1CQ8A

Aspartate aminotransferase (e.c. 2.6.1.1) complexed with c6-pyridoxal-5p-phosphate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Free energy requirement for domain movement of an enzyme
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords ASPARTATE AMINOTRANSFERASE (2.6.1.1)
total genus 132
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1999-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1cq8A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1cq8A01
1KKJA 1W7MA 2VMTA 2W8TA 1M0NA 3A9YA 3DYDA 3FSLA 4IYOA 1D7RA 3GZCA 4W91A 1KL1A 1M32A 3AEMA 3E6GA 1DGEA 1CQ7A 1IX7A 1AAWA 1WYTB 1LW4A 4WLJA 4J5UA 8AATA 5IWQA 3RQ1A 2VGSA 3NNKA 1TPLA 1IUGA 2AEUA 1X28A 1BJOB 3AEMC 3USFA 3WX9A 1AHEA 1ELQA 5I92A 1M0OA 3AEPA 4ZWVA 1WYUA 4Q76A 4F5MA 2E7UA 4ZWMA 2OKKA 5EIGA 1UU1A 1TOKA 2HOYA 3OP7A 4R5FA 5EAVA 4OT8A 2R5CB 4ZLVA 1CS1A 1WKGA 2AY3A 4ISYA 3FFHA 3ISLA 2ZY3A 3KGXA 1QIRA 4EMYA 3ZZKA 1PG8A 3P1TA 4M2KA 4F4EA 1E5EA 1O4SA 3GR9A 3QPGA 2CANA 2Z61A 2VMYA 1TARA 3LWSA 4WB0A 4F5FA 1YOOA 1ARHA 3PD6B 5J8QA 2R2NA 3VOMA 4BA4A 1T3IA 2YOBA 1W7LA 3EZ1A 1SZKA 3VK2A 3WKSA 4ITGA 4RM1A 1CZCA 3DR7A 4B98A 3PGYA 3HDOA 4ATQA 2OATA 3WGBA 2BHXA 1ZOBA 2BI1A 2EH6A 1S07A 2VMXA 1DJ9A 3FRKA 4JF0A 4J8LA 2Q7WA 1OXPA 4A00A 3G7QA 1ORDA 4FFCA 3GJUA 3E9KA 4N0BA 1AMRA 3DZZA 3M5UA 4W1XA 2CB1A 3NYSA 1H1CA 2BIGA 2WK9A 2ZP7A 3GBXA 3VAXA 4AZJA 4GDYA 3RCHA 1SZSA 1UKJA 4ITXA 5FT8A 1BJWA 2VMQA 4XJMA 1SF2A 2FNIA 1S06A 4CXRA 2HORA 4HVKA 1ARGA 3RI6A 2PB0A 4MSOA 1CJ0A 2DGMA 3A9ZA 5K8BA 3COGA 3RUYA 1UU2A 4OC9A 2D65A 2G6WA 2NMPA 3F0HA 4KAMA 1J04A 2HZPA 2JG2A 1QJ5A 1YJZA 5FT4A 4WD2A 5M49A 1BJ4A 2X5DA 2QB3A 1Z7DA 2ZJGA 3E2ZA 4CBSA 1D7VA 4UHNA 4Q75A 1KMJA 1YJYA 2BI3A 3B1EA 3E77A 1ECXA 2TPLA 2VMZA 1QISA 1YIYA 3PDBB 4WB0B 1X29A 3TCMA 3W1JA 3WZFA 3CAIA 5LHAA 3JWAA 2W8WA 3ASAA 2VYCA 2QLRA 1BW0A 3MAFB 1DTYA 4F5IA 5HXXA 4W5KA 3ATHA 1AX4A 4TV7A 1W3UA 4JEZA 4RJYA 2CFBA 4IYOB 1ASEA 1MLYA 4RIZA 4MGRA 1XI9A 1N8PA 4F5JA 1DGDA 3UAKA 1IAYA 2C44A 3JU7A 4OCAA 4R8DA 2HP1A 3IF2A 4A6TA 2W7IA 4AOAA 2AY8A 4ZDPA 3JZLA 1ASAA 1LK9A 4BHDA 3EIBA 2FNUA 3N0LA 5G09A 4PFNA 2PO3A 2AEVA 5DJ1A 2VGVA 2OQXA 4JE5A 1AIAA 1OATA 4A0FA 3FDDA 1GBNA 3HBXA 3KGWA 3B46A 3BCAA 3AOVA 3HLMA 1GD9A 1UU0A 3B8XA 3K28A 4MY5A 2CJDA 2YCPA 1RVUA 2W8JA 2VMOA 3JW9A 1BT4A 2VI8A 1GEWA 2D63A 3BWNC 1OHYA 2GQNA 2JISA 4K2IA 1RV4A 2YCTA 3A8UX 2Z9WA 3HVYA 2D7YA 3A9XA 3WCOA 1ASFA 4U2HA 5AX8A 2Z9XA 4R2NA 1MDOA 3EZSA 5FT5A 1I43A 4A0GA 4P7YA 1W23A 2X3LA 3GETA 3RBFA 3CQ6A 3W1IA 1N2TA 2VMRA 4AH3A 3NU8A 3BWOA 1BQDA 2W7LA 1SVVA 2FYFA 3ASBA 4GE9A 3D6KA 4CBRA 3R9AA 2HOXA 1C7NA 1ARIA 4A0HA 2GMSA 4L0OA 3TFUA 4W8IA 3A2BA 1EJIA 2F8JA 2QMAA 4MQQA 2OGAA 3QGUA 2ZYJA 1OHVA 1DFOA 4MKJA 2CH1A 1MAPA 3AOWA 3KKIA 4GE4A 3ACZA 3FZ7A 3LG0A 3AEOA 2DR1A 5DX5A 1TOGA 1AMAA 1GEYA 2ZY4A 1LC5A 3FZ8A 3DU4A 2C0RA 2VMWA 4GEBA 5E3KA 5M46A 2QB2A 4Q6RA 1KL2A 4WYDA 2HUIA 1ASNA 1ARTA 2W7DA 2AATA 5EFSA 2WK8A 3FVSA 2CINA 2EZ2A 3NX3A 4EB5A 5TF5A 4TMRA 3WGCA 4F5KA 4AO4A 4XJLA 3BS8A 1OHWA 4LNLA 5E4ZA 1CL1A 1AHFA 2YKXA 1TOIA 2ZUKA 2YCNA 3AELA 4GE7A 1X0MA 4XJPA 3MAUA 5HHYA 2D7ZA 1V2EA 3EI9A 4JE5D 4JEWA 4OBUA 1ASGA 1I48A 3ZRPA 1AMQA 3G8MA 1W7NA 1B9HA 1EG5A 4IX8A 1MAQA 4JEYA 3NRAA 4ADDA 4IW7A 4E77A 1QGNA 3AEJC 1G7XA 2YKUA 2BI2A 3E2YA 3QBOA 4A0RA 3UWCA 9AATA 3MBBA 3AV7A 3IHJA 1JS3A 2DOUA 3ZRQA 3FTBA 3I16A 3VK4A 3PD6A 3PIUA 4WP0A 3I5TA 3PAAA 1IX8A 2AY7A 3N5MA 2RFVA 5EUEA 1AICA 3FDBA 1I29A 4UQVA 1VEFA 4QGRA 1EQBA 2VMNA 2R5CA 2AY6A 2X5FA 3NUBA 4U1TA 3II0A 2BYLA 4ZSWA 3FD0A 4WBTA 1AJSB 3F9TA 3VP6A 2BIEA 4IXOA 1LW5A 4FL0A 1B5OA 4ZM3A 2JJHA 2W7MA 2V1PA 4UHMA 4BA5A 3T32A 2CJHA 1MLZA 4CXQA 2EZ1A 3JWBA 4ZM4A 3QM2A 2GMUA 1MGVA 1GEXA 3PDXA 1XEYA 3NYTA 2GSAA 3DC1A 3PJ0A 2D64A 4RKCA 1ELUA 1ASDA 4LC3A 1C0NA 4LW4A 3ZRRA 5G0AA 1CZEA 3ELEA 3BWNA 3Q8NA 1D7UA 2Z67A 2BI9A 4WYAA 3MKJA 5D95A 1WKHA 3QHXA 4PIWA 1WYVB 1PMMA 1CQ6A 2DGKA 1LKCA 2BYJA 2E7IA 2VMPA 2VGZA 3LY1A 1B9IA 1X2AA 2BIAA 2W8UA 4MQPA 4RJ0A 1FC4A 1S09A 2C81A 1C7GA 2DGLA 3GZDC 1AY5A 2PB2A 1WYUB 2BKWA 4EFFA 4K2MA 1PFFA 2CH2A 2HOZA 3PPLA 2AY9A 4WYEA 3WLXA 5EQCA 3VK3A 5G4JA 3GZDA 3UE8A 3ZZJA 4AZKA 2VMVA 2JGTA 4LNMA 3B1DA 4WXGA 2O1BA 3FVUA 1GC4A 1JS6A 3BC8A 4OMAA 3AATA 1WSTA 1N31A 1LC8A 1YAAA 1SFFA 3I4JA 1AY4A 1TASA 2C7TA 4ZDOA 1CL2A 3N75A 4KXKA 2BI5A 1GC0A 3P6KA 1BS0A 3LV2A 1IBJA 1V2DA 1WYVA 2D61A 2VGUA 2AY2A 5D5SA 1M6SA 2XH1A 3QI6A 4UHOA 5EUDA 1FG7A 1V2FA 4ADCA 3K40A 1D2FA 4WLHA 4UOYA 3PDBA 4OBVA 1AHGA 4DGTA 4F5GA 1BJNA 4EU1A 2VIAA 4DBCA 1ASCA 1LC7A 2CJGA 1JF9A 3JTXA 1ARSA 5BJ4A 3WY7A 3BN1A 2BWNA 4ZASA 2OGEA 2Z1YA 5FT6A 4Y0HA 2WKAA 4XQ2A 1M7YA 1VP4A 2R5EA 3H7FA 4W1WA 5M4BA 2W8VA 2BWOA 3TQXA 3AENA 1AIBA 3BCXA 2ZC0A 1C9CA 1GC3A 1ASMA 3NTJA 3TFTA 2AY1A 1RV3A 1BKGA 2YKVA 3DXWA 3MEBA 3BB8A 3EUCA 2YRRA 3FQ8A 4WYGA 4WXBA 1FG3A 1B8GA 1Y4IA 4E3RA 2VIBA 4EB7A 2O7CA 2ORDA 2FQ6A 2JJEA 4H51A 3CQ4A 3HT4A 2XBNA 3QN6A 3RCHB 4Y0DA 1DJEA 1AJSA 1AJRA 4Y0IA 4A6UA 5EIGB 3G0TA 5G2QA 3TATA 4E3QA 2FN6A 3LVMA 5EUNA 3EI6A 1AKBA 4WYFA 1E5FA 3HMUA 2O0RA 3LVJA 1MDXA 3FCRA 3HQTA 5DJ9A 4XEWA 2HUUA 3FFRA 2AY5A 3FQAA 2ZY2A 4ADEA 1TOJA 3H14A 4RLGA 2V0YA 4B9BA 1BQAA 1M0QA 3L44A 3MADA 4NOGA 4TN4A 5LH9A 3NUIA 1YJSA 4IY7A 1G7WA 4JF1A 1SPAA 1M0PA 4ZSYA 1C4KA 2E54A 4W1VA 2EGYA 2JJGA 2ZSLA 4A6RA 1H0CA 4XJOA 3WCNA 4RITA 4ZDLA 2Z1ZA 2CY8A 1S08A 2W7FA 2YHKA 1S0AA 1O61A 4I8AA 3EIAA 1SZUA 3DR4A 1VJOA 2VLFA 1IX6A 3GSBA 4RAEA 1G4VA 4OYTA 4F5HA 1CQ8A 4F5LA 5HDMA 3ECDA 2QA3A 4MQRA 4E1OA 2VMSA 5C6UA 5F8VA 4XK1A 4LNJA 2EPJA 1ASLA 1KKPA 4LW2A 5F9SA 1IAXA 4JEXA 1D7SA 3LVLB 3E2FA 1O62A 3FVXA 3MAFA 4MKKA 4O6ZA 4RKDA 2VMUA 3B1CA 3GWPA 4JEVA 1O69A 5G4IA 4GRXA 3FKDA 3EI5A 3MC6C 5EAAA 1GCKA 1ZODA 2YKYA 3AENB 3NYUA 1G4XA 2VGTA 3ELPA 4BMKA 3DXVA 2Z20A 4OTLA 2AY4A 1YNUA 2DKJA 1QZ9A 1AHYA 4XAUA 1DKAA 2D66A 1U08A 2Z9UA 2FM1A 2VGWA 3L8AA 4CVQA 2W7EA 2VLHA 1ZC9A 1YIZA 1IVRA 1Z3ZA 3OKSA 1AKCA 2W7KA 3BV0A 3AEJA 1ASBA 1PMOA 4KYOA 2HP2A 1P3WA 4P3MA 4PFFA 3KE3A 1GC2A 4M2MA 4A72A 4IXSA 2R0TA 3LVKA 4M2JA 1BJOA 2JJFA 3CBFA 2E7JA 2WK7A 4GSAA 4HF8A 4PVFA 1TATA 3PA9A 3F6TA 3MC6A 3EI8A 1M4NA 2X8UA 3WKRA 5M4DA 3DRDA 2HUFA 1QJ3A 2QBTA 7AATA 2VI9A 1WYTA 1GDEA 2CSTA 2EO5A 3CQ5A 4ATPA 3W1HA 5G2PA 1TOEA 1C7OA 2DKBA 1MDZA 1OXOA 3E2ZB 2BWPA 1AMSA 3FQ7A 1J32A 1QITA 2ZSMA 3BCBA 5E5IA 4BQ0A 2CTZA 3NDNA 2GB3A 4K2BA 1AY8A 1AAMA 1RVYA 3RBLA 5JAYA 1KMKA 2Z9VA 3FZ6A 1LS3A 2ZY5A 4DQ6A 2W7JA 2W7HA 5BJ3A 2D5YA 4Q31A 3R4TA 4ZAHA 3DODA 1IJIA 1I41A 3EI7A 4IXZA 4R5ZA 4WYCA 4ADBA 1AKAA 3K7YA 2OKJA 2W7GA 1DJUA 3HL2A 1B4XA 4WXFA 3NU7A 1B5PA 1JG8A 5DB5A 4AO9A 4N0WA 1V72A 1AHXA 2YRIA
chains in the Genus database with same CATH superfamily
1KKJA 1W7MA 2VMTA 2W8TA 1M0NA 3A9YA 3DYDA 3FSLA 4IYOA 1D7RA 3GZCA 4W91A 1KL1A 1M32A 3AEMA 3E6GA 1DGEA 1CQ7A 1IX7A 1AAWA 1WYTB 1LW4A 4WLJA 4J5UA 8AATA 5IWQA 3RQ1A 2VGSA 3NNKA 1TPLA 1IUGA 2AEUA 1X28A 1BJOB 3AEMC 3USFA 3WX9A 1AHEA 1ELQA 5I92A 1M0OA 3AEPA 4ZWVA 1WYUA 4Q76A 4F5MA 2E7UA 4ZWMA 2OKKA 5EIGA 1UU1A 1TOKA 2HOYA 3OP7A 4R5FA 5EAVA 4OT8A 2R5CB 4ZLVA 1CS1A 1WKGA 2AY3A 4ISYA 3FFHA 3ISLA 2ZY3A 3KGXA 1QIRA 4EMYA 3ZZKA 1PG8A 3P1TA 4M2KA 4F4EA 1E5EA 1O4SA 3GR9A 3N7NA 3QPGA 2CANA 2Z61A 2VMYA 1TARA 3LWSA 4WB0A 4F5FA 1YOOA 1ARHA 3PD6B 5J8QA 2KFPA 2R2NA 3VOMA 4BA4A 1T3IA 2YOBA 1W7LA 3EZ1A 1SZKA 3VK2A 3WKSA 4ITGA 4RM1A 1CZCA 3DR7A 4B98A 3PGYA 3HDOA 4ATQA 2OATA 3WGBA 2BHXA 1ZOBA 2BI1A 2EH6A 1S07A 2VMXA 1DJ9A 3FRKA 4JF0A 4J8LA 2Q7WA 1OXPA 4A00A 3G7QA 1ORDA 4FFCA 3GJUA 3E9KA 4N0BA 1AMRA 3DZZA 3M5UA 4W1XA 3N4SA 2CB1A 3NYSA 1H1CA 2BIGA 2WK9A 2ZP7A 3GBXA 3VAXA 4AZJA 4GDYA 3RCHA 1KAFA 1SZSA 1UKJA 4ITXA 5FT8A 1BJWA 2VMQA 4XJMA 1SF2A 2FNIA 1S06A 4CXRA 2HORA 4HVKA 1ARGA 3RI6A 2PB0A 4MSOA 1CJ0A 2DGMA 3A9ZA 5K8BA 3COGA 3RUYA 1UU2A 4OC9A 2D65A 2G6WA 2NMPA 3F0HA 4KAMA 1J04A 2HZPA 2JG2A 1QJ5A 1YJZA 5FT4A 4WD2A 5M49A 1BJ4A 2X5DA 2QB3A 1Z7DA 2ZJGA 3E2ZA 4CBSA 1D7VA 4UHNA 4Q75A 1KMJA 1YJYA 2BI3A 3B1EA 3E77A 1ECXA 2TPLA 2VMZA 1QISA 1YIYA 3PDBB 4WB0B 1X29A 3TCMA 3W1JA 3WZFA 3CAIA 5LHAA 3JWAA 2W8WA 3ASAA 2VYCA 2QLRA 1BW0A 3MAFB 1DTYA 4F5IA 5HXXA 2FKIA 4W5KA 3ATHA 1AX4A 4TV7A 3N4XA 1W3UA 4JEZA 4RJYA 2CFBA 4IYOB 1ASEA 1MLYA 4RIZA 4MGRA 1XI9A 1N8PA 4F5JA 1DGDA 3UAKA 1IAYA 2C44A 3JU7A 4OCAA 4R8DA 2HP1A 3IF2A 4A6TA 2W7IA 4AOAA 2AY8A 4ZDPA 3JZLA 1ASAA 1LK9A 4BHDA 3EIBA 2FNUA 3N0LA 5G09A 4PFNA 2PO3A 2AEVA 5DJ1A 2VGVA 2OQXA 4JE5A 1AIAA 1OATA 4A0FA 3FDDA 1GBNA 3HBXA 3KGWA 3B46A 3BCAA 3AOVA 3HLMA 1GD9A 1UU0A 3B8XA 3K28A 4MY5A 2CJDA 2YCPA 1RVUA 2W8JA 2VMOA 3JW9A 1BT4A 2VI8A 1GEWA 2D63A 3BWNC 1OHYA 2GQNA 2JISA 4K2IA 1RV4A 3N4RA 2EYQA 2YCTA 3A8UX 2Z9WA 3HVYA 2D7YA 3A9XA 3WCOA 1ASFA 4U2HA 5AX8A 2Z9XA 4R2NA 1MDOA 3EZSA 5FT5A 1I43A 4A0GA 4P7YA 1W23A 2X3LA 3GETA 3RBFA 3CQ6A 3W1IA 1N2TA 2VMRA 4AH3A 3NU8A 3BWOA 1BQDA 2W7LA 1SVVA 2FYFA 3ASBA 4GE9A 3D6KA 4CBRA 3R9AA 2HOXA 1C7NA 1ARIA 4A0HA 2GMSA 4L0OA 3TFUA 4W8IA 3A2BA 1EJIA 2F8JA 2QMAA 4MQQA 2OGAA 3QGUA 2ZYJA 1OHVA 1DFOA 4MKJA 2CH1A 1MAPA 3AOWA 3KKIA 4GE4A 3ACZA 3FZ7A 3LG0A 3AEOA 2DR1A 5DX5A 1TOGA 1AMAA 1GEYA 2ZY4A 1LC5A 3FZ8A 3DU4A 2C0RA 2VMWA 4GEBA 5E3KA 5M46A 2QB2A 4Q6RA 1KL2A 4WYDA 2HUIA 1ASNA 1ARTA 2W7DA 2AATA 5EFSA 2WK8A 3FVSA 2CINA 2EZ2A 3NX3A 4EB5A 5TF5A 4TMRA 3WGCA 4F5KA 4AO4A 4XJLA 3BS8A 1OHWA 4LNLA 5E4ZA 1CL1A 1AHFA 2YKXA 1TOIA 2ZUKA 2YCNA 3AELA 4GE7A 1X0MA 4XJPA 3MAUA 5HHYA 2D7ZA 1V2EA 3EI9A 4JE5D 4JEWA 4OBUA 1ASGA 1I48A 3ZRPA 1AMQA 3G8MA 1W7NA 1B9HA 1EG5A 4IX8A 1MAQA 4JEYA 3NRAA 4ADDA 4IW7A 4K05A 4E77A 1QGNA 3AEJC 1G7XA 2YKUA 2BI2A 3E2YA 3QBOA 4A0RA 3UWCA 9AATA 3MBBA 3AV7A 3IHJA 1JS3A 2DOUA 3ZRQA 3FTBA 3I16A 3VK4A 3PD6A 3PIUA 4WP0A 3I5TA 3PAAA 1IX8A 2AY7A 3N5MA 2RFVA 5EUEA 2A1VA 1AICA 3FDBA 1I29A 4UQVA 1VEFA 4QGRA 1EQBA 2VMNA 2R5CA 2AY6A 2X5FA 3NUBA 4U1TA 3II0A 2BYLA 2QSRA 4ZSWA 3FD0A 4WBTA 1AJSB 3F9TA 3VP6A 2BIEA 4IXOA 1LW5A 4FL0A 1B5OA 4ZM3A 2JJHA 2W7MA 2V1PA 4UHMA 4BA5A 3T32A 2CJHA 1MLZA 4CXQA 2EZ1A 3JWBA 4ZM4A 3QM2A 2GMUA 1MGVA 1GEXA 3PDXA 1XEYA 3NYTA 2GSAA 3DC1A 3PJ0A 2D64A 4RKCA 1ELUA 1ASDA 4LC3A 1C0NA 4LW4A 3ZRRA 5G0AA 1CZEA 3ELEA 3BWNA 3Q8NA 1D7UA 2Z67A 2BI9A 4WYAA 3MKJA 5D95A 1WKHA 3QHXA 4PIWA 1WYVB 1PMMA 1CQ6A 2DGKA 1LKCA 2BYJA 2E7IA 2VMPA 2VGZA 3LY1A 1B9IA 1X2AA 2BIAA 2W8UA 4MQPA 4RJ0A 3H9XA 1FC4A 4H63Q 1S09A 2C81A 1C7GA 2DGLA 3GZDC 1AY5A 2PB2A 1WYUB 2BKWA 4EFFA 4K2MA 1PFFA 2CH2A 2HOZA 3PPLA 2AY9A 4WYEA 3WLXA 5EQCA 3VK3A 5G4JA 3GZDA 3UE8A 3ZZJA 4AZKA 2VMVA 2JGTA 4LNMA 3B1DA 4WXGA 2O1BA 3FVUA 1GC4A 1JS6A 3BC8A 4OMAA 3AATA 1WSTA 1N31A 1LC8A 1YAAA 1SFFA 3I4JA 1AY4A 1TASA 2G7JA 2C7TA 4ZDOA 1CL2A 3N75A 4KXKA 2BI5A 1GC0A 3P6KA 1BS0A 3LV2A 1IBJA 1V2DA 1WYVA 2D61A 2VGUA 2AY2A 5D5SA 1M6SA 2XH1A 3QI6A 4UHOA 5EUDA 1FG7A 1V2FA 4ADCA 3K40A 1D2FA 4WLHA 4UOYA 3PDBA 4OBVA 1AHGA 4DGTA 4F5GA 1BJNA 4EU1A 2VIAA 4DBCA 1ASCA 1LC7A 2CJGA 1JF9A 3JTXA 1ARSA 5BJ4A 3WY7A 3BN1A 2BWNA 4ZASA 2OGEA 2Z1YA 5FT6A 4Y0HA 2WKAA 4XQ2A 1M7YA 1VP4A 2R5EA 3H7FA 4W1WA 5M4BA 2W8VA 2BWOA 3TQXA 3AENA 1AIBA 3BCXA 2ZC0A 1C9CA 1GC3A 1ASMA 3NTJA 3TFTA 2AY1A 1RV3A 1BKGA 2YKVA 3DXWA 3MEBA 3BB8A 3EUCA 2YRRA 3FQ8A 4WYGA 4WXBA 1FG3A 1B8GA 1Y4IA 4E3RA 2VIBA 4EB7A 2O7CA 2ORDA 2FQ6A 2JJEA 4H51A 3CQ4A 3HT4A 2XBNA 3QN6A 3RCHB 4Y0DA 1DJEA 1AJSA 1AJRA 4Y0IA 4A6UA 5EIGB 3G0TA 5G2QA 3TATA 4E3QA 2FN6A 3LVMA 5EUNA 3EI6A 1AKBA 4WYFA 1E5FA 3HMUA 2O0RA 3LVJA 1MDXA 3FCRA 3HQTA 5DJ9A 4XEWA 2HUUA 3FFRA 2AY5A 3FQAA 2ZY2A 4ADEA 1TOJA 3H14A 4RLGA 2V0YA 4B9BA 1BQAA 1M0QA 3L44A 3MADA 4NOGA 4TN4A 5LH9A 3NUIA 1YJSA 4IY7A 1G7WA 4JF1A 1SPAA 1M0PA 4ZSYA 1C4KA 2E54A 4W1VA 2EGYA 2JJGA 2ZSLA 4A6RA 1H0CA 4XJOA 3WCNA 4RITA 4ZDLA 2Z1ZA 2CY8A 1S08A 2W7FA 2YHKA 1S0AA 1O61A 5KTBA 4I8AA 3EIAA 1SZUA 3DR4A 1VJOA 2VLFA 1IX6A 3GSBA 4RAEA 1G4VA 4OYTA 4F5HA 1CQ8A 4F5LA 5HDMA 3ECDA 2QA3A 4MQRA 4E1OA 2VMSA 5C6UA 5F8VA 4XK1A 4LNJA 2EPJA 1ASLA 1KKPA 4LW2A 5F9SA 1IAXA 4JEXA 1D7SA 3LVLB 3E2FA 1O62A 3FVXA 3MAFA 4MKKA 4O6ZA 4RKDA 2VMUA 3B1CA 3GWPA 4JEVA 1O69A 5G4IA 4GRXA 3FKDA 3EI5A 3MC6C 5EAAA 1GCKA 1ZODA 2YKYA 3AENB 3NYUA 1G4XA 2VGTA 3ELPA 4BMKA 3DXVA 2Z20A 4OTLA 2AY4A 1YNUA 2DKJA 1QZ9A 1AHYA 4XAUA 1DKAA 2D66A 1U08A 2Z9UA 2FM1A 2VGWA 3L8AA 4CVQA 2W7EA 2VLHA 1ZC9A 1YIZA 1IVRA 1Z3ZA 3OKSA 1AKCA 2W7KA 3BV0A 3AEJA 1ASBA 1PMOA 4KYOA 2HP2A 1P3WA 4P3MA 4PFFA 3KE3A 1GC2A 4M2MA 4A72A 4IXSA 2R0TA 3LVKA 4M2JA 1BJOA 2JJFA 3CBFA 2E7JA 2WK7A 4GSAA 4HF8A 4PVFA 1TATA 3PA9A 3F6TA 3MC6A 3EI8A 1M4NA 2X8UA 3WKRA 5M4DA 3DRDA 2HUFA 1QJ3A 2QBTA 7AATA 2VI9A 1WYTA 1GDEA 2CSTA 2EO5A 3CQ5A 4ATPA 3W1HA 5G2PA 1TOEA 1C7OA 2DKBA 1MDZA 1OXOA 3E2ZB 2BWPA 1AMSA 3FQ7A 1J32A 1QITA 2ZSMA 3BCBA 5E5IA 4BQ0A 2CTZA 3NDNA 2GB3A 4K2BA 1AY8A 1AAMA 1RVYA 3RBLA 5JAYA 1KMKA 2Z9VA 3FZ6A 1LS3A 2ZY5A 4DQ6A 2W7JA 2W7HA 5BJ3A 2D5YA 4Q31A 3R4TA 4ZAHA 3DODA 1IJIA 1I41A 3EI7A 4IXZA 4R5ZA 4WYCA 4ADBA 1AKAA 3K7YA 2OKJA 2W7GA 1DJUA 3HL2A 1B4XA 4WXFA 3NU7A 1B5PA 1JG8A 5DB5A 4AO9A 4N0WA 1V72A 1AHXA 2WB6A 2YRIA
chains in the Genus database with same CATH topology
1KKJA 1W7MA 2VMTA 2W8TA 1M0NA 3A9YA 3DYDA 3FSLA 4IYOA 1D7RA 3GZCA 4W91A 1KL1A 1M32A 3AEMA 3E6GA 1DGEA 1CQ7A 1IX7A 1AAWA 1WYTB 1LW4A 4WLJA 4J5UA 8AATA 5IWQA 3RQ1A 2VGSA 3NNKA 1TPLA 1IUGA 2AEUA 1X28A 1BJOB 3AEMC 3USFA 3WX9A 1AHEA 1ELQA 5I92A 1M0OA 3AEPA 4ZWVA 1WYUA 4Q76A 4F5MA 2E7UA 4ZWMA 2OKKA 5EIGA 1UU1A 1TOKA 2HOYA 3OP7A 4R5FA 5EAVA 4OT8A 2R5CB 4ZLVA 1CS1A 1WKGA 2AY3A 4ISYA 3FFHA 3ISLA 2ZY3A 3KGXA 1QIRA 4EMYA 3ZZKA 1PG8A 3P1TA 4M2KA 4F4EA 1E5EA 1O4SA 3GR9A 3N7NA 3QPGA 2CANA 2Z61A 2VMYA 1TARA 3LWSA 4WB0A 4F5FA 1YOOA 1ARHA 3PD6B 5J8QA 2KFPA 2R2NA 3VOMA 4BA4A 1T3IA 2YOBA 1W7LA 3EZ1A 1SZKA 3VK2A 3WKSA 4ITGA 4RM1A 1CZCA 3DR7A 4B98A 3PGYA 3HDOA 4ATQA 2OATA 3WGBA 2BHXA 1ZOBA 2BI1A 2EH6A 1S07A 2VMXA 1DJ9A 3FRKA 4JF0A 4J8LA 2Q7WA 1OXPA 4A00A 3G7QA 1ORDA 4FFCA 3GJUA 3E9KA 4N0BA 1AMRA 3DZZA 3M5UA 4W1XA 3N4SA 2CB1A 3NYSA 1H1CA 2BIGA 2WK9A 2ZP7A 3GBXA 3VAXA 4AZJA 4GDYA 3RCHA 1SZSA 1UKJA 4ITXA 5FT8A 1BJWA 2VMQA 4XJMA 1SF2A 2FNIA 1S06A 4CXRA 2HORA 4HVKA 1ARGA 3RI6A 2PB0A 4MSOA 1CJ0A 2DGMA 3A9ZA 5K8BA 3COGA 3RUYA 1UU2A 4OC9A 2D65A 2G6WA 2NMPA 3F0HA 4KAMA 1J04A 2HZPA 2JG2A 1QJ5A 1YJZA 5FT4A 4WD2A 5M49A 1BJ4A 2X5DA 2QB3A 1Z7DA 2ZJGA 3E2ZA 4CBSA 1D7VA 4UHNA 4Q75A 1KMJA 1YJYA 2BI3A 3B1EA 3E77A 1ECXA 2TPLA 2VMZA 1QISA 1YIYA 3PDBB 4WB0B 1X29A 3TCMA 3W1JA 3WZFA 3CAIA 5LHAA 3JWAA 2W8WA 3ASAA 2VYCA 2QLRA 1BW0A 3MAFB 1DTYA 4F5IA 5HXXA 2FKIA 4W5KA 3ATHA 1AX4A 4TV7A 3N4XA 1W3UA 4JEZA 4RJYA 2CFBA 4IYOB 1ASEA 1MLYA 4RIZA 4MGRA 1XI9A 1N8PA 4F5JA 1DGDA 3UAKA 1IAYA 2C44A 3JU7A 4OCAA 4R8DA 2HP1A 3IF2A 4A6TA 2W7IA 4AOAA 2AY8A 4ZDPA 3JZLA 1ASAA 1LK9A 4BHDA 3EIBA 2FNUA 3N0LA 5G09A 4PFNA 2PO3A 2AEVA 5DJ1A 2VGVA 2OQXA 4JE5A 1AIAA 1OATA 4A0FA 3FDDA 1GBNA 3HBXA 3KGWA 3B46A 3BCAA 3AOVA 3HLMA 1GD9A 1UU0A 3B8XA 3K28A 4MY5A 2CJDA 2YCPA 1RVUA 2W8JA 2VMOA 3JW9A 1BT4A 2VI8A 1GEWA 2D63A 3BWNC 1OHYA 2GQNA 2JISA 4K2IA 1RV4A 3N4RA 2EYQA 2YCTA 3A8UX 2Z9WA 3HVYA 2D7YA 3A9XA 3WCOA 1ASFA 4U2HA 5AX8A 2Z9XA 4R2NA 1MDOA 3EZSA 5FT5A 1I43A 4A0GA 4P7YA 1W23A 2X3LA 3GETA 3RBFA 3CQ6A 3W1IA 1N2TA 2VMRA 4AH3A 3NU8A 3BWOA 1BQDA 2W7LA 1SVVA 2FYFA 3ASBA 4GE9A 3D6KA 4CBRA 3R9AA 2HOXA 1C7NA 1ARIA 4A0HA 2GMSA 4L0OA 3TFUA 4W8IA 3A2BA 1EJIA 2F8JA 2QMAA 4MQQA 2OGAA 3QGUA 2ZYJA 1OHVA 1DFOA 4MKJA 2CH1A 1MAPA 3AOWA 3KKIA 4GE4A 3ACZA 3FZ7A 3LG0A 3AEOA 2DR1A 5DX5A 1TOGA 1AMAA 1GEYA 2ZY4A 1LC5A 3FZ8A 3DU4A 2C0RA 2VMWA 4GEBA 5E3KA 5M46A 2QB2A 4Q6RA 1KL2A 4WYDA 2HUIA 1ASNA 1ARTA 2W7DA 2AATA 5EFSA 2WK8A 3FVSA 2CINA 2EZ2A 3NX3A 4EB5A 5TF5A 4TMRA 3WGCA 4F5KA 4AO4A 4XJLA 3BS8A 1OHWA 4LNLA 5E4ZA 1CL1A 1AHFA 2YKXA 1TOIA 2ZUKA 2YCNA 3AELA 4GE7A 1X0MA 4XJPA 3MAUA 5HHYA 2D7ZA 1V2EA 3EI9A 4JE5D 4JEWA 4OBUA 1ASGA 1I48A 3ZRPA 1AMQA 3G8MA 1W7NA 1B9HA 1EG5A 4IX8A 1MAQA 4JEYA 3NRAA 4ADDA 4IW7A 4K05A 4E77A 1QGNA 3AEJC 1G7XA 2YKUA 2BI2A 3E2YA 3QBOA 4A0RA 3UWCA 9AATA 3MBBA 3AV7A 3IHJA 1JS3A 2DOUA 3ZRQA 3FTBA 3I16A 3VK4A 3PD6A 3PIUA 4WP0A 3I5TA 3PAAA 1IX8A 2AY7A 3N5MA 2RFVA 5EUEA 2A1VA 1AICA 3FDBA 1I29A 4UQVA 1VEFA 4QGRA 1EQBA 2VMNA 2R5CA 2AY6A 2X5FA 3NUBA 4U1TA 3II0A 2BYLA 2QSRA 4ZSWA 3FD0A 4WBTA 1AJSB 3F9TA 3VP6A 2BIEA 4IXOA 1LW5A 4FL0A 1B5OA 4ZM3A 2JJHA 2W7MA 2V1PA 4UHMA 4BA5A 3T32A 2CJHA 1MLZA 4CXQA 2EZ1A 3JWBA 4ZM4A 3QM2A 2GMUA 1MGVA 1GEXA 3PDXA 1XEYA 3NYTA 2GSAA 3DC1A 3PJ0A 2D64A 4RKCA 1ELUA 1ASDA 4LC3A 1C0NA 4LW4A 3ZRRA 5G0AA 1CZEA 3ELEA 3BWNA 3Q8NA 1D7UA 2Z67A 2BI9A 4WYAA 3MKJA 5D95A 1WKHA 3QHXA 4PIWA 1WYVB 1PMMA 1CQ6A 2DGKA 1LKCA 2BYJA 2E7IA 2VMPA 2VGZA 3LY1A 1B9IA 1X2AA 2BIAA 2W8UA 4MQPA 4RJ0A 3H9XA 1FC4A 4H63Q 1S09A 2C81A 1C7GA 2DGLA 3GZDC 1AY5A 2PB2A 1WYUB 2BKWA 4EFFA 4K2MA 1PFFA 2CH2A 2HOZA 3PPLA 2AY9A 4WYEA 3WLXA 5EQCA 3VK3A 5G4JA 3GZDA 3UE8A 3ZZJA 4AZKA 2VMVA 2JGTA 4LNMA 3B1DA 4WXGA 2O1BA 3FVUA 1GC4A 1JS6A 3BC8A 4OMAA 3AATA 1WSTA 1N31A 1LC8A 1YAAA 1SFFA 3I4JA 1AY4A 1TASA 2G7JA 2C7TA 4ZDOA 1CL2A 3N75A 4KXKA 2BI5A 1GC0A 3P6KA 1BS0A 3LV2A 1IBJA 1V2DA 1WYVA 2D61A 2VGUA 2AY2A 5D5SA 1M6SA 2XH1A 3QI6A 4UHOA 5EUDA 1FG7A 1V2FA 4ADCA 3K40A 1D2FA 4WLHA 4UOYA 3PDBA 4OBVA 1AHGA 4DGTA 4F5GA 1BJNA 4EU1A 2VIAA 4DBCA 1ASCA 1LC7A 2CJGA 1JF9A 3JTXA 1ARSA 5BJ4A 3WY7A 3BN1A 2BWNA 4ZASA 2OGEA 2Z1YA 5FT6A 4Y0HA 2WKAA 4XQ2A 1M7YA 1VP4A 2R5EA 3H7FA 4W1WA 5M4BA 2W8VA 2BWOA 3TQXA 3AENA 1AIBA 3BCXA 2ZC0A 1C9CA 1GC3A 1ASMA 3NTJA 3TFTA 2AY1A 1RV3A 1BKGA 2YKVA 3DXWA 3MEBA 3BB8A 3EUCA 2YRRA 3FQ8A 4WYGA 4WXBA 1FG3A 1B8GA 1Y4IA 4E3RA 2VIBA 4EB7A 2O7CA 2ORDA 2FQ6A 2JJEA 4H51A 3CQ4A 3HT4A 2XBNA 3QN6A 3RCHB 4Y0DA 1DJEA 1AJSA 1AJRA 4Y0IA 4A6UA 5EIGB 3G0TA 5G2QA 3TATA 4E3QA 2FN6A 3LVMA 5EUNA 3EI6A 1AKBA 4WYFA 1E5FA 3HMUA 2O0RA 3LVJA 1MDXA 3FCRA 3HQTA 5DJ9A 4XEWA 2HUUA 3FFRA 2AY5A 3FQAA 2ZY2A 4ADEA 1TOJA 3H14A 4RLGA 2V0YA 4B9BA 1BQAA 1M0QA 3L44A 3MADA 4NOGA 4TN4A 5LH9A 3NUIA 1YJSA 4IY7A 1G7WA 4JF1A 1SPAA 1M0PA 4ZSYA 1C4KA 2E54A 4W1VA 2EGYA 2JJGA 2ZSLA 4A6RA 1H0CA 4XJOA 3WCNA 4RITA 4ZDLA 2Z1ZA 2CY8A 1S08A 2W7FA 2YHKA 1S0AA 1O61A 5KTBA 4I8AA 3EIAA 1SZUA 3DR4A 1VJOA 2VLFA 1IX6A 3GSBA 4RAEA 1G4VA 4OYTA 4F5HA 1CQ8A 4F5LA 5HDMA 3ECDA 2QA3A 4MQRA 4E1OA 2VMSA 5C6UA 5F8VA 4XK1A 4LNJA 2EPJA 1ASLA 1KKPA 4LW2A 5F9SA 1IAXA 4JEXA 1D7SA 3LVLB 3E2FA 1O62A 3FVXA 3MAFA 4MKKA 4O6ZA 4RKDA 2VMUA 3B1CA 3GWPA 4JEVA 1O69A 5G4IA 4GRXA 3FKDA 3EI5A 3MC6C 5EAAA 1GCKA 1ZODA 2YKYA 3AENB 3NYUA 1G4XA 2VGTA 3ELPA 4BMKA 3DXVA 2Z20A 4OTLA 2AY4A 1YNUA 2DKJA 1QZ9A 1AHYA 4XAUA 1DKAA 2D66A 1U08A 2Z9UA 2FM1A 2VGWA 3L8AA 4CVQA 2W7EA 2VLHA 1ZC9A 1YIZA 1IVRA 1Z3ZA 3OKSA 1AKCA 2W7KA 3BV0A 3AEJA 1ASBA 1PMOA 4KYOA 2HP2A 1P3WA 4P3MA 4PFFA 3KE3A 1GC2A 4M2MA 4A72A 4IXSA 2R0TA 3LVKA 4M2JA 1BJOA 2JJFA 3CBFA 2E7JA 2WK7A 4GSAA 4HF8A 4PVFA 1TATA 3PA9A 3F6TA 3MC6A 3EI8A 1M4NA 2X8UA 3WKRA 5M4DA 3DRDA 2HUFA 1QJ3A 2QBTA 7AATA 2VI9A 1WYTA 1GDEA 2CSTA 2EO5A 3CQ5A 4ATPA 3W1HA 5G2PA 1TOEA 1C7OA 2DKBA 1MDZA 1OXOA 3E2ZB 2BWPA 1AMSA 3FQ7A 1J32A 1QITA 2ZSMA 3BCBA 5E5IA 4BQ0A 2CTZA 3NDNA 2GB3A 4K2BA 1AY8A 1AAMA 1RVYA 3RBLA 5JAYA 1KMKA 2Z9VA 3FZ6A 1LS3A 2ZY5A 4DQ6A 2W7JA 2W7HA 5BJ3A 2D5YA 4Q31A 3R4TA 4ZAHA 3DODA 1IJIA 1I41A 3EI7A 4IXZA 4R5ZA 4WYCA 4ADBA 1AKAA 3K7YA 2OKJA 2W7GA 1DJUA 3HL2A 1B4XA 4WXFA 3NU7A 1B5PA 1JG8A 5DB5A 4AO9A 4N0WA 1V72A 1AHXA 2WB6A 2YRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKJ A;  1W7M A;  2VMT A;  2W8T A;  1M0N A;  3A9Y A;  3DYD A;  3FSL A;  4IYO A;  1D7R A;  3GZC A;  4W91 A;  1KL1 A;  1M32 A;  3AEM A;  3E6G A;  1DGE A;  1CQ7 A;  1IX7 A;  1AAW A;  1WYT B;  1LW4 A;  4WLJ A;  4J5U A;  8AAT A;  5IWQ A;  3RQ1 A;  2VGS A;  3NNK A;  1TPL A;  1IUG A;  2AEU A;  1X28 A;  1BJO B;  3AEM C;  3USF A;  3WX9 A;  1AHE A;  1ELQ A;  5I92 A;  1M0O A;  3AEP A;  4ZWV A;  1WYU A;  4Q76 A;  4F5M A;  2E7U A;  4ZWM A;  2OKK A;  5EIG A;  1UU1 A;  1TOK A;  2HOY A;  3OP7 A;  4R5F A;  5EAV A;  4OT8 A;  2R5C B;  4ZLV A;  1CS1 A;  1WKG A;  2AY3 A;  4ISY A;  3FFH A;  3ISL A;  2ZY3 A;  3KGX A;  1QIR A;  4EMY A;  3ZZK A;  1PG8 A;  3P1T A;  4M2K A;  4F4E A;  1E5E A;  1O4S A;  3GR9 A;  3QPG A;  2CAN A;  2Z61 A;  2VMY A;  1TAR A;  3LWS A;  4WB0 A;  4F5F A;  1YOO A;  1ARH A;  3PD6 B;  5J8Q A;  2R2N A;  3VOM A;  4BA4 A;  1T3I A;  2YOB A;  1W7L A;  3EZ1 A;  1SZK A;  3VK2 A;  3WKS A;  4ITG A;  4RM1 A;  1CZC A;  3DR7 A;  4B98 A;  3PGY A;  3HDO A;  4ATQ A;  2OAT A;  3WGB A;  2BHX A;  1ZOB A;  2BI1 A;  2EH6 A;  1S07 A;  2VMX A;  1DJ9 A;  3FRK A;  4JF0 A;  4J8L A;  2Q7W A;  1OXP A;  4A00 A;  3G7Q A;  1ORD A;  4FFC A;  3GJU A;  3E9K A;  4N0B A;  1AMR A;  3DZZ A;  3M5U A;  4W1X A;  2CB1 A;  3NYS A;  1H1C A;  2BIG A;  2WK9 A;  2ZP7 A;  3GBX A;  3VAX A;  4AZJ A;  4GDY A;  3RCH A;  1SZS A;  1UKJ A;  4ITX A;  5FT8 A;  1BJW A;  2VMQ A;  4XJM A;  1SF2 A;  2FNI A;  1S06 A;  4CXR A;  2HOR A;  4HVK A;  1ARG A;  3RI6 A;  2PB0 A;  4MSO A;  1CJ0 A;  2DGM A;  3A9Z A;  5K8B A;  3COG A;  3RUY A;  1UU2 A;  4OC9 A;  2D65 A;  2G6W A;  2NMP A;  3F0H A;  4KAM A;  1J04 A;  2HZP A;  2JG2 A;  1QJ5 A;  1YJZ A;  5FT4 A;  4WD2 A;  5M49 A;  1BJ4 A;  2X5D A;  2QB3 A;  1Z7D A;  2ZJG A;  3E2Z A;  4CBS A;  1D7V A;  4UHN A;  4Q75 A;  1KMJ A;  1YJY A;  2BI3 A;  3B1E A;  3E77 A;  1ECX A;  2TPL A;  2VMZ A;  1QIS A;  1YIY A;  3PDB B;  4WB0 B;  1X29 A;  3TCM A;  3W1J A;  3WZF A;  3CAI A;  5LHA A;  3JWA A;  2W8W A;  3ASA A;  2VYC A;  2QLR A;  1BW0 A;  3MAF B;  1DTY A;  4F5I A;  5HXX A;  4W5K A;  3ATH A;  1AX4 A;  4TV7 A;  1W3U A;  4JEZ A;  4RJY A;  2CFB A;  4IYO B;  1ASE A;  1MLY A;  4RIZ A;  4MGR A;  1XI9 A;  1N8P A;  4F5J A;  1DGD A;  3UAK A;  1IAY A;  2C44 A;  3JU7 A;  4OCA A;  4R8D A;  2HP1 A;  3IF2 A;  4A6T A;  2W7I A;  4AOA A;  2AY8 A;  4ZDP A;  3JZL A;  1ASA A;  1LK9 A;  4BHD A;  3EIB A;  2FNU A;  3N0L A;  5G09 A;  4PFN A;  2PO3 A;  2AEV A;  5DJ1 A;  2VGV A;  2OQX A;  4JE5 A;  1AIA A;  1OAT A;  4A0F A;  3FDD A;  1GBN A;  3HBX A;  3KGW A;  3B46 A;  3BCA A;  3AOV A;  3HLM A;  1GD9 A;  1UU0 A;  3B8X A;  3K28 A;  4MY5 A;  2CJD A;  2YCP A;  1RVU A;  2W8J A;  2VMO A;  3JW9 A;  1BT4 A;  2VI8 A;  1GEW A;  2D63 A;  3BWN C;  1OHY A;  2GQN A;  2JIS A;  4K2I A;  1RV4 A;  2YCT A;  3A8U X;  2Z9W A;  3HVY A;  2D7Y A;  3A9X A;  3WCO A;  1ASF A;  4U2H A;  5AX8 A;  2Z9X A;  4R2N A;  1MDO A;  3EZS A;  5FT5 A;  1I43 A;  4A0G A;  4P7Y A;  1W23 A;  2X3L A;  3GET A;  3RBF A;  3CQ6 A;  3W1I A;  1N2T A;  2VMR A;  4AH3 A;  3NU8 A;  3BWO A;  1BQD A;  2W7L A;  1SVV A;  2FYF A;  3ASB A;  4GE9 A;  3D6K A;  4CBR A;  3R9A A;  2HOX A;  1C7N A;  1ARI A;  4A0H A;  2GMS A;  4L0O A;  3TFU A;  4W8I A;  3A2B A;  1EJI A;  2F8J A;  2QMA A;  4MQQ A;  2OGA A;  3QGU A;  2ZYJ A;  1OHV A;  1DFO A;  4MKJ A;  2CH1 A;  1MAP A;  3AOW A;  3KKI A;  4GE4 A;  3ACZ A;  3FZ7 A;  3LG0 A;  3AEO A;  2DR1 A;  5DX5 A;  1TOG A;  1AMA A;  1GEY A;  2ZY4 A;  1LC5 A;  3FZ8 A;  3DU4 A;  2C0R A;  2VMW A;  4GEB A;  5E3K A;  5M46 A;  2QB2 A;  4Q6R A;  1KL2 A;  4WYD A;  2HUI A;  1ASN A;  1ART A;  2W7D A;  2AAT A;  5EFS A;  2WK8 A;  3FVS A;  2CIN A;  2EZ2 A;  3NX3 A;  4EB5 A;  5TF5 A;  4TMR A;  3WGC A;  4F5K A;  4AO4 A;  4XJL A;  3BS8 A;  1OHW A;  4LNL A;  5E4Z A;  1CL1 A;  1AHF A;  2YKX A;  1TOI A;  2ZUK A;  2YCN A;  3AEL A;  4GE7 A;  1X0M A;  4XJP A;  3MAU A;  5HHY A;  2D7Z A;  1V2E A;  3EI9 A;  4JE5 D;  4JEW A;  4OBU A;  1ASG A;  1I48 A;  3ZRP A;  1AMQ A;  3G8M A;  1W7N A;  1B9H A;  1EG5 A;  4IX8 A;  1MAQ A;  4JEY A;  3NRA A;  4ADD A;  4IW7 A;  4E77 A;  1QGN A;  3AEJ C;  1G7X A;  2YKU A;  2BI2 A;  3E2Y A;  3QBO A;  4A0R A;  3UWC A;  9AAT A;  3MBB A;  3AV7 A;  3IHJ A;  1JS3 A;  2DOU A;  3ZRQ A;  3FTB A;  3I16 A;  3VK4 A;  3PD6 A;  3PIU A;  4WP0 A;  3I5T A;  3PAA A;  1IX8 A;  2AY7 A;  3N5M A;  2RFV A;  5EUE A;  1AIC A;  3FDB A;  1I29 A;  4UQV A;  1VEF A;  4QGR A;  1EQB A;  2VMN A;  2R5C A;  2AY6 A;  2X5F A;  3NUB A;  4U1T A;  3II0 A;  2BYL A;  4ZSW A;  3FD0 A;  4WBT A;  1AJS B;  3F9T A;  3VP6 A;  2BIE A;  4IXO A;  1LW5 A;  4FL0 A;  1B5O A;  4ZM3 A;  2JJH A;  2W7M A;  2V1P A;  4UHM A;  4BA5 A;  3T32 A;  2CJH A;  1MLZ A;  4CXQ A;  2EZ1 A;  3JWB A;  4ZM4 A;  3QM2 A;  2GMU A;  1MGV A;  1GEX A;  3PDX A;  1XEY A;  3NYT A;  2GSA A;  3DC1 A;  3PJ0 A;  2D64 A;  4RKC A;  1ELU A;  1ASD A;  4LC3 A;  1C0N A;  4LW4 A;  3ZRR A;  5G0A A;  1CZE A;  3ELE A;  3BWN A;  3Q8N A;  1D7U A;  2Z67 A;  2BI9 A;  4WYA A;  3MKJ A;  5D95 A;  1WKH A;  3QHX A;  4PIW A;  1WYV B;  1PMM A;  1CQ6 A;  2DGK A;  1LKC A;  2BYJ A;  2E7I A;  2VMP A;  2VGZ A;  3LY1 A;  1B9I A;  1X2A A;  2BIA A;  2W8U A;  4MQP A;  4RJ0 A;  1FC4 A;  1S09 A;  2C81 A;  1C7G A;  2DGL A;  3GZD C;  1AY5 A;  2PB2 A;  1WYU B;  2BKW A;  4EFF A;  4K2M A;  1PFF A;  2CH2 A;  2HOZ A;  3PPL A;  2AY9 A;  4WYE A;  3WLX A;  5EQC A;  3VK3 A;  5G4J A;  3GZD A;  3UE8 A;  3ZZJ A;  4AZK A;  2VMV A;  2JGT A;  4LNM A;  3B1D A;  4WXG A;  2O1B A;  3FVU A;  1GC4 A;  1JS6 A;  3BC8 A;  4OMA A;  3AAT A;  1WST A;  1N31 A;  1LC8 A;  1YAA A;  1SFF A;  3I4J A;  1AY4 A;  1TAS A;  2C7T A;  4ZDO A;  1CL2 A;  3N75 A;  4KXK A;  2BI5 A;  1GC0 A;  3P6K A;  1BS0 A;  3LV2 A;  1IBJ A;  1V2D A;  1WYV A;  2D61 A;  2VGU A;  2AY2 A;  5D5S A;  1M6S A;  2XH1 A;  3QI6 A;  4UHO A;  5EUD A;  1FG7 A;  1V2F A;  4ADC A;  3K40 A;  1D2F A;  4WLH A;  4UOY A;  3PDB A;  4OBV A;  1AHG A;  4DGT A;  4F5G A;  1BJN A;  4EU1 A;  2VIA A;  4DBC A;  1ASC A;  1LC7 A;  2CJG A;  1JF9 A;  3JTX A;  1ARS A;  5BJ4 A;  3WY7 A;  3BN1 A;  2BWN A;  4ZAS A;  2OGE A;  2Z1Y A;  5FT6 A;  4Y0H A;  2WKA A;  4XQ2 A;  1M7Y A;  1VP4 A;  2R5E A;  3H7F A;  4W1W A;  5M4B A;  2W8V A;  2BWO A;  3TQX A;  3AEN A;  1AIB A;  3BCX A;  2ZC0 A;  1C9C A;  1GC3 A;  1ASM A;  3NTJ A;  3TFT A;  2AY1 A;  1RV3 A;  1BKG A;  2YKV A;  3DXW A;  3MEB A;  3BB8 A;  3EUC A;  2YRR A;  3FQ8 A;  4WYG A;  4WXB A;  1FG3 A;  1B8G A;  1Y4I A;  4E3R A;  2VIB A;  4EB7 A;  2O7C A;  2ORD A;  2FQ6 A;  2JJE A;  4H51 A;  3CQ4 A;  3HT4 A;  2XBN A;  3QN6 A;  3RCH B;  4Y0D A;  1DJE A;  1AJS A;  1AJR A;  4Y0I A;  4A6U A;  5EIG B;  3G0T A;  5G2Q A;  3TAT A;  4E3Q A;  2FN6 A;  3LVM A;  5EUN A;  3EI6 A;  1AKB A;  4WYF A;  1E5F A;  3HMU A;  2O0R A;  3LVJ A;  1MDX A;  3FCR A;  3HQT A;  5DJ9 A;  4XEW A;  2HUU A;  3FFR A;  2AY5 A;  3FQA A;  2ZY2 A;  4ADE A;  1TOJ A;  3H14 A;  4RLG A;  2V0Y A;  4B9B A;  1BQA A;  1M0Q A;  3L44 A;  3MAD A;  4NOG A;  4TN4 A;  5LH9 A;  3NUI A;  1YJS A;  4IY7 A;  1G7W A;  4JF1 A;  1SPA A;  1M0P A;  4ZSY A;  1C4K A;  2E54 A;  4W1V A;  2EGY A;  2JJG A;  2ZSL A;  4A6R A;  1H0C A;  4XJO A;  3WCN A;  4RIT A;  4ZDL A;  2Z1Z A;  2CY8 A;  1S08 A;  2W7F A;  2YHK A;  1S0A A;  1O61 A;  4I8A A;  3EIA A;  1SZU A;  3DR4 A;  1VJO A;  2VLF A;  1IX6 A;  3GSB A;  4RAE A;  1G4V A;  4OYT A;  4F5H A;  1CQ8 A;  4F5L A;  5HDM A;  3ECD A;  2QA3 A;  4MQR A;  4E1O A;  2VMS A;  5C6U A;  5F8V A;  4XK1 A;  4LNJ A;  2EPJ A;  1ASL A;  1KKP A;  4LW2 A;  5F9S A;  1IAX A;  4JEX A;  1D7S A;  3LVL B;  3E2F A;  1O62 A;  3FVX A;  3MAF A;  4MKK A;  4O6Z A;  4RKD A;  2VMU A;  3B1C A;  3GWP A;  4JEV A;  1O69 A;  5G4I A;  4GRX A;  3FKD A;  3EI5 A;  3MC6 C;  5EAA A;  1GCK A;  1ZOD A;  2YKY A;  3AEN B;  3NYU A;  1G4X A;  2VGT A;  3ELP A;  4BMK A;  3DXV A;  2Z20 A;  4OTL A;  2AY4 A;  1YNU A;  2DKJ A;  1QZ9 A;  1AHY A;  4XAU A;  1DKA A;  2D66 A;  1U08 A;  2Z9U A;  2FM1 A;  2VGW A;  3L8A A;  4CVQ A;  2W7E A;  2VLH A;  1ZC9 A;  1YIZ A;  1IVR A;  1Z3Z A;  3OKS A;  1AKC A;  2W7K A;  3BV0 A;  3AEJ A;  1ASB A;  1PMO A;  4KYO A;  2HP2 A;  1P3W A;  4P3M A;  4PFF A;  3KE3 A;  1GC2 A;  4M2M A;  4A72 A;  4IXS A;  2R0T A;  3LVK A;  4M2J A;  1BJO A;  2JJF A;  3CBF A;  2E7J A;  2WK7 A;  4GSA A;  4HF8 A;  4PVF A;  1TAT A;  3PA9 A;  3F6T A;  3MC6 A;  3EI8 A;  1M4N A;  2X8U A;  3WKR A;  5M4D A;  3DRD A;  2HUF A;  1QJ3 A;  2QBT A;  7AAT A;  2VI9 A;  1WYT A;  1GDE A;  2CST A;  2EO5 A;  3CQ5 A;  4ATP A;  3W1H A;  5G2P A;  1TOE A;  1C7O A;  2DKB A;  1MDZ A;  1OXO A;  3E2Z B;  2BWP A;  1AMS A;  3FQ7 A;  1J32 A;  1QIT A;  2ZSM A;  3BCB A;  5E5I A;  4BQ0 A;  2CTZ A;  3NDN A;  2GB3 A;  4K2B A;  1AY8 A;  1AAM A;  1RVY A;  3RBL A;  5JAY A;  1KMK A;  2Z9V A;  3FZ6 A;  1LS3 A;  2ZY5 A;  4DQ6 A;  2W7J A;  2W7H A;  5BJ3 A;  2D5Y A;  4Q31 A;  3R4T A;  4ZAH A;  3DOD A;  1IJI A;  1I41 A;  3EI7 A;  4IXZ A;  4R5Z A;  4WYC A;  4ADB A;  1AKA A;  3K7Y A;  2OKJ A;  2W7G A;  1DJU A;  3HL2 A;  1B4X A;  4WXF A;  3NU7 A;  1B5P A;  1JG8 A;  5DB5 A;  4AO9 A;  4N0W A;  1V72 A;  1AHX A;  2YRI A; 
#chains in the Genus database with same CATH topology
 1KKJ A;  1W7M A;  2VMT A;  2W8T A;  1M0N A;  3A9Y A;  3DYD A;  3FSL A;  4IYO A;  1D7R A;  3GZC A;  4W91 A;  1KL1 A;  1M32 A;  3AEM A;  3E6G A;  1DGE A;  1CQ7 A;  1IX7 A;  1AAW A;  1WYT B;  1LW4 A;  4WLJ A;  4J5U A;  8AAT A;  5IWQ A;  3RQ1 A;  2VGS A;  3NNK A;  1TPL A;  1IUG A;  2AEU A;  1X28 A;  1BJO B;  3AEM C;  3USF A;  3WX9 A;  1AHE A;  1ELQ A;  5I92 A;  1M0O A;  3AEP A;  4ZWV A;  1WYU A;  4Q76 A;  4F5M A;  2E7U A;  4ZWM A;  2OKK A;  5EIG A;  1UU1 A;  1TOK A;  2HOY A;  3OP7 A;  4R5F A;  5EAV A;  4OT8 A;  2R5C B;  4ZLV A;  1CS1 A;  1WKG A;  2AY3 A;  4ISY A;  3FFH A;  3ISL A;  2ZY3 A;  3KGX A;  1QIR A;  4EMY A;  3ZZK A;  1PG8 A;  3P1T A;  4M2K A;  4F4E A;  1E5E A;  1O4S A;  3GR9 A;  3N7N A;  3QPG A;  2CAN A;  2Z61 A;  2VMY A;  1TAR A;  3LWS A;  4WB0 A;  4F5F A;  1YOO A;  1ARH A;  3PD6 B;  5J8Q A;  2KFP A;  2R2N A;  3VOM A;  4BA4 A;  1T3I A;  2YOB A;  1W7L A;  3EZ1 A;  1SZK A;  3VK2 A;  3WKS A;  4ITG A;  4RM1 A;  1CZC A;  3DR7 A;  4B98 A;  3PGY A;  3HDO A;  4ATQ A;  2OAT A;  3WGB A;  2BHX A;  1ZOB A;  2BI1 A;  2EH6 A;  1S07 A;  2VMX A;  1DJ9 A;  3FRK A;  4JF0 A;  4J8L A;  2Q7W A;  1OXP A;  4A00 A;  3G7Q A;  1ORD A;  4FFC A;  3GJU A;  3E9K A;  4N0B A;  1AMR A;  3DZZ A;  3M5U A;  4W1X A;  3N4S A;  2CB1 A;  3NYS A;  1H1C A;  2BIG A;  2WK9 A;  2ZP7 A;  3GBX A;  3VAX A;  4AZJ A;  4GDY A;  3RCH A;  1KAF A;  1SZS A;  1UKJ A;  4ITX A;  5FT8 A;  1BJW A;  2VMQ A;  4XJM A;  1SF2 A;  2FNI A;  1S06 A;  4CXR A;  2HOR A;  4HVK A;  1ARG A;  3RI6 A;  2PB0 A;  4MSO A;  1CJ0 A;  2DGM A;  3A9Z A;  5K8B A;  3COG A;  3RUY A;  1UU2 A;  4OC9 A;  2D65 A;  2G6W A;  2NMP A;  3F0H A;  4KAM A;  1J04 A;  2HZP A;  2JG2 A;  1QJ5 A;  1YJZ A;  5FT4 A;  4WD2 A;  5M49 A;  1BJ4 A;  2X5D A;  2QB3 A;  1Z7D A;  2ZJG A;  3E2Z A;  4CBS A;  1D7V A;  4UHN A;  4Q75 A;  1KMJ A;  1YJY A;  2BI3 A;  3B1E A;  3E77 A;  1ECX A;  2TPL A;  2VMZ A;  1QIS A;  1YIY A;  3PDB B;  4WB0 B;  1X29 A;  3TCM A;  3W1J A;  3WZF A;  3CAI A;  5LHA A;  3JWA A;  2W8W A;  3ASA A;  2VYC A;  2QLR A;  1BW0 A;  3MAF B;  1DTY A;  4F5I A;  5HXX A;  2FKI A;  4W5K A;  3ATH A;  1AX4 A;  4TV7 A;  3N4X A;  1W3U A;  4JEZ A;  4RJY A;  2CFB A;  4IYO B;  1ASE A;  1MLY A;  4RIZ A;  4MGR A;  1XI9 A;  1N8P A;  4F5J A;  1DGD A;  3UAK A;  1IAY A;  2C44 A;  3JU7 A;  4OCA A;  4R8D A;  2HP1 A;  3IF2 A;  4A6T A;  2W7I A;  4AOA A;  2AY8 A;  4ZDP A;  3JZL A;  1ASA A;  1LK9 A;  4BHD A;  3EIB A;  2FNU A;  3N0L A;  5G09 A;  4PFN A;  2PO3 A;  2AEV A;  5DJ1 A;  2VGV A;  2OQX A;  4JE5 A;  1AIA A;  1OAT A;  4A0F A;  3FDD A;  1GBN A;  3HBX A;  3KGW A;  3B46 A;  3BCA A;  3AOV A;  3HLM A;  1GD9 A;  1UU0 A;  3B8X A;  3K28 A;  4MY5 A;  2CJD A;  2YCP A;  1RVU A;  2W8J A;  2VMO A;  3JW9 A;  1BT4 A;  2VI8 A;  1GEW A;  2D63 A;  3BWN C;  1OHY A;  2GQN A;  2JIS A;  4K2I A;  1RV4 A;  3N4R A;  2EYQ A;  2YCT A;  3A8U X;  2Z9W A;  3HVY A;  2D7Y A;  3A9X A;  3WCO A;  1ASF A;  4U2H A;  5AX8 A;  2Z9X A;  4R2N A;  1MDO A;  3EZS A;  5FT5 A;  1I43 A;  4A0G A;  4P7Y A;  1W23 A;  2X3L A;  3GET A;  3RBF A;  3CQ6 A;  3W1I A;  1N2T A;  2VMR A;  4AH3 A;  3NU8 A;  3BWO A;  1BQD A;  2W7L A;  1SVV A;  2FYF A;  3ASB A;  4GE9 A;  3D6K A;  4CBR A;  3R9A A;  2HOX A;  1C7N A;  1ARI A;  4A0H A;  2GMS A;  4L0O A;  3TFU A;  4W8I A;  3A2B A;  1EJI A;  2F8J A;  2QMA A;  4MQQ A;  2OGA A;  3QGU A;  2ZYJ A;  1OHV A;  1DFO A;  4MKJ A;  2CH1 A;  1MAP A;  3AOW A;  3KKI A;  4GE4 A;  3ACZ A;  3FZ7 A;  3LG0 A;  3AEO A;  2DR1 A;  5DX5 A;  1TOG A;  1AMA A;  1GEY A;  2ZY4 A;  1LC5 A;  3FZ8 A;  3DU4 A;  2C0R A;  2VMW A;  4GEB A;  5E3K A;  5M46 A;  2QB2 A;  4Q6R A;  1KL2 A;  4WYD A;  2HUI A;  1ASN A;  1ART A;  2W7D A;  2AAT A;  5EFS A;  2WK8 A;  3FVS A;  2CIN A;  2EZ2 A;  3NX3 A;  4EB5 A;  5TF5 A;  4TMR A;  3WGC A;  4F5K A;  4AO4 A;  4XJL A;  3BS8 A;  1OHW A;  4LNL A;  5E4Z A;  1CL1 A;  1AHF A;  2YKX A;  1TOI A;  2ZUK A;  2YCN A;  3AEL A;  4GE7 A;  1X0M A;  4XJP A;  3MAU A;  5HHY A;  2D7Z A;  1V2E A;  3EI9 A;  4JE5 D;  4JEW A;  4OBU A;  1ASG A;  1I48 A;  3ZRP A;  1AMQ A;  3G8M A;  1W7N A;  1B9H A;  1EG5 A;  4IX8 A;  1MAQ A;  4JEY A;  3NRA A;  4ADD A;  4IW7 A;  4K05 A;  4E77 A;  1QGN A;  3AEJ C;  1G7X A;  2YKU A;  2BI2 A;  3E2Y A;  3QBO A;  4A0R A;  3UWC A;  9AAT A;  3MBB A;  3AV7 A;  3IHJ A;  1JS3 A;  2DOU A;  3ZRQ A;  3FTB A;  3I16 A;  3VK4 A;  3PD6 A;  3PIU A;  4WP0 A;  3I5T A;  3PAA A;  1IX8 A;  2AY7 A;  3N5M A;  2RFV A;  5EUE A;  2A1V A;  1AIC A;  3FDB A;  1I29 A;  4UQV A;  1VEF A;  4QGR A;  1EQB A;  2VMN A;  2R5C A;  2AY6 A;  2X5F A;  3NUB A;  4U1T A;  3II0 A;  2BYL A;  2QSR A;  4ZSW A;  3FD0 A;  4WBT A;  1AJS B;  3F9T A;  3VP6 A;  2BIE A;  4IXO A;  1LW5 A;  4FL0 A;  1B5O A;  4ZM3 A;  2JJH A;  2W7M A;  2V1P A;  4UHM A;  4BA5 A;  3T32 A;  2CJH A;  1MLZ A;  4CXQ A;  2EZ1 A;  3JWB A;  4ZM4 A;  3QM2 A;  2GMU A;  1MGV A;  1GEX A;  3PDX A;  1XEY A;  3NYT A;  2GSA A;  3DC1 A;  3PJ0 A;  2D64 A;  4RKC A;  1ELU A;  1ASD A;  4LC3 A;  1C0N A;  4LW4 A;  3ZRR A;  5G0A A;  1CZE A;  3ELE A;  3BWN A;  3Q8N A;  1D7U A;  2Z67 A;  2BI9 A;  4WYA A;  3MKJ A;  5D95 A;  1WKH A;  3QHX A;  4PIW A;  1WYV B;  1PMM A;  1CQ6 A;  2DGK A;  1LKC A;  2BYJ A;  2E7I A;  2VMP A;  2VGZ A;  3LY1 A;  1B9I A;  1X2A A;  2BIA A;  2W8U A;  4MQP A;  4RJ0 A;  3H9X A;  1FC4 A;  4H63 Q;  1S09 A;  2C81 A;  1C7G A;  2DGL A;  3GZD C;  1AY5 A;  2PB2 A;  1WYU B;  2BKW A;  4EFF A;  4K2M A;  1PFF A;  2CH2 A;  2HOZ A;  3PPL A;  2AY9 A;  4WYE A;  3WLX A;  5EQC A;  3VK3 A;  5G4J A;  3GZD A;  3UE8 A;  3ZZJ A;  4AZK A;  2VMV A;  2JGT A;  4LNM A;  3B1D A;  4WXG A;  2O1B A;  3FVU A;  1GC4 A;  1JS6 A;  3BC8 A;  4OMA A;  3AAT A;  1WST A;  1N31 A;  1LC8 A;  1YAA A;  1SFF A;  3I4J A;  1AY4 A;  1TAS A;  2G7J A;  2C7T A;  4ZDO A;  1CL2 A;  3N75 A;  4KXK A;  2BI5 A;  1GC0 A;  3P6K A;  1BS0 A;  3LV2 A;  1IBJ A;  1V2D A;  1WYV A;  2D61 A;  2VGU A;  2AY2 A;  5D5S A;  1M6S A;  2XH1 A;  3QI6 A;  4UHO A;  5EUD A;  1FG7 A;  1V2F A;  4ADC A;  3K40 A;  1D2F A;  4WLH A;  4UOY A;  3PDB A;  4OBV A;  1AHG A;  4DGT A;  4F5G A;  1BJN A;  4EU1 A;  2VIA A;  4DBC A;  1ASC A;  1LC7 A;  2CJG A;  1JF9 A;  3JTX A;  1ARS A;  5BJ4 A;  3WY7 A;  3BN1 A;  2BWN A;  4ZAS A;  2OGE A;  2Z1Y A;  5FT6 A;  4Y0H A;  2WKA A;  4XQ2 A;  1M7Y A;  1VP4 A;  2R5E A;  3H7F A;  4W1W A;  5M4B A;  2W8V A;  2BWO A;  3TQX A;  3AEN A;  1AIB A;  3BCX A;  2ZC0 A;  1C9C A;  1GC3 A;  1ASM A;  3NTJ A;  3TFT A;  2AY1 A;  1RV3 A;  1BKG A;  2YKV A;  3DXW A;  3MEB A;  3BB8 A;  3EUC A;  2YRR A;  3FQ8 A;  4WYG A;  4WXB A;  1FG3 A;  1B8G A;  1Y4I A;  4E3R A;  2VIB A;  4EB7 A;  2O7C A;  2ORD A;  2FQ6 A;  2JJE A;  4H51 A;  3CQ4 A;  3HT4 A;  2XBN A;  3QN6 A;  3RCH B;  4Y0D A;  1DJE A;  1AJS A;  1AJR A;  4Y0I A;  4A6U A;  5EIG B;  3G0T A;  5G2Q A;  3TAT A;  4E3Q A;  2FN6 A;  3LVM A;  5EUN A;  3EI6 A;  1AKB A;  4WYF A;  1E5F A;  3HMU A;  2O0R A;  3LVJ A;  1MDX A;  3FCR A;  3HQT A;  5DJ9 A;  4XEW A;  2HUU A;  3FFR A;  2AY5 A;  3FQA A;  2ZY2 A;  4ADE A;  1TOJ A;  3H14 A;  4RLG A;  2V0Y A;  4B9B A;  1BQA A;  1M0Q A;  3L44 A;  3MAD A;  4NOG A;  4TN4 A;  5LH9 A;  3NUI A;  1YJS A;  4IY7 A;  1G7W A;  4JF1 A;  1SPA A;  1M0P A;  4ZSY A;  1C4K A;  2E54 A;  4W1V A;  2EGY A;  2JJG A;  2ZSL A;  4A6R A;  1H0C A;  4XJO A;  3WCN A;  4RIT A;  4ZDL A;  2Z1Z A;  2CY8 A;  1S08 A;  2W7F A;  2YHK A;  1S0A A;  1O61 A;  5KTB A;  4I8A A;  3EIA A;  1SZU A;  3DR4 A;  1VJO A;  2VLF A;  1IX6 A;  3GSB A;  4RAE A;  1G4V A;  4OYT A;  4F5H A;  1CQ8 A;  4F5L A;  5HDM A;  3ECD A;  2QA3 A;  4MQR A;  4E1O A;  2VMS A;  5C6U A;  5F8V A;  4XK1 A;  4LNJ A;  2EPJ A;  1ASL A;  1KKP A;  4LW2 A;  5F9S A;  1IAX A;  4JEX A;  1D7S A;  3LVL B;  3E2F A;  1O62 A;  3FVX A;  3MAF A;  4MKK A;  4O6Z A;  4RKD A;  2VMU A;  3B1C A;  3GWP A;  4JEV A;  1O69 A;  5G4I A;  4GRX A;  3FKD A;  3EI5 A;  3MC6 C;  5EAA A;  1GCK A;  1ZOD A;  2YKY A;  3AEN B;  3NYU A;  1G4X A;  2VGT A;  3ELP A;  4BMK A;  3DXV A;  2Z20 A;  4OTL A;  2AY4 A;  1YNU A;  2DKJ A;  1QZ9 A;  1AHY A;  4XAU A;  1DKA A;  2D66 A;  1U08 A;  2Z9U A;  2FM1 A;  2VGW A;  3L8A A;  4CVQ A;  2W7E A;  2VLH A;  1ZC9 A;  1YIZ A;  1IVR A;  1Z3Z A;  3OKS A;  1AKC A;  2W7K A;  3BV0 A;  3AEJ A;  1ASB A;  1PMO A;  4KYO A;  2HP2 A;  1P3W A;  4P3M A;  4PFF A;  3KE3 A;  1GC2 A;  4M2M A;  4A72 A;  4IXS A;  2R0T A;  3LVK A;  4M2J A;  1BJO A;  2JJF A;  3CBF A;  2E7J A;  2WK7 A;  4GSA A;  4HF8 A;  4PVF A;  1TAT A;  3PA9 A;  3F6T A;  3MC6 A;  3EI8 A;  1M4N A;  2X8U A;  3WKR A;  5M4D A;  3DRD A;  2HUF A;  1QJ3 A;  2QBT A;  7AAT A;  2VI9 A;  1WYT A;  1GDE A;  2CST A;  2EO5 A;  3CQ5 A;  4ATP A;  3W1H A;  5G2P A;  1TOE A;  1C7O A;  2DKB A;  1MDZ A;  1OXO A;  3E2Z B;  2BWP A;  1AMS A;  3FQ7 A;  1J32 A;  1QIT A;  2ZSM A;  3BCB A;  5E5I A;  4BQ0 A;  2CTZ A;  3NDN A;  2GB3 A;  4K2B A;  1AY8 A;  1AAM A;  1RVY A;  3RBL A;  5JAY A;  1KMK A;  2Z9V A;  3FZ6 A;  1LS3 A;  2ZY5 A;  4DQ6 A;  2W7J A;  2W7H A;  5BJ3 A;  2D5Y A;  4Q31 A;  3R4T A;  4ZAH A;  3DOD A;  1IJI A;  1I41 A;  3EI7 A;  4IXZ A;  4R5Z A;  4WYC A;  4ADB A;  1AKA A;  3K7Y A;  2OKJ A;  2W7G A;  1DJU A;  3HL2 A;  1B4X A;  4WXF A;  3NU7 A;  1B5P A;  1JG8 A;  5DB5 A;  4AO9 A;  4N0W A;  1V72 A;  1AHX A;  2WB6 A;  2YRI A; 
#chains in the Genus database with same CATH homology
 1KKJ A;  1W7M A;  2VMT A;  2W8T A;  1M0N A;  3A9Y A;  3DYD A;  3FSL A;  4IYO A;  1D7R A;  3GZC A;  4W91 A;  1KL1 A;  1M32 A;  3AEM A;  3E6G A;  1DGE A;  1CQ7 A;  1IX7 A;  1AAW A;  1WYT B;  1LW4 A;  4WLJ A;  4J5U A;  8AAT A;  5IWQ A;  3RQ1 A;  2VGS A;  3NNK A;  1TPL A;  1IUG A;  2AEU A;  1X28 A;  1BJO B;  3AEM C;  3USF A;  3WX9 A;  1AHE A;  1ELQ A;  5I92 A;  1M0O A;  3AEP A;  4ZWV A;  1WYU A;  4Q76 A;  4F5M A;  2E7U A;  4ZWM A;  2OKK A;  5EIG A;  1UU1 A;  1TOK A;  2HOY A;  3OP7 A;  4R5F A;  5EAV A;  4OT8 A;  2R5C B;  4ZLV A;  1CS1 A;  1WKG A;  2AY3 A;  4ISY A;  3FFH A;  3ISL A;  2ZY3 A;  3KGX A;  1QIR A;  4EMY A;  3ZZK A;  1PG8 A;  3P1T A;  4M2K A;  4F4E A;  1E5E A;  1O4S A;  3GR9 A;  3N7N A;  3QPG A;  2CAN A;  2Z61 A;  2VMY A;  1TAR A;  3LWS A;  4WB0 A;  4F5F A;  1YOO A;  1ARH A;  3PD6 B;  5J8Q A;  2KFP A;  2R2N A;  3VOM A;  4BA4 A;  1T3I A;  2YOB A;  1W7L A;  3EZ1 A;  1SZK A;  3VK2 A;  3WKS A;  4ITG A;  4RM1 A;  1CZC A;  3DR7 A;  4B98 A;  3PGY A;  3HDO A;  4ATQ A;  2OAT A;  3WGB A;  2BHX A;  1ZOB A;  2BI1 A;  2EH6 A;  1S07 A;  2VMX A;  1DJ9 A;  3FRK A;  4JF0 A;  4J8L A;  2Q7W A;  1OXP A;  4A00 A;  3G7Q A;  1ORD A;  4FFC A;  3GJU A;  3E9K A;  4N0B A;  1AMR A;  3DZZ A;  3M5U A;  4W1X A;  3N4S A;  2CB1 A;  3NYS A;  1H1C A;  2BIG A;  2WK9 A;  2ZP7 A;  3GBX A;  3VAX A;  4AZJ A;  4GDY A;  3RCH A;  1SZS A;  1UKJ A;  4ITX A;  5FT8 A;  1BJW A;  2VMQ A;  4XJM A;  1SF2 A;  2FNI A;  1S06 A;  4CXR A;  2HOR A;  4HVK A;  1ARG A;  3RI6 A;  2PB0 A;  4MSO A;  1CJ0 A;  2DGM A;  3A9Z A;  5K8B A;  3COG A;  3RUY A;  1UU2 A;  4OC9 A;  2D65 A;  2G6W A;  2NMP A;  3F0H A;  4KAM A;  1J04 A;  2HZP A;  2JG2 A;  1QJ5 A;  1YJZ A;  5FT4 A;  4WD2 A;  5M49 A;  1BJ4 A;  2X5D A;  2QB3 A;  1Z7D A;  2ZJG A;  3E2Z A;  4CBS A;  1D7V A;  4UHN A;  4Q75 A;  1KMJ A;  1YJY A;  2BI3 A;  3B1E A;  3E77 A;  1ECX A;  2TPL A;  2VMZ A;  1QIS A;  1YIY A;  3PDB B;  4WB0 B;  1X29 A;  3TCM A;  3W1J A;  3WZF A;  3CAI A;  5LHA A;  3JWA A;  2W8W A;  3ASA A;  2VYC A;  2QLR A;  1BW0 A;  3MAF B;  1DTY A;  4F5I A;  5HXX A;  2FKI A;  4W5K A;  3ATH A;  1AX4 A;  4TV7 A;  3N4X A;  1W3U A;  4JEZ A;  4RJY A;  2CFB A;  4IYO B;  1ASE A;  1MLY A;  4RIZ A;  4MGR A;  1XI9 A;  1N8P A;  4F5J A;  1DGD A;  3UAK A;  1IAY A;  2C44 A;  3JU7 A;  4OCA A;  4R8D A;  2HP1 A;  3IF2 A;  4A6T A;  2W7I A;  4AOA A;  2AY8 A;  4ZDP A;  3JZL A;  1ASA A;  1LK9 A;  4BHD A;  3EIB A;  2FNU A;  3N0L A;  5G09 A;  4PFN A;  2PO3 A;  2AEV A;  5DJ1 A;  2VGV A;  2OQX A;  4JE5 A;  1AIA A;  1OAT A;  4A0F A;  3FDD A;  1GBN A;  3HBX A;  3KGW A;  3B46 A;  3BCA A;  3AOV A;  3HLM A;  1GD9 A;  1UU0 A;  3B8X A;  3K28 A;  4MY5 A;  2CJD A;  2YCP A;  1RVU A;  2W8J A;  2VMO A;  3JW9 A;  1BT4 A;  2VI8 A;  1GEW A;  2D63 A;  3BWN C;  1OHY A;  2GQN A;  2JIS A;  4K2I A;  1RV4 A;  3N4R A;  2EYQ A;  2YCT A;  3A8U X;  2Z9W A;  3HVY A;  2D7Y A;  3A9X A;  3WCO A;  1ASF A;  4U2H A;  5AX8 A;  2Z9X A;  4R2N A;  1MDO A;  3EZS A;  5FT5 A;  1I43 A;  4A0G A;  4P7Y A;  1W23 A;  2X3L A;  3GET A;  3RBF A;  3CQ6 A;  3W1I A;  1N2T A;  2VMR A;  4AH3 A;  3NU8 A;  3BWO A;  1BQD A;  2W7L A;  1SVV A;  2FYF A;  3ASB A;  4GE9 A;  3D6K A;  4CBR A;  3R9A A;  2HOX A;  1C7N A;  1ARI A;  4A0H A;  2GMS A;  4L0O A;  3TFU A;  4W8I A;  3A2B A;  1EJI A;  2F8J A;  2QMA A;  4MQQ A;  2OGA A;  3QGU A;  2ZYJ A;  1OHV A;  1DFO A;  4MKJ A;  2CH1 A;  1MAP A;  3AOW A;  3KKI A;  4GE4 A;  3ACZ A;  3FZ7 A;  3LG0 A;  3AEO A;  2DR1 A;  5DX5 A;  1TOG A;  1AMA A;  1GEY A;  2ZY4 A;  1LC5 A;  3FZ8 A;  3DU4 A;  2C0R A;  2VMW A;  4GEB A;  5E3K A;  5M46 A;  2QB2 A;  4Q6R A;  1KL2 A;  4WYD A;  2HUI A;  1ASN A;  1ART A;  2W7D A;  2AAT A;  5EFS A;  2WK8 A;  3FVS A;  2CIN A;  2EZ2 A;  3NX3 A;  4EB5 A;  5TF5 A;  4TMR A;  3WGC A;  4F5K A;  4AO4 A;  4XJL A;  3BS8 A;  1OHW A;  4LNL A;  5E4Z A;  1CL1 A;  1AHF A;  2YKX A;  1TOI A;  2ZUK A;  2YCN A;  3AEL A;  4GE7 A;  1X0M A;  4XJP A;  3MAU A;  5HHY A;  2D7Z A;  1V2E A;  3EI9 A;  4JE5 D;  4JEW A;  4OBU A;  1ASG A;  1I48 A;  3ZRP A;  1AMQ A;  3G8M A;  1W7N A;  1B9H A;  1EG5 A;  4IX8 A;  1MAQ A;  4JEY A;  3NRA A;  4ADD A;  4IW7 A;  4K05 A;  4E77 A;  1QGN A;  3AEJ C;  1G7X A;  2YKU A;  2BI2 A;  3E2Y A;  3QBO A;  4A0R A;  3UWC A;  9AAT A;  3MBB A;  3AV7 A;  3IHJ A;  1JS3 A;  2DOU A;  3ZRQ A;  3FTB A;  3I16 A;  3VK4 A;  3PD6 A;  3PIU A;  4WP0 A;  3I5T A;  3PAA A;  1IX8 A;  2AY7 A;  3N5M A;  2RFV A;  5EUE A;  2A1V A;  1AIC A;  3FDB A;  1I29 A;  4UQV A;  1VEF A;  4QGR A;  1EQB A;  2VMN A;  2R5C A;  2AY6 A;  2X5F A;  3NUB A;  4U1T A;  3II0 A;  2BYL A;  2QSR A;  4ZSW A;  3FD0 A;  4WBT A;  1AJS B;  3F9T A;  3VP6 A;  2BIE A;  4IXO A;  1LW5 A;  4FL0 A;  1B5O A;  4ZM3 A;  2JJH A;  2W7M A;  2V1P A;  4UHM A;  4BA5 A;  3T32 A;  2CJH A;  1MLZ A;  4CXQ A;  2EZ1 A;  3JWB A;  4ZM4 A;  3QM2 A;  2GMU A;  1MGV A;  1GEX A;  3PDX A;  1XEY A;  3NYT A;  2GSA A;  3DC1 A;  3PJ0 A;  2D64 A;  4RKC A;  1ELU A;  1ASD A;  4LC3 A;  1C0N A;  4LW4 A;  3ZRR A;  5G0A A;  1CZE A;  3ELE A;  3BWN A;  3Q8N A;  1D7U A;  2Z67 A;  2BI9 A;  4WYA A;  3MKJ A;  5D95 A;  1WKH A;  3QHX A;  4PIW A;  1WYV B;  1PMM A;  1CQ6 A;  2DGK A;  1LKC A;  2BYJ A;  2E7I A;  2VMP A;  2VGZ A;  3LY1 A;  1B9I A;  1X2A A;  2BIA A;  2W8U A;  4MQP A;  4RJ0 A;  3H9X A;  1FC4 A;  4H63 Q;  1S09 A;  2C81 A;  1C7G A;  2DGL A;  3GZD C;  1AY5 A;  2PB2 A;  1WYU B;  2BKW A;  4EFF A;  4K2M A;  1PFF A;  2CH2 A;  2HOZ A;  3PPL A;  2AY9 A;  4WYE A;  3WLX A;  5EQC A;  3VK3 A;  5G4J A;  3GZD A;  3UE8 A;  3ZZJ A;  4AZK A;  2VMV A;  2JGT A;  4LNM A;  3B1D A;  4WXG A;  2O1B A;  3FVU A;  1GC4 A;  1JS6 A;  3BC8 A;  4OMA A;  3AAT A;  1WST A;  1N31 A;  1LC8 A;  1YAA A;  1SFF A;  3I4J A;  1AY4 A;  1TAS A;  2G7J A;  2C7T A;  4ZDO A;  1CL2 A;  3N75 A;  4KXK A;  2BI5 A;  1GC0 A;  3P6K A;  1BS0 A;  3LV2 A;  1IBJ A;  1V2D A;  1WYV A;  2D61 A;  2VGU A;  2AY2 A;  5D5S A;  1M6S A;  2XH1 A;  3QI6 A;  4UHO A;  5EUD A;  1FG7 A;  1V2F A;  4ADC A;  3K40 A;  1D2F A;  4WLH A;  4UOY A;  3PDB A;  4OBV A;  1AHG A;  4DGT A;  4F5G A;  1BJN A;  4EU1 A;  2VIA A;  4DBC A;  1ASC A;  1LC7 A;  2CJG A;  1JF9 A;  3JTX A;  1ARS A;  5BJ4 A;  3WY7 A;  3BN1 A;  2BWN A;  4ZAS A;  2OGE A;  2Z1Y A;  5FT6 A;  4Y0H A;  2WKA A;  4XQ2 A;  1M7Y A;  1VP4 A;  2R5E A;  3H7F A;  4W1W A;  5M4B A;  2W8V A;  2BWO A;  3TQX A;  3AEN A;  1AIB A;  3BCX A;  2ZC0 A;  1C9C A;  1GC3 A;  1ASM A;  3NTJ A;  3TFT A;  2AY1 A;  1RV3 A;  1BKG A;  2YKV A;  3DXW A;  3MEB A;  3BB8 A;  3EUC A;  2YRR A;  3FQ8 A;  4WYG A;  4WXB A;  1FG3 A;  1B8G A;  1Y4I A;  4E3R A;  2VIB A;  4EB7 A;  2O7C A;  2ORD A;  2FQ6 A;  2JJE A;  4H51 A;  3CQ4 A;  3HT4 A;  2XBN A;  3QN6 A;  3RCH B;  4Y0D A;  1DJE A;  1AJS A;  1AJR A;  4Y0I A;  4A6U A;  5EIG B;  3G0T A;  5G2Q A;  3TAT A;  4E3Q A;  2FN6 A;  3LVM A;  5EUN A;  3EI6 A;  1AKB A;  4WYF A;  1E5F A;  3HMU A;  2O0R A;  3LVJ A;  1MDX A;  3FCR A;  3HQT A;  5DJ9 A;  4XEW A;  2HUU A;  3FFR A;  2AY5 A;  3FQA A;  2ZY2 A;  4ADE A;  1TOJ A;  3H14 A;  4RLG A;  2V0Y A;  4B9B A;  1BQA A;  1M0Q A;  3L44 A;  3MAD A;  4NOG A;  4TN4 A;  5LH9 A;  3NUI A;  1YJS A;  4IY7 A;  1G7W A;  4JF1 A;  1SPA A;  1M0P A;  4ZSY A;  1C4K A;  2E54 A;  4W1V A;  2EGY A;  2JJG A;  2ZSL A;  4A6R A;  1H0C A;  4XJO A;  3WCN A;  4RIT A;  4ZDL A;  2Z1Z A;  2CY8 A;  1S08 A;  2W7F A;  2YHK A;  1S0A A;  1O61 A;  5KTB A;  4I8A A;  3EIA A;  1SZU A;  3DR4 A;  1VJO A;  2VLF A;  1IX6 A;  3GSB A;  4RAE A;  1G4V A;  4OYT A;  4F5H A;  1CQ8 A;  4F5L A;  5HDM A;  3ECD A;  2QA3 A;  4MQR A;  4E1O A;  2VMS A;  5C6U A;  5F8V A;  4XK1 A;  4LNJ A;  2EPJ A;  1ASL A;  1KKP A;  4LW2 A;  5F9S A;  1IAX A;  4JEX A;  1D7S A;  3LVL B;  3E2F A;  1O62 A;  3FVX A;  3MAF A;  4MKK A;  4O6Z A;  4RKD A;  2VMU A;  3B1C A;  3GWP A;  4JEV A;  1O69 A;  5G4I A;  4GRX A;  3FKD A;  3EI5 A;  3MC6 C;  5EAA A;  1GCK A;  1ZOD A;  2YKY A;  3AEN B;  3NYU A;  1G4X A;  2VGT A;  3ELP A;  4BMK A;  3DXV A;  2Z20 A;  4OTL A;  2AY4 A;  1YNU A;  2DKJ A;  1QZ9 A;  1AHY A;  4XAU A;  1DKA A;  2D66 A;  1U08 A;  2Z9U A;  2FM1 A;  2VGW A;  3L8A A;  4CVQ A;  2W7E A;  2VLH A;  1ZC9 A;  1YIZ A;  1IVR A;  1Z3Z A;  3OKS A;  1AKC A;  2W7K A;  3BV0 A;  3AEJ A;  1ASB A;  1PMO A;  4KYO A;  2HP2 A;  1P3W A;  4P3M A;  4PFF A;  3KE3 A;  1GC2 A;  4M2M A;  4A72 A;  4IXS A;  2R0T A;  3LVK A;  4M2J A;  1BJO A;  2JJF A;  3CBF A;  2E7J A;  2WK7 A;  4GSA A;  4HF8 A;  4PVF A;  1TAT A;  3PA9 A;  3F6T A;  3MC6 A;  3EI8 A;  1M4N A;  2X8U A;  3WKR A;  5M4D A;  3DRD A;  2HUF A;  1QJ3 A;  2QBT A;  7AAT A;  2VI9 A;  1WYT A;  1GDE A;  2CST A;  2EO5 A;  3CQ5 A;  4ATP A;  3W1H A;  5G2P A;  1TOE A;  1C7O A;  2DKB A;  1MDZ A;  1OXO A;  3E2Z B;  2BWP A;  1AMS A;  3FQ7 A;  1J32 A;  1QIT A;  2ZSM A;  3BCB A;  5E5I A;  4BQ0 A;  2CTZ A;  3NDN A;  2GB3 A;  4K2B A;  1AY8 A;  1AAM A;  1RVY A;  3RBL A;  5JAY A;  1KMK A;  2Z9V A;  3FZ6 A;  1LS3 A;  2ZY5 A;  4DQ6 A;  2W7J A;  2W7H A;  5BJ3 A;  2D5Y A;  4Q31 A;  3R4T A;  4ZAH A;  3DOD A;  1IJI A;  1I41 A;  3EI7 A;  4IXZ A;  4R5Z A;  4WYC A;  4ADB A;  1AKA A;  3K7Y A;  2OKJ A;  2W7G A;  1DJU A;  3HL2 A;  1B4X A;  4WXF A;  3NU7 A;  1B5P A;  1JG8 A;  5DB5 A;  4AO9 A;  4N0W A;  1V72 A;  1AHX A;  2WB6 A;  2YRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...