1CQ8A

Aspartate aminotransferase (e.c. 2.6.1.1) complexed with c6-pyridoxal-5p-phosphate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE (2.6.1.1)
publication title Free energy requirement for domain movement of an enzyme
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 132
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1999-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1cq8A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1cq8A01
5FT8A 1N31A 3FD0A 4ZDLA 3ELPA 4MKKA 3GETA 4FL0A 2BIEA 1YIYA 5C6UA 1MDOA 4N0WA 1YJSA 2BIGA 3EI8A 3Q8NA 3AEMC 5DX5A 1S08A 3FQAA 1X29A 4OC9A 5AX8A 4RKCA 2CFBA 1ARSA 2DKJA 1H1CA 1G4XA 4ZAHA 1U08A 1TPLA 1WKHA 2EH6A 2WK8A 3NYSA 2QB3A 4MY5A 3ISLA 1AY8A 2FNIA 4W91A 4XEWA 3RCHB 2VMRA 3QGUA 3RQ1A 5K8BA 4A0RA 4JE5A 1ORDA 3I4JA 4ZM4A 2BYJA 3GWPA 3PA9A 2Z67A 3A9YA 1YAAA 3A2BA 4NOGA 3TCMA 3AENB 4DQ6A 1YOOA 2YRRA 3EI5A 3E2ZA 4WBTA 1AHEA 1OXOA 4JEVA 3F6TA 2ZYJA 3I16A 3P6KA 4F5KA 3QHXA 1IX6A 1WYUA 2W8VA 2HP1A 3BV0A 4JE5D 4E77A 1O61A 1ASDA 4F5LA 2ZJGA 5LH9A 3QM2A 1Z7DA 2E7UA 2AEVA 2VLHA 3EIBA 3ELEA 3OKSA 4PIWA 3PDXA 3DODA 4A0FA 1D7RA 2BI2A 2YOBA 5EAVA 2ZY3A 4F5MA 3JWAA 3G7QA 2JJHA 3M5UA 1DJ9A 2EGYA 4CVQA 1QIRA 1SF2A 3B1CA 2CJGA 4WLJA 1LW4A 2O7CA 2XBNA 4Q6RA 1SPAA 2CJHA 5F8VA 4LNMA 1BW0A 2CJDA 2VI9A 2HUFA 3N75A 4RIZA 4AH3A 2C0RA 1M4NA 2HUUA 3B1DA 3UWCA 3EI6A 4DGTA 2DGKA 2EZ1A 1ASCA 2PB0A 4TV7A 3CQ5A 2BI5A 2V1PA 3NNKA 3KGXA 5M4BA 1ARHA 4OCAA 3N5MA 1ELQA 4RM1A 5G2PA 3E2YA 3P1TA 2FYFA 2YCPA 2ZP7A 8AATA 4WP0A 1PMMA 4ZLVA 4PFFA 2AY7A 2HUIA 1O4SA 2Z9XA 1LW5A 3B8XA 1QJ3A 3NYUA 1MAPA 1LS3A 4IYOA 4PFNA 4MQPA 2CH2A 4R2NA 1M0QA 3UE8A 4J8LA 1UU0A 2D61A 2GMSA 1ECXA 3PDBB 1V2EA 3ASBA 1LC8A 4MQRA 4W1VA 4ATPA 1LK9A 2DKBA 2R0TA 1J32A 2YRIA 1QITA 3W1IA 4I8AA 4N0BA 2GB3A 4P3MA 2GSAA 3VOMA 2HOZA 1B9HA 1C4KA 2OKJA 4E1OA 1BJWA 2W8JA 3GR9A 3MAFA 1H0CA 3L44A 1G7XA 2YKUA 3AEMA 3G0TA 2YKXA 1IAYA 2D63A 2YKYA 2C81A 3BCXA 3RBFA 3FZ6A 1BQDA 2VGSA 1GDEA 3NUBA 3AOVA 3R9AA 1C0NA 4W1XA 1AICA 1ASEA 4RKDA 5BJ3A 3FCRA 4GE7A 2YCNA 3HBXA 5M49A 2F8JA 3WCOA 1C7GA 2FQ6A 4UHNA 3RCHA 3GZDC 3DU4A 1UU1A 4IXZA 1B4XA 2YCTA 2DGLA 5J8QA 1D7SA 4LNJA 4F5IA 5FT4A 3VK3A 2WK9A 1B8GA 4ADEA 2W7FA 4JEWA 1OHWA 1X28A 1MDXA 2NMPA 1ELUA 3KGWA 4CBSA 4ZWVA 5FT5A 3LG0A 2AY4A 4EB5A 2W7DA 2ZC0A 1D2FA 1QZ9A 3AATA 4OYTA 1ASBA 1M32A 3FDDA 1RVUA 1YJZA 4M2KA 4ZDOA 5IWQA 2AY9A 2HOYA 2VMPA 3VK2A 1BJOA 1JF9A 2ZSLA 4RITA 1ASGA 3MC6C 1ASNA 4XK1A 4QGRA 5BJ4A 1JS3A 1GCKA 4TN4A 5TF5A 1AY4A 3NU8A 1FG3A 2O0RA 2OGAA 3JTXA 1MLZA 4DBCA 3BCAA 1AMRA 4BQ0A 2HOXA 1IVRA 1QGNA 1W3UA 2VMTA 3FZ7A 1DGDA 1OATA 2O1BA 4JF0A 1LC5A 1D7VA 4ZASA 4B98A 2BWNA 3AV7A 4R8DA 2AY6A 2Z9UA 4A00A 1W23A 4JF1A 2VLFA 1PG8A 4IXOA 2OATA 2VI8A 2W8UA 5EIGB 3NDNA 2EZ2A 3LY1A 1V2DA 1N8PA 1WYVA 3D6KA 3EI7A 3FZ8A 1IJIA 2CTZA 3FQ8A 1RV3A 3AEJC 2W7JA 5F9SA 1TASA 1WYTA 3BB8A 2R5CA 1KL2A 4RJYA 3T32A 1AX4A 2AY3A 2D65A 3F9TA 1PFFA 3OP7A 5HDMA 4PVFA 5G4JA 1DFOA 4A6RA 3LWSA 2G6WA 1AIAA 2DR1A 3PGYA 3DR7A 1G7WA 1TATA 3JZLA 5G09A 1S0AA 5G4IA 1MLYA 3K28A 3E77A 3WGBA 1G4VA 4XJOA 4OBUA 1CZCA 1M0PA 7AATA 1CL1A 1AHXA 1SZSA 1SZUA 1UKJA 3K40A 3CQ4A 3FVXA 4CXQA 4FFCA 1AJSB 1BQAA 1BT4A 1AAWA 1SFFA 2E7JA 1AHFA 1DKAA 1C9CA 3DZZA 4A0HA 3GZDA 4WYAA 2EPJA 4AO9A 1S07A 2AEUA 1ZOBA 3GSBA 2W7IA 9AATA 2W7KA 3DR4A 3VAXA 3PD6A 3NTJA 4F5FA 1I29A 2WKAA 3MAUA 2YHKA 4WXGA 2JISA 4GSAA 4RLGA 4W5KA 3HQTA 5DJ9A 4W1WA 4H51A 2CANA 3EZ1A 1YIZA 1WKGA 2AATA 3NYTA 2VMOA 2ZY2A 1ARTA 2W8TA 1DTYA 4O6ZA 3FFRA 1MDZA 2JJFA 4ITXA 4XAUA 1TOKA 3FSLA 2OQXA 3PPLA 1CZEA 1EJIA 1KMKA 3KE3A 3MKJA 1I43A 2WK7A 3MC6A 4UHMA 4EFFA 1YJYA 1IUGA 4A6UA 2BWOA 2OKKA 2R2NA 4GRXA 4LW2A 1CQ7A 4IW7A 1IBJA 1QISA 4OMAA 1ASAA 1AY5A 3IF2A 1TOEA 2BHXA 3CQ6A 3FTBA 3NU7A 2D64A 1BS0A 1AMAA 1CS1A 1GEXA 1KKPA 2GMUA 2VIAA 3E2ZB 3ECDA 3IHJA 4IX8A 4UOYA 1XEYA 1ASLA 2VYCA 1I48A 3NX3A 5M46A 2Z9WA 2VGVA 3A9ZA 4ZSYA 1IX7A 2R5EA 2VMYA 1CQ6A 4WD2A 3JU7A 1AKAA 3K7YA 3ZRQA 2VIBA 4F5HA 4AOAA 3CBFA 4WYCA 3I5TA 5E5IA 2ZY5A 2FN6A 1M7YA 3DYDA 2CSTA 1PMOA 2D7ZA 2W8WA 3B46A 1RV4A 5EIGA 3LVJA 4E3QA 1AKBA 1SVVA 2XH1A 4GDYA 2E54A 5EQCA 1ZC9A 3G8MA 3WKSA 4BA5A 2YKVA 1VP4A 3AENA 2W7MA 3HMUA 3AEJA 4K2IA 1AJRA 2QBTA 3HDOA 2QB2A 3JW9A 4HF8A 2AY2A 1TOJA 1B5PA 3DC1A 3LVLB 4MKJA 4MQQA 3N0LA 4IY7A 1LKCA 3WZFA 3HVYA 3LV2A 1DGEA 4GE9A 5HHYA 2ZUKA 4OT8A 4R5ZA 1W7LA 2Z20A 3UAKA 1AIBA 3TQXA 1ASFA 4OTLA 3ACZA 3QN6A 3L8AA 1B5OA 4WYDA 1GC0A 2C44A 1ASMA 2FNUA 3WLXA 3TFUA 2X8UA 4ZWMA 3FRKA 3EIAA 4AZJA 3E2FA 3JWBA 2AY1A 2EO5A 3FDBA 4P7YA 2VMZA 3ZZJA 3BWOA 4KAMA 3E6GA 4Y0HA 1AHGA 3CAIA 4ISYA 5D95A 4WXFA 1X2AA 4IYOB 4UHOA 4R5FA 1DJUA 4A72A 3AOWA 4Q75A 5LHAA 1AMSA 1DJEA 1LC7A 2X3LA 3W1HA 3ASAA 1M0NA 5EAAA 4XQ2A 1GBNA 3A8UX 4LC3A 4WYFA 4A6TA 4ADCA 4CXRA 3MEBA 2VGUA 1GC2A 4Y0IA 4JEYA 5E4ZA 1TOIA 2Z1YA 2C7TA 1KL1A 3QI6A 3MAFB 1GEWA 1CQ8A 3BS8A 3AEPA 3ZRPA 1E5FA 1GD9A 3QBOA 2ZY4A 3LVMA 3EUCA 4B9BA 1TOGA 1C7NA 2HORA 1I41A 2Z9VA 3R4TA 1WSTA 5DJ1A 3FFHA 1OXPA 4XJMA 4BA4A 2D5YA 3PDBA 4CBRA 2HP2A 1Z3ZA 2W7EA 4KYOA 4WB0B 1M0OA 1B9IA 2VMNA 2BI3A 3MADA 2D66A 3WCNA 3FQ7A 3NRAA 2VMSA 1W7NA 2X5DA 3BWNC 1T3IA 2JG2A 5DB5A 2DOUA 3NUIA 2X5FA 4WYEA 1D7UA 1S09A 1M6SA 1EQBA 2TPLA 1SZKA 1TARA 3F0HA 1ARIA 4U2HA 4Q76A 2QA3A 2VGWA 2W7GA 1V2FA 2BI9A 4M2MA 2VMQA 4J5UA 2RFVA 4AO4A 3TATA 4L0OA 1FG7A 3FVSA 4GE4A 4A0GA 4WYGA 1BJOB 3FVUA 1YNUA 4F5JA 1S06A 2D7YA 3WGCA 3W1JA 2JJEA 4EU1A 1C7OA 1OHYA 3WY7A 2Z61A 1BJ4A 3BN1A 1KMJA 3ATHA 1ARGA 2BWPA 3B1EA 4KXKA 1O69A 3AELA 5G2QA 4ITGA 5EUNA 4RAEA 4ATQA 3HL2A 1GC4A 3COGA 2CB1A 1AHYA 1OHVA 4WLHA 2JGTA 2QLRA 4ZSWA 3KKIA 4BMKA 3RUYA 5EUDA 1CJ0A 4F5GA 2VMVA 2W7LA 4F4EA 1QJ5A 2VGTA 4LW4A 3ZZKA 1BKGA 3AEOA 1IAXA 2BIAA 3DXVA 2CY8A 4K2BA 2ORDA 2V0YA 2W7HA 4BHDA 3A9XA 4HVKA 5M4DA 3MBBA 3PIUA 1WYVB 1E5EA 4JEXA 3H7FA 3USFA 2VMWA 1FC4A 1WYTB 2R5CB 1JS6A 3H14A 3DRDA 3BCBA 1AAMA 1WYUB 4M2JA 5EFSA 3LVKA 2FM1A 4W8IA 4RJ0A 5G0AA 4ADDA 1V72A 2PO3A 4ZDPA 3GBXA 1AMQA 3GJUA 4IXSA 3ZRRA 2CH1A 3TFTA 4MSOA 1Y4IA 3BC8A 3DXWA 3EI9A 4EMYA 1CL2A 1P3WA 2GQNA 3HLMA 3PAAA 2OGEA 1UU2A 2ZSMA 4E3RA 2Q7WA 2HZPA 3RI6A 4ADBA 1GC3A 4K2MA 3GZCA 1KKJA 4JEZA 3PJ0A 3HT4A 1GEYA 3WX9A 1ZODA 2AY8A 2VMXA 1W7MA 4Y0DA 1N2TA 3E9KA 4WXBA 4XJLA 3FKDA 4Q31A 2JJGA 4WB0A 2BYLA 2DGMA 4AZKA 5D5SA 3VK4A 3BWNA 1RVYA 5I92A 1X0MA 1IX8A 2E7IA 1EG5A 2BI1A 3PD6B 4MGRA 1VJOA 5FT6A 3WKRA 2AY5A 2VMUA 3QPGA 3EZSA 2CINA 2VGZA 4GEBA 3VP6A 2QMAA 3RBLA 2PB2A 1O62A 3II0A 1VEFA 2BKWA 1J04A 1AKCA 4UQVA 4XJPA 5E3KA 1AJSA 4EB7A 1JG8A 4ZM3A 1XI9A 4TMRA 2Z1ZA 5EUEA 4U1TA 5HXXA 1MAQA 1MGVA 4LNLA 5JAYA 1BJNA 4OBVA
chains in the Genus database with same CATH superfamily
4H63Q 5FT8A 1N31A 3FD0A 4ZDLA 3ELPA 4MKKA 3GETA 4FL0A 2BIEA 1YIYA 5C6UA 1MDOA 4N0WA 1YJSA 2BIGA 3EI8A 3Q8NA 3AEMC 5DX5A 1S08A 3FQAA 1X29A 4OC9A 5AX8A 4RKCA 2CFBA 1ARSA 2DKJA 1H1CA 1G4XA 4ZAHA 1U08A 1TPLA 1WKHA 2EH6A 2WK8A 3NYSA 2QB3A 4MY5A 3ISLA 1AY8A 2FNIA 4W91A 4XEWA 3RCHB 2VMRA 3QGUA 3RQ1A 5K8BA 4A0RA 4JE5A 1ORDA 3I4JA 4ZM4A 2BYJA 3GWPA 3PA9A 2Z67A 3A9YA 1YAAA 3A2BA 4NOGA 3TCMA 3AENB 4DQ6A 1YOOA 2YRRA 3EI5A 3E2ZA 4WBTA 1AHEA 1OXOA 4JEVA 3F6TA 2ZYJA 3I16A 3P6KA 4F5KA 3QHXA 1IX6A 1WYUA 2W8VA 2HP1A 3BV0A 4JE5D 4E77A 1O61A 1ASDA 4F5LA 2ZJGA 5LH9A 3QM2A 1Z7DA 2E7UA 2AEVA 2VLHA 3EIBA 3ELEA 3OKSA 4PIWA 3PDXA 3DODA 4A0FA 1D7RA 2BI2A 2YOBA 5EAVA 2ZY3A 4F5MA 3JWAA 3G7QA 2JJHA 3M5UA 1DJ9A 2EGYA 4CVQA 1QIRA 1SF2A 3B1CA 2CJGA 4WLJA 1LW4A 2O7CA 2XBNA 4Q6RA 1SPAA 2CJHA 5F8VA 4LNMA 1BW0A 2CJDA 2VI9A 2HUFA 3N75A 4RIZA 4AH3A 2C0RA 1M4NA 2HUUA 3B1DA 3UWCA 3EI6A 4DGTA 2DGKA 2EZ1A 1ASCA 2PB0A 4TV7A 3CQ5A 2BI5A 2V1PA 3NNKA 3KGXA 5M4BA 1ARHA 4OCAA 3N5MA 1ELQA 4RM1A 5G2PA 3E2YA 3P1TA 2FYFA 2YCPA 2ZP7A 8AATA 4WP0A 1PMMA 4ZLVA 4PFFA 2AY7A 2HUIA 1O4SA 2Z9XA 1LW5A 3B8XA 1QJ3A 3NYUA 1MAPA 1LS3A 4IYOA 4PFNA 4MQPA 2CH2A 4R2NA 1M0QA 3UE8A 4J8LA 1UU0A 2D61A 2GMSA 1ECXA 3PDBB 1V2EA 3ASBA 1LC8A 4MQRA 4W1VA 4ATPA 1LK9A 2DKBA 2R0TA 1J32A 2YRIA 1QITA 2KFPA 3W1IA 4I8AA 4N0BA 2GB3A 4P3MA 2GSAA 3VOMA 2HOZA 1B9HA 1C4KA 2OKJA 4E1OA 1BJWA 2W8JA 3GR9A 3MAFA 1H0CA 3L44A 1G7XA 2YKUA 3AEMA 3G0TA 2YKXA 1IAYA 2D63A 2YKYA 2C81A 3BCXA 3RBFA 3FZ6A 1BQDA 2VGSA 1GDEA 3NUBA 2FKIA 3AOVA 3R9AA 1C0NA 4W1XA 1AICA 1ASEA 4RKDA 5BJ3A 3FCRA 4GE7A 2YCNA 3HBXA 5M49A 2F8JA 3WCOA 1C7GA 2FQ6A 4UHNA 3RCHA 3GZDC 3DU4A 1UU1A 4IXZA 1B4XA 2YCTA 2DGLA 5J8QA 1D7SA 4LNJA 4F5IA 5FT4A 3VK3A 2WK9A 1B8GA 4ADEA 2W7FA 4JEWA 1OHWA 1X28A 1MDXA 2NMPA 1ELUA 3KGWA 4CBSA 4ZWVA 5FT5A 3LG0A 2AY4A 4EB5A 2W7DA 2ZC0A 1D2FA 1QZ9A 3AATA 4OYTA 1ASBA 1M32A 3FDDA 1RVUA 1YJZA 4M2KA 4ZDOA 5IWQA 2AY9A 2HOYA 2VMPA 3VK2A 1BJOA 1JF9A 2ZSLA 4RITA 1ASGA 3MC6C 1ASNA 4XK1A 4QGRA 5BJ4A 1JS3A 1GCKA 4TN4A 5TF5A 1AY4A 3NU8A 1FG3A 2O0RA 2OGAA 3JTXA 1MLZA 4DBCA 3BCAA 1AMRA 4BQ0A 2HOXA 1IVRA 1QGNA 1W3UA 2VMTA 3FZ7A 1DGDA 1OATA 2QSRA 2O1BA 4JF0A 1LC5A 1D7VA 4ZASA 4B98A 2BWNA 3AV7A 4R8DA 2AY6A 2Z9UA 4A00A 1W23A 4JF1A 2VLFA 1PG8A 4IXOA 2OATA 2VI8A 2W8UA 5EIGB 3NDNA 2EZ2A 3LY1A 3N7NA 1V2DA 1N8PA 1WYVA 3D6KA 3EI7A 3FZ8A 1IJIA 2CTZA 3FQ8A 1RV3A 3AEJC 2W7JA 5F9SA 3N4RA 1TASA 1WYTA 3BB8A 2R5CA 1KL2A 4RJYA 3T32A 1AX4A 2AY3A 2D65A 3F9TA 1PFFA 3OP7A 5HDMA 4PVFA 4K05A 5G4JA 1DFOA 4A6RA 3LWSA 2G6WA 1AIAA 2DR1A 3PGYA 3DR7A 1G7WA 1TATA 3JZLA 5G09A 1S0AA 5G4IA 1MLYA 3K28A 3E77A 3WGBA 1G4VA 4XJOA 4OBUA 1CZCA 1M0PA 7AATA 1CL1A 1AHXA 1SZSA 1SZUA 1UKJA 3K40A 3CQ4A 3FVXA 4CXQA 4FFCA 1AJSB 1BQAA 1BT4A 1AAWA 1SFFA 2E7JA 1AHFA 1DKAA 1C9CA 3DZZA 4A0HA 3GZDA 4WYAA 2EPJA 4AO9A 1S07A 2AEUA 1ZOBA 3GSBA 2W7IA 9AATA 2W7KA 3DR4A 3VAXA 3PD6A 3NTJA 4F5FA 1I29A 2WKAA 3MAUA 2YHKA 4WXGA 2JISA 4GSAA 4RLGA 4W5KA 3HQTA 5DJ9A 4W1WA 4H51A 2CANA 3EZ1A 1YIZA 1WKGA 2AATA 3NYTA 2VMOA 2ZY2A 1ARTA 2W8TA 1DTYA 4O6ZA 3FFRA 3N4XA 1MDZA 2JJFA 4ITXA 4XAUA 1TOKA 3FSLA 2OQXA 3PPLA 1CZEA 1EJIA 1KMKA 3KE3A 3MKJA 1I43A 2WK7A 3MC6A 4UHMA 4EFFA 1YJYA 1IUGA 4A6UA 5KTBA 2BWOA 2OKKA 2R2NA 4GRXA 4LW2A 1CQ7A 4IW7A 1IBJA 1QISA 4OMAA 1ASAA 1AY5A 3IF2A 1TOEA 2BHXA 3CQ6A 3FTBA 3NU7A 2D64A 1BS0A 1AMAA 1CS1A 1GEXA 1KKPA 2GMUA 2VIAA 3E2ZB 3ECDA 3IHJA 4IX8A 4UOYA 1XEYA 1ASLA 2VYCA 1I48A 3NX3A 5M46A 2Z9WA 2VGVA 3A9ZA 4ZSYA 1IX7A 2R5EA 2VMYA 1CQ6A 4WD2A 3JU7A 1AKAA 3K7YA 3ZRQA 2VIBA 4F5HA 1KAFA 4AOAA 3CBFA 4WYCA 3I5TA 5E5IA 2ZY5A 2FN6A 1M7YA 3DYDA 2CSTA 1PMOA 2D7ZA 2W8WA 3B46A 1RV4A 5EIGA 3LVJA 4E3QA 1AKBA 1SVVA 2XH1A 4GDYA 2E54A 5EQCA 1ZC9A 3G8MA 3WKSA 4BA5A 2YKVA 1VP4A 3AENA 2W7MA 3HMUA 3AEJA 4K2IA 1AJRA 2QBTA 3HDOA 2QB2A 3JW9A 3H9XA 4HF8A 2AY2A 1TOJA 1B5PA 3DC1A 3LVLB 4MKJA 4MQQA 3N0LA 4IY7A 1LKCA 3WZFA 3HVYA 3LV2A 1DGEA 4GE9A 5HHYA 2ZUKA 4OT8A 4R5ZA 1W7LA 2Z20A 3UAKA 1AIBA 3TQXA 1ASFA 4OTLA 3ACZA 3QN6A 3L8AA 1B5OA 4WYDA 1GC0A 2C44A 1ASMA 2FNUA 3WLXA 3TFUA 2X8UA 4ZWMA 3FRKA 3EIAA 4AZJA 3E2FA 3JWBA 2AY1A 2EO5A 3FDBA 4P7YA 2VMZA 3ZZJA 3BWOA 4KAMA 3E6GA 4Y0HA 1AHGA 3CAIA 4ISYA 5D95A 4WXFA 1X2AA 4IYOB 4UHOA 4R5FA 1DJUA 4A72A 3AOWA 4Q75A 5LHAA 1AMSA 1DJEA 1LC7A 2X3LA 3W1HA 3ASAA 1M0NA 5EAAA 4XQ2A 1GBNA 3A8UX 4LC3A 4WYFA 4A6TA 4ADCA 4CXRA 3MEBA 2VGUA 1GC2A 4Y0IA 4JEYA 5E4ZA 1TOIA 2Z1YA 2C7TA 1KL1A 3QI6A 3MAFB 1GEWA 1CQ8A 3BS8A 3AEPA 3ZRPA 1E5FA 1GD9A 3QBOA 2ZY4A 3LVMA 3EUCA 4B9BA 1TOGA 1C7NA 2HORA 1I41A 2Z9VA 3R4TA 1WSTA 5DJ1A 3FFHA 1OXPA 4XJMA 4BA4A 2G7JA 2D5YA 3PDBA 4CBRA 2HP2A 1Z3ZA 2W7EA 4KYOA 4WB0B 1M0OA 1B9IA 2VMNA 2BI3A 3MADA 2D66A 3WCNA 3FQ7A 3NRAA 2VMSA 1W7NA 2X5DA 3BWNC 1T3IA 2JG2A 5DB5A 2DOUA 3NUIA 2X5FA 4WYEA 1D7UA 1S09A 1M6SA 1EQBA 2TPLA 1SZKA 1TARA 3F0HA 1ARIA 4U2HA 4Q76A 2QA3A 2VGWA 2W7GA 1V2FA 2BI9A 4M2MA 2VMQA 4J5UA 2RFVA 4AO4A 2A1VA 3TATA 4L0OA 1FG7A 3FVSA 4GE4A 4A0GA 4WYGA 1BJOB 3FVUA 1YNUA 4F5JA 1S06A 2D7YA 3WGCA 3W1JA 2JJEA 4EU1A 1C7OA 1OHYA 3WY7A 2Z61A 1BJ4A 3BN1A 1KMJA 3ATHA 1ARGA 2BWPA 3B1EA 4KXKA 1O69A 3AELA 5G2QA 4ITGA 5EUNA 4RAEA 4ATQA 3HL2A 1GC4A 3COGA 2CB1A 1AHYA 1OHVA 4WLHA 2JGTA 3N4SA 2QLRA 4ZSWA 3KKIA 4BMKA 3RUYA 5EUDA 1CJ0A 4F5GA 2VMVA 2W7LA 4F4EA 1QJ5A 2VGTA 4LW4A 3ZZKA 1BKGA 3AEOA 1IAXA 2WB6A 2BIAA 3DXVA 2CY8A 4K2BA 2ORDA 2V0YA 2W7HA 4BHDA 3A9XA 4HVKA 5M4DA 3MBBA 3PIUA 1WYVB 1E5EA 4JEXA 3H7FA 3USFA 2VMWA 1FC4A 1WYTB 2R5CB 1JS6A 3H14A 3DRDA 3BCBA 1AAMA 1WYUB 4M2JA 5EFSA 3LVKA 2FM1A 4W8IA 4RJ0A 5G0AA 4ADDA 1V72A 2PO3A 4ZDPA 3GBXA 1AMQA 3GJUA 4IXSA 3ZRRA 2CH1A 3TFTA 4MSOA 1Y4IA 3BC8A 3DXWA 3EI9A 4EMYA 1CL2A 1P3WA 2GQNA 3HLMA 3PAAA 2OGEA 1UU2A 2ZSMA 4E3RA 2Q7WA 2HZPA 3RI6A 4ADBA 1GC3A 4K2MA 3GZCA 1KKJA 4JEZA 3PJ0A 3HT4A 1GEYA 3WX9A 1ZODA 2AY8A 2VMXA 2EYQA 1W7MA 4Y0DA 1N2TA 3E9KA 4WXBA 4XJLA 3FKDA 4Q31A 2JJGA 4WB0A 2BYLA 2DGMA 4AZKA 5D5SA 3VK4A 3BWNA 1RVYA 5I92A 1X0MA 1IX8A 2E7IA 1EG5A 2BI1A 3PD6B 4MGRA 1VJOA 5FT6A 3WKRA 2AY5A 2VMUA 3QPGA 3EZSA 2CINA 2VGZA 4GEBA 3VP6A 2QMAA 3RBLA 2PB2A 1O62A 3II0A 1VEFA 2BKWA 1J04A 1AKCA 4UQVA 4XJPA 5E3KA 1AJSA 4EB7A 1JG8A 4ZM3A 1XI9A 4TMRA 2Z1ZA 5EUEA 4U1TA 5HXXA 1MAQA 1MGVA 4LNLA 5JAYA 1BJNA 4OBVA
chains in the Genus database with same CATH topology
4H63Q 5FT8A 1N31A 3FD0A 4ZDLA 3ELPA 4MKKA 3GETA 4FL0A 2BIEA 1YIYA 5C6UA 1MDOA 4N0WA 1YJSA 2BIGA 3EI8A 3Q8NA 3AEMC 5DX5A 1S08A 3FQAA 1X29A 4OC9A 5AX8A 4RKCA 2CFBA 1ARSA 2DKJA 1H1CA 1G4XA 4ZAHA 1U08A 1TPLA 1WKHA 2EH6A 2WK8A 3NYSA 2QB3A 4MY5A 3ISLA 1AY8A 2FNIA 4W91A 4XEWA 3RCHB 2VMRA 3QGUA 3RQ1A 5K8BA 4A0RA 4JE5A 1ORDA 3I4JA 4ZM4A 2BYJA 3GWPA 3PA9A 2Z67A 3A9YA 1YAAA 3A2BA 4NOGA 3TCMA 3AENB 4DQ6A 1YOOA 2YRRA 3EI5A 3E2ZA 4WBTA 1AHEA 1OXOA 4JEVA 3F6TA 2ZYJA 3I16A 3P6KA 4F5KA 3QHXA 1IX6A 1WYUA 2W8VA 2HP1A 3BV0A 4JE5D 4E77A 1O61A 1ASDA 4F5LA 2ZJGA 5LH9A 3QM2A 1Z7DA 2E7UA 2AEVA 2VLHA 3EIBA 3ELEA 3OKSA 4PIWA 3PDXA 3DODA 4A0FA 1D7RA 2BI2A 2YOBA 5EAVA 2ZY3A 4F5MA 3JWAA 3G7QA 2JJHA 3M5UA 1DJ9A 2EGYA 4CVQA 1QIRA 1SF2A 3B1CA 2CJGA 4WLJA 1LW4A 2O7CA 2XBNA 4Q6RA 1SPAA 2CJHA 5F8VA 4LNMA 1BW0A 2CJDA 2VI9A 2HUFA 3N75A 4RIZA 4AH3A 2C0RA 1M4NA 2HUUA 3B1DA 3UWCA 3EI6A 4DGTA 2DGKA 2EZ1A 1ASCA 2PB0A 4TV7A 3CQ5A 2BI5A 2V1PA 3NNKA 3KGXA 5M4BA 1ARHA 4OCAA 3N5MA 1ELQA 4RM1A 5G2PA 3E2YA 3P1TA 2FYFA 2YCPA 2ZP7A 8AATA 4WP0A 1PMMA 4ZLVA 4PFFA 2AY7A 2HUIA 1O4SA 2Z9XA 1LW5A 3B8XA 1QJ3A 3NYUA 1MAPA 1LS3A 4IYOA 4PFNA 4MQPA 2CH2A 4R2NA 1M0QA 3UE8A 4J8LA 1UU0A 2D61A 2GMSA 1ECXA 3PDBB 1V2EA 3ASBA 1LC8A 4MQRA 4W1VA 4ATPA 1LK9A 2DKBA 2R0TA 1J32A 2YRIA 1QITA 2KFPA 3W1IA 4I8AA 4N0BA 2GB3A 4P3MA 2GSAA 3VOMA 2HOZA 1B9HA 1C4KA 2OKJA 4E1OA 1BJWA 2W8JA 3GR9A 3MAFA 1H0CA 3L44A 1G7XA 2YKUA 3AEMA 3G0TA 2YKXA 1IAYA 2D63A 2YKYA 2C81A 3BCXA 3RBFA 3FZ6A 1BQDA 2VGSA 1GDEA 3NUBA 2FKIA 3AOVA 3R9AA 1C0NA 4W1XA 1AICA 1ASEA 4RKDA 5BJ3A 3FCRA 4GE7A 2YCNA 3HBXA 5M49A 2F8JA 3WCOA 1C7GA 2FQ6A 4UHNA 3RCHA 3GZDC 3DU4A 1UU1A 4IXZA 1B4XA 2YCTA 2DGLA 5J8QA 1D7SA 4LNJA 4F5IA 5FT4A 3VK3A 2WK9A 1B8GA 4ADEA 2W7FA 4JEWA 1OHWA 1X28A 1MDXA 2NMPA 1ELUA 3KGWA 4CBSA 4ZWVA 5FT5A 3LG0A 2AY4A 4EB5A 2W7DA 2ZC0A 1D2FA 1QZ9A 3AATA 4OYTA 1ASBA 1M32A 3FDDA 1RVUA 1YJZA 4M2KA 4ZDOA 5IWQA 2AY9A 2HOYA 2VMPA 3VK2A 1BJOA 1JF9A 2ZSLA 4RITA 1ASGA 3MC6C 1ASNA 4XK1A 4QGRA 5BJ4A 1JS3A 1GCKA 4TN4A 5TF5A 1AY4A 3NU8A 1FG3A 2O0RA 2OGAA 3JTXA 1MLZA 4DBCA 3BCAA 1AMRA 4BQ0A 2HOXA 1IVRA 1QGNA 1W3UA 2VMTA 3FZ7A 1DGDA 1OATA 2QSRA 2O1BA 4JF0A 1LC5A 1D7VA 4ZASA 4B98A 2BWNA 3AV7A 4R8DA 2AY6A 2Z9UA 4A00A 1W23A 4JF1A 2VLFA 1PG8A 4IXOA 2OATA 2VI8A 2W8UA 5EIGB 3NDNA 2EZ2A 3LY1A 3N7NA 1V2DA 1N8PA 1WYVA 3D6KA 3EI7A 3FZ8A 1IJIA 2CTZA 3FQ8A 1RV3A 3AEJC 2W7JA 5F9SA 3N4RA 1TASA 1WYTA 3BB8A 2R5CA 1KL2A 4RJYA 3T32A 1AX4A 2AY3A 2D65A 3F9TA 1PFFA 3OP7A 5HDMA 4PVFA 4K05A 5G4JA 1DFOA 4A6RA 3LWSA 2G6WA 1AIAA 2DR1A 3PGYA 3DR7A 1G7WA 1TATA 3JZLA 5G09A 1S0AA 5G4IA 1MLYA 3K28A 3E77A 3WGBA 1G4VA 4XJOA 4OBUA 1CZCA 1M0PA 7AATA 1CL1A 1AHXA 1SZSA 1SZUA 1UKJA 3K40A 3CQ4A 3FVXA 4CXQA 4FFCA 1AJSB 1BQAA 1BT4A 1AAWA 1SFFA 2E7JA 1AHFA 1DKAA 1C9CA 3DZZA 4A0HA 3GZDA 4WYAA 2EPJA 4AO9A 1S07A 2AEUA 1ZOBA 3GSBA 2W7IA 9AATA 2W7KA 3DR4A 3VAXA 3PD6A 3NTJA 4F5FA 1I29A 2WKAA 3MAUA 2YHKA 4WXGA 2JISA 4GSAA 4RLGA 4W5KA 3HQTA 5DJ9A 4W1WA 4H51A 2CANA 3EZ1A 1YIZA 1WKGA 2AATA 3NYTA 2VMOA 2ZY2A 1ARTA 2W8TA 1DTYA 4O6ZA 3FFRA 3N4XA 1MDZA 2JJFA 4ITXA 4XAUA 1TOKA 3FSLA 2OQXA 3PPLA 1CZEA 1EJIA 1KMKA 3KE3A 3MKJA 1I43A 2WK7A 3MC6A 4UHMA 4EFFA 1YJYA 1IUGA 4A6UA 5KTBA 2BWOA 2OKKA 2R2NA 4GRXA 4LW2A 1CQ7A 4IW7A 1IBJA 1QISA 4OMAA 1ASAA 1AY5A 3IF2A 1TOEA 2BHXA 3CQ6A 3FTBA 3NU7A 2D64A 1BS0A 1AMAA 1CS1A 1GEXA 1KKPA 2GMUA 2VIAA 3E2ZB 3ECDA 3IHJA 4IX8A 4UOYA 1XEYA 1ASLA 2VYCA 1I48A 3NX3A 5M46A 2Z9WA 2VGVA 3A9ZA 4ZSYA 1IX7A 2R5EA 2VMYA 1CQ6A 4WD2A 3JU7A 1AKAA 3K7YA 3ZRQA 2VIBA 4F5HA 4AOAA 3CBFA 4WYCA 3I5TA 5E5IA 2ZY5A 2FN6A 1M7YA 3DYDA 2CSTA 1PMOA 2D7ZA 2W8WA 3B46A 1RV4A 5EIGA 3LVJA 4E3QA 1AKBA 1SVVA 2XH1A 4GDYA 2E54A 5EQCA 1ZC9A 3G8MA 3WKSA 4BA5A 2YKVA 1VP4A 3AENA 2W7MA 3HMUA 3AEJA 4K2IA 1AJRA 2QBTA 3HDOA 2QB2A 3JW9A 3H9XA 4HF8A 2AY2A 1TOJA 1B5PA 3DC1A 3LVLB 4MKJA 4MQQA 3N0LA 4IY7A 1LKCA 3WZFA 3HVYA 3LV2A 1DGEA 4GE9A 5HHYA 2ZUKA 4OT8A 4R5ZA 1W7LA 2Z20A 3UAKA 1AIBA 3TQXA 1ASFA 4OTLA 3ACZA 3QN6A 3L8AA 1B5OA 4WYDA 1GC0A 2C44A 1ASMA 2FNUA 3WLXA 3TFUA 2X8UA 4ZWMA 3FRKA 3EIAA 4AZJA 3E2FA 3JWBA 2AY1A 2EO5A 3FDBA 4P7YA 2VMZA 3ZZJA 3BWOA 4KAMA 3E6GA 4Y0HA 1AHGA 3CAIA 4ISYA 5D95A 4WXFA 1X2AA 4IYOB 4UHOA 4R5FA 1DJUA 4A72A 3AOWA 4Q75A 5LHAA 1AMSA 1DJEA 1LC7A 2X3LA 3W1HA 3ASAA 1M0NA 5EAAA 4XQ2A 1GBNA 3A8UX 4LC3A 4WYFA 4A6TA 4ADCA 4CXRA 3MEBA 2VGUA 1GC2A 4Y0IA 4JEYA 5E4ZA 1TOIA 2Z1YA 2C7TA 1KL1A 3QI6A 3MAFB 1GEWA 1CQ8A 3BS8A 3AEPA 3ZRPA 1E5FA 1GD9A 3QBOA 2ZY4A 3LVMA 3EUCA 4B9BA 1TOGA 1C7NA 2HORA 1I41A 2Z9VA 3R4TA 1WSTA 5DJ1A 3FFHA 1OXPA 4XJMA 4BA4A 2G7JA 2D5YA 3PDBA 4CBRA 2HP2A 1Z3ZA 2W7EA 4KYOA 4WB0B 1M0OA 1B9IA 2VMNA 2BI3A 3MADA 2D66A 3WCNA 3FQ7A 3NRAA 2VMSA 1W7NA 2X5DA 3BWNC 1T3IA 2JG2A 5DB5A 2DOUA 3NUIA 2X5FA 4WYEA 1D7UA 1S09A 1M6SA 1EQBA 2TPLA 1SZKA 1TARA 3F0HA 1ARIA 4U2HA 4Q76A 2QA3A 2VGWA 2W7GA 1V2FA 2BI9A 4M2MA 2VMQA 4J5UA 2RFVA 4AO4A 2A1VA 3TATA 4L0OA 1FG7A 3FVSA 4GE4A 4A0GA 4WYGA 1BJOB 3FVUA 1YNUA 4F5JA 1S06A 2D7YA 3WGCA 3W1JA 2JJEA 4EU1A 1C7OA 1OHYA 3WY7A 2Z61A 1BJ4A 3BN1A 1KMJA 3ATHA 1ARGA 2BWPA 3B1EA 4KXKA 1O69A 3AELA 5G2QA 4ITGA 5EUNA 4RAEA 4ATQA 3HL2A 1GC4A 3COGA 2CB1A 1AHYA 1OHVA 4WLHA 2JGTA 3N4SA 2QLRA 4ZSWA 3KKIA 4BMKA 3RUYA 5EUDA 1CJ0A 4F5GA 2VMVA 2W7LA 4F4EA 1QJ5A 2VGTA 4LW4A 3ZZKA 1BKGA 3AEOA 1IAXA 2WB6A 2BIAA 3DXVA 2CY8A 4K2BA 2ORDA 2V0YA 2W7HA 4BHDA 3A9XA 4HVKA 5M4DA 3MBBA 3PIUA 1WYVB 1E5EA 4JEXA 3H7FA 3USFA 2VMWA 1FC4A 1WYTB 2R5CB 1JS6A 3H14A 3DRDA 3BCBA 1AAMA 1WYUB 4M2JA 5EFSA 3LVKA 2FM1A 4W8IA 4RJ0A 5G0AA 4ADDA 1V72A 2PO3A 4ZDPA 3GBXA 1AMQA 3GJUA 4IXSA 3ZRRA 2CH1A 3TFTA 4MSOA 1Y4IA 3BC8A 3DXWA 3EI9A 4EMYA 1CL2A 1P3WA 2GQNA 3HLMA 3PAAA 2OGEA 1UU2A 2ZSMA 4E3RA 2Q7WA 2HZPA 3RI6A 4ADBA 1GC3A 4K2MA 3GZCA 1KKJA 4JEZA 3PJ0A 3HT4A 1GEYA 3WX9A 1ZODA 2AY8A 2VMXA 2EYQA 1W7MA 4Y0DA 1N2TA 3E9KA 4WXBA 4XJLA 3FKDA 4Q31A 2JJGA 4WB0A 2BYLA 2DGMA 4AZKA 5D5SA 3VK4A 3BWNA 1RVYA 5I92A 1X0MA 1IX8A 2E7IA 1EG5A 2BI1A 3PD6B 4MGRA 1VJOA 5FT6A 3WKRA 2AY5A 2VMUA 3QPGA 3EZSA 2CINA 2VGZA 4GEBA 3VP6A 2QMAA 3RBLA 2PB2A 1O62A 3II0A 1VEFA 2BKWA 1J04A 1AKCA 4UQVA 4XJPA 5E3KA 1AJSA 4EB7A 1JG8A 4ZM3A 1XI9A 4TMRA 2Z1ZA 5EUEA 4U1TA 5HXXA 1MAQA 1MGVA 4LNLA 5JAYA 1BJNA 4OBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FT8 A;  1N31 A;  3FD0 A;  4ZDL A;  3ELP A;  4MKK A;  3GET A;  4FL0 A;  2BIE A;  1YIY A;  5C6U A;  1MDO A;  4N0W A;  1YJS A;  2BIG A;  3EI8 A;  3Q8N A;  3AEM C;  5DX5 A;  1S08 A;  3FQA A;  1X29 A;  4OC9 A;  5AX8 A;  4RKC A;  2CFB A;  1ARS A;  2DKJ A;  1H1C A;  1G4X A;  4ZAH A;  1U08 A;  1TPL A;  1WKH A;  2EH6 A;  2WK8 A;  3NYS A;  2QB3 A;  4MY5 A;  3ISL A;  1AY8 A;  2FNI A;  4W91 A;  4XEW A;  3RCH B;  2VMR A;  3QGU A;  3RQ1 A;  5K8B A;  4A0R A;  4JE5 A;  1ORD A;  3I4J A;  4ZM4 A;  2BYJ A;  3GWP A;  3PA9 A;  2Z67 A;  3A9Y A;  1YAA A;  3A2B A;  4NOG A;  3TCM A;  3AEN B;  4DQ6 A;  1YOO A;  2YRR A;  3EI5 A;  3E2Z A;  4WBT A;  1AHE A;  1OXO A;  4JEV A;  3F6T A;  2ZYJ A;  3I16 A;  3P6K A;  4F5K A;  3QHX A;  1IX6 A;  1WYU A;  2W8V A;  2HP1 A;  3BV0 A;  4JE5 D;  4E77 A;  1O61 A;  1ASD A;  4F5L A;  2ZJG A;  5LH9 A;  3QM2 A;  1Z7D A;  2E7U A;  2AEV A;  2VLH A;  3EIB A;  3ELE A;  3OKS A;  4PIW A;  3PDX A;  3DOD A;  4A0F A;  1D7R A;  2BI2 A;  2YOB A;  5EAV A;  2ZY3 A;  4F5M A;  3JWA A;  3G7Q A;  2JJH A;  3M5U A;  1DJ9 A;  2EGY A;  4CVQ A;  1QIR A;  1SF2 A;  3B1C A;  2CJG A;  4WLJ A;  1LW4 A;  2O7C A;  2XBN A;  4Q6R A;  1SPA A;  2CJH A;  5F8V A;  4LNM A;  1BW0 A;  2CJD A;  2VI9 A;  2HUF A;  3N75 A;  4RIZ A;  4AH3 A;  2C0R A;  1M4N A;  2HUU A;  3B1D A;  3UWC A;  3EI6 A;  4DGT A;  2DGK A;  2EZ1 A;  1ASC A;  2PB0 A;  4TV7 A;  3CQ5 A;  2BI5 A;  2V1P A;  3NNK A;  3KGX A;  5M4B A;  1ARH A;  4OCA A;  3N5M A;  1ELQ A;  4RM1 A;  5G2P A;  3E2Y A;  3P1T A;  2FYF A;  2YCP A;  2ZP7 A;  8AAT A;  4WP0 A;  1PMM A;  4ZLV A;  4PFF A;  2AY7 A;  2HUI A;  1O4S A;  2Z9X A;  1LW5 A;  3B8X A;  1QJ3 A;  3NYU A;  1MAP A;  1LS3 A;  4IYO A;  4PFN A;  4MQP A;  2CH2 A;  4R2N A;  1M0Q A;  3UE8 A;  4J8L A;  1UU0 A;  2D61 A;  2GMS A;  1ECX A;  3PDB B;  1V2E A;  3ASB A;  1LC8 A;  4MQR A;  4W1V A;  4ATP A;  1LK9 A;  2DKB A;  2R0T A;  1J32 A;  2YRI A;  1QIT A;  3W1I A;  4I8A A;  4N0B A;  2GB3 A;  4P3M A;  2GSA A;  3VOM A;  2HOZ A;  1B9H A;  1C4K A;  2OKJ A;  4E1O A;  1BJW A;  2W8J A;  3GR9 A;  3MAF A;  1H0C A;  3L44 A;  1G7X A;  2YKU A;  3AEM A;  3G0T A;  2YKX A;  1IAY A;  2D63 A;  2YKY A;  2C81 A;  3BCX A;  3RBF A;  3FZ6 A;  1BQD A;  2VGS A;  1GDE A;  3NUB A;  3AOV A;  3R9A A;  1C0N A;  4W1X A;  1AIC A;  1ASE A;  4RKD A;  5BJ3 A;  3FCR A;  4GE7 A;  2YCN A;  3HBX A;  5M49 A;  2F8J A;  3WCO A;  1C7G A;  2FQ6 A;  4UHN A;  3RCH A;  3GZD C;  3DU4 A;  1UU1 A;  4IXZ A;  1B4X A;  2YCT A;  2DGL A;  5J8Q A;  1D7S A;  4LNJ A;  4F5I A;  5FT4 A;  3VK3 A;  2WK9 A;  1B8G A;  4ADE A;  2W7F A;  4JEW A;  1OHW A;  1X28 A;  1MDX A;  2NMP A;  1ELU A;  3KGW A;  4CBS A;  4ZWV A;  5FT5 A;  3LG0 A;  2AY4 A;  4EB5 A;  2W7D A;  2ZC0 A;  1D2F A;  1QZ9 A;  3AAT A;  4OYT A;  1ASB A;  1M32 A;  3FDD A;  1RVU A;  1YJZ A;  4M2K A;  4ZDO A;  5IWQ A;  2AY9 A;  2HOY A;  2VMP A;  3VK2 A;  1BJO A;  1JF9 A;  2ZSL A;  4RIT A;  1ASG A;  3MC6 C;  1ASN A;  4XK1 A;  4QGR A;  5BJ4 A;  1JS3 A;  1GCK A;  4TN4 A;  5TF5 A;  1AY4 A;  3NU8 A;  1FG3 A;  2O0R A;  2OGA A;  3JTX A;  1MLZ A;  4DBC A;  3BCA A;  1AMR A;  4BQ0 A;  2HOX A;  1IVR A;  1QGN A;  1W3U A;  2VMT A;  3FZ7 A;  1DGD A;  1OAT A;  2O1B A;  4JF0 A;  1LC5 A;  1D7V A;  4ZAS A;  4B98 A;  2BWN A;  3AV7 A;  4R8D A;  2AY6 A;  2Z9U A;  4A00 A;  1W23 A;  4JF1 A;  2VLF A;  1PG8 A;  4IXO A;  2OAT A;  2VI8 A;  2W8U A;  5EIG B;  3NDN A;  2EZ2 A;  3LY1 A;  1V2D A;  1N8P A;  1WYV A;  3D6K A;  3EI7 A;  3FZ8 A;  1IJI A;  2CTZ A;  3FQ8 A;  1RV3 A;  3AEJ C;  2W7J A;  5F9S A;  1TAS A;  1WYT A;  3BB8 A;  2R5C A;  1KL2 A;  4RJY A;  3T32 A;  1AX4 A;  2AY3 A;  2D65 A;  3F9T A;  1PFF A;  3OP7 A;  5HDM A;  4PVF A;  5G4J A;  1DFO A;  4A6R A;  3LWS A;  2G6W A;  1AIA A;  2DR1 A;  3PGY A;  3DR7 A;  1G7W A;  1TAT A;  3JZL A;  5G09 A;  1S0A A;  5G4I A;  1MLY A;  3K28 A;  3E77 A;  3WGB A;  1G4V A;  4XJO A;  4OBU A;  1CZC A;  1M0P A;  7AAT A;  1CL1 A;  1AHX A;  1SZS A;  1SZU A;  1UKJ A;  3K40 A;  3CQ4 A;  3FVX A;  4CXQ A;  4FFC A;  1AJS B;  1BQA A;  1BT4 A;  1AAW A;  1SFF A;  2E7J A;  1AHF A;  1DKA A;  1C9C A;  3DZZ A;  4A0H A;  3GZD A;  4WYA A;  2EPJ A;  4AO9 A;  1S07 A;  2AEU A;  1ZOB A;  3GSB A;  2W7I A;  9AAT A;  2W7K A;  3DR4 A;  3VAX A;  3PD6 A;  3NTJ A;  4F5F A;  1I29 A;  2WKA A;  3MAU A;  2YHK A;  4WXG A;  2JIS A;  4GSA A;  4RLG A;  4W5K A;  3HQT A;  5DJ9 A;  4W1W A;  4H51 A;  2CAN A;  3EZ1 A;  1YIZ A;  1WKG A;  2AAT A;  3NYT A;  2VMO A;  2ZY2 A;  1ART A;  2W8T A;  1DTY A;  4O6Z A;  3FFR A;  1MDZ A;  2JJF A;  4ITX A;  4XAU A;  1TOK A;  3FSL A;  2OQX A;  3PPL A;  1CZE A;  1EJI A;  1KMK A;  3KE3 A;  3MKJ A;  1I43 A;  2WK7 A;  3MC6 A;  4UHM A;  4EFF A;  1YJY A;  1IUG A;  4A6U A;  2BWO A;  2OKK A;  2R2N A;  4GRX A;  4LW2 A;  1CQ7 A;  4IW7 A;  1IBJ A;  1QIS A;  4OMA A;  1ASA A;  1AY5 A;  3IF2 A;  1TOE A;  2BHX A;  3CQ6 A;  3FTB A;  3NU7 A;  2D64 A;  1BS0 A;  1AMA A;  1CS1 A;  1GEX A;  1KKP A;  2GMU A;  2VIA A;  3E2Z B;  3ECD A;  3IHJ A;  4IX8 A;  4UOY A;  1XEY A;  1ASL A;  2VYC A;  1I48 A;  3NX3 A;  5M46 A;  2Z9W A;  2VGV A;  3A9Z A;  4ZSY A;  1IX7 A;  2R5E A;  2VMY A;  1CQ6 A;  4WD2 A;  3JU7 A;  1AKA A;  3K7Y A;  3ZRQ A;  2VIB A;  4F5H A;  4AOA A;  3CBF A;  4WYC A;  3I5T A;  5E5I A;  2ZY5 A;  2FN6 A;  1M7Y A;  3DYD A;  2CST A;  1PMO A;  2D7Z A;  2W8W A;  3B46 A;  1RV4 A;  5EIG A;  3LVJ A;  4E3Q A;  1AKB A;  1SVV A;  2XH1 A;  4GDY A;  2E54 A;  5EQC A;  1ZC9 A;  3G8M A;  3WKS A;  4BA5 A;  2YKV A;  1VP4 A;  3AEN A;  2W7M A;  3HMU A;  3AEJ A;  4K2I A;  1AJR A;  2QBT A;  3HDO A;  2QB2 A;  3JW9 A;  4HF8 A;  2AY2 A;  1TOJ A;  1B5P A;  3DC1 A;  3LVL B;  4MKJ A;  4MQQ A;  3N0L A;  4IY7 A;  1LKC A;  3WZF A;  3HVY A;  3LV2 A;  1DGE A;  4GE9 A;  5HHY A;  2ZUK A;  4OT8 A;  4R5Z A;  1W7L A;  2Z20 A;  3UAK A;  1AIB A;  3TQX A;  1ASF A;  4OTL A;  3ACZ A;  3QN6 A;  3L8A A;  1B5O A;  4WYD A;  1GC0 A;  2C44 A;  1ASM A;  2FNU A;  3WLX A;  3TFU A;  2X8U A;  4ZWM A;  3FRK A;  3EIA A;  4AZJ A;  3E2F A;  3JWB A;  2AY1 A;  2EO5 A;  3FDB A;  4P7Y A;  2VMZ A;  3ZZJ A;  3BWO A;  4KAM A;  3E6G A;  4Y0H A;  1AHG A;  3CAI A;  4ISY A;  5D95 A;  4WXF A;  1X2A A;  4IYO B;  4UHO A;  4R5F A;  1DJU A;  4A72 A;  3AOW A;  4Q75 A;  5LHA A;  1AMS A;  1DJE A;  1LC7 A;  2X3L A;  3W1H A;  3ASA A;  1M0N A;  5EAA A;  4XQ2 A;  1GBN A;  3A8U X;  4LC3 A;  4WYF A;  4A6T A;  4ADC A;  4CXR A;  3MEB A;  2VGU A;  1GC2 A;  4Y0I A;  4JEY A;  5E4Z A;  1TOI A;  2Z1Y A;  2C7T A;  1KL1 A;  3QI6 A;  3MAF B;  1GEW A;  1CQ8 A;  3BS8 A;  3AEP A;  3ZRP A;  1E5F A;  1GD9 A;  3QBO A;  2ZY4 A;  3LVM A;  3EUC A;  4B9B A;  1TOG A;  1C7N A;  2HOR A;  1I41 A;  2Z9V A;  3R4T A;  1WST A;  5DJ1 A;  3FFH A;  1OXP A;  4XJM A;  4BA4 A;  2D5Y A;  3PDB A;  4CBR A;  2HP2 A;  1Z3Z A;  2W7E A;  4KYO A;  4WB0 B;  1M0O A;  1B9I A;  2VMN A;  2BI3 A;  3MAD A;  2D66 A;  3WCN A;  3FQ7 A;  3NRA A;  2VMS A;  1W7N A;  2X5D A;  3BWN C;  1T3I A;  2JG2 A;  5DB5 A;  2DOU A;  3NUI A;  2X5F A;  4WYE A;  1D7U A;  1S09 A;  1M6S A;  1EQB A;  2TPL A;  1SZK A;  1TAR A;  3F0H A;  1ARI A;  4U2H A;  4Q76 A;  2QA3 A;  2VGW A;  2W7G A;  1V2F A;  2BI9 A;  4M2M A;  2VMQ A;  4J5U A;  2RFV A;  4AO4 A;  3TAT A;  4L0O A;  1FG7 A;  3FVS A;  4GE4 A;  4A0G A;  4WYG A;  1BJO B;  3FVU A;  1YNU A;  4F5J A;  1S06 A;  2D7Y A;  3WGC A;  3W1J A;  2JJE A;  4EU1 A;  1C7O A;  1OHY A;  3WY7 A;  2Z61 A;  1BJ4 A;  3BN1 A;  1KMJ A;  3ATH A;  1ARG A;  2BWP A;  3B1E A;  4KXK A;  1O69 A;  3AEL A;  5G2Q A;  4ITG A;  5EUN A;  4RAE A;  4ATQ A;  3HL2 A;  1GC4 A;  3COG A;  2CB1 A;  1AHY A;  1OHV A;  4WLH A;  2JGT A;  2QLR A;  4ZSW A;  3KKI A;  4BMK A;  3RUY A;  5EUD A;  1CJ0 A;  4F5G A;  2VMV A;  2W7L A;  4F4E A;  1QJ5 A;  2VGT A;  4LW4 A;  3ZZK A;  1BKG A;  3AEO A;  1IAX A;  2BIA A;  3DXV A;  2CY8 A;  4K2B A;  2ORD A;  2V0Y A;  2W7H A;  4BHD A;  3A9X A;  4HVK A;  5M4D A;  3MBB A;  3PIU A;  1WYV B;  1E5E A;  4JEX A;  3H7F A;  3USF A;  2VMW A;  1FC4 A;  1WYT B;  2R5C B;  1JS6 A;  3H14 A;  3DRD A;  3BCB A;  1AAM A;  1WYU B;  4M2J A;  5EFS A;  3LVK A;  2FM1 A;  4W8I A;  4RJ0 A;  5G0A A;  4ADD A;  1V72 A;  2PO3 A;  4ZDP A;  3GBX A;  1AMQ A;  3GJU A;  4IXS A;  3ZRR A;  2CH1 A;  3TFT A;  4MSO A;  1Y4I A;  3BC8 A;  3DXW A;  3EI9 A;  4EMY A;  1CL2 A;  1P3W A;  2GQN A;  3HLM A;  3PAA A;  2OGE A;  1UU2 A;  2ZSM A;  4E3R A;  2Q7W A;  2HZP A;  3RI6 A;  4ADB A;  1GC3 A;  4K2M A;  3GZC A;  1KKJ A;  4JEZ A;  3PJ0 A;  3HT4 A;  1GEY A;  3WX9 A;  1ZOD A;  2AY8 A;  2VMX A;  1W7M A;  4Y0D A;  1N2T A;  3E9K A;  4WXB A;  4XJL A;  3FKD A;  4Q31 A;  2JJG A;  4WB0 A;  2BYL A;  2DGM A;  4AZK A;  5D5S A;  3VK4 A;  3BWN A;  1RVY A;  5I92 A;  1X0M A;  1IX8 A;  2E7I A;  1EG5 A;  2BI1 A;  3PD6 B;  4MGR A;  1VJO A;  5FT6 A;  3WKR A;  2AY5 A;  2VMU A;  3QPG A;  3EZS A;  2CIN A;  2VGZ A;  4GEB A;  3VP6 A;  2QMA A;  3RBL A;  2PB2 A;  1O62 A;  3II0 A;  1VEF A;  2BKW A;  1J04 A;  1AKC A;  4UQV A;  4XJP A;  5E3K A;  1AJS A;  4EB7 A;  1JG8 A;  4ZM3 A;  1XI9 A;  4TMR A;  2Z1Z A;  5EUE A;  4U1T A;  5HXX A;  1MAQ A;  1MGV A;  4LNL A;  5JAY A;  1BJN A;  4OBV A; 
#chains in the Genus database with same CATH topology
 4H63 Q;  5FT8 A;  1N31 A;  3FD0 A;  4ZDL A;  3ELP A;  4MKK A;  3GET A;  4FL0 A;  2BIE A;  1YIY A;  5C6U A;  1MDO A;  4N0W A;  1YJS A;  2BIG A;  3EI8 A;  3Q8N A;  3AEM C;  5DX5 A;  1S08 A;  3FQA A;  1X29 A;  4OC9 A;  5AX8 A;  4RKC A;  2CFB A;  1ARS A;  2DKJ A;  1H1C A;  1G4X A;  4ZAH A;  1U08 A;  1TPL A;  1WKH A;  2EH6 A;  2WK8 A;  3NYS A;  2QB3 A;  4MY5 A;  3ISL A;  1AY8 A;  2FNI A;  4W91 A;  4XEW A;  3RCH B;  2VMR A;  3QGU A;  3RQ1 A;  5K8B A;  4A0R A;  4JE5 A;  1ORD A;  3I4J A;  4ZM4 A;  2BYJ A;  3GWP A;  3PA9 A;  2Z67 A;  3A9Y A;  1YAA A;  3A2B A;  4NOG A;  3TCM A;  3AEN B;  4DQ6 A;  1YOO A;  2YRR A;  3EI5 A;  3E2Z A;  4WBT A;  1AHE A;  1OXO A;  4JEV A;  3F6T A;  2ZYJ A;  3I16 A;  3P6K A;  4F5K A;  3QHX A;  1IX6 A;  1WYU A;  2W8V A;  2HP1 A;  3BV0 A;  4JE5 D;  4E77 A;  1O61 A;  1ASD A;  4F5L A;  2ZJG A;  5LH9 A;  3QM2 A;  1Z7D A;  2E7U A;  2AEV A;  2VLH A;  3EIB A;  3ELE A;  3OKS A;  4PIW A;  3PDX A;  3DOD A;  4A0F A;  1D7R A;  2BI2 A;  2YOB A;  5EAV A;  2ZY3 A;  4F5M A;  3JWA A;  3G7Q A;  2JJH A;  3M5U A;  1DJ9 A;  2EGY A;  4CVQ A;  1QIR A;  1SF2 A;  3B1C A;  2CJG A;  4WLJ A;  1LW4 A;  2O7C A;  2XBN A;  4Q6R A;  1SPA A;  2CJH A;  5F8V A;  4LNM A;  1BW0 A;  2CJD A;  2VI9 A;  2HUF A;  3N75 A;  4RIZ A;  4AH3 A;  2C0R A;  1M4N A;  2HUU A;  3B1D A;  3UWC A;  3EI6 A;  4DGT A;  2DGK A;  2EZ1 A;  1ASC A;  2PB0 A;  4TV7 A;  3CQ5 A;  2BI5 A;  2V1P A;  3NNK A;  3KGX A;  5M4B A;  1ARH A;  4OCA A;  3N5M A;  1ELQ A;  4RM1 A;  5G2P A;  3E2Y A;  3P1T A;  2FYF A;  2YCP A;  2ZP7 A;  8AAT A;  4WP0 A;  1PMM A;  4ZLV A;  4PFF A;  2AY7 A;  2HUI A;  1O4S A;  2Z9X A;  1LW5 A;  3B8X A;  1QJ3 A;  3NYU A;  1MAP A;  1LS3 A;  4IYO A;  4PFN A;  4MQP A;  2CH2 A;  4R2N A;  1M0Q A;  3UE8 A;  4J8L A;  1UU0 A;  2D61 A;  2GMS A;  1ECX A;  3PDB B;  1V2E A;  3ASB A;  1LC8 A;  4MQR A;  4W1V A;  4ATP A;  1LK9 A;  2DKB A;  2R0T A;  1J32 A;  2YRI A;  1QIT A;  2KFP A;  3W1I A;  4I8A A;  4N0B A;  2GB3 A;  4P3M A;  2GSA A;  3VOM A;  2HOZ A;  1B9H A;  1C4K A;  2OKJ A;  4E1O A;  1BJW A;  2W8J A;  3GR9 A;  3MAF A;  1H0C A;  3L44 A;  1G7X A;  2YKU A;  3AEM A;  3G0T A;  2YKX A;  1IAY A;  2D63 A;  2YKY A;  2C81 A;  3BCX A;  3RBF A;  3FZ6 A;  1BQD A;  2VGS A;  1GDE A;  3NUB A;  2FKI A;  3AOV A;  3R9A A;  1C0N A;  4W1X A;  1AIC A;  1ASE A;  4RKD A;  5BJ3 A;  3FCR A;  4GE7 A;  2YCN A;  3HBX A;  5M49 A;  2F8J A;  3WCO A;  1C7G A;  2FQ6 A;  4UHN A;  3RCH A;  3GZD C;  3DU4 A;  1UU1 A;  4IXZ A;  1B4X A;  2YCT A;  2DGL A;  5J8Q A;  1D7S A;  4LNJ A;  4F5I A;  5FT4 A;  3VK3 A;  2WK9 A;  1B8G A;  4ADE A;  2W7F A;  4JEW A;  1OHW A;  1X28 A;  1MDX A;  2NMP A;  1ELU A;  3KGW A;  4CBS A;  4ZWV A;  5FT5 A;  3LG0 A;  2AY4 A;  4EB5 A;  2W7D A;  2ZC0 A;  1D2F A;  1QZ9 A;  3AAT A;  4OYT A;  1ASB A;  1M32 A;  3FDD A;  1RVU A;  1YJZ A;  4M2K A;  4ZDO A;  5IWQ A;  2AY9 A;  2HOY A;  2VMP A;  3VK2 A;  1BJO A;  1JF9 A;  2ZSL A;  4RIT A;  1ASG A;  3MC6 C;  1ASN A;  4XK1 A;  4QGR A;  5BJ4 A;  1JS3 A;  1GCK A;  4TN4 A;  5TF5 A;  1AY4 A;  3NU8 A;  1FG3 A;  2O0R A;  2OGA A;  3JTX A;  1MLZ A;  4DBC A;  3BCA A;  1AMR A;  4BQ0 A;  2HOX A;  1IVR A;  1QGN A;  1W3U A;  2VMT A;  3FZ7 A;  1DGD A;  1OAT A;  2QSR A;  2O1B A;  4JF0 A;  1LC5 A;  1D7V A;  4ZAS A;  4B98 A;  2BWN A;  3AV7 A;  4R8D A;  2AY6 A;  2Z9U A;  4A00 A;  1W23 A;  4JF1 A;  2VLF A;  1PG8 A;  4IXO A;  2OAT A;  2VI8 A;  2W8U A;  5EIG B;  3NDN A;  2EZ2 A;  3LY1 A;  3N7N A;  1V2D A;  1N8P A;  1WYV A;  3D6K A;  3EI7 A;  3FZ8 A;  1IJI A;  2CTZ A;  3FQ8 A;  1RV3 A;  3AEJ C;  2W7J A;  5F9S A;  3N4R A;  1TAS A;  1WYT A;  3BB8 A;  2R5C A;  1KL2 A;  4RJY A;  3T32 A;  1AX4 A;  2AY3 A;  2D65 A;  3F9T A;  1PFF A;  3OP7 A;  5HDM A;  4PVF A;  4K05 A;  5G4J A;  1DFO A;  4A6R A;  3LWS A;  2G6W A;  1AIA A;  2DR1 A;  3PGY A;  3DR7 A;  1G7W A;  1TAT A;  3JZL A;  5G09 A;  1S0A A;  5G4I A;  1MLY A;  3K28 A;  3E77 A;  3WGB A;  1G4V A;  4XJO A;  4OBU A;  1CZC A;  1M0P A;  7AAT A;  1CL1 A;  1AHX A;  1SZS A;  1SZU A;  1UKJ A;  3K40 A;  3CQ4 A;  3FVX A;  4CXQ A;  4FFC A;  1AJS B;  1BQA A;  1BT4 A;  1AAW A;  1SFF A;  2E7J A;  1AHF A;  1DKA A;  1C9C A;  3DZZ A;  4A0H A;  3GZD A;  4WYA A;  2EPJ A;  4AO9 A;  1S07 A;  2AEU A;  1ZOB A;  3GSB A;  2W7I A;  9AAT A;  2W7K A;  3DR4 A;  3VAX A;  3PD6 A;  3NTJ A;  4F5F A;  1I29 A;  2WKA A;  3MAU A;  2YHK A;  4WXG A;  2JIS A;  4GSA A;  4RLG A;  4W5K A;  3HQT A;  5DJ9 A;  4W1W A;  4H51 A;  2CAN A;  3EZ1 A;  1YIZ A;  1WKG A;  2AAT A;  3NYT A;  2VMO A;  2ZY2 A;  1ART A;  2W8T A;  1DTY A;  4O6Z A;  3FFR A;  3N4X A;  1MDZ A;  2JJF A;  4ITX A;  4XAU A;  1TOK A;  3FSL A;  2OQX A;  3PPL A;  1CZE A;  1EJI A;  1KMK A;  3KE3 A;  3MKJ A;  1I43 A;  2WK7 A;  3MC6 A;  4UHM A;  4EFF A;  1YJY A;  1IUG A;  4A6U A;  5KTB A;  2BWO A;  2OKK A;  2R2N A;  4GRX A;  4LW2 A;  1CQ7 A;  4IW7 A;  1IBJ A;  1QIS A;  4OMA A;  1ASA A;  1AY5 A;  3IF2 A;  1TOE A;  2BHX A;  3CQ6 A;  3FTB A;  3NU7 A;  2D64 A;  1BS0 A;  1AMA A;  1CS1 A;  1GEX A;  1KKP A;  2GMU A;  2VIA A;  3E2Z B;  3ECD A;  3IHJ A;  4IX8 A;  4UOY A;  1XEY A;  1ASL A;  2VYC A;  1I48 A;  3NX3 A;  5M46 A;  2Z9W A;  2VGV A;  3A9Z A;  4ZSY A;  1IX7 A;  2R5E A;  2VMY A;  1CQ6 A;  4WD2 A;  3JU7 A;  1AKA A;  3K7Y A;  3ZRQ A;  2VIB A;  4F5H A;  1KAF A;  4AOA A;  3CBF A;  4WYC A;  3I5T A;  5E5I A;  2ZY5 A;  2FN6 A;  1M7Y A;  3DYD A;  2CST A;  1PMO A;  2D7Z A;  2W8W A;  3B46 A;  1RV4 A;  5EIG A;  3LVJ A;  4E3Q A;  1AKB A;  1SVV A;  2XH1 A;  4GDY A;  2E54 A;  5EQC A;  1ZC9 A;  3G8M A;  3WKS A;  4BA5 A;  2YKV A;  1VP4 A;  3AEN A;  2W7M A;  3HMU A;  3AEJ A;  4K2I A;  1AJR A;  2QBT A;  3HDO A;  2QB2 A;  3JW9 A;  3H9X A;  4HF8 A;  2AY2 A;  1TOJ A;  1B5P A;  3DC1 A;  3LVL B;  4MKJ A;  4MQQ A;  3N0L A;  4IY7 A;  1LKC A;  3WZF A;  3HVY A;  3LV2 A;  1DGE A;  4GE9 A;  5HHY A;  2ZUK A;  4OT8 A;  4R5Z A;  1W7L A;  2Z20 A;  3UAK A;  1AIB A;  3TQX A;  1ASF A;  4OTL A;  3ACZ A;  3QN6 A;  3L8A A;  1B5O A;  4WYD A;  1GC0 A;  2C44 A;  1ASM A;  2FNU A;  3WLX A;  3TFU A;  2X8U A;  4ZWM A;  3FRK A;  3EIA A;  4AZJ A;  3E2F A;  3JWB A;  2AY1 A;  2EO5 A;  3FDB A;  4P7Y A;  2VMZ A;  3ZZJ A;  3BWO A;  4KAM A;  3E6G A;  4Y0H A;  1AHG A;  3CAI A;  4ISY A;  5D95 A;  4WXF A;  1X2A A;  4IYO B;  4UHO A;  4R5F A;  1DJU A;  4A72 A;  3AOW A;  4Q75 A;  5LHA A;  1AMS A;  1DJE A;  1LC7 A;  2X3L A;  3W1H A;  3ASA A;  1M0N A;  5EAA A;  4XQ2 A;  1GBN A;  3A8U X;  4LC3 A;  4WYF A;  4A6T A;  4ADC A;  4CXR A;  3MEB A;  2VGU A;  1GC2 A;  4Y0I A;  4JEY A;  5E4Z A;  1TOI A;  2Z1Y A;  2C7T A;  1KL1 A;  3QI6 A;  3MAF B;  1GEW A;  1CQ8 A;  3BS8 A;  3AEP A;  3ZRP A;  1E5F A;  1GD9 A;  3QBO A;  2ZY4 A;  3LVM A;  3EUC A;  4B9B A;  1TOG A;  1C7N A;  2HOR A;  1I41 A;  2Z9V A;  3R4T A;  1WST A;  5DJ1 A;  3FFH A;  1OXP A;  4XJM A;  4BA4 A;  2G7J A;  2D5Y A;  3PDB A;  4CBR A;  2HP2 A;  1Z3Z A;  2W7E A;  4KYO A;  4WB0 B;  1M0O A;  1B9I A;  2VMN A;  2BI3 A;  3MAD A;  2D66 A;  3WCN A;  3FQ7 A;  3NRA A;  2VMS A;  1W7N A;  2X5D A;  3BWN C;  1T3I A;  2JG2 A;  5DB5 A;  2DOU A;  3NUI A;  2X5F A;  4WYE A;  1D7U A;  1S09 A;  1M6S A;  1EQB A;  2TPL A;  1SZK A;  1TAR A;  3F0H A;  1ARI A;  4U2H A;  4Q76 A;  2QA3 A;  2VGW A;  2W7G A;  1V2F A;  2BI9 A;  4M2M A;  2VMQ A;  4J5U A;  2RFV A;  4AO4 A;  2A1V A;  3TAT A;  4L0O A;  1FG7 A;  3FVS A;  4GE4 A;  4A0G A;  4WYG A;  1BJO B;  3FVU A;  1YNU A;  4F5J A;  1S06 A;  2D7Y A;  3WGC A;  3W1J A;  2JJE A;  4EU1 A;  1C7O A;  1OHY A;  3WY7 A;  2Z61 A;  1BJ4 A;  3BN1 A;  1KMJ A;  3ATH A;  1ARG A;  2BWP A;  3B1E A;  4KXK A;  1O69 A;  3AEL A;  5G2Q A;  4ITG A;  5EUN A;  4RAE A;  4ATQ A;  3HL2 A;  1GC4 A;  3COG A;  2CB1 A;  1AHY A;  1OHV A;  4WLH A;  2JGT A;  3N4S A;  2QLR A;  4ZSW A;  3KKI A;  4BMK A;  3RUY A;  5EUD A;  1CJ0 A;  4F5G A;  2VMV A;  2W7L A;  4F4E A;  1QJ5 A;  2VGT A;  4LW4 A;  3ZZK A;  1BKG A;  3AEO A;  1IAX A;  2WB6 A;  2BIA A;  3DXV A;  2CY8 A;  4K2B A;  2ORD A;  2V0Y A;  2W7H A;  4BHD A;  3A9X A;  4HVK A;  5M4D A;  3MBB A;  3PIU A;  1WYV B;  1E5E A;  4JEX A;  3H7F A;  3USF A;  2VMW A;  1FC4 A;  1WYT B;  2R5C B;  1JS6 A;  3H14 A;  3DRD A;  3BCB A;  1AAM A;  1WYU B;  4M2J A;  5EFS A;  3LVK A;  2FM1 A;  4W8I A;  4RJ0 A;  5G0A A;  4ADD A;  1V72 A;  2PO3 A;  4ZDP A;  3GBX A;  1AMQ A;  3GJU A;  4IXS A;  3ZRR A;  2CH1 A;  3TFT A;  4MSO A;  1Y4I A;  3BC8 A;  3DXW A;  3EI9 A;  4EMY A;  1CL2 A;  1P3W A;  2GQN A;  3HLM A;  3PAA A;  2OGE A;  1UU2 A;  2ZSM A;  4E3R A;  2Q7W A;  2HZP A;  3RI6 A;  4ADB A;  1GC3 A;  4K2M A;  3GZC A;  1KKJ A;  4JEZ A;  3PJ0 A;  3HT4 A;  1GEY A;  3WX9 A;  1ZOD A;  2AY8 A;  2VMX A;  2EYQ A;  1W7M A;  4Y0D A;  1N2T A;  3E9K A;  4WXB A;  4XJL A;  3FKD A;  4Q31 A;  2JJG A;  4WB0 A;  2BYL A;  2DGM A;  4AZK A;  5D5S A;  3VK4 A;  3BWN A;  1RVY A;  5I92 A;  1X0M A;  1IX8 A;  2E7I A;  1EG5 A;  2BI1 A;  3PD6 B;  4MGR A;  1VJO A;  5FT6 A;  3WKR A;  2AY5 A;  2VMU A;  3QPG A;  3EZS A;  2CIN A;  2VGZ A;  4GEB A;  3VP6 A;  2QMA A;  3RBL A;  2PB2 A;  1O62 A;  3II0 A;  1VEF A;  2BKW A;  1J04 A;  1AKC A;  4UQV A;  4XJP A;  5E3K A;  1AJS A;  4EB7 A;  1JG8 A;  4ZM3 A;  1XI9 A;  4TMR A;  2Z1Z A;  5EUE A;  4U1T A;  5HXX A;  1MAQ A;  1MGV A;  4LNL A;  5JAY A;  1BJN A;  4OBV A; 
#chains in the Genus database with same CATH homology
 4H63 Q;  5FT8 A;  1N31 A;  3FD0 A;  4ZDL A;  3ELP A;  4MKK A;  3GET A;  4FL0 A;  2BIE A;  1YIY A;  5C6U A;  1MDO A;  4N0W A;  1YJS A;  2BIG A;  3EI8 A;  3Q8N A;  3AEM C;  5DX5 A;  1S08 A;  3FQA A;  1X29 A;  4OC9 A;  5AX8 A;  4RKC A;  2CFB A;  1ARS A;  2DKJ A;  1H1C A;  1G4X A;  4ZAH A;  1U08 A;  1TPL A;  1WKH A;  2EH6 A;  2WK8 A;  3NYS A;  2QB3 A;  4MY5 A;  3ISL A;  1AY8 A;  2FNI A;  4W91 A;  4XEW A;  3RCH B;  2VMR A;  3QGU A;  3RQ1 A;  5K8B A;  4A0R A;  4JE5 A;  1ORD A;  3I4J A;  4ZM4 A;  2BYJ A;  3GWP A;  3PA9 A;  2Z67 A;  3A9Y A;  1YAA A;  3A2B A;  4NOG A;  3TCM A;  3AEN B;  4DQ6 A;  1YOO A;  2YRR A;  3EI5 A;  3E2Z A;  4WBT A;  1AHE A;  1OXO A;  4JEV A;  3F6T A;  2ZYJ A;  3I16 A;  3P6K A;  4F5K A;  3QHX A;  1IX6 A;  1WYU A;  2W8V A;  2HP1 A;  3BV0 A;  4JE5 D;  4E77 A;  1O61 A;  1ASD A;  4F5L A;  2ZJG A;  5LH9 A;  3QM2 A;  1Z7D A;  2E7U A;  2AEV A;  2VLH A;  3EIB A;  3ELE A;  3OKS A;  4PIW A;  3PDX A;  3DOD A;  4A0F A;  1D7R A;  2BI2 A;  2YOB A;  5EAV A;  2ZY3 A;  4F5M A;  3JWA A;  3G7Q A;  2JJH A;  3M5U A;  1DJ9 A;  2EGY A;  4CVQ A;  1QIR A;  1SF2 A;  3B1C A;  2CJG A;  4WLJ A;  1LW4 A;  2O7C A;  2XBN A;  4Q6R A;  1SPA A;  2CJH A;  5F8V A;  4LNM A;  1BW0 A;  2CJD A;  2VI9 A;  2HUF A;  3N75 A;  4RIZ A;  4AH3 A;  2C0R A;  1M4N A;  2HUU A;  3B1D A;  3UWC A;  3EI6 A;  4DGT A;  2DGK A;  2EZ1 A;  1ASC A;  2PB0 A;  4TV7 A;  3CQ5 A;  2BI5 A;  2V1P A;  3NNK A;  3KGX A;  5M4B A;  1ARH A;  4OCA A;  3N5M A;  1ELQ A;  4RM1 A;  5G2P A;  3E2Y A;  3P1T A;  2FYF A;  2YCP A;  2ZP7 A;  8AAT A;  4WP0 A;  1PMM A;  4ZLV A;  4PFF A;  2AY7 A;  2HUI A;  1O4S A;  2Z9X A;  1LW5 A;  3B8X A;  1QJ3 A;  3NYU A;  1MAP A;  1LS3 A;  4IYO A;  4PFN A;  4MQP A;  2CH2 A;  4R2N A;  1M0Q A;  3UE8 A;  4J8L A;  1UU0 A;  2D61 A;  2GMS A;  1ECX A;  3PDB B;  1V2E A;  3ASB A;  1LC8 A;  4MQR A;  4W1V A;  4ATP A;  1LK9 A;  2DKB A;  2R0T A;  1J32 A;  2YRI A;  1QIT A;  2KFP A;  3W1I A;  4I8A A;  4N0B A;  2GB3 A;  4P3M A;  2GSA A;  3VOM A;  2HOZ A;  1B9H A;  1C4K A;  2OKJ A;  4E1O A;  1BJW A;  2W8J A;  3GR9 A;  3MAF A;  1H0C A;  3L44 A;  1G7X A;  2YKU A;  3AEM A;  3G0T A;  2YKX A;  1IAY A;  2D63 A;  2YKY A;  2C81 A;  3BCX A;  3RBF A;  3FZ6 A;  1BQD A;  2VGS A;  1GDE A;  3NUB A;  2FKI A;  3AOV A;  3R9A A;  1C0N A;  4W1X A;  1AIC A;  1ASE A;  4RKD A;  5BJ3 A;  3FCR A;  4GE7 A;  2YCN A;  3HBX A;  5M49 A;  2F8J A;  3WCO A;  1C7G A;  2FQ6 A;  4UHN A;  3RCH A;  3GZD C;  3DU4 A;  1UU1 A;  4IXZ A;  1B4X A;  2YCT A;  2DGL A;  5J8Q A;  1D7S A;  4LNJ A;  4F5I A;  5FT4 A;  3VK3 A;  2WK9 A;  1B8G A;  4ADE A;  2W7F A;  4JEW A;  1OHW A;  1X28 A;  1MDX A;  2NMP A;  1ELU A;  3KGW A;  4CBS A;  4ZWV A;  5FT5 A;  3LG0 A;  2AY4 A;  4EB5 A;  2W7D A;  2ZC0 A;  1D2F A;  1QZ9 A;  3AAT A;  4OYT A;  1ASB A;  1M32 A;  3FDD A;  1RVU A;  1YJZ A;  4M2K A;  4ZDO A;  5IWQ A;  2AY9 A;  2HOY A;  2VMP A;  3VK2 A;  1BJO A;  1JF9 A;  2ZSL A;  4RIT A;  1ASG A;  3MC6 C;  1ASN A;  4XK1 A;  4QGR A;  5BJ4 A;  1JS3 A;  1GCK A;  4TN4 A;  5TF5 A;  1AY4 A;  3NU8 A;  1FG3 A;  2O0R A;  2OGA A;  3JTX A;  1MLZ A;  4DBC A;  3BCA A;  1AMR A;  4BQ0 A;  2HOX A;  1IVR A;  1QGN A;  1W3U A;  2VMT A;  3FZ7 A;  1DGD A;  1OAT A;  2QSR A;  2O1B A;  4JF0 A;  1LC5 A;  1D7V A;  4ZAS A;  4B98 A;  2BWN A;  3AV7 A;  4R8D A;  2AY6 A;  2Z9U A;  4A00 A;  1W23 A;  4JF1 A;  2VLF A;  1PG8 A;  4IXO A;  2OAT A;  2VI8 A;  2W8U A;  5EIG B;  3NDN A;  2EZ2 A;  3LY1 A;  3N7N A;  1V2D A;  1N8P A;  1WYV A;  3D6K A;  3EI7 A;  3FZ8 A;  1IJI A;  2CTZ A;  3FQ8 A;  1RV3 A;  3AEJ C;  2W7J A;  5F9S A;  3N4R A;  1TAS A;  1WYT A;  3BB8 A;  2R5C A;  1KL2 A;  4RJY A;  3T32 A;  1AX4 A;  2AY3 A;  2D65 A;  3F9T A;  1PFF A;  3OP7 A;  5HDM A;  4PVF A;  4K05 A;  5G4J A;  1DFO A;  4A6R A;  3LWS A;  2G6W A;  1AIA A;  2DR1 A;  3PGY A;  3DR7 A;  1G7W A;  1TAT A;  3JZL A;  5G09 A;  1S0A A;  5G4I A;  1MLY A;  3K28 A;  3E77 A;  3WGB A;  1G4V A;  4XJO A;  4OBU A;  1CZC A;  1M0P A;  7AAT A;  1CL1 A;  1AHX A;  1SZS A;  1SZU A;  1UKJ A;  3K40 A;  3CQ4 A;  3FVX A;  4CXQ A;  4FFC A;  1AJS B;  1BQA A;  1BT4 A;  1AAW A;  1SFF A;  2E7J A;  1AHF A;  1DKA A;  1C9C A;  3DZZ A;  4A0H A;  3GZD A;  4WYA A;  2EPJ A;  4AO9 A;  1S07 A;  2AEU A;  1ZOB A;  3GSB A;  2W7I A;  9AAT A;  2W7K A;  3DR4 A;  3VAX A;  3PD6 A;  3NTJ A;  4F5F A;  1I29 A;  2WKA A;  3MAU A;  2YHK A;  4WXG A;  2JIS A;  4GSA A;  4RLG A;  4W5K A;  3HQT A;  5DJ9 A;  4W1W A;  4H51 A;  2CAN A;  3EZ1 A;  1YIZ A;  1WKG A;  2AAT A;  3NYT A;  2VMO A;  2ZY2 A;  1ART A;  2W8T A;  1DTY A;  4O6Z A;  3FFR A;  3N4X A;  1MDZ A;  2JJF A;  4ITX A;  4XAU A;  1TOK A;  3FSL A;  2OQX A;  3PPL A;  1CZE A;  1EJI A;  1KMK A;  3KE3 A;  3MKJ A;  1I43 A;  2WK7 A;  3MC6 A;  4UHM A;  4EFF A;  1YJY A;  1IUG A;  4A6U A;  5KTB A;  2BWO A;  2OKK A;  2R2N A;  4GRX A;  4LW2 A;  1CQ7 A;  4IW7 A;  1IBJ A;  1QIS A;  4OMA A;  1ASA A;  1AY5 A;  3IF2 A;  1TOE A;  2BHX A;  3CQ6 A;  3FTB A;  3NU7 A;  2D64 A;  1BS0 A;  1AMA A;  1CS1 A;  1GEX A;  1KKP A;  2GMU A;  2VIA A;  3E2Z B;  3ECD A;  3IHJ A;  4IX8 A;  4UOY A;  1XEY A;  1ASL A;  2VYC A;  1I48 A;  3NX3 A;  5M46 A;  2Z9W A;  2VGV A;  3A9Z A;  4ZSY A;  1IX7 A;  2R5E A;  2VMY A;  1CQ6 A;  4WD2 A;  3JU7 A;  1AKA A;  3K7Y A;  3ZRQ A;  2VIB A;  4F5H A;  4AOA A;  3CBF A;  4WYC A;  3I5T A;  5E5I A;  2ZY5 A;  2FN6 A;  1M7Y A;  3DYD A;  2CST A;  1PMO A;  2D7Z A;  2W8W A;  3B46 A;  1RV4 A;  5EIG A;  3LVJ A;  4E3Q A;  1AKB A;  1SVV A;  2XH1 A;  4GDY A;  2E54 A;  5EQC A;  1ZC9 A;  3G8M A;  3WKS A;  4BA5 A;  2YKV A;  1VP4 A;  3AEN A;  2W7M A;  3HMU A;  3AEJ A;  4K2I A;  1AJR A;  2QBT A;  3HDO A;  2QB2 A;  3JW9 A;  3H9X A;  4HF8 A;  2AY2 A;  1TOJ A;  1B5P A;  3DC1 A;  3LVL B;  4MKJ A;  4MQQ A;  3N0L A;  4IY7 A;  1LKC A;  3WZF A;  3HVY A;  3LV2 A;  1DGE A;  4GE9 A;  5HHY A;  2ZUK A;  4OT8 A;  4R5Z A;  1W7L A;  2Z20 A;  3UAK A;  1AIB A;  3TQX A;  1ASF A;  4OTL A;  3ACZ A;  3QN6 A;  3L8A A;  1B5O A;  4WYD A;  1GC0 A;  2C44 A;  1ASM A;  2FNU A;  3WLX A;  3TFU A;  2X8U A;  4ZWM A;  3FRK A;  3EIA A;  4AZJ A;  3E2F A;  3JWB A;  2AY1 A;  2EO5 A;  3FDB A;  4P7Y A;  2VMZ A;  3ZZJ A;  3BWO A;  4KAM A;  3E6G A;  4Y0H A;  1AHG A;  3CAI A;  4ISY A;  5D95 A;  4WXF A;  1X2A A;  4IYO B;  4UHO A;  4R5F A;  1DJU A;  4A72 A;  3AOW A;  4Q75 A;  5LHA A;  1AMS A;  1DJE A;  1LC7 A;  2X3L A;  3W1H A;  3ASA A;  1M0N A;  5EAA A;  4XQ2 A;  1GBN A;  3A8U X;  4LC3 A;  4WYF A;  4A6T A;  4ADC A;  4CXR A;  3MEB A;  2VGU A;  1GC2 A;  4Y0I A;  4JEY A;  5E4Z A;  1TOI A;  2Z1Y A;  2C7T A;  1KL1 A;  3QI6 A;  3MAF B;  1GEW A;  1CQ8 A;  3BS8 A;  3AEP A;  3ZRP A;  1E5F A;  1GD9 A;  3QBO A;  2ZY4 A;  3LVM A;  3EUC A;  4B9B A;  1TOG A;  1C7N A;  2HOR A;  1I41 A;  2Z9V A;  3R4T A;  1WST A;  5DJ1 A;  3FFH A;  1OXP A;  4XJM A;  4BA4 A;  2G7J A;  2D5Y A;  3PDB A;  4CBR A;  2HP2 A;  1Z3Z A;  2W7E A;  4KYO A;  4WB0 B;  1M0O A;  1B9I A;  2VMN A;  2BI3 A;  3MAD A;  2D66 A;  3WCN A;  3FQ7 A;  3NRA A;  2VMS A;  1W7N A;  2X5D A;  3BWN C;  1T3I A;  2JG2 A;  5DB5 A;  2DOU A;  3NUI A;  2X5F A;  4WYE A;  1D7U A;  1S09 A;  1M6S A;  1EQB A;  2TPL A;  1SZK A;  1TAR A;  3F0H A;  1ARI A;  4U2H A;  4Q76 A;  2QA3 A;  2VGW A;  2W7G A;  1V2F A;  2BI9 A;  4M2M A;  2VMQ A;  4J5U A;  2RFV A;  4AO4 A;  2A1V A;  3TAT A;  4L0O A;  1FG7 A;  3FVS A;  4GE4 A;  4A0G A;  4WYG A;  1BJO B;  3FVU A;  1YNU A;  4F5J A;  1S06 A;  2D7Y A;  3WGC A;  3W1J A;  2JJE A;  4EU1 A;  1C7O A;  1OHY A;  3WY7 A;  2Z61 A;  1BJ4 A;  3BN1 A;  1KMJ A;  3ATH A;  1ARG A;  2BWP A;  3B1E A;  4KXK A;  1O69 A;  3AEL A;  5G2Q A;  4ITG A;  5EUN A;  4RAE A;  4ATQ A;  3HL2 A;  1GC4 A;  3COG A;  2CB1 A;  1AHY A;  1OHV A;  4WLH A;  2JGT A;  3N4S A;  2QLR A;  4ZSW A;  3KKI A;  4BMK A;  3RUY A;  5EUD A;  1CJ0 A;  4F5G A;  2VMV A;  2W7L A;  4F4E A;  1QJ5 A;  2VGT A;  4LW4 A;  3ZZK A;  1BKG A;  3AEO A;  1IAX A;  2WB6 A;  2BIA A;  3DXV A;  2CY8 A;  4K2B A;  2ORD A;  2V0Y A;  2W7H A;  4BHD A;  3A9X A;  4HVK A;  5M4D A;  3MBB A;  3PIU A;  1WYV B;  1E5E A;  4JEX A;  3H7F A;  3USF A;  2VMW A;  1FC4 A;  1WYT B;  2R5C B;  1JS6 A;  3H14 A;  3DRD A;  3BCB A;  1AAM A;  1WYU B;  4M2J A;  5EFS A;  3LVK A;  2FM1 A;  4W8I A;  4RJ0 A;  5G0A A;  4ADD A;  1V72 A;  2PO3 A;  4ZDP A;  3GBX A;  1AMQ A;  3GJU A;  4IXS A;  3ZRR A;  2CH1 A;  3TFT A;  4MSO A;  1Y4I A;  3BC8 A;  3DXW A;  3EI9 A;  4EMY A;  1CL2 A;  1P3W A;  2GQN A;  3HLM A;  3PAA A;  2OGE A;  1UU2 A;  2ZSM A;  4E3R A;  2Q7W A;  2HZP A;  3RI6 A;  4ADB A;  1GC3 A;  4K2M A;  3GZC A;  1KKJ A;  4JEZ A;  3PJ0 A;  3HT4 A;  1GEY A;  3WX9 A;  1ZOD A;  2AY8 A;  2VMX A;  2EYQ A;  1W7M A;  4Y0D A;  1N2T A;  3E9K A;  4WXB A;  4XJL A;  3FKD A;  4Q31 A;  2JJG A;  4WB0 A;  2BYL A;  2DGM A;  4AZK A;  5D5S A;  3VK4 A;  3BWN A;  1RVY A;  5I92 A;  1X0M A;  1IX8 A;  2E7I A;  1EG5 A;  2BI1 A;  3PD6 B;  4MGR A;  1VJO A;  5FT6 A;  3WKR A;  2AY5 A;  2VMU A;  3QPG A;  3EZS A;  2CIN A;  2VGZ A;  4GEB A;  3VP6 A;  2QMA A;  3RBL A;  2PB2 A;  1O62 A;  3II0 A;  1VEF A;  2BKW A;  1J04 A;  1AKC A;  4UQV A;  4XJP A;  5E3K A;  1AJS A;  4EB7 A;  1JG8 A;  4ZM3 A;  1XI9 A;  4TMR A;  2Z1Z A;  5EUE A;  4U1T A;  5HXX A;  1MAQ A;  1MGV A;  4LNL A;  5JAY A;  1BJN A;  4OBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...