1CQ8A

Aspartate aminotransferase (e.c. 2.6.1.1) complexed with c6-pyridoxal-5p-phosphate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
396
structure length
396
Chain Sequence
b'MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE (2.6.1.1)
publication title Free energy requirement for domain movement of an enzyme
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 132
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1999-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1cq8A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1cq8A01
2Z9UA 3DZZA 2W7LA 3GJUA 1C7GA 5C6UA 2D66A 1XI9A 1LC7A 2W7GA 3KGXA 2OKJA 2HP1A 1O4SA 2D65A 1ASMA 2V1PA 1D7SA 4UHMA 2CINA 2GB3A 1Z3ZA 3DXWA 4ZSWA 1AICA 1ELQA 1I48A 4H51A 1N31A 2YKUA 4JEZA 4W8IA 2WK8A 4WYAA 1G4XA 3EZ1A 2VMVA 3TCMA 2QA3A 1AMQA 2BWOA 4M2KA 4ZDPA 3ZRPA 1P3WA 5DJ9A 2CH2A 4WYCA 1AHGA 1VEFA 3QGUA 1PFFA 2HOZA 4A0HA 3A9ZA 2E7JA 3PDBB 1WSTA 2D7ZA 5G4JA 4OCAA 1Z7DA 1CZCA 2W7DA 2Z61A 4RLGA 1M32A 3ELEA 2RFVA 3UAKA 2VGZA 1TOIA 1LS3A 1D7UA 2W8UA 2R0TA 4WYFA 2O7CA 1CZEA 2JJFA 3DR4A 4HVKA 4CBRA 4CVQA 2CJHA 3B46A 5LHAA 4TN4A 4BHDA 1DGDA 3EUCA 1B5PA 4B98A 4A6RA 5EIGA 5F8VA 4JEWA 3AV7A 5BJ4A 4RM1A 3A9YA 1TOGA 1M0OA 4XK1A 1ELUA 3T32A 3HVYA 4OT8A 5HDMA 1JS6A 1QITA 4OBUA 1MDOA 4P7YA 5EFSA 3NYSA 4F5GA 1BJOB 1AJRA 1FG7A 2CH1A 4IY7A 3DODA 4MQRA 3HDOA 4W5KA 1U08A 4M2JA 2DOUA 1C7NA 4I8AA 2BWNA 1GEXA 1X0MA 1SFFA 3NUIA 1AAWA 2ZY4A 2VLHA 2YCNA 4OYTA 2FM1A 3VOMA 4MKKA 1TOEA 3QM2A 5FT4A 2DR1A 2V0YA 2C7TA 3LVLB 1M0QA 2YOBA 2Q7WA 2HUIA 1AMRA 5EUNA 2ZSMA 3FKDA 2Z9VA 2HUUA 1GBNA 4QGRA 4WXGA 4WYEA 1V2EA 5DJ1A 2W7KA 3N0LA 3FFRA 3VP6A 1DGEA 2VMSA 1SZSA 3DC1A 1QZ9A 2HOYA 2W7FA 1RVUA 2AY8A 1EJIA 1I43A 2BWPA 2BIEA 3A9XA 1UKJA 3ELPA 3MC6C 3B1CA 3B1EA 5K8BA 3P1TA 1ASEA 3RUYA 1S07A 4A6TA 3GBXA 3FQ7A 5AX8A 3FZ6A 1JS3A 2OQXA 3G7QA 3AEJA 1AY5A 1BT4A 3OKSA 1CQ6A 2AY5A 1IX7A 1FC4A 2GMSA 2XBNA 3DRDA 3BB8A 4IYOA 4LNLA 1I41A 4EMYA 1B4XA 2GQNA 2D7YA 3OP7A 3RQ1A 1GD9A 2X5DA 2WK9A 2HUFA 4UQVA 1ZC9A 4RKDA 5G2QA 3BWNC 4F5FA 2D5YA 4GE9A 3WGBA 3VK3A 3LG0A 4Q31A 2E54A 4EB7A 4F5HA 4AZJA 1W7LA 2R5CB 1BQDA 4JE5A 4CXRA 2R5EA 3EIAA 2CFBA 2JISA 1WYTB 4K2BA 3WZFA 2CJGA 2OGAA 4NOGA 3TATA 5D5SA 4BQ0A 2BI1A 4CXQA 2HZPA 2VMPA 1ORDA 3FFHA 1AJSA 1BKGA 4W1XA 2AEUA 5FT5A 1WKGA 2ZUKA 2VMWA 3PPLA 1IX6A 3L8AA 3FZ7A 3LY1A 2ZY5A 4U1TA 3QN6A 1ASDA 1O61A 4WLHA 2D61A 3AEPA 1CQ7A 4ADBA 2DKJA 4XJMA 1DKAA 1N8PA 1AHYA 2E7UA 2YKYA 3DU4A 4JEYA 3FCRA 1ARIA 1BS0A 4ITXA 4EB5A 1KKPA 1QJ5A 1O62A 4R2NA 4KYOA 3KGWA 1AHXA 4OMAA 4J5UA 3WCNA 1GC0A 2VIAA 1KL2A 1V72A 1TARA 3K7YA 3LVMA 3NU8A 5G0AA 3QI6A 3MAFB 1AKCA 1SF2A 2HORA 1M7YA 1C4KA 2GMUA 5JAYA 2W7JA 3R9AA 1IAYA 2O1BA 4PVFA 4RJ0A 5D95A 1WYUA 3EZSA 2ZJGA 3AEOA 1GDEA 3FTBA 3GZDC 1ECXA 4W1WA 3JWAA 2CY8A 2X3LA 1MLYA 4F5LA 1QGNA 3COGA 3VAXA 3BCBA 1TPLA 3NNKA 2ZY2A 4ZAHA 2WKAA 2OKKA 3II0A 3MBBA 4AH3A 1KKJA 3BWNA 1KL1A 1AX4A 3F9TA 2DGLA 3EI6A 4FL0A 1ARTA 3W1JA 2GSAA 7AATA 5E5IA 1H0CA 2FQ6A 2VIBA 5J8QA 3RCHA 1D2FA 3DR7A 2EPJA 1V2DA 3AENB 3FDBA 3NUBA 2AY6A 1ASFA 4K2MA 5HHYA 1ASNA 4OTLA 4IW7A 2D64A 4A72A 3Q8NA 1DJUA 1YJSA 2JJHA 2PB0A 3RBFA 3E9KA 1AMSA 3LV2A 3RI6A 1D7RA 3LVJA 4ZASA 3A8UX 1BQAA 4BMKA 4GRXA 1E5FA 2JG2A 2PO3A 3UWCA 2YKVA 3ISLA 4ZWMA 1LC5A 2BYLA 4R5ZA 3USFA 4MY5A 2HP2A 4W1VA 1IVRA 2W8VA 4UHOA 4RITA 1AMAA 3WKSA 4LNMA 1ARGA 1M4NA 2BI2A 5M49A 4N0BA 2O0RA 3JW9A 2AY4A 4WB0A 3ATHA 1J32A 3PIUA 1RV3A 1YAAA 3PD6A 2WK7A 3A2BA 1H1CA 2BKWA 2QB2A 1WKHA 2AY7A 1ASCA 4E1OA 1OHYA 1UU2A 3UE8A 4WXFA 2W8WA 4WXBA 1C7OA 2VGSA 3H14A 1TATA 2CB1A 3H7FA 3R4TA 4LW4A 3ZZJA 2C0RA 3DYDA 2EGYA 2VMYA 5G2PA 2YRIA 2W7IA 1AKAA 1GC4A 3E6GA 3CQ6A 3GZDA 3I4JA 4L0OA 4LNJA 3PJ0A 1RVYA 3CQ5A 3JU7A 3NRAA 3E2ZA 3NU7A 1BJWA 4XAUA 4KAMA 3EI8A 3WLXA 3NX3A 4JEVA 1QIRA 1S06A 5EIGB 1WYVA 4GE4A 5IWQA 4AO4A 3KE3A 2AY9A 1W7MA 2CJDA 1X2AA 2FNUA 2W7HA 3WCOA 1YOOA 2QBTA 4ADDA 1G7WA 3PGYA 4HF8A 3JTXA 3JZLA 1E5EA 1Y4IA 2BI5A 4MGRA 2BI9A 4GSAA 1VP4A 3B8XA 2JJEA 1QISA 4F5KA 3BCXA 3GR9A 4MKJA 3RBLA 3E77A 4MQQA 3BV0A 4ADCA 1PMMA 3E2FA 3N5MA 3NDNA 1UU0A 3QPGA 4W91A 2YHKA 4JF1A 5DB5A 2PB2A 4AZKA 3GWPA 1OATA 5G4IA 4RKCA 4WLJA 3BWOA 4GDYA 4WYGA 3FQAA 2G6WA 1PG8A 5M4BA 2ZY3A 4JEXA 3EI7A 1B8GA 1TOKA 4RAEA 2VMUA 4PFNA 4ZDOA 1B9IA 1AIBA 4R5FA 1LK9A 1M6SA 4N0WA 2VMTA 1BW0A 5FT8A 1GC3A 2BHXA 2R2NA 2VMQA 4XJOA 1MAPA 5M4DA 3BS8A 3L44A 2W7EA 5F9SA 1CJ0A 4E77A 2VMZA 2Z9WA 2Z1ZA 3K40A 4DQ6A 2XH1A 3ZRQA 2AEVA 1QJ3A 2FNIA 4ZLVA 1AAMA 3DXVA 5I92A 3TFUA 3W1IA 4BA4A 5M46A 2X8UA 2EH6A 3MC6A 1YIYA 2Z9XA 4B9BA 1AHFA 1ASLA 4JE5D 3AOWA 2Z67A 1BJOA 2AATA 2CTZA 3ASBA 3F6TA 2W8JA 4IYOB 5E3KA 9AATA 1JG8A 1CS1A 2C81A 4KXKA 5EUDA 4DBCA 1GEYA 4GE7A 4M2MA 3WGCA 2F8JA 5EAVA 2AY3A 3FZ8A 1AKBA 2C44A 4F5JA 1AHEA 2YKXA 2Z20A 1LKCA 2YCTA 1MLZA 1CL1A 3AELA 4J8LA 3I5TA 3FD0A 4E3RA 1FG3A 3D6KA 3FDDA 2Z1YA 3VK2A 3NTJA 1UU1A 5BJ3A 1IAXA 1ARHA 3CBFA 4ATPA 1IBJA 1OHVA 4RIZA 1AIAA 2JJGA 2BIAA 2W7MA 4LW2A 4MSOA 4R8DA 1AJSB 1AY8A 3LVKA 1B5OA 3CQ4A 3WX9A 1W23A 3LWSA 4PIWA 3MAUA 3WY7A 1SZUA 1ARSA 4OC9A 4U2HA 3FVSA 4F5IA 4P3MA 2BYJA 4Y0DA 1DJ9A 1MAQA 4PFFA 3NYTA 3JWBA 1PMOA 4AO9A 2QLRA 5EAAA 1C9CA 4TMRA 3ASAA 5EQCA 5FT6A 4ATQA 2ORDA 2ZC0A 4XJPA 1SVVA 3AEJC 1S0AA 1IX8A 3P6KA 2VMRA 1IUGA 4XJLA 1V2FA 3ZZKA 1TASA 3BN1A 4MQPA 3AEMC 4IXZA 3MEBA 4IXOA 2VGUA 3HBXA 4A6UA 1ZODA 1MDXA 3FRKA 4DGTA 2VLFA 3E2YA 1W7NA 2ZP7A 2CSTA 3GETA 4EFFA 4RJYA 4E3QA 3N75A 1WYUB 2W8TA 3AOVA 3FVUA 2CANA 1S08A 2EZ1A 1C0NA 1LW4A 4WD2A 4ZDLA 1DFOA 2VI8A 4ZSYA 1LW5A 2R5CA 3IHJA 2VI9A 3M5UA 3QHXA 4JF0A 5LH9A 3GZCA 2BI3A 1WYTA 3AATA 1GC2A 4O6ZA 3K28A 3GSBA 1SZKA 4OBVA 4TV7A 3BCAA 4WYDA 2DGKA 2EZ2A 3IF2A 4FFCA 3ZRRA 4Y0HA 3EI5A 3PA9A 1DJEA 1CQ8A 1XEYA 1M0NA 2FYFA 2ZSLA 1X28A 4UHNA 3RCHB 1OXOA 1EG5A 5TF5A 2DKBA 3KKIA 4ISYA 2QB3A 4ITGA 4EU1A 1RV4A 2OATA 5EUEA 1S09A 1SPAA 4AOAA 1J04A 3PAAA 3TQXA 1GEWA 1ASBA 1I29A 4GEBA 3HT4A 2VGVA 2VGTA 2VMNA 4A0FA 1CL2A 2YRRA 1G4VA 1AY4A 3BC8A 2AY1A 4Q75A 2NMPA 4Q76A 3PDXA 1MGVA 3EIBA 8AATA 3F0HA 5E4ZA 3MAFA 3QBOA 4XEWA 2HOXA 3FSLA 1LC8A 1OXPA 1DTYA 1T3IA 1IJIA 3NYUA 4WB0B 2VMOA 3TFTA 1ZOBA 4IX8A 2ZYJA 3AEMA 3PD6B 3PDBA 3VK4A 4WBTA 4Q6RA 2BIGA 4ZWVA 4WP0A 4UOYA 4K2IA 4A00A 2TPLA 5G09A 2QMAA 2VGWA 4ZM4A 1KMJA 4XQ2A 4ZM3A 2VYCA 1BJ4A 1TOJA 4Y0IA 1BJNA 1YJYA 3W1HA 4A0RA 1VJOA 2AY2A 1JF9A 4IXSA 2VMXA 2DGMA 4F4EA 1GCKA 2OGEA 1YJZA 3FVXA 4CBSA 1YNUA 1W3UA 2D63A 1MDZA 3EI9A 3G8MA 1M0PA 3E2ZB 3FQ8A 3I16A 3HLMA 2YCPA 2FN6A 3CAIA 1KMKA 3G0TA 1YIZA 2JGTA 1OHWA 3ACZA 1WYVB 3WKRA 4F5MA 1B9HA 3MADA 4ADEA 5HXXA 2EO5A 4A0GA 2E7IA 5DX5A 3AENA 4BA5A 1X29A 1D7VA 3MKJA 1ASGA 3HQTA 1ASAA 1O69A 3HL2A 1G7XA 1EQBA 3HMUA 3ECDA 2X5FA 3B1DA 1N2TA 4LC3A
chains in the Genus database with same CATH superfamily
2Z9UA 3DZZA 2W7LA 3GJUA 1C7GA 5C6UA 2D66A 1XI9A 1LC7A 2W7GA 3KGXA 2OKJA 2HP1A 1O4SA 2D65A 1ASMA 2V1PA 1D7SA 4UHMA 2CINA 2GB3A 1Z3ZA 3N4SA 3DXWA 4ZSWA 1AICA 1ELQA 1I48A 4H51A 1N31A 2YKUA 4JEZA 4W8IA 2WK8A 4WYAA 1G4XA 3EZ1A 2VMVA 3TCMA 2QA3A 1AMQA 2BWOA 4M2KA 4ZDPA 3ZRPA 1P3WA 5DJ9A 2CH2A 4WYCA 1AHGA 1VEFA 3QGUA 2KFPA 1PFFA 2HOZA 4A0HA 3A9ZA 2E7JA 3PDBB 1WSTA 2D7ZA 5G4JA 4OCAA 1Z7DA 1CZCA 2W7DA 2Z61A 4RLGA 1M32A 3ELEA 2RFVA 3UAKA 2VGZA 1TOIA 1LS3A 1D7UA 2W8UA 2R0TA 4WYFA 2O7CA 1CZEA 2JJFA 3DR4A 4HVKA 4CBRA 4CVQA 2CJHA 3B46A 5LHAA 4TN4A 4BHDA 1DGDA 3EUCA 1B5PA 4B98A 4A6RA 5EIGA 5F8VA 4JEWA 3AV7A 5BJ4A 4RM1A 3A9YA 1TOGA 1M0OA 4XK1A 1ELUA 3T32A 3HVYA 4OT8A 5HDMA 1JS6A 1QITA 4OBUA 1MDOA 4P7YA 5EFSA 3NYSA 4F5GA 1BJOB 1AJRA 1FG7A 2CH1A 4IY7A 3DODA 4MQRA 3H9XA 3HDOA 4W5KA 1U08A 4M2JA 2DOUA 1C7NA 4I8AA 2BWNA 1GEXA 1X0MA 1SFFA 3NUIA 1AAWA 2ZY4A 5KTBA 2VLHA 4H63Q 2YCNA 4OYTA 2FM1A 3VOMA 4MKKA 1TOEA 3QM2A 5FT4A 2DR1A 2V0YA 2QSRA 2G7JA 2C7TA 3LVLB 1M0QA 2YOBA 2Q7WA 2HUIA 1AMRA 5EUNA 2ZSMA 3FKDA 2Z9VA 2HUUA 1GBNA 4QGRA 4WXGA 4WYEA 1V2EA 5DJ1A 2W7KA 3N0LA 3FFRA 3VP6A 1DGEA 2VMSA 1SZSA 3DC1A 1QZ9A 2HOYA 2W7FA 1RVUA 2AY8A 1EJIA 1I43A 2BWPA 2BIEA 3A9XA 1UKJA 3ELPA 3MC6C 3B1CA 3B1EA 5K8BA 3P1TA 1ASEA 3RUYA 1S07A 4A6TA 3GBXA 3FQ7A 5AX8A 3FZ6A 1JS3A 2OQXA 3G7QA 3AEJA 1AY5A 1BT4A 3OKSA 1CQ6A 2AY5A 1IX7A 1FC4A 2GMSA 2XBNA 3DRDA 3BB8A 4IYOA 4LNLA 1I41A 4EMYA 1B4XA 2GQNA 2D7YA 3OP7A 3RQ1A 1GD9A 2X5DA 2WK9A 2HUFA 4UQVA 1ZC9A 4RKDA 5G2QA 3BWNC 4F5FA 2D5YA 4GE9A 3WGBA 3VK3A 3LG0A 4Q31A 2E54A 4EB7A 4F5HA 4AZJA 1W7LA 2R5CB 1BQDA 4JE5A 4CXRA 2R5EA 3EIAA 2CFBA 2JISA 1WYTB 4K2BA 3WZFA 2CJGA 2OGAA 4NOGA 3TATA 5D5SA 4BQ0A 2BI1A 4CXQA 2HZPA 2VMPA 1ORDA 3FFHA 1AJSA 1BKGA 4W1XA 2AEUA 5FT5A 1WKGA 2ZUKA 2VMWA 3PPLA 1IX6A 3L8AA 3FZ7A 3LY1A 2ZY5A 4U1TA 3QN6A 1ASDA 1O61A 4WLHA 2D61A 3AEPA 1CQ7A 4ADBA 2DKJA 4XJMA 1DKAA 1N8PA 1AHYA 2E7UA 2YKYA 3DU4A 4JEYA 3FCRA 1ARIA 1BS0A 4ITXA 4EB5A 1KKPA 1QJ5A 1O62A 4R2NA 2WB6A 4KYOA 3KGWA 1AHXA 4OMAA 4J5UA 3WCNA 1GC0A 2VIAA 1KL2A 1V72A 1TARA 3K7YA 3LVMA 3NU8A 5G0AA 3QI6A 3MAFB 1AKCA 1SF2A 2HORA 1M7YA 1C4KA 2GMUA 5JAYA 2W7JA 3R9AA 1IAYA 2O1BA 4PVFA 4RJ0A 5D95A 1WYUA 3EZSA 2ZJGA 3AEOA 1GDEA 3FTBA 3GZDC 1ECXA 4W1WA 3JWAA 2CY8A 2X3LA 1MLYA 4F5LA 1QGNA 3COGA 3VAXA 3BCBA 1TPLA 3NNKA 2ZY2A 4ZAHA 2WKAA 2OKKA 3II0A 3MBBA 4AH3A 1KKJA 3BWNA 1KL1A 2A1VA 1AX4A 3F9TA 2DGLA 3EI6A 4FL0A 1ARTA 3W1JA 2GSAA 7AATA 3N4XA 5E5IA 1H0CA 2FQ6A 2VIBA 5J8QA 3N4RA 3RCHA 1D2FA 3DR7A 2EPJA 1V2DA 3AENB 3FDBA 3NUBA 2AY6A 1ASFA 4K2MA 5HHYA 1ASNA 4OTLA 4IW7A 2D64A 4A72A 3Q8NA 1DJUA 1YJSA 2JJHA 2PB0A 3RBFA 3E9KA 1AMSA 3LV2A 3RI6A 1D7RA 3LVJA 4ZASA 3A8UX 1BQAA 4BMKA 4GRXA 1E5FA 2JG2A 2PO3A 3UWCA 2YKVA 3ISLA 4ZWMA 1LC5A 2BYLA 4R5ZA 3USFA 4MY5A 2HP2A 4W1VA 1IVRA 2W8VA 4UHOA 4RITA 1AMAA 3WKSA 4LNMA 1ARGA 1M4NA 2BI2A 5M49A 4N0BA 2O0RA 3JW9A 2AY4A 4WB0A 3ATHA 1J32A 3PIUA 1RV3A 1YAAA 3PD6A 2WK7A 3A2BA 1H1CA 2BKWA 2QB2A 1WKHA 2AY7A 1ASCA 4E1OA 1OHYA 1UU2A 3UE8A 4WXFA 2W8WA 4WXBA 1C7OA 2VGSA 3H14A 1TATA 2CB1A 3H7FA 3R4TA 4LW4A 3ZZJA 2C0RA 3DYDA 2EGYA 2VMYA 5G2PA 2YRIA 2W7IA 1AKAA 1GC4A 3E6GA 3CQ6A 3GZDA 3I4JA 4L0OA 4LNJA 3PJ0A 1RVYA 3CQ5A 3JU7A 3NRAA 3E2ZA 3NU7A 1BJWA 4XAUA 4KAMA 3EI8A 3WLXA 2FKIA 3NX3A 4JEVA 1QIRA 1S06A 5EIGB 1WYVA 4GE4A 5IWQA 4AO4A 3KE3A 2AY9A 1W7MA 2CJDA 1X2AA 2FNUA 2W7HA 3WCOA 1YOOA 2QBTA 4ADDA 1G7WA 3PGYA 4HF8A 3JTXA 3JZLA 4K05A 1E5EA 1Y4IA 2BI5A 4MGRA 2BI9A 4GSAA 1VP4A 3B8XA 2JJEA 1QISA 4F5KA 3BCXA 3GR9A 4MKJA 3RBLA 3E77A 4MQQA 3BV0A 4ADCA 1PMMA 3E2FA 3N5MA 3NDNA 1UU0A 3QPGA 4W91A 2YHKA 4JF1A 5DB5A 2PB2A 4AZKA 3GWPA 1OATA 5G4IA 4RKCA 4WLJA 3BWOA 4GDYA 4WYGA 3FQAA 2G6WA 1PG8A 5M4BA 2ZY3A 4JEXA 3EI7A 1B8GA 1TOKA 4RAEA 2VMUA 4PFNA 4ZDOA 1B9IA 1AIBA 4R5FA 1LK9A 1M6SA 4N0WA 2VMTA 1BW0A 5FT8A 1GC3A 2BHXA 2R2NA 2VMQA 4XJOA 1MAPA 5M4DA 3BS8A 3L44A 2W7EA 5F9SA 1CJ0A 4E77A 2VMZA 2Z9WA 2Z1ZA 3K40A 4DQ6A 2XH1A 3ZRQA 2AEVA 1QJ3A 2FNIA 4ZLVA 1AAMA 3DXVA 5I92A 3TFUA 3W1IA 4BA4A 5M46A 2X8UA 2EH6A 3MC6A 1YIYA 2Z9XA 4B9BA 1AHFA 1ASLA 4JE5D 3AOWA 2Z67A 1BJOA 2AATA 2CTZA 3ASBA 3F6TA 2W8JA 4IYOB 5E3KA 9AATA 1JG8A 1CS1A 2C81A 4KXKA 5EUDA 4DBCA 1GEYA 4GE7A 4M2MA 3WGCA 2F8JA 5EAVA 2AY3A 3FZ8A 1AKBA 2C44A 4F5JA 1AHEA 2YKXA 2Z20A 1LKCA 2YCTA 1MLZA 1CL1A 3AELA 4J8LA 3I5TA 3FD0A 4E3RA 1FG3A 3D6KA 3FDDA 2Z1YA 3VK2A 3NTJA 1UU1A 5BJ3A 1IAXA 1ARHA 3CBFA 4ATPA 1IBJA 1OHVA 4RIZA 1AIAA 2JJGA 2BIAA 2W7MA 4LW2A 4MSOA 4R8DA 1AJSB 1AY8A 3LVKA 1B5OA 3CQ4A 3WX9A 1W23A 3LWSA 4PIWA 3MAUA 3WY7A 1SZUA 1ARSA 4OC9A 4U2HA 2EYQA 3FVSA 4F5IA 4P3MA 2BYJA 4Y0DA 1DJ9A 1MAQA 4PFFA 3NYTA 3JWBA 1PMOA 4AO9A 2QLRA 5EAAA 1C9CA 4TMRA 3ASAA 5EQCA 5FT6A 4ATQA 2ORDA 2ZC0A 4XJPA 1SVVA 3AEJC 1S0AA 1IX8A 3P6KA 2VMRA 1IUGA 4XJLA 1V2FA 3ZZKA 1TASA 3BN1A 4MQPA 3AEMC 4IXZA 3MEBA 4IXOA 2VGUA 3HBXA 4A6UA 1ZODA 1MDXA 3FRKA 4DGTA 2VLFA 3E2YA 1W7NA 2ZP7A 2CSTA 3GETA 4EFFA 4RJYA 4E3QA 3N75A 1KAFA 1WYUB 2W8TA 3AOVA 3FVUA 2CANA 1S08A 2EZ1A 1C0NA 1LW4A 4WD2A 4ZDLA 1DFOA 2VI8A 4ZSYA 1LW5A 2R5CA 3IHJA 2VI9A 3M5UA 3QHXA 4JF0A 5LH9A 3GZCA 2BI3A 1WYTA 3AATA 1GC2A 4O6ZA 3K28A 3GSBA 1SZKA 4OBVA 4TV7A 3BCAA 4WYDA 2DGKA 2EZ2A 3IF2A 4FFCA 3ZRRA 4Y0HA 3EI5A 3PA9A 1DJEA 1CQ8A 1XEYA 1M0NA 2FYFA 2ZSLA 1X28A 4UHNA 3RCHB 1OXOA 1EG5A 5TF5A 2DKBA 3KKIA 4ISYA 2QB3A 4ITGA 4EU1A 1RV4A 2OATA 5EUEA 1S09A 1SPAA 4AOAA 1J04A 3PAAA 3TQXA 1GEWA 3N7NA 1ASBA 1I29A 4GEBA 3HT4A 2VGVA 2VGTA 2VMNA 4A0FA 1CL2A 2YRRA 1G4VA 1AY4A 3BC8A 2AY1A 4Q75A 2NMPA 4Q76A 3PDXA 1MGVA 3EIBA 8AATA 3F0HA 5E4ZA 3MAFA 3QBOA 4XEWA 2HOXA 3FSLA 1LC8A 1OXPA 1DTYA 1T3IA 1IJIA 3NYUA 4WB0B 2VMOA 3TFTA 1ZOBA 4IX8A 2ZYJA 3AEMA 3PD6B 3PDBA 3VK4A 4WBTA 4Q6RA 2BIGA 4ZWVA 4WP0A 4UOYA 4K2IA 4A00A 2TPLA 5G09A 2QMAA 2VGWA 4ZM4A 1KMJA 4XQ2A 4ZM3A 2VYCA 1BJ4A 1TOJA 4Y0IA 1BJNA 1YJYA 3W1HA 4A0RA 1VJOA 2AY2A 1JF9A 4IXSA 2VMXA 2DGMA 4F4EA 1GCKA 2OGEA 1YJZA 3FVXA 4CBSA 1YNUA 1W3UA 2D63A 1MDZA 3EI9A 3G8MA 1M0PA 3E2ZB 3FQ8A 3I16A 3HLMA 2YCPA 2FN6A 3CAIA 1KMKA 3G0TA 1YIZA 2JGTA 1OHWA 3ACZA 1WYVB 3WKRA 4F5MA 1B9HA 3MADA 4ADEA 5HXXA 2EO5A 4A0GA 2E7IA 5DX5A 3AENA 4BA5A 1X29A 1D7VA 3MKJA 1ASGA 3HQTA 1ASAA 1O69A 3HL2A 1G7XA 1EQBA 3HMUA 3ECDA 2X5FA 3B1DA 1N2TA 4LC3A
chains in the Genus database with same CATH topology
2Z9UA 3DZZA 2W7LA 3GJUA 1C7GA 5C6UA 2D66A 1XI9A 1LC7A 2W7GA 3KGXA 2OKJA 2HP1A 1O4SA 2D65A 1ASMA 2V1PA 1D7SA 4UHMA 2CINA 2GB3A 1Z3ZA 3N4SA 3DXWA 4ZSWA 1AICA 1ELQA 1I48A 4H51A 1N31A 2YKUA 4JEZA 4W8IA 2WK8A 4WYAA 1G4XA 3EZ1A 2VMVA 3TCMA 2QA3A 1AMQA 2BWOA 4M2KA 4ZDPA 3ZRPA 1P3WA 5DJ9A 2CH2A 4WYCA 1AHGA 1VEFA 3QGUA 2KFPA 1PFFA 2HOZA 4A0HA 3A9ZA 2E7JA 3PDBB 1WSTA 2D7ZA 5G4JA 4OCAA 1Z7DA 1CZCA 2W7DA 2Z61A 4RLGA 1M32A 3ELEA 2RFVA 3UAKA 2VGZA 1TOIA 1LS3A 1D7UA 2W8UA 2R0TA 4WYFA 2O7CA 1CZEA 2JJFA 3DR4A 4HVKA 4CBRA 4CVQA 2CJHA 3B46A 5LHAA 4TN4A 4BHDA 1DGDA 3EUCA 1B5PA 4B98A 4A6RA 5EIGA 5F8VA 4JEWA 3AV7A 5BJ4A 4RM1A 3A9YA 1TOGA 1M0OA 4XK1A 1ELUA 3T32A 3HVYA 4OT8A 5HDMA 1JS6A 1QITA 4OBUA 1MDOA 4P7YA 5EFSA 3NYSA 4F5GA 1BJOB 1AJRA 1FG7A 2CH1A 4IY7A 3DODA 4MQRA 3H9XA 3HDOA 4W5KA 1U08A 4M2JA 2DOUA 1C7NA 4I8AA 2BWNA 1GEXA 1X0MA 1SFFA 3NUIA 1AAWA 2ZY4A 5KTBA 2VLHA 4H63Q 2YCNA 4OYTA 2FM1A 3VOMA 4MKKA 1TOEA 3QM2A 5FT4A 2DR1A 2V0YA 2QSRA 2G7JA 2C7TA 3LVLB 1M0QA 2YOBA 2Q7WA 2HUIA 1AMRA 5EUNA 2ZSMA 3FKDA 2Z9VA 2HUUA 1GBNA 4QGRA 4WXGA 4WYEA 1V2EA 5DJ1A 2W7KA 3N0LA 3FFRA 3VP6A 1DGEA 2VMSA 1SZSA 3DC1A 1QZ9A 2HOYA 2W7FA 1RVUA 2AY8A 1EJIA 1I43A 2BWPA 2BIEA 3A9XA 1UKJA 3ELPA 3MC6C 3B1CA 3B1EA 5K8BA 3P1TA 1ASEA 3RUYA 1S07A 4A6TA 3GBXA 3FQ7A 5AX8A 3FZ6A 1JS3A 2OQXA 3G7QA 3AEJA 1AY5A 1BT4A 3OKSA 1CQ6A 2AY5A 1IX7A 1FC4A 2GMSA 2XBNA 3DRDA 3BB8A 4IYOA 4LNLA 1I41A 4EMYA 1B4XA 2GQNA 2D7YA 3OP7A 3RQ1A 1GD9A 2X5DA 2WK9A 2HUFA 4UQVA 1ZC9A 4RKDA 5G2QA 3BWNC 4F5FA 2D5YA 4GE9A 3WGBA 3VK3A 3LG0A 4Q31A 2E54A 4EB7A 4F5HA 4AZJA 1W7LA 2R5CB 1BQDA 4JE5A 4CXRA 2R5EA 3EIAA 2CFBA 2JISA 1WYTB 4K2BA 3WZFA 2CJGA 2OGAA 4NOGA 3TATA 5D5SA 4BQ0A 2BI1A 4CXQA 2HZPA 2VMPA 1ORDA 3FFHA 1AJSA 1BKGA 4W1XA 2AEUA 5FT5A 1WKGA 2ZUKA 2VMWA 3PPLA 1IX6A 3L8AA 3FZ7A 3LY1A 2ZY5A 4U1TA 3QN6A 1ASDA 1O61A 4WLHA 2D61A 3AEPA 1CQ7A 4ADBA 2DKJA 4XJMA 1DKAA 1N8PA 1AHYA 2E7UA 2YKYA 3DU4A 4JEYA 3FCRA 1ARIA 1BS0A 4ITXA 4EB5A 1KKPA 1QJ5A 1O62A 4R2NA 2WB6A 4KYOA 3KGWA 1AHXA 4OMAA 4J5UA 3WCNA 1GC0A 2VIAA 1KL2A 1V72A 1TARA 3K7YA 3LVMA 3NU8A 5G0AA 3QI6A 3MAFB 1AKCA 1SF2A 2HORA 1M7YA 1C4KA 2GMUA 5JAYA 2W7JA 3R9AA 1IAYA 2O1BA 4PVFA 4RJ0A 5D95A 1WYUA 3EZSA 2ZJGA 3AEOA 1GDEA 3FTBA 3GZDC 1ECXA 4W1WA 3JWAA 2CY8A 2X3LA 1MLYA 4F5LA 1QGNA 3COGA 3VAXA 3BCBA 1TPLA 3NNKA 2ZY2A 4ZAHA 2WKAA 2OKKA 3II0A 3MBBA 4AH3A 1KKJA 3BWNA 1KL1A 2A1VA 1AX4A 3F9TA 2DGLA 3EI6A 4FL0A 1ARTA 3W1JA 2GSAA 7AATA 3N4XA 5E5IA 1H0CA 2FQ6A 2VIBA 5J8QA 3N4RA 3RCHA 1D2FA 3DR7A 2EPJA 1V2DA 3AENB 3FDBA 3NUBA 2AY6A 1ASFA 4K2MA 5HHYA 1ASNA 4OTLA 4IW7A 2D64A 4A72A 3Q8NA 1DJUA 1YJSA 2JJHA 2PB0A 3RBFA 3E9KA 1AMSA 3LV2A 3RI6A 1D7RA 3LVJA 4ZASA 3A8UX 1BQAA 4BMKA 4GRXA 1E5FA 2JG2A 2PO3A 3UWCA 2YKVA 3ISLA 4ZWMA 1LC5A 2BYLA 4R5ZA 3USFA 4MY5A 2HP2A 4W1VA 1IVRA 2W8VA 4UHOA 4RITA 1AMAA 3WKSA 4LNMA 1ARGA 1M4NA 2BI2A 5M49A 4N0BA 2O0RA 3JW9A 2AY4A 4WB0A 3ATHA 1J32A 3PIUA 1RV3A 1YAAA 3PD6A 2WK7A 3A2BA 1H1CA 2BKWA 2QB2A 1WKHA 2AY7A 1ASCA 4E1OA 1OHYA 1UU2A 3UE8A 4WXFA 2W8WA 4WXBA 1C7OA 2VGSA 3H14A 1TATA 2CB1A 3H7FA 3R4TA 4LW4A 3ZZJA 2C0RA 3DYDA 2EGYA 2VMYA 5G2PA 2YRIA 2W7IA 1AKAA 1GC4A 3E6GA 3CQ6A 3GZDA 3I4JA 4L0OA 4LNJA 3PJ0A 1RVYA 3CQ5A 3JU7A 3NRAA 3E2ZA 3NU7A 1BJWA 4XAUA 4KAMA 3EI8A 3WLXA 2FKIA 3NX3A 4JEVA 1QIRA 1S06A 5EIGB 1WYVA 4GE4A 5IWQA 4AO4A 3KE3A 2AY9A 1W7MA 2CJDA 1X2AA 2FNUA 2W7HA 3WCOA 1YOOA 2QBTA 4ADDA 1G7WA 3PGYA 4HF8A 3JTXA 3JZLA 4K05A 1E5EA 1Y4IA 2BI5A 4MGRA 2BI9A 4GSAA 1VP4A 3B8XA 2JJEA 1QISA 4F5KA 3BCXA 3GR9A 4MKJA 3RBLA 3E77A 4MQQA 3BV0A 4ADCA 1PMMA 3E2FA 3N5MA 3NDNA 1UU0A 3QPGA 4W91A 2YHKA 4JF1A 5DB5A 2PB2A 4AZKA 3GWPA 1OATA 5G4IA 4RKCA 4WLJA 3BWOA 4GDYA 4WYGA 3FQAA 2G6WA 1PG8A 5M4BA 2ZY3A 4JEXA 3EI7A 1B8GA 1TOKA 4RAEA 2VMUA 4PFNA 4ZDOA 1B9IA 1AIBA 4R5FA 1LK9A 1M6SA 4N0WA 2VMTA 1BW0A 5FT8A 1GC3A 2BHXA 2R2NA 2VMQA 4XJOA 1MAPA 5M4DA 3BS8A 3L44A 2W7EA 5F9SA 1CJ0A 4E77A 2VMZA 2Z9WA 2Z1ZA 3K40A 4DQ6A 2XH1A 3ZRQA 2AEVA 1QJ3A 2FNIA 4ZLVA 1AAMA 3DXVA 5I92A 3TFUA 3W1IA 4BA4A 5M46A 2X8UA 2EH6A 3MC6A 1YIYA 2Z9XA 4B9BA 1AHFA 1ASLA 4JE5D 3AOWA 2Z67A 1BJOA 2AATA 2CTZA 3ASBA 3F6TA 2W8JA 4IYOB 5E3KA 9AATA 1JG8A 1CS1A 2C81A 4KXKA 5EUDA 4DBCA 1GEYA 4GE7A 4M2MA 3WGCA 2F8JA 5EAVA 2AY3A 3FZ8A 1AKBA 2C44A 4F5JA 1AHEA 2YKXA 2Z20A 1LKCA 2YCTA 1MLZA 1CL1A 3AELA 4J8LA 3I5TA 3FD0A 4E3RA 1FG3A 3D6KA 3FDDA 2Z1YA 3VK2A 3NTJA 1UU1A 5BJ3A 1IAXA 1ARHA 3CBFA 4ATPA 1IBJA 1OHVA 4RIZA 1AIAA 2JJGA 2BIAA 2W7MA 4LW2A 4MSOA 4R8DA 1AJSB 1AY8A 3LVKA 1B5OA 3CQ4A 3WX9A 1W23A 3LWSA 4PIWA 3MAUA 3WY7A 1SZUA 1ARSA 4OC9A 4U2HA 2EYQA 3FVSA 4F5IA 4P3MA 2BYJA 4Y0DA 1DJ9A 1MAQA 4PFFA 3NYTA 3JWBA 1PMOA 4AO9A 2QLRA 5EAAA 1C9CA 4TMRA 3ASAA 5EQCA 5FT6A 4ATQA 2ORDA 2ZC0A 4XJPA 1SVVA 3AEJC 1S0AA 1IX8A 3P6KA 2VMRA 1IUGA 4XJLA 1V2FA 3ZZKA 1TASA 3BN1A 4MQPA 3AEMC 4IXZA 3MEBA 4IXOA 2VGUA 3HBXA 4A6UA 1ZODA 1MDXA 3FRKA 4DGTA 2VLFA 3E2YA 1W7NA 2ZP7A 2CSTA 3GETA 4EFFA 4RJYA 4E3QA 3N75A 1WYUB 2W8TA 3AOVA 3FVUA 2CANA 1S08A 2EZ1A 1C0NA 1LW4A 4WD2A 4ZDLA 1DFOA 2VI8A 4ZSYA 1LW5A 2R5CA 3IHJA 2VI9A 3M5UA 3QHXA 4JF0A 5LH9A 3GZCA 2BI3A 1WYTA 3AATA 1GC2A 4O6ZA 3K28A 3GSBA 1SZKA 4OBVA 4TV7A 3BCAA 4WYDA 2DGKA 2EZ2A 3IF2A 4FFCA 3ZRRA 4Y0HA 3EI5A 3PA9A 1DJEA 1CQ8A 1XEYA 1M0NA 2FYFA 2ZSLA 1X28A 4UHNA 3RCHB 1OXOA 1EG5A 5TF5A 2DKBA 3KKIA 4ISYA 2QB3A 4ITGA 4EU1A 1RV4A 2OATA 5EUEA 1S09A 1SPAA 4AOAA 1J04A 3PAAA 3TQXA 1GEWA 3N7NA 1ASBA 1I29A 4GEBA 3HT4A 2VGVA 2VGTA 2VMNA 4A0FA 1CL2A 2YRRA 1G4VA 1AY4A 3BC8A 2AY1A 4Q75A 2NMPA 4Q76A 3PDXA 1MGVA 3EIBA 8AATA 3F0HA 5E4ZA 3MAFA 3QBOA 4XEWA 2HOXA 3FSLA 1LC8A 1OXPA 1DTYA 1T3IA 1IJIA 3NYUA 4WB0B 2VMOA 3TFTA 1ZOBA 4IX8A 2ZYJA 3AEMA 3PD6B 3PDBA 3VK4A 4WBTA 4Q6RA 2BIGA 4ZWVA 4WP0A 4UOYA 4K2IA 4A00A 2TPLA 5G09A 2QMAA 2VGWA 4ZM4A 1KMJA 4XQ2A 4ZM3A 2VYCA 1BJ4A 1TOJA 4Y0IA 1BJNA 1YJYA 3W1HA 4A0RA 1VJOA 2AY2A 1JF9A 4IXSA 2VMXA 2DGMA 4F4EA 1GCKA 2OGEA 1YJZA 3FVXA 4CBSA 1YNUA 1W3UA 2D63A 1MDZA 3EI9A 3G8MA 1M0PA 3E2ZB 3FQ8A 3I16A 3HLMA 2YCPA 2FN6A 3CAIA 1KMKA 3G0TA 1YIZA 2JGTA 1OHWA 3ACZA 1WYVB 3WKRA 4F5MA 1B9HA 3MADA 4ADEA 5HXXA 2EO5A 4A0GA 2E7IA 5DX5A 3AENA 4BA5A 1X29A 1D7VA 3MKJA 1ASGA 3HQTA 1ASAA 1O69A 3HL2A 1G7XA 1EQBA 3HMUA 3ECDA 2X5FA 3B1DA 1N2TA 4LC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z9U A;  3DZZ A;  2W7L A;  3GJU A;  1C7G A;  5C6U A;  2D66 A;  1XI9 A;  1LC7 A;  2W7G A;  3KGX A;  2OKJ A;  2HP1 A;  1O4S A;  2D65 A;  1ASM A;  2V1P A;  1D7S A;  4UHM A;  2CIN A;  2GB3 A;  1Z3Z A;  3DXW A;  4ZSW A;  1AIC A;  1ELQ A;  1I48 A;  4H51 A;  1N31 A;  2YKU A;  4JEZ A;  4W8I A;  2WK8 A;  4WYA A;  1G4X A;  3EZ1 A;  2VMV A;  3TCM A;  2QA3 A;  1AMQ A;  2BWO A;  4M2K A;  4ZDP A;  3ZRP A;  1P3W A;  5DJ9 A;  2CH2 A;  4WYC A;  1AHG A;  1VEF A;  3QGU A;  1PFF A;  2HOZ A;  4A0H A;  3A9Z A;  2E7J A;  3PDB B;  1WST A;  2D7Z A;  5G4J A;  4OCA A;  1Z7D A;  1CZC A;  2W7D A;  2Z61 A;  4RLG A;  1M32 A;  3ELE A;  2RFV A;  3UAK A;  2VGZ A;  1TOI A;  1LS3 A;  1D7U A;  2W8U A;  2R0T A;  4WYF A;  2O7C A;  1CZE A;  2JJF A;  3DR4 A;  4HVK A;  4CBR A;  4CVQ A;  2CJH A;  3B46 A;  5LHA A;  4TN4 A;  4BHD A;  1DGD A;  3EUC A;  1B5P A;  4B98 A;  4A6R A;  5EIG A;  5F8V A;  4JEW A;  3AV7 A;  5BJ4 A;  4RM1 A;  3A9Y A;  1TOG A;  1M0O A;  4XK1 A;  1ELU A;  3T32 A;  3HVY A;  4OT8 A;  5HDM A;  1JS6 A;  1QIT A;  4OBU A;  1MDO A;  4P7Y A;  5EFS A;  3NYS A;  4F5G A;  1BJO B;  1AJR A;  1FG7 A;  2CH1 A;  4IY7 A;  3DOD A;  4MQR A;  3HDO A;  4W5K A;  1U08 A;  4M2J A;  2DOU A;  1C7N A;  4I8A A;  2BWN A;  1GEX A;  1X0M A;  1SFF A;  3NUI A;  1AAW A;  2ZY4 A;  2VLH A;  2YCN A;  4OYT A;  2FM1 A;  3VOM A;  4MKK A;  1TOE A;  3QM2 A;  5FT4 A;  2DR1 A;  2V0Y A;  2C7T A;  3LVL B;  1M0Q A;  2YOB A;  2Q7W A;  2HUI A;  1AMR A;  5EUN A;  2ZSM A;  3FKD A;  2Z9V A;  2HUU A;  1GBN A;  4QGR A;  4WXG A;  4WYE A;  1V2E A;  5DJ1 A;  2W7K A;  3N0L A;  3FFR A;  3VP6 A;  1DGE A;  2VMS A;  1SZS A;  3DC1 A;  1QZ9 A;  2HOY A;  2W7F A;  1RVU A;  2AY8 A;  1EJI A;  1I43 A;  2BWP A;  2BIE A;  3A9X A;  1UKJ A;  3ELP A;  3MC6 C;  3B1C A;  3B1E A;  5K8B A;  3P1T A;  1ASE A;  3RUY A;  1S07 A;  4A6T A;  3GBX A;  3FQ7 A;  5AX8 A;  3FZ6 A;  1JS3 A;  2OQX A;  3G7Q A;  3AEJ A;  1AY5 A;  1BT4 A;  3OKS A;  1CQ6 A;  2AY5 A;  1IX7 A;  1FC4 A;  2GMS A;  2XBN A;  3DRD A;  3BB8 A;  4IYO A;  4LNL A;  1I41 A;  4EMY A;  1B4X A;  2GQN A;  2D7Y A;  3OP7 A;  3RQ1 A;  1GD9 A;  2X5D A;  2WK9 A;  2HUF A;  4UQV A;  1ZC9 A;  4RKD A;  5G2Q A;  3BWN C;  4F5F A;  2D5Y A;  4GE9 A;  3WGB A;  3VK3 A;  3LG0 A;  4Q31 A;  2E54 A;  4EB7 A;  4F5H A;  4AZJ A;  1W7L A;  2R5C B;  1BQD A;  4JE5 A;  4CXR A;  2R5E A;  3EIA A;  2CFB A;  2JIS A;  1WYT B;  4K2B A;  3WZF A;  2CJG A;  2OGA A;  4NOG A;  3TAT A;  5D5S A;  4BQ0 A;  2BI1 A;  4CXQ A;  2HZP A;  2VMP A;  1ORD A;  3FFH A;  1AJS A;  1BKG A;  4W1X A;  2AEU A;  5FT5 A;  1WKG A;  2ZUK A;  2VMW A;  3PPL A;  1IX6 A;  3L8A A;  3FZ7 A;  3LY1 A;  2ZY5 A;  4U1T A;  3QN6 A;  1ASD A;  1O61 A;  4WLH A;  2D61 A;  3AEP A;  1CQ7 A;  4ADB A;  2DKJ A;  4XJM A;  1DKA A;  1N8P A;  1AHY A;  2E7U A;  2YKY A;  3DU4 A;  4JEY A;  3FCR A;  1ARI A;  1BS0 A;  4ITX A;  4EB5 A;  1KKP A;  1QJ5 A;  1O62 A;  4R2N A;  4KYO A;  3KGW A;  1AHX A;  4OMA A;  4J5U A;  3WCN A;  1GC0 A;  2VIA A;  1KL2 A;  1V72 A;  1TAR A;  3K7Y A;  3LVM A;  3NU8 A;  5G0A A;  3QI6 A;  3MAF B;  1AKC A;  1SF2 A;  2HOR A;  1M7Y A;  1C4K A;  2GMU A;  5JAY A;  2W7J A;  3R9A A;  1IAY A;  2O1B A;  4PVF A;  4RJ0 A;  5D95 A;  1WYU A;  3EZS A;  2ZJG A;  3AEO A;  1GDE A;  3FTB A;  3GZD C;  1ECX A;  4W1W A;  3JWA A;  2CY8 A;  2X3L A;  1MLY A;  4F5L A;  1QGN A;  3COG A;  3VAX A;  3BCB A;  1TPL A;  3NNK A;  2ZY2 A;  4ZAH A;  2WKA A;  2OKK A;  3II0 A;  3MBB A;  4AH3 A;  1KKJ A;  3BWN A;  1KL1 A;  1AX4 A;  3F9T A;  2DGL A;  3EI6 A;  4FL0 A;  1ART A;  3W1J A;  2GSA A;  7AAT A;  5E5I A;  1H0C A;  2FQ6 A;  2VIB A;  5J8Q A;  3RCH A;  1D2F A;  3DR7 A;  2EPJ A;  1V2D A;  3AEN B;  3FDB A;  3NUB A;  2AY6 A;  1ASF A;  4K2M A;  5HHY A;  1ASN A;  4OTL A;  4IW7 A;  2D64 A;  4A72 A;  3Q8N A;  1DJU A;  1YJS A;  2JJH A;  2PB0 A;  3RBF A;  3E9K A;  1AMS A;  3LV2 A;  3RI6 A;  1D7R A;  3LVJ A;  4ZAS A;  3A8U X;  1BQA A;  4BMK A;  4GRX A;  1E5F A;  2JG2 A;  2PO3 A;  3UWC A;  2YKV A;  3ISL A;  4ZWM A;  1LC5 A;  2BYL A;  4R5Z A;  3USF A;  4MY5 A;  2HP2 A;  4W1V A;  1IVR A;  2W8V A;  4UHO A;  4RIT A;  1AMA A;  3WKS A;  4LNM A;  1ARG A;  1M4N A;  2BI2 A;  5M49 A;  4N0B A;  2O0R A;  3JW9 A;  2AY4 A;  4WB0 A;  3ATH A;  1J32 A;  3PIU A;  1RV3 A;  1YAA A;  3PD6 A;  2WK7 A;  3A2B A;  1H1C A;  2BKW A;  2QB2 A;  1WKH A;  2AY7 A;  1ASC A;  4E1O A;  1OHY A;  1UU2 A;  3UE8 A;  4WXF A;  2W8W A;  4WXB A;  1C7O A;  2VGS A;  3H14 A;  1TAT A;  2CB1 A;  3H7F A;  3R4T A;  4LW4 A;  3ZZJ A;  2C0R A;  3DYD A;  2EGY A;  2VMY A;  5G2P A;  2YRI A;  2W7I A;  1AKA A;  1GC4 A;  3E6G A;  3CQ6 A;  3GZD A;  3I4J A;  4L0O A;  4LNJ A;  3PJ0 A;  1RVY A;  3CQ5 A;  3JU7 A;  3NRA A;  3E2Z A;  3NU7 A;  1BJW A;  4XAU A;  4KAM A;  3EI8 A;  3WLX A;  3NX3 A;  4JEV A;  1QIR A;  1S06 A;  5EIG B;  1WYV A;  4GE4 A;  5IWQ A;  4AO4 A;  3KE3 A;  2AY9 A;  1W7M A;  2CJD A;  1X2A A;  2FNU A;  2W7H A;  3WCO A;  1YOO A;  2QBT A;  4ADD A;  1G7W A;  3PGY A;  4HF8 A;  3JTX A;  3JZL A;  1E5E A;  1Y4I A;  2BI5 A;  4MGR A;  2BI9 A;  4GSA A;  1VP4 A;  3B8X A;  2JJE A;  1QIS A;  4F5K A;  3BCX A;  3GR9 A;  4MKJ A;  3RBL A;  3E77 A;  4MQQ A;  3BV0 A;  4ADC A;  1PMM A;  3E2F A;  3N5M A;  3NDN A;  1UU0 A;  3QPG A;  4W91 A;  2YHK A;  4JF1 A;  5DB5 A;  2PB2 A;  4AZK A;  3GWP A;  1OAT A;  5G4I A;  4RKC A;  4WLJ A;  3BWO A;  4GDY A;  4WYG A;  3FQA A;  2G6W A;  1PG8 A;  5M4B A;  2ZY3 A;  4JEX A;  3EI7 A;  1B8G A;  1TOK A;  4RAE A;  2VMU A;  4PFN A;  4ZDO A;  1B9I A;  1AIB A;  4R5F A;  1LK9 A;  1M6S A;  4N0W A;  2VMT A;  1BW0 A;  5FT8 A;  1GC3 A;  2BHX A;  2R2N A;  2VMQ A;  4XJO A;  1MAP A;  5M4D A;  3BS8 A;  3L44 A;  2W7E A;  5F9S A;  1CJ0 A;  4E77 A;  2VMZ A;  2Z9W A;  2Z1Z A;  3K40 A;  4DQ6 A;  2XH1 A;  3ZRQ A;  2AEV A;  1QJ3 A;  2FNI A;  4ZLV A;  1AAM A;  3DXV A;  5I92 A;  3TFU A;  3W1I A;  4BA4 A;  5M46 A;  2X8U A;  2EH6 A;  3MC6 A;  1YIY A;  2Z9X A;  4B9B A;  1AHF A;  1ASL A;  4JE5 D;  3AOW A;  2Z67 A;  1BJO A;  2AAT A;  2CTZ A;  3ASB A;  3F6T A;  2W8J A;  4IYO B;  5E3K A;  9AAT A;  1JG8 A;  1CS1 A;  2C81 A;  4KXK A;  5EUD A;  4DBC A;  1GEY A;  4GE7 A;  4M2M A;  3WGC A;  2F8J A;  5EAV A;  2AY3 A;  3FZ8 A;  1AKB A;  2C44 A;  4F5J A;  1AHE A;  2YKX A;  2Z20 A;  1LKC A;  2YCT A;  1MLZ A;  1CL1 A;  3AEL A;  4J8L A;  3I5T A;  3FD0 A;  4E3R A;  1FG3 A;  3D6K A;  3FDD A;  2Z1Y A;  3VK2 A;  3NTJ A;  1UU1 A;  5BJ3 A;  1IAX A;  1ARH A;  3CBF A;  4ATP A;  1IBJ A;  1OHV A;  4RIZ A;  1AIA A;  2JJG A;  2BIA A;  2W7M A;  4LW2 A;  4MSO A;  4R8D A;  1AJS B;  1AY8 A;  3LVK A;  1B5O A;  3CQ4 A;  3WX9 A;  1W23 A;  3LWS A;  4PIW A;  3MAU A;  3WY7 A;  1SZU A;  1ARS A;  4OC9 A;  4U2H A;  3FVS A;  4F5I A;  4P3M A;  2BYJ A;  4Y0D A;  1DJ9 A;  1MAQ A;  4PFF A;  3NYT A;  3JWB A;  1PMO A;  4AO9 A;  2QLR A;  5EAA A;  1C9C A;  4TMR A;  3ASA A;  5EQC A;  5FT6 A;  4ATQ A;  2ORD A;  2ZC0 A;  4XJP A;  1SVV A;  3AEJ C;  1S0A A;  1IX8 A;  3P6K A;  2VMR A;  1IUG A;  4XJL A;  1V2F A;  3ZZK A;  1TAS A;  3BN1 A;  4MQP A;  3AEM C;  4IXZ A;  3MEB A;  4IXO A;  2VGU A;  3HBX A;  4A6U A;  1ZOD A;  1MDX A;  3FRK A;  4DGT A;  2VLF A;  3E2Y A;  1W7N A;  2ZP7 A;  2CST A;  3GET A;  4EFF A;  4RJY A;  4E3Q A;  3N75 A;  1WYU B;  2W8T A;  3AOV A;  3FVU A;  2CAN A;  1S08 A;  2EZ1 A;  1C0N A;  1LW4 A;  4WD2 A;  4ZDL A;  1DFO A;  2VI8 A;  4ZSY A;  1LW5 A;  2R5C A;  3IHJ A;  2VI9 A;  3M5U A;  3QHX A;  4JF0 A;  5LH9 A;  3GZC A;  2BI3 A;  1WYT A;  3AAT A;  1GC2 A;  4O6Z A;  3K28 A;  3GSB A;  1SZK A;  4OBV A;  4TV7 A;  3BCA A;  4WYD A;  2DGK A;  2EZ2 A;  3IF2 A;  4FFC A;  3ZRR A;  4Y0H A;  3EI5 A;  3PA9 A;  1DJE A;  1CQ8 A;  1XEY A;  1M0N A;  2FYF A;  2ZSL A;  1X28 A;  4UHN A;  3RCH B;  1OXO A;  1EG5 A;  5TF5 A;  2DKB A;  3KKI A;  4ISY A;  2QB3 A;  4ITG A;  4EU1 A;  1RV4 A;  2OAT A;  5EUE A;  1S09 A;  1SPA A;  4AOA A;  1J04 A;  3PAA A;  3TQX A;  1GEW A;  1ASB A;  1I29 A;  4GEB A;  3HT4 A;  2VGV A;  2VGT A;  2VMN A;  4A0F A;  1CL2 A;  2YRR A;  1G4V A;  1AY4 A;  3BC8 A;  2AY1 A;  4Q75 A;  2NMP A;  4Q76 A;  3PDX A;  1MGV A;  3EIB A;  8AAT A;  3F0H A;  5E4Z A;  3MAF A;  3QBO A;  4XEW A;  2HOX A;  3FSL A;  1LC8 A;  1OXP A;  1DTY A;  1T3I A;  1IJI A;  3NYU A;  4WB0 B;  2VMO A;  3TFT A;  1ZOB A;  4IX8 A;  2ZYJ A;  3AEM A;  3PD6 B;  3PDB A;  3VK4 A;  4WBT A;  4Q6R A;  2BIG A;  4ZWV A;  4WP0 A;  4UOY A;  4K2I A;  4A00 A;  2TPL A;  5G09 A;  2QMA A;  2VGW A;  4ZM4 A;  1KMJ A;  4XQ2 A;  4ZM3 A;  2VYC A;  1BJ4 A;  1TOJ A;  4Y0I A;  1BJN A;  1YJY A;  3W1H A;  4A0R A;  1VJO A;  2AY2 A;  1JF9 A;  4IXS A;  2VMX A;  2DGM A;  4F4E A;  1GCK A;  2OGE A;  1YJZ A;  3FVX A;  4CBS A;  1YNU A;  1W3U A;  2D63 A;  1MDZ A;  3EI9 A;  3G8M A;  1M0P A;  3E2Z B;  3FQ8 A;  3I16 A;  3HLM A;  2YCP A;  2FN6 A;  3CAI A;  1KMK A;  3G0T A;  1YIZ A;  2JGT A;  1OHW A;  3ACZ A;  1WYV B;  3WKR A;  4F5M A;  1B9H A;  3MAD A;  4ADE A;  5HXX A;  2EO5 A;  4A0G A;  2E7I A;  5DX5 A;  3AEN A;  4BA5 A;  1X29 A;  1D7V A;  3MKJ A;  1ASG A;  3HQT A;  1ASA A;  1O69 A;  3HL2 A;  1G7X A;  1EQB A;  3HMU A;  3ECD A;  2X5F A;  3B1D A;  1N2T A;  4LC3 A; 
#chains in the Genus database with same CATH topology
 2Z9U A;  3DZZ A;  2W7L A;  3GJU A;  1C7G A;  5C6U A;  2D66 A;  1XI9 A;  1LC7 A;  2W7G A;  3KGX A;  2OKJ A;  2HP1 A;  1O4S A;  2D65 A;  1ASM A;  2V1P A;  1D7S A;  4UHM A;  2CIN A;  2GB3 A;  1Z3Z A;  3N4S A;  3DXW A;  4ZSW A;  1AIC A;  1ELQ A;  1I48 A;  4H51 A;  1N31 A;  2YKU A;  4JEZ A;  4W8I A;  2WK8 A;  4WYA A;  1G4X A;  3EZ1 A;  2VMV A;  3TCM A;  2QA3 A;  1AMQ A;  2BWO A;  4M2K A;  4ZDP A;  3ZRP A;  1P3W A;  5DJ9 A;  2CH2 A;  4WYC A;  1AHG A;  1VEF A;  3QGU A;  2KFP A;  1PFF A;  2HOZ A;  4A0H A;  3A9Z A;  2E7J A;  3PDB B;  1WST A;  2D7Z A;  5G4J A;  4OCA A;  1Z7D A;  1CZC A;  2W7D A;  2Z61 A;  4RLG A;  1M32 A;  3ELE A;  2RFV A;  3UAK A;  2VGZ A;  1TOI A;  1LS3 A;  1D7U A;  2W8U A;  2R0T A;  4WYF A;  2O7C A;  1CZE A;  2JJF A;  3DR4 A;  4HVK A;  4CBR A;  4CVQ A;  2CJH A;  3B46 A;  5LHA A;  4TN4 A;  4BHD A;  1DGD A;  3EUC A;  1B5P A;  4B98 A;  4A6R A;  5EIG A;  5F8V A;  4JEW A;  3AV7 A;  5BJ4 A;  4RM1 A;  3A9Y A;  1TOG A;  1M0O A;  4XK1 A;  1ELU A;  3T32 A;  3HVY A;  4OT8 A;  5HDM A;  1JS6 A;  1QIT A;  4OBU A;  1MDO A;  4P7Y A;  5EFS A;  3NYS A;  4F5G A;  1BJO B;  1AJR A;  1FG7 A;  2CH1 A;  4IY7 A;  3DOD A;  4MQR A;  3H9X A;  3HDO A;  4W5K A;  1U08 A;  4M2J A;  2DOU A;  1C7N A;  4I8A A;  2BWN A;  1GEX A;  1X0M A;  1SFF A;  3NUI A;  1AAW A;  2ZY4 A;  5KTB A;  2VLH A;  4H63 Q;  2YCN A;  4OYT A;  2FM1 A;  3VOM A;  4MKK A;  1TOE A;  3QM2 A;  5FT4 A;  2DR1 A;  2V0Y A;  2QSR A;  2G7J A;  2C7T A;  3LVL B;  1M0Q A;  2YOB A;  2Q7W A;  2HUI A;  1AMR A;  5EUN A;  2ZSM A;  3FKD A;  2Z9V A;  2HUU A;  1GBN A;  4QGR A;  4WXG A;  4WYE A;  1V2E A;  5DJ1 A;  2W7K A;  3N0L A;  3FFR A;  3VP6 A;  1DGE A;  2VMS A;  1SZS A;  3DC1 A;  1QZ9 A;  2HOY A;  2W7F A;  1RVU A;  2AY8 A;  1EJI A;  1I43 A;  2BWP A;  2BIE A;  3A9X A;  1UKJ A;  3ELP A;  3MC6 C;  3B1C A;  3B1E A;  5K8B A;  3P1T A;  1ASE A;  3RUY A;  1S07 A;  4A6T A;  3GBX A;  3FQ7 A;  5AX8 A;  3FZ6 A;  1JS3 A;  2OQX A;  3G7Q A;  3AEJ A;  1AY5 A;  1BT4 A;  3OKS A;  1CQ6 A;  2AY5 A;  1IX7 A;  1FC4 A;  2GMS A;  2XBN A;  3DRD A;  3BB8 A;  4IYO A;  4LNL A;  1I41 A;  4EMY A;  1B4X A;  2GQN A;  2D7Y A;  3OP7 A;  3RQ1 A;  1GD9 A;  2X5D A;  2WK9 A;  2HUF A;  4UQV A;  1ZC9 A;  4RKD A;  5G2Q A;  3BWN C;  4F5F A;  2D5Y A;  4GE9 A;  3WGB A;  3VK3 A;  3LG0 A;  4Q31 A;  2E54 A;  4EB7 A;  4F5H A;  4AZJ A;  1W7L A;  2R5C B;  1BQD A;  4JE5 A;  4CXR A;  2R5E A;  3EIA A;  2CFB A;  2JIS A;  1WYT B;  4K2B A;  3WZF A;  2CJG A;  2OGA A;  4NOG A;  3TAT A;  5D5S A;  4BQ0 A;  2BI1 A;  4CXQ A;  2HZP A;  2VMP A;  1ORD A;  3FFH A;  1AJS A;  1BKG A;  4W1X A;  2AEU A;  5FT5 A;  1WKG A;  2ZUK A;  2VMW A;  3PPL A;  1IX6 A;  3L8A A;  3FZ7 A;  3LY1 A;  2ZY5 A;  4U1T A;  3QN6 A;  1ASD A;  1O61 A;  4WLH A;  2D61 A;  3AEP A;  1CQ7 A;  4ADB A;  2DKJ A;  4XJM A;  1DKA A;  1N8P A;  1AHY A;  2E7U A;  2YKY A;  3DU4 A;  4JEY A;  3FCR A;  1ARI A;  1BS0 A;  4ITX A;  4EB5 A;  1KKP A;  1QJ5 A;  1O62 A;  4R2N A;  2WB6 A;  4KYO A;  3KGW A;  1AHX A;  4OMA A;  4J5U A;  3WCN A;  1GC0 A;  2VIA A;  1KL2 A;  1V72 A;  1TAR A;  3K7Y A;  3LVM A;  3NU8 A;  5G0A A;  3QI6 A;  3MAF B;  1AKC A;  1SF2 A;  2HOR A;  1M7Y A;  1C4K A;  2GMU A;  5JAY A;  2W7J A;  3R9A A;  1IAY A;  2O1B A;  4PVF A;  4RJ0 A;  5D95 A;  1WYU A;  3EZS A;  2ZJG A;  3AEO A;  1GDE A;  3FTB A;  3GZD C;  1ECX A;  4W1W A;  3JWA A;  2CY8 A;  2X3L A;  1MLY A;  4F5L A;  1QGN A;  3COG A;  3VAX A;  3BCB A;  1TPL A;  3NNK A;  2ZY2 A;  4ZAH A;  2WKA A;  2OKK A;  3II0 A;  3MBB A;  4AH3 A;  1KKJ A;  3BWN A;  1KL1 A;  2A1V A;  1AX4 A;  3F9T A;  2DGL A;  3EI6 A;  4FL0 A;  1ART A;  3W1J A;  2GSA A;  7AAT A;  3N4X A;  5E5I A;  1H0C A;  2FQ6 A;  2VIB A;  5J8Q A;  3N4R A;  3RCH A;  1D2F A;  3DR7 A;  2EPJ A;  1V2D A;  3AEN B;  3FDB A;  3NUB A;  2AY6 A;  1ASF A;  4K2M A;  5HHY A;  1ASN A;  4OTL A;  4IW7 A;  2D64 A;  4A72 A;  3Q8N A;  1DJU A;  1YJS A;  2JJH A;  2PB0 A;  3RBF A;  3E9K A;  1AMS A;  3LV2 A;  3RI6 A;  1D7R A;  3LVJ A;  4ZAS A;  3A8U X;  1BQA A;  4BMK A;  4GRX A;  1E5F A;  2JG2 A;  2PO3 A;  3UWC A;  2YKV A;  3ISL A;  4ZWM A;  1LC5 A;  2BYL A;  4R5Z A;  3USF A;  4MY5 A;  2HP2 A;  4W1V A;  1IVR A;  2W8V A;  4UHO A;  4RIT A;  1AMA A;  3WKS A;  4LNM A;  1ARG A;  1M4N A;  2BI2 A;  5M49 A;  4N0B A;  2O0R A;  3JW9 A;  2AY4 A;  4WB0 A;  3ATH A;  1J32 A;  3PIU A;  1RV3 A;  1YAA A;  3PD6 A;  2WK7 A;  3A2B A;  1H1C A;  2BKW A;  2QB2 A;  1WKH A;  2AY7 A;  1ASC A;  4E1O A;  1OHY A;  1UU2 A;  3UE8 A;  4WXF A;  2W8W A;  4WXB A;  1C7O A;  2VGS A;  3H14 A;  1TAT A;  2CB1 A;  3H7F A;  3R4T A;  4LW4 A;  3ZZJ A;  2C0R A;  3DYD A;  2EGY A;  2VMY A;  5G2P A;  2YRI A;  2W7I A;  1AKA A;  1GC4 A;  3E6G A;  3CQ6 A;  3GZD A;  3I4J A;  4L0O A;  4LNJ A;  3PJ0 A;  1RVY A;  3CQ5 A;  3JU7 A;  3NRA A;  3E2Z A;  3NU7 A;  1BJW A;  4XAU A;  4KAM A;  3EI8 A;  3WLX A;  2FKI A;  3NX3 A;  4JEV A;  1QIR A;  1S06 A;  5EIG B;  1WYV A;  4GE4 A;  5IWQ A;  4AO4 A;  3KE3 A;  2AY9 A;  1W7M A;  2CJD A;  1X2A A;  2FNU A;  2W7H A;  3WCO A;  1YOO A;  2QBT A;  4ADD A;  1G7W A;  3PGY A;  4HF8 A;  3JTX A;  3JZL A;  4K05 A;  1E5E A;  1Y4I A;  2BI5 A;  4MGR A;  2BI9 A;  4GSA A;  1VP4 A;  3B8X A;  2JJE A;  1QIS A;  4F5K A;  3BCX A;  3GR9 A;  4MKJ A;  3RBL A;  3E77 A;  4MQQ A;  3BV0 A;  4ADC A;  1PMM A;  3E2F A;  3N5M A;  3NDN A;  1UU0 A;  3QPG A;  4W91 A;  2YHK A;  4JF1 A;  5DB5 A;  2PB2 A;  4AZK A;  3GWP A;  1OAT A;  5G4I A;  4RKC A;  4WLJ A;  3BWO A;  4GDY A;  4WYG A;  3FQA A;  2G6W A;  1PG8 A;  5M4B A;  2ZY3 A;  4JEX A;  3EI7 A;  1B8G A;  1TOK A;  4RAE A;  2VMU A;  4PFN A;  4ZDO A;  1B9I A;  1AIB A;  4R5F A;  1LK9 A;  1M6S A;  4N0W A;  2VMT A;  1BW0 A;  5FT8 A;  1GC3 A;  2BHX A;  2R2N A;  2VMQ A;  4XJO A;  1MAP A;  5M4D A;  3BS8 A;  3L44 A;  2W7E A;  5F9S A;  1CJ0 A;  4E77 A;  2VMZ A;  2Z9W A;  2Z1Z A;  3K40 A;  4DQ6 A;  2XH1 A;  3ZRQ A;  2AEV A;  1QJ3 A;  2FNI A;  4ZLV A;  1AAM A;  3DXV A;  5I92 A;  3TFU A;  3W1I A;  4BA4 A;  5M46 A;  2X8U A;  2EH6 A;  3MC6 A;  1YIY A;  2Z9X A;  4B9B A;  1AHF A;  1ASL A;  4JE5 D;  3AOW A;  2Z67 A;  1BJO A;  2AAT A;  2CTZ A;  3ASB A;  3F6T A;  2W8J A;  4IYO B;  5E3K A;  9AAT A;  1JG8 A;  1CS1 A;  2C81 A;  4KXK A;  5EUD A;  4DBC A;  1GEY A;  4GE7 A;  4M2M A;  3WGC A;  2F8J A;  5EAV A;  2AY3 A;  3FZ8 A;  1AKB A;  2C44 A;  4F5J A;  1AHE A;  2YKX A;  2Z20 A;  1LKC A;  2YCT A;  1MLZ A;  1CL1 A;  3AEL A;  4J8L A;  3I5T A;  3FD0 A;  4E3R A;  1FG3 A;  3D6K A;  3FDD A;  2Z1Y A;  3VK2 A;  3NTJ A;  1UU1 A;  5BJ3 A;  1IAX A;  1ARH A;  3CBF A;  4ATP A;  1IBJ A;  1OHV A;  4RIZ A;  1AIA A;  2JJG A;  2BIA A;  2W7M A;  4LW2 A;  4MSO A;  4R8D A;  1AJS B;  1AY8 A;  3LVK A;  1B5O A;  3CQ4 A;  3WX9 A;  1W23 A;  3LWS A;  4PIW A;  3MAU A;  3WY7 A;  1SZU A;  1ARS A;  4OC9 A;  4U2H A;  2EYQ A;  3FVS A;  4F5I A;  4P3M A;  2BYJ A;  4Y0D A;  1DJ9 A;  1MAQ A;  4PFF A;  3NYT A;  3JWB A;  1PMO A;  4AO9 A;  2QLR A;  5EAA A;  1C9C A;  4TMR A;  3ASA A;  5EQC A;  5FT6 A;  4ATQ A;  2ORD A;  2ZC0 A;  4XJP A;  1SVV A;  3AEJ C;  1S0A A;  1IX8 A;  3P6K A;  2VMR A;  1IUG A;  4XJL A;  1V2F A;  3ZZK A;  1TAS A;  3BN1 A;  4MQP A;  3AEM C;  4IXZ A;  3MEB A;  4IXO A;  2VGU A;  3HBX A;  4A6U A;  1ZOD A;  1MDX A;  3FRK A;  4DGT A;  2VLF A;  3E2Y A;  1W7N A;  2ZP7 A;  2CST A;  3GET A;  4EFF A;  4RJY A;  4E3Q A;  3N75 A;  1KAF A;  1WYU B;  2W8T A;  3AOV A;  3FVU A;  2CAN A;  1S08 A;  2EZ1 A;  1C0N A;  1LW4 A;  4WD2 A;  4ZDL A;  1DFO A;  2VI8 A;  4ZSY A;  1LW5 A;  2R5C A;  3IHJ A;  2VI9 A;  3M5U A;  3QHX A;  4JF0 A;  5LH9 A;  3GZC A;  2BI3 A;  1WYT A;  3AAT A;  1GC2 A;  4O6Z A;  3K28 A;  3GSB A;  1SZK A;  4OBV A;  4TV7 A;  3BCA A;  4WYD A;  2DGK A;  2EZ2 A;  3IF2 A;  4FFC A;  3ZRR A;  4Y0H A;  3EI5 A;  3PA9 A;  1DJE A;  1CQ8 A;  1XEY A;  1M0N A;  2FYF A;  2ZSL A;  1X28 A;  4UHN A;  3RCH B;  1OXO A;  1EG5 A;  5TF5 A;  2DKB A;  3KKI A;  4ISY A;  2QB3 A;  4ITG A;  4EU1 A;  1RV4 A;  2OAT A;  5EUE A;  1S09 A;  1SPA A;  4AOA A;  1J04 A;  3PAA A;  3TQX A;  1GEW A;  3N7N A;  1ASB A;  1I29 A;  4GEB A;  3HT4 A;  2VGV A;  2VGT A;  2VMN A;  4A0F A;  1CL2 A;  2YRR A;  1G4V A;  1AY4 A;  3BC8 A;  2AY1 A;  4Q75 A;  2NMP A;  4Q76 A;  3PDX A;  1MGV A;  3EIB A;  8AAT A;  3F0H A;  5E4Z A;  3MAF A;  3QBO A;  4XEW A;  2HOX A;  3FSL A;  1LC8 A;  1OXP A;  1DTY A;  1T3I A;  1IJI A;  3NYU A;  4WB0 B;  2VMO A;  3TFT A;  1ZOB A;  4IX8 A;  2ZYJ A;  3AEM A;  3PD6 B;  3PDB A;  3VK4 A;  4WBT A;  4Q6R A;  2BIG A;  4ZWV A;  4WP0 A;  4UOY A;  4K2I A;  4A00 A;  2TPL A;  5G09 A;  2QMA A;  2VGW A;  4ZM4 A;  1KMJ A;  4XQ2 A;  4ZM3 A;  2VYC A;  1BJ4 A;  1TOJ A;  4Y0I A;  1BJN A;  1YJY A;  3W1H A;  4A0R A;  1VJO A;  2AY2 A;  1JF9 A;  4IXS A;  2VMX A;  2DGM A;  4F4E A;  1GCK A;  2OGE A;  1YJZ A;  3FVX A;  4CBS A;  1YNU A;  1W3U A;  2D63 A;  1MDZ A;  3EI9 A;  3G8M A;  1M0P A;  3E2Z B;  3FQ8 A;  3I16 A;  3HLM A;  2YCP A;  2FN6 A;  3CAI A;  1KMK A;  3G0T A;  1YIZ A;  2JGT A;  1OHW A;  3ACZ A;  1WYV B;  3WKR A;  4F5M A;  1B9H A;  3MAD A;  4ADE A;  5HXX A;  2EO5 A;  4A0G A;  2E7I A;  5DX5 A;  3AEN A;  4BA5 A;  1X29 A;  1D7V A;  3MKJ A;  1ASG A;  3HQT A;  1ASA A;  1O69 A;  3HL2 A;  1G7X A;  1EQB A;  3HMU A;  3ECD A;  2X5F A;  3B1D A;  1N2T A;  4LC3 A; 
#chains in the Genus database with same CATH homology
 2Z9U A;  3DZZ A;  2W7L A;  3GJU A;  1C7G A;  5C6U A;  2D66 A;  1XI9 A;  1LC7 A;  2W7G A;  3KGX A;  2OKJ A;  2HP1 A;  1O4S A;  2D65 A;  1ASM A;  2V1P A;  1D7S A;  4UHM A;  2CIN A;  2GB3 A;  1Z3Z A;  3N4S A;  3DXW A;  4ZSW A;  1AIC A;  1ELQ A;  1I48 A;  4H51 A;  1N31 A;  2YKU A;  4JEZ A;  4W8I A;  2WK8 A;  4WYA A;  1G4X A;  3EZ1 A;  2VMV A;  3TCM A;  2QA3 A;  1AMQ A;  2BWO A;  4M2K A;  4ZDP A;  3ZRP A;  1P3W A;  5DJ9 A;  2CH2 A;  4WYC A;  1AHG A;  1VEF A;  3QGU A;  2KFP A;  1PFF A;  2HOZ A;  4A0H A;  3A9Z A;  2E7J A;  3PDB B;  1WST A;  2D7Z A;  5G4J A;  4OCA A;  1Z7D A;  1CZC A;  2W7D A;  2Z61 A;  4RLG A;  1M32 A;  3ELE A;  2RFV A;  3UAK A;  2VGZ A;  1TOI A;  1LS3 A;  1D7U A;  2W8U A;  2R0T A;  4WYF A;  2O7C A;  1CZE A;  2JJF A;  3DR4 A;  4HVK A;  4CBR A;  4CVQ A;  2CJH A;  3B46 A;  5LHA A;  4TN4 A;  4BHD A;  1DGD A;  3EUC A;  1B5P A;  4B98 A;  4A6R A;  5EIG A;  5F8V A;  4JEW A;  3AV7 A;  5BJ4 A;  4RM1 A;  3A9Y A;  1TOG A;  1M0O A;  4XK1 A;  1ELU A;  3T32 A;  3HVY A;  4OT8 A;  5HDM A;  1JS6 A;  1QIT A;  4OBU A;  1MDO A;  4P7Y A;  5EFS A;  3NYS A;  4F5G A;  1BJO B;  1AJR A;  1FG7 A;  2CH1 A;  4IY7 A;  3DOD A;  4MQR A;  3H9X A;  3HDO A;  4W5K A;  1U08 A;  4M2J A;  2DOU A;  1C7N A;  4I8A A;  2BWN A;  1GEX A;  1X0M A;  1SFF A;  3NUI A;  1AAW A;  2ZY4 A;  5KTB A;  2VLH A;  4H63 Q;  2YCN A;  4OYT A;  2FM1 A;  3VOM A;  4MKK A;  1TOE A;  3QM2 A;  5FT4 A;  2DR1 A;  2V0Y A;  2QSR A;  2G7J A;  2C7T A;  3LVL B;  1M0Q A;  2YOB A;  2Q7W A;  2HUI A;  1AMR A;  5EUN A;  2ZSM A;  3FKD A;  2Z9V A;  2HUU A;  1GBN A;  4QGR A;  4WXG A;  4WYE A;  1V2E A;  5DJ1 A;  2W7K A;  3N0L A;  3FFR A;  3VP6 A;  1DGE A;  2VMS A;  1SZS A;  3DC1 A;  1QZ9 A;  2HOY A;  2W7F A;  1RVU A;  2AY8 A;  1EJI A;  1I43 A;  2BWP A;  2BIE A;  3A9X A;  1UKJ A;  3ELP A;  3MC6 C;  3B1C A;  3B1E A;  5K8B A;  3P1T A;  1ASE A;  3RUY A;  1S07 A;  4A6T A;  3GBX A;  3FQ7 A;  5AX8 A;  3FZ6 A;  1JS3 A;  2OQX A;  3G7Q A;  3AEJ A;  1AY5 A;  1BT4 A;  3OKS A;  1CQ6 A;  2AY5 A;  1IX7 A;  1FC4 A;  2GMS A;  2XBN A;  3DRD A;  3BB8 A;  4IYO A;  4LNL A;  1I41 A;  4EMY A;  1B4X A;  2GQN A;  2D7Y A;  3OP7 A;  3RQ1 A;  1GD9 A;  2X5D A;  2WK9 A;  2HUF A;  4UQV A;  1ZC9 A;  4RKD A;  5G2Q A;  3BWN C;  4F5F A;  2D5Y A;  4GE9 A;  3WGB A;  3VK3 A;  3LG0 A;  4Q31 A;  2E54 A;  4EB7 A;  4F5H A;  4AZJ A;  1W7L A;  2R5C B;  1BQD A;  4JE5 A;  4CXR A;  2R5E A;  3EIA A;  2CFB A;  2JIS A;  1WYT B;  4K2B A;  3WZF A;  2CJG A;  2OGA A;  4NOG A;  3TAT A;  5D5S A;  4BQ0 A;  2BI1 A;  4CXQ A;  2HZP A;  2VMP A;  1ORD A;  3FFH A;  1AJS A;  1BKG A;  4W1X A;  2AEU A;  5FT5 A;  1WKG A;  2ZUK A;  2VMW A;  3PPL A;  1IX6 A;  3L8A A;  3FZ7 A;  3LY1 A;  2ZY5 A;  4U1T A;  3QN6 A;  1ASD A;  1O61 A;  4WLH A;  2D61 A;  3AEP A;  1CQ7 A;  4ADB A;  2DKJ A;  4XJM A;  1DKA A;  1N8P A;  1AHY A;  2E7U A;  2YKY A;  3DU4 A;  4JEY A;  3FCR A;  1ARI A;  1BS0 A;  4ITX A;  4EB5 A;  1KKP A;  1QJ5 A;  1O62 A;  4R2N A;  2WB6 A;  4KYO A;  3KGW A;  1AHX A;  4OMA A;  4J5U A;  3WCN A;  1GC0 A;  2VIA A;  1KL2 A;  1V72 A;  1TAR A;  3K7Y A;  3LVM A;  3NU8 A;  5G0A A;  3QI6 A;  3MAF B;  1AKC A;  1SF2 A;  2HOR A;  1M7Y A;  1C4K A;  2GMU A;  5JAY A;  2W7J A;  3R9A A;  1IAY A;  2O1B A;  4PVF A;  4RJ0 A;  5D95 A;  1WYU A;  3EZS A;  2ZJG A;  3AEO A;  1GDE A;  3FTB A;  3GZD C;  1ECX A;  4W1W A;  3JWA A;  2CY8 A;  2X3L A;  1MLY A;  4F5L A;  1QGN A;  3COG A;  3VAX A;  3BCB A;  1TPL A;  3NNK A;  2ZY2 A;  4ZAH A;  2WKA A;  2OKK A;  3II0 A;  3MBB A;  4AH3 A;  1KKJ A;  3BWN A;  1KL1 A;  2A1V A;  1AX4 A;  3F9T A;  2DGL A;  3EI6 A;  4FL0 A;  1ART A;  3W1J A;  2GSA A;  7AAT A;  3N4X A;  5E5I A;  1H0C A;  2FQ6 A;  2VIB A;  5J8Q A;  3N4R A;  3RCH A;  1D2F A;  3DR7 A;  2EPJ A;  1V2D A;  3AEN B;  3FDB A;  3NUB A;  2AY6 A;  1ASF A;  4K2M A;  5HHY A;  1ASN A;  4OTL A;  4IW7 A;  2D64 A;  4A72 A;  3Q8N A;  1DJU A;  1YJS A;  2JJH A;  2PB0 A;  3RBF A;  3E9K A;  1AMS A;  3LV2 A;  3RI6 A;  1D7R A;  3LVJ A;  4ZAS A;  3A8U X;  1BQA A;  4BMK A;  4GRX A;  1E5F A;  2JG2 A;  2PO3 A;  3UWC A;  2YKV A;  3ISL A;  4ZWM A;  1LC5 A;  2BYL A;  4R5Z A;  3USF A;  4MY5 A;  2HP2 A;  4W1V A;  1IVR A;  2W8V A;  4UHO A;  4RIT A;  1AMA A;  3WKS A;  4LNM A;  1ARG A;  1M4N A;  2BI2 A;  5M49 A;  4N0B A;  2O0R A;  3JW9 A;  2AY4 A;  4WB0 A;  3ATH A;  1J32 A;  3PIU A;  1RV3 A;  1YAA A;  3PD6 A;  2WK7 A;  3A2B A;  1H1C A;  2BKW A;  2QB2 A;  1WKH A;  2AY7 A;  1ASC A;  4E1O A;  1OHY A;  1UU2 A;  3UE8 A;  4WXF A;  2W8W A;  4WXB A;  1C7O A;  2VGS A;  3H14 A;  1TAT A;  2CB1 A;  3H7F A;  3R4T A;  4LW4 A;  3ZZJ A;  2C0R A;  3DYD A;  2EGY A;  2VMY A;  5G2P A;  2YRI A;  2W7I A;  1AKA A;  1GC4 A;  3E6G A;  3CQ6 A;  3GZD A;  3I4J A;  4L0O A;  4LNJ A;  3PJ0 A;  1RVY A;  3CQ5 A;  3JU7 A;  3NRA A;  3E2Z A;  3NU7 A;  1BJW A;  4XAU A;  4KAM A;  3EI8 A;  3WLX A;  2FKI A;  3NX3 A;  4JEV A;  1QIR A;  1S06 A;  5EIG B;  1WYV A;  4GE4 A;  5IWQ A;  4AO4 A;  3KE3 A;  2AY9 A;  1W7M A;  2CJD A;  1X2A A;  2FNU A;  2W7H A;  3WCO A;  1YOO A;  2QBT A;  4ADD A;  1G7W A;  3PGY A;  4HF8 A;  3JTX A;  3JZL A;  4K05 A;  1E5E A;  1Y4I A;  2BI5 A;  4MGR A;  2BI9 A;  4GSA A;  1VP4 A;  3B8X A;  2JJE A;  1QIS A;  4F5K A;  3BCX A;  3GR9 A;  4MKJ A;  3RBL A;  3E77 A;  4MQQ A;  3BV0 A;  4ADC A;  1PMM A;  3E2F A;  3N5M A;  3NDN A;  1UU0 A;  3QPG A;  4W91 A;  2YHK A;  4JF1 A;  5DB5 A;  2PB2 A;  4AZK A;  3GWP A;  1OAT A;  5G4I A;  4RKC A;  4WLJ A;  3BWO A;  4GDY A;  4WYG A;  3FQA A;  2G6W A;  1PG8 A;  5M4B A;  2ZY3 A;  4JEX A;  3EI7 A;  1B8G A;  1TOK A;  4RAE A;  2VMU A;  4PFN A;  4ZDO A;  1B9I A;  1AIB A;  4R5F A;  1LK9 A;  1M6S A;  4N0W A;  2VMT A;  1BW0 A;  5FT8 A;  1GC3 A;  2BHX A;  2R2N A;  2VMQ A;  4XJO A;  1MAP A;  5M4D A;  3BS8 A;  3L44 A;  2W7E A;  5F9S A;  1CJ0 A;  4E77 A;  2VMZ A;  2Z9W A;  2Z1Z A;  3K40 A;  4DQ6 A;  2XH1 A;  3ZRQ A;  2AEV A;  1QJ3 A;  2FNI A;  4ZLV A;  1AAM A;  3DXV A;  5I92 A;  3TFU A;  3W1I A;  4BA4 A;  5M46 A;  2X8U A;  2EH6 A;  3MC6 A;  1YIY A;  2Z9X A;  4B9B A;  1AHF A;  1ASL A;  4JE5 D;  3AOW A;  2Z67 A;  1BJO A;  2AAT A;  2CTZ A;  3ASB A;  3F6T A;  2W8J A;  4IYO B;  5E3K A;  9AAT A;  1JG8 A;  1CS1 A;  2C81 A;  4KXK A;  5EUD A;  4DBC A;  1GEY A;  4GE7 A;  4M2M A;  3WGC A;  2F8J A;  5EAV A;  2AY3 A;  3FZ8 A;  1AKB A;  2C44 A;  4F5J A;  1AHE A;  2YKX A;  2Z20 A;  1LKC A;  2YCT A;  1MLZ A;  1CL1 A;  3AEL A;  4J8L A;  3I5T A;  3FD0 A;  4E3R A;  1FG3 A;  3D6K A;  3FDD A;  2Z1Y A;  3VK2 A;  3NTJ A;  1UU1 A;  5BJ3 A;  1IAX A;  1ARH A;  3CBF A;  4ATP A;  1IBJ A;  1OHV A;  4RIZ A;  1AIA A;  2JJG A;  2BIA A;  2W7M A;  4LW2 A;  4MSO A;  4R8D A;  1AJS B;  1AY8 A;  3LVK A;  1B5O A;  3CQ4 A;  3WX9 A;  1W23 A;  3LWS A;  4PIW A;  3MAU A;  3WY7 A;  1SZU A;  1ARS A;  4OC9 A;  4U2H A;  2EYQ A;  3FVS A;  4F5I A;  4P3M A;  2BYJ A;  4Y0D A;  1DJ9 A;  1MAQ A;  4PFF A;  3NYT A;  3JWB A;  1PMO A;  4AO9 A;  2QLR A;  5EAA A;  1C9C A;  4TMR A;  3ASA A;  5EQC A;  5FT6 A;  4ATQ A;  2ORD A;  2ZC0 A;  4XJP A;  1SVV A;  3AEJ C;  1S0A A;  1IX8 A;  3P6K A;  2VMR A;  1IUG A;  4XJL A;  1V2F A;  3ZZK A;  1TAS A;  3BN1 A;  4MQP A;  3AEM C;  4IXZ A;  3MEB A;  4IXO A;  2VGU A;  3HBX A;  4A6U A;  1ZOD A;  1MDX A;  3FRK A;  4DGT A;  2VLF A;  3E2Y A;  1W7N A;  2ZP7 A;  2CST A;  3GET A;  4EFF A;  4RJY A;  4E3Q A;  3N75 A;  1WYU B;  2W8T A;  3AOV A;  3FVU A;  2CAN A;  1S08 A;  2EZ1 A;  1C0N A;  1LW4 A;  4WD2 A;  4ZDL A;  1DFO A;  2VI8 A;  4ZSY A;  1LW5 A;  2R5C A;  3IHJ A;  2VI9 A;  3M5U A;  3QHX A;  4JF0 A;  5LH9 A;  3GZC A;  2BI3 A;  1WYT A;  3AAT A;  1GC2 A;  4O6Z A;  3K28 A;  3GSB A;  1SZK A;  4OBV A;  4TV7 A;  3BCA A;  4WYD A;  2DGK A;  2EZ2 A;  3IF2 A;  4FFC A;  3ZRR A;  4Y0H A;  3EI5 A;  3PA9 A;  1DJE A;  1CQ8 A;  1XEY A;  1M0N A;  2FYF A;  2ZSL A;  1X28 A;  4UHN A;  3RCH B;  1OXO A;  1EG5 A;  5TF5 A;  2DKB A;  3KKI A;  4ISY A;  2QB3 A;  4ITG A;  4EU1 A;  1RV4 A;  2OAT A;  5EUE A;  1S09 A;  1SPA A;  4AOA A;  1J04 A;  3PAA A;  3TQX A;  1GEW A;  3N7N A;  1ASB A;  1I29 A;  4GEB A;  3HT4 A;  2VGV A;  2VGT A;  2VMN A;  4A0F A;  1CL2 A;  2YRR A;  1G4V A;  1AY4 A;  3BC8 A;  2AY1 A;  4Q75 A;  2NMP A;  4Q76 A;  3PDX A;  1MGV A;  3EIB A;  8AAT A;  3F0H A;  5E4Z A;  3MAF A;  3QBO A;  4XEW A;  2HOX A;  3FSL A;  1LC8 A;  1OXP A;  1DTY A;  1T3I A;  1IJI A;  3NYU A;  4WB0 B;  2VMO A;  3TFT A;  1ZOB A;  4IX8 A;  2ZYJ A;  3AEM A;  3PD6 B;  3PDB A;  3VK4 A;  4WBT A;  4Q6R A;  2BIG A;  4ZWV A;  4WP0 A;  4UOY A;  4K2I A;  4A00 A;  2TPL A;  5G09 A;  2QMA A;  2VGW A;  4ZM4 A;  1KMJ A;  4XQ2 A;  4ZM3 A;  2VYC A;  1BJ4 A;  1TOJ A;  4Y0I A;  1BJN A;  1YJY A;  3W1H A;  4A0R A;  1VJO A;  2AY2 A;  1JF9 A;  4IXS A;  2VMX A;  2DGM A;  4F4E A;  1GCK A;  2OGE A;  1YJZ A;  3FVX A;  4CBS A;  1YNU A;  1W3U A;  2D63 A;  1MDZ A;  3EI9 A;  3G8M A;  1M0P A;  3E2Z B;  3FQ8 A;  3I16 A;  3HLM A;  2YCP A;  2FN6 A;  3CAI A;  1KMK A;  3G0T A;  1YIZ A;  2JGT A;  1OHW A;  3ACZ A;  1WYV B;  3WKR A;  4F5M A;  1B9H A;  3MAD A;  4ADE A;  5HXX A;  2EO5 A;  4A0G A;  2E7I A;  5DX5 A;  3AEN A;  4BA5 A;  1X29 A;  1D7V A;  3MKJ A;  1ASG A;  3HQT A;  1ASA A;  1O69 A;  3HL2 A;  1G7X A;  1EQB A;  3HMU A;  3ECD A;  2X5F A;  3B1D A;  1N2T A;  4LC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...