OQEA 1POV0 1RUD3 2OIIA 2Q30A 3SH4A 5JXGA 3I3EA 4DPNA 2YFZA 4HXCA 5BXXA 2WINB 3MFAA 5F3EA 1C5HA 4KMQA 2YUEA 1UQXA 2WUHA 4AI8A 4I02A 1HW5A 5AC92 2XDVA 1YQ2A 1UXZA 3P3NA 3FC0A 4CYDA 4EYUA 1OHFA 3D6EA 5LK5A 3I3MA 1H4GA 3ETQA 3BI3A 1F31A 4LJHA 1WMEA 1Q8SA 4UW5A 3I2FA 1AYN3 2IXJA 4BIOA 1XYPA 4LKSA 4BE3A 1HIXA 4QB2A 3THCA 3OGSA 5C3RA 4OHYA 5CISA 2Y8KA 3POFA 2RR11 4FPCA 4Z82A 3RVHA 4GXLA 2G9GA 4N9IA 3HQUA 1UL9A 1WMXA 1YJKA 2AEYA 1KD7A 5AC93 4Z92B 4EN7B 2PAKA 3THPA 2YPDA 1YHFA 5LRRA 3RNSA 2EXIA 1XB9A 3E97A 1COV2 1YQ5A 3ZOIA 3LKJA 3LDKA 3RZKA 1GANA 1LOBA 1CJDA 2IXCA 2YU1A 1VPHA 2ZZQA 4KGQA 5FZFA 3C8XA 2B8MA 2HLEA 3S0MA 3L2YA 1YFWA 2VMHA 1C8M2 3QH6A 5D21A 1DGRA 2CTVA 1UY0A 3O0VA 3NKTA 3UESA 3ZSKA 1SEFA 3GHMA 4ISQA 4NHMA 3BVCA 4XBQA 3IDAA 4YGEA 3I2DA 1HQNA 1W9TA 2FBEA 2VQAA 5GLUA 1DQ2A 2BBVA 1BQPA 1T6BX 3CO2A 3P1IA 4XUOA 3O1SA 2VMEA 1QDOA 1ND2C 1QXJA 2YB7A 4HMZA 5J98B 4OQ9A 4XDQA 3C7OA 3NJXA 5IVCA 4Q0PA 1CJPA 4J6GA 1C8M3 4GH4C 4PDWC 1U5ZA 2VMGA 2BZDA 4EZ4A 3UETA 4CPBA 3N7JA 2FZ1A 4LBQB 1IOAA 5BPXA 5HCHA 4FTBA 5DDJ1 2VVEA 3BCWA 4SBVA 4YVSC 1W8HA 3VKOA 4CU7A 2D3SA 2SBAA 3H8OA 2ZAHA 3PUIA 4Y4RA 3WNLA 3ZYRA 4BYYA 2DF7A 4HG6B 1CD3G 2WJSA 4KWKA 4AE2A 5CBLA 4EN6B 3PDQA 1N1TA 2WNUC 2ZZJA 4GJYA 1OOPA 2B42B 2YGMA 3VBFB 3NJVA 2AREA 2WS93 3ZXLA 4FPLA 1Y43B 5CG9A 3AMMA 3WCRA 5C8CA 4DMIA 3NAPA 3ON7A 3HQXA 1LOFA 2GH8A 2Y33A 4XFFA 4QM8A 2PYTA 2W39A 2JB8A 2YC2A 1TG7A 5DUWA 3ZIXA 5A33B 2HWC1 2AACA 4QKNA 4D7SA 3C3VA 1XE0A 1D2SA 1W8NA 4H7LA 4Q0UA 4PIYA 3MZHA 4TLGA 4XFCA 4P9IA 3V56A 4JKLA 2RJ2A 3ZSLA 5T54A 4XMIA 5FZLA 3RZGA 1S0EA 4Q4X1 1Q8PA 2XQXA 3DUIA 3B94A 5GALA 1N1SA 5BV6A 5FZ4A 4COWA 1BBT2 1Z7S3 4QHBA 2KA3A 1QF3A 1BLZA 3OSDA 1W2TA 1RXGA 1JU4A 5BNNC 2DFBA 1J3PA 1F4HA 1S0FA 2Y6FA 5H9QA 2XBO1 5K0UC 1RUC3 2NP0A 4JTOA 1HLCA 1B35A 3O1VA 3POWA 1UU4A 2H6BA 2ZGNA 5I93A 3IBMA 3WVJA 4E2QA 5FQ0A 1SDDB 1OURA 2AUYA 2NM1A 2ZS6B 5JVVA 2XHNA 5DMYA 1U5XA 5BNOC 3KV6A 1HJGA 4RHV1 3NNJA 2RE9A 1CZSA 1HXS1 4LKDA 5FBJA 3IN9A 3M3CA 1C1FA 4KNCA 3CMGA 1GMMA 2IVIB 2PQSA 3OY8A 1SDWA 3LIGA 3URFA 2R062 1V9U1 1ZNPA 2EA7A 3VD5A 1DQ6A 2UWAA 4YW3A 1OD3A 1VMFA 3PUAA 2IXIA 3R4DB 4FQZA 5EYXA 1UOFA 4WVMB 1VBA1 5C6CA 4AEJA 5L9RA 4NAOA 4L92A 1JTZX 4XJZA 4K1ZA 4XAAA 3RJ2X 2ZMNA 2B9UA 1NA1A 2YV8A 1VBD3 3AZVA 4MO3M 4UBHA 2ORZA 1GP6A 2YROA 1ND2B 3DV8A 5FP3A 4AG4A 4BQ5A 5K9YA 2P3IA 2BRTA 2WNVC 5HV0A 1F8VA 4X8NA 5C3SA 1XRUA 2J22A 3IAQA 2R7EB 3BPZA 1LULA 3L9JT 2Z79A 4GH4B 4PDWB 3FLTA 1PX3A 1W0PA 2W5FA 2Y34A 3AKRA 5FMCA 5CFCB 1RMU2 1SPPA 2D3PA 2XR4A 3AP5A 4FP2A 4M3CF 2VY0A 1QJEA 2ENRA 5FK8A 1E5RA 2D6LX 3PJYA 1GQHA 4YVSB 5JAXA 1RYYA 2VZOA 5FP9A 5JOWA 1ENQA 2JJ6A 4IUGA 1MZ6A 3WW3A 3KCCA 1JXNA 3IIIA 4NOTA 5LA9A 4CUBA 4XMAA 1SBFA 3KV4A 2D3RA 3FE5A 1JUIA 4BQWA 1RMU3 2GH2A 2ZX2A 2WNUB 3LA2A 1O8PA 3B02A 2JE9A 3KT7A 1S1AA 1UU6A 4DO0A 1UY3A 4I3GA 2UURA 5G04L 3PUQA 2Z4FA 1H1MA 3K4AA 4TXWA 5DG2A 4LORA 3WEZA 1HB1A 3JBG3 3AYCA 1CAUB 4BA6A 5A7WA 1QJX1 1VBE3 1XE7A 2ZOEB 4F7ZA 5IFTA 3ZXEA 4UFMA 1PMJX 3SNMA 3WLUA 3FN9A 1ASJ1 4QWNA 4K7JA 4FO9A 4JGYC 1GNYA 3N9QA 4XOGA 4L0PA 3WOGA 4CRQA 5FIXA 1W0OA 2RS52 1ULOA 2DU1A 2BEOA 4XXPA 4BQXA 5C71A 4LO7A 4OUEA 1NQDA 1IG0A 2HWE3 4XFGA 4UBGA 2R041 2YBPA 4WM8C 4FAGA 2DTWA 1PM4A 1PIV1 4RR3A 3GZEA 1DYOA 1LESA 1EPWA 3MF9A 3AKSA 1RUJ2 1UWWA 2XB6C 5GZCA 3GZTB 3B3QE 1I6XA 1QOSA 4QPGB 3ILRA 2XH6A 5BNNB 2QE3A 2XPJA 5JPNB 1CPNA 5GZFA 5A3MA 3ZO0B 3S5AA 4L99A 4TN7A 3CJIC 2L9LA 1YYNA 5IT6A 2YU2A 3I59B 4XF0A 3MW2A 3UL2A 3D82A 4W6XA 1VBB2 1GP5A 1W90A 1GOGA 2B45X 1LOCA 4FPKA 1HRV2 3RFRA 4S2DA 5BNOB 2A6YA 2WAOA 1PGL2 1ZBA3 2D40A 4XDOA 1EUTA 4QMAA 1W8WA 5CVRA 4BQYA 1DLCA 3J4UH 1M06G 2ZX4A 4NIHA 2E7QA 2RM21 2H0VA 4IEZA 2BGPA 4R4ZA 4Q0QA 4TLFA 4NE9A 1YRZA 4FPFA 1T6GC 3T0AA 1VBB3 1RHI2 3VZOA 5FPAA 3BU0A 1HRI2 4HSJA 2EAAA 4PBOA 4CDUC 5F5CA 1D0HA 5ACA2 1GQGA 5JOXA 1VIWB 3ZYIB 2I74A 1ZX5A 3KB5A 2WNVB 4CP1A 4BISA 1RITA 1V70A 1YC61 3CBNA 1PK6A 4NROA 3NVCA 4XQ4A 4DNYA 4FVVA 4WZFA 5A7PA 1QY4A 2WDBA 4YGCA 3VBUA 2GALA 2ADEA 2GMEA 1KDMA 1POV3 4IEQA 2FCVA 1OPMA 1KGYA 1ST8A 4JDOA 3VD7A 3B7MA 3ZYFA 1AYN1 2VOKA 1H2LA 1SACA 4GKXA 3LZZA 2XXZA 3VB9A 3WQ0A 4AR2A 3WV6A 5ACA3 2ILMA 1YUDA 1XNCA 2JIGA 4XQWA 2CGPA 4MOAA 3RYRA 4QT6A 1US2A 4ZS3A 3TNPB 2JXAA 1IPSA 1VAMA 5AC91 5FMOL 2PLV2 4LTAA 5LA1A 1LU1A 4HKWA 5L36A 2R073 2BBAA 3NRUA 3LSEA 4QQPA 4YW7A 3U0ZA 2ZX0A 3O0WA 3ZMNA 3SEEA 1J1LA 4I0WB 5KHGA 3SISA 2CDOA 3FHIB 4WVWA 4E9KA 1J58A 4AFAA 3I3BA 4GZ9A 5KR7A 2C9KA 1AZDA 1SQ4A 1XU1A 1VALA 1NAEA 2A3WA 2HEVF 2QTWB 1RUG2 2W92A 2X5IB 4JGYB 2PLV3 4N9HA 1VLNA 2C24A 3IAPA 4IEVA 5FP8A 2XL7A 1COV1 3T2PA 4JVAA 2VMIA 1AL0G 1O4TA 1SFYA 2XHKA 4WM8B 1PMHX 5CG8A 1TNFA 4J25A 1IPJA 2HEWF 3PU3A 5GZDA 1MEC2 1YEWA 1REDA 4LE4A 1D4M2 2GNBA 1FNYA 1ZZ9A 1C8M1 3C2UA 3O1MA 3NMBA 1O3QA 2B46X 2LRPA 3V0AA 4D6RA 1QOOA 1PO12 3GCXA 4BMBA 4EN9B 4CCJA 2GNDA 4ES8A 1WLCA 2HJIA 1WGPA 5CU1A 1N1YA 3IB3A 3CJIB 5GLZA 3WG1A 2O14A 1ULFA 2BTVC 4I2OA 3KV9A 2P34A 4JHTA 3QBQA 4COZA 5JXIA 3RQ0A 5C70A 1UKRA 2FMDA 3MV11 4XIOA 3WP3A 5DABA 1NLQA 3ME2A 3CEWA 3N9OA 2ZAAA 1DQ0A 5IW0A 1UYZA 1X8EA 2E53A 3WUCA 2WS91 4FOYA 5BUVA 4X8PA 2WR9A 2JG8C 2VECA 1UZVA 4GALA 5FYBA 1NZCA
chains in the Genus database with same CATH topology
1DZQA 3ZPYA 3VBFA 2CWSA 1OSGA 3PJQA 1AX1A 1O7FA 3DKWA 2DUPA 2KM2A 5L73A 3KT1A 5ABJC 3AX4A 3KGZA 2IFWA 3MLKA 4XILA 5A33A 2ZGRA 4F8AA 1S55A 3ZXGA 1K5MC 1OFNA 2O8QA 3RJRA 2I07B 3M7AA 4QX5A 2EF6A 4OI1A 1Z7S1 2OZ6A 2O8OA 1OFSA 4Y1XA 3R6SA 5EJ3A 1RVF3 2RS13 1G7YA 2YHJA 1RUC1 1OMIA 5DDJ3 1FMD2 1SLTA 3ATGA 3B9CA 3CU7A 1Z78A 4BLIA 5D8AC 3RMYA 3LAGA 4L97A 1NY72 3G7DA 4UW3A 1OOPB 3AMNA 2D43A 3OGGA 4AW7A 1ZRDA 4TWTA 2HKXA 2WT1A 5DG1A 4Q29A 3OBTA 3VZJA 3H1YA 3NAPB 1O5LA 3AMHA 3VLBB 1QJZA 5HCAA 4JDMA 4P9GA 3MIBA 3EO6A 4WVMA 4B3NA 1GNHA 4F83A 3PVBB 2HWF2 5EYYA 4OLLA 3MICA 1TNRA 4OHZA 5JIUA 5BNPC 3VZMA 1DGRN 1Q5OA 3H9AA 1ND2A 4FQ4A 5JZGC 1CPMA 4KG8A 4PDWA 1CR7A 4QQLA 2HWD2 4MX3A 4CDWC 2WT2A 4AVTA 3JCIA 1MR5A 4Z07A 4COUA 5FPXA 1RUNA 2BFUS 1H2NA 3H0OA 4GWNA 1FOD2 5GZGA 1HQWA 5A3LA 1RMU1 3FBYA 3GHNA 1URXA 3BOPA 1YFXA 3KSCA 4LBLA 4LO5B 4AVCA 1RUE2 3ZFFC 4COVA 3R4UA 5KXCA 2HWD3 2JG8B 4GQ7A 3ACLA 1SCSA 2P3KA 2WNUA 5AVPA 4RHV3 1IQAA 1HXS3 5ABJB 3INAA 1FV2A 3AZWA 3NL1A 3MGUA 1CAUA 4XYXA 3H1WA 3EJKA 2FMYA 2CAUA 1WBLA 1PNFA 4A7YA 4PF5A 2WC2A 4ZXKA 4NWVA 1VBA3 2Q4SA 3LA3A 1K5MB 3WHUA 1BYHA 4I30A 3V0BB 4AFMA 1UW8A 2ZGOA 4OZXA 3MLLA 1GR3A 2GDFA 3M4FA 5BYNA 5T5PA 5EXOA 1U0AA 1AR72 4MXVA 1TQ5A 5GLVA 3IM0A 5JR7B 1J1TA 5E88A 3RG0A 3KZ4C 2MNGA 5BNNA 1NXMA 1YO8A 4LHNA 2D5FA 1V6NA 4Q4V2 1A78A 1H9WA 3AMPA 5D8AB 1EV12 1RUJ1 5K0UA 3WT3A 3DF0A 3VKLA 2D6NA 1ZBA1 3VDDC 4DRVA 3I59A 2Y0OA 1EAH2 1MQTC 1VBC2 1RL3A 1AR73 4NPRA 4LR4A 5BNOA 4C1WA 3O5SA 4URTA 2W68A 2ZHMA 3AFGA 1LCLA 3AYDA 3AM2A 4C1XA 1VBB1 3SITA 1PZ7A 1QJX3 1PGL1 1XNDA 5I0RA 3NV1A 1LOGA 4GULA 5SV8A 1DZRA 1GSLA 4YM0A 1VBC3 5GLTA 3B01A 2P37A 1R1ZA 5BNPB 4XTPA 4JRLA 3MIFA 2A6WA 5KXDA 1I3HA 2WNVA 2ZPXA 3JU9A 2DVFA 5JZGB 3WP4A 5IK5A 2WFF2 2WZR2 3HN1A 1DDLA 1RHI1 3GYDA 1HRI1 4IEPA 1PIV3 3LCPA 1J3QA 4CDWB 3AP7A 5ACA1 1C1LA 1W39A 4K40A 4AVVA 5IK7A 1H2KA 1IGOA 4FPGA 2VW0A 3VZKA 1AR82 3D5OA 3R0RA 4HETA 3ZXFA 2OPKA 2WZR3 4LHKA 1WD3A 3ZFFB 3AXDA 2D97A 3VBHC 4MGKE 2ET1A 3UKVA 3NW4A 4O9EA 3DGTA 3SH3A 4Q0SA 4CEWC 5AFBA 2EALA 3SCHA 5KHKA 1YFUA 2PLV1 2JKBA 1HV0A 4KU8A 4Q4Y3 3WDVA 2BW8A 1MZEA 3AKPA 5L19A 1MVQA 4AQ6A 4JGYA 5CFDA 4BIFA 1X8MA 4AEDC 4AI2A 1YI7A 3OBRA 4LBJA 5F6LB 1IS3A 2GN7A 1REFA 1UMZA 4IV1C 1RUG1 3VBUB 4WM8A 4H3WA 3X29B 1AF9A 2Q5TA 2Z2SB 5K8SA 4IEWA 1ZYBA 5T50A 5GZEA 1ZRFA 1X50A 1LTEA 5JIAA 3AKTA 5KWRA 3OYWB 2WLQA 4DB5A 2QDNA 1R1A2 4PBPA 1MEC1 1VB2A 1UKGA 3AFKA 4YZ1A 3CJIA 1ND3C 3SH5A 3VDDB 1PO11 4A7ZA 3IT8A 4Y24A 1LHWA 1MQTB 3CL1A 4PIXA 4WBBA 4Q8KA 1N47A 4N53C 1W6MB 1WW6A 4AYUA 4L11A 3SLIA 2AR6A 5LK7B 1GBGA 1D4VB 4G4FA 4V1PA 1PVC2 4C90A 1H8VA 3IPVB 1HQLA 1LHUA 3QD6A 3WP6A 2YZ4A 3E5QA 1H4HA 3PHMA 4DS0A 2DCTA 1EY2A 4I0BA 1PVXA 2C5DA 1ONAA 2UYBA 4YVWC 3E5UA 4ISRA 3VHPA 4OULA 1H1AA 4CDUA 5KBFA 1DF0A 2X8KA 4ONUA 3M3QA 3WQ1A 1QH7A 1COV3 1H2MA 2A3XA 1CVNA 4CZSA 5JSRA 1PNGA 4YZ4A 1S0DA 2VH9A 3V0AB 4LBNA 5EV7A 4Q1PA 1ZBE2 5C8WA 2WT0A 1RVF1 2RS11 1OD5A 5CNAA 3JUUA 1LOAA 2RJKA 4EROA 3PLQA 1I9RA 3R4SA 2AENA 5IK8A 3AMQA 4B29A 1O3TA 1OLRA 1LHNA 4OI4A 2ZGLA 4QD2A 4JDNA 3VHOA 4H7MA 2PTMA 4CEWB 2YMZA 5I0SA 1D2QA 3FZ3A 5E8AA 1DIWA 1FMD1 4NWWA 3TN92 1QJU2 4K21A 2CGOA 1DFQA 1NY71 5LEJA 5TSWA 2ZABA 4EJRA 1AYM2 1VRH2 4AEDB 3M8LA 5AFEA 2QZ2A 4GIQA 5H9RA 2FHRA 4HKLA 4G9SB 4FTSA 4IV1B 1KQRA 1LOEA 3TN93 4KU7A 3MDPA 2XKPA 4AHWA 3CF6E 4OHWA 3MPPG 2GSYA 2B5HA 3DL3A 4ZU5A 3AYAA 5JCTA 4DRRA 1XNBA 2DURA 2XLGA 3KT4A 2ES3A 2CV6A 5KHJA 1ND3B 2WSVA 4HN1A 2NMNA 4E4ZA 5FO8B 3JQXA 1JUHA 4YLZA 4N53B 1AXYA 2PHRA 1MS3A 1NCRC 2HWD1 3MEPA 1AR92 1BBT3 2H0BA 4D7YA 1DQ5A 1CAVB 4EN8B 1JBCA 4I01A 2WWSA 1I5ZA 1L3JA 3UJQA 2TNFA 1MACA 1PZ8A 2JG8A 3H7YA 3WCSA 4U36A 1FOD1 2QFEA 5CA6A 2ZX3A 1PGSA 3KD4A 1YLLA 1VJ2A 3O14A 4CEYC 2XJTA 2H6CA 1RUE1 1LODA 4X6QB 4YVWB 3M70A 5ABJA 4Y1VA 3VZLA 1N3QA 1ZRCA 1WLDA 3H1MA 2GMPA 5I91A 4YG3A 2ZX1A 4DOUA 1F2NA 4K9SA 2R063 1K5MA 5DUUA 3K51A 3FBMA 3OTFA 2XGXA 5EWSA 2RMU2 3ALQA 3ZXKA 2WIIB 3HT2A 3ZXJA 4YW4A 4PLMA 4R52A 1DU3D 4JC1A 4LHLA 3L2HA 4N43C 1CX4A 2A6ZA 5BNQA 3MF6A 1V6MA 5KC5A 2UYAA 1QU0A 2VNRA 4I09A 4R9AA 5D8AA 1AR71 3FFZA 5KC6A 1SBEA 1IZ3A 3TNQA 5T3NA 2OYZA 1ZZCA 4B8EA 3PTYA 4YM3A 1BMV2 4AQSA 1H1IA 2SLIA 1EV11 1YI9A 2P2KA 1HX6A 1QQP2 2R49A 3B93A 3H8UA 4XFHA 5GJ6A 2XL9A 2DU0A 1EAH1 4J1XA 1VBC1 1F9KA 3E6CC 3N3HA 4YRDA 4AI0A 1QDCA 5CFDC 1RJ8A 1UIJA 2VVFA 3ZN5A 4SLIA 4JRAA 2R6QA 3J8F2 2FQPA 4BLJA 3TOJA 5BNPA 1MVEA 4FP3A 4LO8A 5T52A 5JZGA 3RMXA 5HBAA 1W2UA 3ZN4A 1RUOA 3WXPA 4HL0A 4CDWA 4Y22B 1FAYA 4E4SA 2RS53 1BXHA 1UZZA 4QQOA 2WL1A 2HEYF 3J8F3 2WFF1 5A32B 2WZR1 5K0UB 1NLRA 3NKGA 3VBRC 2YXSA 3BIWE 2ATFA 1NCRB 4KGGA 2GU9A 4LUMA 1REEA 2KXLA 4NHKA 2VG9A 1RUJ3 3ZFFA 4QPYA 3VN4A 4YSFA 1AR81 2LM3A 1QNWA 1Q8QA 4M01A 5DUVA 2EVXA 1QGLA 4Q4Y1 3KCXA 4AHXA 4CEYB 1LHVA 4IV3C 1GZWB 4M3CE 3AZXA 2AYHA 4PLOA 4XJ9A 5C9AC 4TZDA 1LGCA 3M1HA 3W9AA 3RWNA 1HRV3 3QCWA 4JV4A 1IKPA 3FJSA 1WCDJ 1DQ4A 2ZGTA 4EWDA 4YZ3A 5FREA 3LWCA 4AI3A 3ZSMA 4D3WA 2HWB2 1TME2 4JQRA 1ZZ6A 1MS1A 2R1BA 3IDEA 1G8WA 3PVNA 4WV8A 1SMVA 1MS9A 3B00A 5E89A 1RHI3 5DZFA 1HRI3 5E16A 1YCIA 5DZEA 3P3PA 5T5JA 3Q9OA 4N43B 2ZGSA 1FNZA 3OYWA 1TME3 1ZM1A 4XZPA 1V6OA 1BZWA 5F1RA 1MS5A 1BJQA 1WW4A 4NVPA 4P5HA 4AGGA 4XJ8A 1CAWA 3USSA 3VDDA 4KWLA 1MQTA 4WVVA 1UAIA 3O0XA 1A3KA 1W6MA 1ZZ7A 2E9QA 3KCYA 4FOVA 1CQ9A 2JICA 2ZTNA 5H9PA 4AWDA 2V73A 3IPVA 4QQHA 5CFDB 5FLJA 1SCRA 3UKNA 4BMEA 4UW4A 1PVC1 4DXZA 1OA4A 4HK8A 2WA4A 2Z69A 4R9CA 3LSDA 3AJYA 2E7AA 2D5HA 1XU2A 2XLAA 2C9AA 1RUG3 4IEOA 1V00A 3PMSA 2DWRA 5JWPA 3WDYA 3NV4A 1A8MA 2QZ3A 4MGIE 3M3OA 3WX5A 1QMJA 4XF4A 4ZU4A 3UJOA 1ENXA 2D6PA 3VBRB 1JYIA 4M3CA 3V64A 1MEC3 3FMGA 1E57A 1ZBE1 1D4M3 4BHPA 1GV9A 1KS5A 3U10A 1PO13 3VBHA 3M3EA 2WNEA 1W6NA 2Y0IA 3JZVA 1WD4A 4CEWA 4IV3B 1TEIA 5FFOC 3RDIA 1RUH2 2JD4A 4NN0A 1CESA 1A6CA 1V6KA 3D4KA 5FMOS 4ASMB 5C9AB 2DVDA 4GA9A 5LRSA 3M2MA 4KBBA 2XG3A 1S0CA 1YFYA 2VXRA 3N35A 2PELA 3SHRA 4CDUB 4XFIA 1ZVFA 2E6VA 3EQEA 4AEDA 1LEMA 2OW4A 3VHNA 3JQWA 4YW1A 1OA2A 3RI8A 3TN91 3HMYA 4IV1A 3ZYPA 3N4MA 1RGSA 2VUJA 2CY6A 2ZGQA 1Q43A 1AYM1 2VGDA 1VRH1 1JH5A 1XYNA 2NN8A 2NQYA 1FPN2 1J3RA 4BOWA 2GC3A 1QNYA 4E2GA 3RI9A 3WDWA 2VUAA 4LA2A 4AF9A 3WD5A 2VNOA 3WY6A 1ULCA 1LJ7A 2GNTA 5I8TA 5K7PA 4LO6B 1N1VA 3RS6A 3WR0A 2C0ZA 4B7EA 1ND3A 2PHDA 4XHXA 2DV9A 4Z8BA 5T55A 1BBT1 2ZKLA 1MS4A 1FPN3 1IS6A 4N53A 4TYSA 1IHMA 2PA7A 3N7KA 4A7KA 4EV0A 3VKFC 1CAVA 3NV2A 4KWJA 4RSUA 1O4ZA 1QOTA 3WDXA 1X33A 5FAXA 1FMD3 1OPOA 1WLTA 4CP2A 3AXEA 3WNXA 4BZ4A 3HBZA 4YVWA 1PMIA 1QXPA 3RYPA 3KQRA 4IQPA 4XIKA 2WLPA 3KM5A 3WP5A 2RS32 2BWAA 3W58A 1CONA 2R061 3EHKA 3VBOC 3B69A 4QU2A 1UZYA 3WDTA 3HR9A 3HIFA 3HWJA 4Z1VA 4FTEA 4Q4X2 4HVRA 2HWF3 2VOXA 3DN7A 3JB8A 2RS33 1OQDA 4D69A 1MZ5A 4FBFA 1UPIA 4Y4YA 3UV9A 3AYEA 1O5UA 1HDKA 2XBO2 2ARBA 1W6PA 5HXVA 5JSOA 4YW5A 5FPZA 3ZFEC 2PFWA 3QACA 1TE1B 1R092 2JENA 1KJLA 1FOD3 3U11A 1RC6A 2PHWA 1V6IA 3D8CA 2O1QA 3PMEA 4H55A 1RUE3 2LTNA 2EXHA 1G9FA 4LBQD 5HCFA 2MEV2 1QQP1 3AP9A 4EN0A 2VOWA 1DHKB 2RS51 1RJ7A 1EYBA 4QGLA 5FO7B 3J8F1 1Q8VA 4AHYA 4B4RA 1AX2A 1AL22 4WM7C 4Y22A 1RIRA 3PNAA 1DLLA 2XVGA 3I7DA 1S0GA 3UKTA 2JG9C 5A32A 1NOVA 3IMNA 1VB4A 1DYKA 2DCZA 4HVOA 4XW3A 5JLVA 1NCRA 1XNKA 3MIEA 5EFUA 1NE4A 4B4QA 3N36A 3S7EA 1AL23 1VAVA 2QVSB 3AZZA 3RZZA 4CEYA 1LKNA 4Q4V3 1EV13 1W6OB 5FBZA 1GZWA 1HRV1 2GMMA 4RL7A 1RUI2 1EAH3 1GNZA 2G4IA 4RS5C 1TMF2 2WQZC 4MLOA 3IWZA 2QQPA 4XF9A 3VBOB 2PHUA 5J96B 1GZCA 1S0BA 4XETA 4XHBA 2QUOA 4MVTA 5CB7A 3VGIA 2UWBA 2D6KA 2PAMA 1HKDA 4OI2A 1RUI3 4LULA 4NHLA 2R042 1UX6A 4YZ5A 2ZKNA 1ENRA 3VUOA 1CAXB 1TME1 2VU9A 4Y5Z0 3MFCA 4PLNA 4QM9A 2PN5A 5FDBA 4N43A 3RSJA 4YNIA 2IFRA 4LBKA 2WFF3 4E27A 4GWMA 4KH9A 1BEV2 2XVKA 2ZHNA 2ZMLA 4R8HA 2R16A 1ZZ8A 3T1MA 1UF2C 3ZFEB 3M3IA 1QWRA 2A71A 1SLBA<