1CQ9A

Peanut lectin-triclinic form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the peanut lectin-lactose complex at acidic pH: retention of unusual quaternary structure, empty and carbohydrate bound combining sites, molecular mimicry and crystal packing directed by interactions at the combining site.
pubmed doi rcsb
molecule tags Lectin
molecule keywords PROTEIN (PEANUT LECTIN)
total genus 53
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cq9A00
2GNBA 2R0HA 4LBOA 3ZSMA 4Y1VA 2YV8A 2XG3A 1N3QA 1V00A 4XIOA 2OVUA 4Q1RA 2ZA9A 4ZXKA 2CWMA 2JDZA 1S1AA 3POWA 5CB7A 2PHXA 3PJQA 1JUIA 2RHPA 2W52A 2AH2A 2ZGLA 2JE9A 2WT1A 5GLWA 1W6NB 3WG4A 2VUAA 2YMZA 4ATFA 3NV2A 2DVGA 4FPLA 1QNWA 2GN7A 2D6KA 2E7TA 1UL9A 4D69A 4YM3A 1GV9A 1PZ7A 3LSDA 2UU8A 5F9TA 2VW2A 3SNMA 2D3SA 4XJ8A 1YRZA 1AF9A 1WW5A 4WVWA 1LGCA 4W65A 3V64A 2NZ9A 2EIGA 1CESA 2EXJA 4XOGA 5IK8A 1FV2A 4XJ9A 3U4XA 4XMIA 1AJOA 2PHRA 1UZZA 2CL2A 2DVDA 3ZXFA 1UAIA 1N47A 4BMBA 3V0BB 3ZXLA 4XYXA 4MYEA 4NOTA 2UURA 3WDUA 2ARXA 1KITA 2ZGQA 1QOSA 2D3RA 4M3CE 4XHBA 3RG0A 1W6PA 1JBCA 3M3CA 3WG3A 2ZHKA 3DUIA 1MVQA 1PZ8A 1YXWA 1FX5A 1V6MA 3AZZA 1KRIA 4YG6A 3M3OA 1CR7A 1SLLA 1ENQA 3RRDA 2P37A 4R9DA 2WKKA 1BYHA 2CYFA 4M01A 1V6KA 5GZEA 4WVVA 3UL2A 2WSUA 1UKGA 3ILRA 2WSVA 4FPKA 4PF5A 5GLUA 1SLTA 2XB6C 1LOEA 1QOOA 3CNAA 1H30A 1BJQA 2DVAA 2YY1A 1DYPA 5KXEA 1AXZA 4BMEA 3WHUA 3D4KA 2D43A 1SLCA 1DBNA 1WW4A 2E6VA 2WT0A 1DQ6A 1JW6A 1GNHA 1S0CA 3VKMA 2EXHA 1GNZA 4BQ1A 1MVEA 1N3OA 1LESA 1OFSA 1AXKA 1YYNA 3AK0A 2A3WA 2A75A 2E7QA 3RQ0A 1KJRA 2GNMA 1S0EA 1LU2A 3FLRA 1HQLA 3WUDA 3SITA 3N7MA 4BLIA 1G9DA 1DQ4A 1WD4A 2R16A 2A3YA 3HR9A 1GANA 4YGBA 5DUVA 1LOFC 1W6MA 4XBQA 1ULCA 1QDCA 2SBAA 4BOWA 4LBLA 3NV3A 2ZMNA 3APBA 3FUOA 3RMYA 5KXBA 1CONA 2PELA 4FOWA 1V6OA 3BODA 5IK7A 5H9SA 4FOVA 4Z8BA 1LECA 4XJUA 1LOCA 1W6QB 4HANA 4ATEA 5GLVA 2DUOA 2EAKA 2Q5TA 2EALA 4Q26A 3AYCA 5L73A 1BQPA 2ZBJA 3WDVA 3TB0A 5EYYA 4Q1PA 1DZQA 3IN9A 1V6JA 2EXIA 1UMZA 3I8TA 5FRAA 3QCWA 3V0BA 4GALA 4IQPA 4FOYA 4RL7A 2VW0A 2WT2A 4JRAA 1TEIA 4DRRA 3OY8A 4YM0A 5DG1A 1LHOA 3WDYA 1G9AA 1D2SA 5T5LA 1IKPA 4YM2A 1LU1A 1WLWA 3AZYA 4UW3A 3VKFC 1I1EA 2DUQA 1C57A 1FV3A 2GN3A 5DXDA 3NWKA 1KJLA 2DV9A 3WG2A 2ZGMA 4AGVA 1IOAA 1GZWB 3AFKA 2D7FA 1G9CA 3FFZA 2OUHA 1RIRA 3A0KA 2FHRA 3POYA 3PMEA 1FYUA 4PBPA 2DU1A 4XILA 4XTPA 1ENRA 1PZ9A 1WLDA 3LCPA 4XTMA 4YW5A 3IM0A 3V65A 4GWNA 4UW5A 4ITCA 1MS3A 3ASIA 4YG3A 1V6NA 3ZSJA 1CPMA 2PHWA 1UN1A 2GALA 1JYIA 4Y24A 4AGRA 4YW1A 1SBFA 4XIKA 2TEPA 1GSLA 2GMEA 3ATGA 4LBKA 1IS4A 1ULFA 3R05A 3AJZA 4Y20A 2NM1A 1QNYA 2AGSA 1LGBA 1GZCA 3A0NA 4K20A 4ISRA 5DUUA 5GM0A 2JD4A 1Z0HA 1U0AA 2VW1A 3OGGA 4BLJA 5IK5A 1MS0A 4FPHA 5F5QA 4K1ZA 3GNEA 4Y1XA 3VKLA 1CQ9A 3R4UA 4P9YA 5BYNA 2A3XA 2WJSA 5EWSA 1UPSA 4XZPA 3UK9A 3WUCA 2SLIA 5T54A 3L2YA 3BOPA 1X50A 2ZGTA 1LOBA 2JECA 3H0OA 2R1BA 1AX0A 1DYKA 1SCRA 3BIWE 4YFWA 2NN8A 1ULEA 1FATA 1LTEA 1RINA 4Y1YA 4XE9A 2D6NA 1SLAA 2GMMA 1CPNA 4AVSA 1DQ2A 2A5ZA 1GZWA 2A6YA 1IS3A 1KDMA 2D6OX 1SBEA 3A4UA 2PHTA 4YW4A 4YGEA 2AREA 3WVJA 1WW6A 4YZ5A 1QF3A 1VAVA 3WNXA 5IUQA 1AZDA 4L8QA 3B69A 4XJAA 5E88A 1AJKA 2BQPA 4AWDA 1B09A 2YXSA 1JYCA 1LENA 4TYSA 5GZDA 2A70A 1LHWA 1LOGA 1D0HA 3ILFA 5E8AA 4PQ9A 5GZFA 4FP3A 4Q8LA 3N7LA 3FBYA 1YIFA 2W08A 2ZGOA 4ZKTB 3D5OA 1A78A 1BXHA 1DQ1A 1FNZA 1O4YA 2D6LX 3VKNA 2EXKA 1MACA 3HMYA 4YM1A 2ZABA 1MZ5A 3AJYA 3AYDA 1RITA 1SLBA 1BZWA 2EF6A 4XXAA 5GZCA 3B01A 2YZ4A 3OYWB 4K21A 2I2SA 1LHVA 1YO8A 2DUPA 3OBRA 1S0IA 1W6PB 3N7JA 2CNAA 4XHXA 2JE7A 1LEDA 5HCAA 2JJ6A 2DTYA 4YZ3A 1HQWA 3B00A 3R4SA 4GWMA 5T55A 3USUB 1DLLA 4XXPA 1LULA 4Q27A 4AGGA 1G9BA 3WDTA 1GZ9A 2GMPA 3MEPA 5JMCA 5GJ6A 4BM8A 1GICA 4FPGA 1DQ0A 1WD3A 1OKQA 1W0OA 4FP2A 1SCSA 2CTVA 5GALA 1APNA 2ES3A 3SH3A 4DFSA 3M2MA 3AXEA 1GLHA 2GNTA 1SFYA 1W0PA 3VV1A 3KM5A 4FPCA 5CA6A 4XMAA 2Z42A 4SLIA 1ZM1A 2ZGSA 1G9FA 2ZHNA 5GLTA 5H9PA 4GKYA 3O5SA 1AXYA 1N1SA 1Y7BA 4C1XA 1DHKB 5T50A 2ZGNA 2ARBA 1HKDA 3N36A 3VKOA 2W39A 2ZGKA 3PVEA 4P14A 4XDQA 3SH4A 4PBOA 3WOGA 1WLCA 2HYKA 1ULGA 4LBJA 1SBDA 1XQNA 5JOZA 3T2TA 1MS8A 1ZA4A 1W6OA 3AP5A 4H55A 4Y1ZA 1Q8PA 2VXRA 3WHTA 1H9PA 1QOTA 2A71A 2WLQA 1G8WA 1N1YA 3IPVB 4DRVA 4AVTA 4Y20B 3ZSKA 2ZMLA 3AZWA 4OZXA 1LCLA 5T5OA 1Q8SA 3RS6A 2PHFA 3B9CA 3JU9A 2LTNA 1CIWA 4U2AA 5LK5A 4M3CF 3WDXA 1SACA 2DURA 3MPPG 3WDWA 1LGNA 1AVBA 1J1TA 5AVAA 4R9AA 1A3KA 1Q8QA 2G4IA 4FPOB 1GKBA 4PCRA 4P9WA 5H9QA 1IKQA 4UW4A 4GKXA 1UZYA 1FNYA 3AZXA 1WW7A 1MZ6A 3IMNA 4Y22B 2D6MA 5DZFA 2JKBA 4UW6A 3OBTA 4YGDA 1EPWA 5JDBA 2R0FA 3AP7A 4K1YA 3SISA 5JOXA 2WNEA 4BPZA 3ZXJA 4C1WA 3ZSLA 1MR5A 5DG2A 5JLVA 1MS4A 1QU0A 2A6VA 1QKQA 3ZYRA 1N1TA 4YGCA 4TZDA 4HL0A 5FREA 2R49A 1DGLA 1S0BA 2W68A 3O0WA 3POSA 1ULDA 3V0AB 3ZYPA 5GZGA 4AVVA 3OY8B 1MS9A 1UX6A 2VH9A 3M3QA 3O0VA 2UWBA 2B7YA 2ZACA 1GYKA 1URXA 5DUXA 2ZZJA 3TAYA 2NP0A 4R9CA 2YROA 2DVBA 3PVOA 1S0JA 1F5FA 1LOAA 4FOQA 5EXOA 2AENA 3T1MA 1NXD1 2ZHMA 4YFZA 3N3HA 1V6LA 2ZMKA 1CN1A 1LOFA 3MW3A 3HN1A 3IPVA 4NO4A 5DZGA 1Z78A 4CTEA 1QDOA 2ZKNA 3WLUA 3BTAA 1S0DA 5KXCA 1W6OB 4YZ2A 1GBGA 1DIWA 1W6QA 2DVFA 2P34A 4FQ4A 1LODA 3IKWA 1JN2P 5CNAA 2UWAA 2NMNA 3N35A 3WCSA 1H9WA 4KBBA 4LBQB 4AYUA 1DQ5A 1V6IA 2ZAAA 3I4IA 2A6WA 2P3JA 1N1VA 2DWRA 1CJPA 5SV8A 2PHUA 1C1LA 3FLTA 3T1LA 2FMDA 4ASMB 1MS1A 4WZFA 1F9KA 1AX1A 1W6MB 1ONAA 2ZGUA 4Q8KA 4XBLA 4XBNA 2D6PA 4CZSA 5JVVA 1HDKA 1Q8OA 1S0GA 4DS0A 1WBFA 3QLQA 4M00A 1C4RA 1DFQA 3AYEA 5GLZA 1I3HA 1IS6A 2P2KA 4DPNA 4LBMA 2C5DA 4M3CA 3RMXA 5T52A 3ZXEA 2DU0A 4FPYA 2VU9A 3WZ1A 4FPEA 3O0XA 2NYYA 3WV6A 4JCKA 2OUJA 3B3QE 1F31A 2V73A 4JC1A 2NMOA 2DYCA 3KQRA 3USUA 4LBQA 2OW4A 5CAZA 4YG0A 4Y1UA 3WG1A 5JOYA 4YW2A 3N7KA 2H0BA 2D3PA 5HCBA 5H9RA 2DTWA 1OQ1A 2P3IA 5T5JA 3ILNA 3INAA 4WV8A 4F83A 3OYWA 2WQZC 2AR6A 1IS5A 1JXNA 3Q9OA 2AUYA 1S0FA 2A6ZA 2AYHA 4FPJA 1BKZA 1FAYA 1LEMA 2E51A 1WCSA 2GNDA 2GDFA 2KM2A 3GALA 4FPFA 1NLSA 1LHUA 4ISQA 5DUWA 5T5PA 2R1DA 1QGLA 3PVNA 4R9BA 4CRQA 1LJ7A 4LBQD 2E53A 2ENRA 4LBNA 3W59A 2LALA 3D6EA 1G7YA 1G86A 2UWCA 3JUUA 3LSEA 1CVNA 3UJOA 3ZPYA 4YZ4A 1KQRA 1VALA 2CY6A 1VAMA 3V0AA 1SLIA 2C9AA 3RSJA 3M3EA 3SH5A 4P9XA 3FUQA 5HCFA 1A8DA 1VIWB 1ENSA 1QMJA 1O4ZA 2A7AA 3AYAA 3MW4A 3ZXKA 1JHNA 1HLCA 4M3CB 2P3KA 2A6XA 2D44A 1MS5A 3OPZA 4Y22A 1LHNA 3M1HA 3MW2A 4Q2FA 2ZGRA 5IK4A 4I30A 3O12A 5JOWA 3VUOA 1KDKA 4FQZA 5IT6A 3OJBA 1YI7A 1Q8VA 3NV4A 3AP4A 1C1FA 3AZVA 4GA9A 3NV1A 4XJZA 1N3PA 1VLNA 1WBLA 2VY0A 4FVVA 2V5YA 1W6NA 3AP9A 2ZHLA 2CWSA 4YZ1A 5KXDA 3AP6A 5CBLA 5EYXA 3UJQA 1AX2A 3ZVXA 1R1ZA 4YLZA 4RA0A 4GXLA 4XJWA 1WUVA 4YW3A 1JOJA 3C2UA 4Y26A 3W58A 4U36A 3AXDA 3ENRA 2ERFA 3WCRA 2ZGPA 5E89A 3DGTA 4DQAA 3SLIA 5DZEA 1Q56A 3AX4A 3FLPA
chains in the Genus database with same CATH superfamily
5TSWA 3ZFEA 3GHNA 2XG3A 1N3QA 3NNMA 4XIOA 5EJ1B 3BTXA 3GYDA 3ZXGA 3UT0A 2JDZA 1CIYA 3G6JB 1OXCA 3POWA 2PHXA 1C8NA 1JUIA 2RHPA 2W52A 1XNDA 2VQUA 2JE9A 4HLTA 4LT5A 1W6NB 1DG6A 4GB31 5E16A 2YMZA 5KHIA 3J7MA 3NV2A 2DVGA 1RUF2 4FPLA 4YRDA 3LPGA 1M4WA 4OI2A 4D69A 4MGSA 5F3EA 2Q8OA 4YM3A 1GV9A 1FT9A 3IB3A 5FZCA 2XPJA 4JTOA 4QDQA 4CU6A 1WMEA 2D3SA 5FP8A 1AF9A 1PMIA 4PIXA 1LGCA 2QFEA 2NZ9A 4HKOA 1FV2A 4NWVA 4XJ9A 1YQ8A 1QIQA 4P00B 1RC6A 1BBT3 4DY3A 4IV3A 4JGYB 4KBZA 1MZEA 1UZZA 2CL2A 3ZXFA 4HZFA 3ZXLA 4XYXA 5FZFA 2JG9B 2UURA 2XUMA 1EAH1 3DECA 3P5BA 4HSJA 4E4DX 3OBAA 3UKTA 1QOSA 4M3CE 4XHBA 3JD71 1ZX5A 2ZHKA 3ZN4A 2WO7A 1QJFA 3ZIXA 3LOBA 1YXWA 1UKRA 3VBSA 1W9SA 1H0BA 2XUEA 3TNPB 4FAGA 3RRDA 1DLCA 2WKKA 2VCCA 1V6KA 2YPJA 4QQLA 1FPN3 4JV4A 5A6XA 4HN0A 3UL2A 2EAAA 2WSUA 5IAXA 1UKGA 1PIV3 3UKVA 4S2FA 1W2NA 1TMF1 2F4PA 3T2QA 1OC1A 1QOOA 1W3XA 5FYMA 4I09A 5CYYA 1ULPA 1BJQA 3KV5A 2VECA 2YY1A 4XUQA 5A7PA 2IXIA 2PMWB 3N9NA 5FZOA 3J8F1 4QX5A 5CISA 1RUD1 1ZYBA 2D43A 1COV1 3WY6A 4D6RA 2C9KA 2WS93 4DUWA 4JRLA 5G04L 1H4GA 3GJAA 3K2OA 4D6SA 4BQ1A 2FCVA 4XACA 2QQLA 4N9HA 1MVEA 1ODNA 5F32A 5F6KA 3RZGA 1ASJ1 1OFSA 3RFRA 2VZSA 2V72A 1AXKA 2A3WA 2GSYA 4A6OA 3KHCA 3H1MA 2XJQA 2FDKA 1UWWA 1NCRC 1HQLA 3FLRA 2FCTA 1G9DA 4TTGA 1Z7S2 1QH7A 1DQ4A 2TNFA 3U0ZA 3HR9A 5CZKA 4YVSC 1L7RA 5BNOC 4AI9A 5FBJA 1LOFC 4XBQA 3BVCA 3LEIA 2WWSA 1US2A 1E5IA 2Y8KA 1QDCA 1RXFA 2SBAA 4LEJA 2OZ6A 1F35A 1H1IA 1QJY3 2PHDA 3APBA 3FUOA 3NV3A 4MV2A 1QQP3 4UFMA 5FO8B 1XU2A 3UNPA 3ACIA 1CONA 1WGPA 2VMDA 4B1MA 3GZUC 5FP7A 5FPXA 3BODA 3PNAA 5IK7A 1CX1A 4TWTA 3OG2A 4L92A 3VBFB 4XFHA 2XJRA 3URFA 4ATEA 2DUOA 4QQHA 4I3PA 1VBC3 3NRUA 3I3EA 5D21A 5I91A 5FOBB 3I59A 4HPKB 1W2UA 3OGJA 4JVAA 2R071 3MI8A 2GAUA 4WVMB 4FSJA 4QB6A 2YG0A 3VBOB 5IATA 1GQPA 1V6JA 4O61A 1B35B 2LUWA 2ZX2A 1TMF3 4PI0A 4YWAA 5EFUA 2W91A 5CKNA 2P5BA 4JRAA 3PURA 4DRRA 2R072 1D2SA 1H8TB 4LUMA 1LU1A 3VKFC 4D8MA 4UW3A 1I1EA 1O91A 1BMV1 4HK9A 2V4AA 5DXDA 3ZN6A 2HEWF 4ZU7A 4LO7A 2D7FA 3IIAA 5L7OB 1AUYA 1W04A 1YCIA 2CGNA 2PQSA 3A0KA 5FR3A 1JZ8A 1ULOA 3QH7A 4PBPA 4TXWA 1PZ9A 1WLDA 4KL1A 5FXVA 1EUTA 2EVXA 5JI7A 4TSVA 3V65A 1MEC1 1VBD1 4GWIA 3OUJA 4YG3A 1V6NA 3MIGA 2BPA2 1GZTA 4FXKB 4RSUA 3LAGA 1YWKA 3KVAA 1FPN2 2HWE1 3RZJA 1GSLA 1ZZ6A 4E27A 2XKPA 3POGA 4I0WB 4MHUA 3SC7X 3ATGA 2X8KA 4E9KA 1CAXB 1IS4A 4NPMA 1UXXX 4G4FA 1MEC3 2VJXA 3R05A 3KCYA 4AHXA 4Y20A 5T5JA 2Q1MA 2HWC2 5DUUA 1JYNA 5DAWA 4AI3A 2VW1A 3OGGA 2DDUA 4WM8A 2BOJA 4A3XA 2CGPA 2RS31 2IWGB 4K1ZA 3JB8A 2WS92 3VHPA 4ASKA 4BB3A 4DUXA 4XCBA 4Q4V1 2WA3A 3ZFGA 4XZPA 4PHZA 3VDBA 1J1LA 2C24A 3JZVA 4PLOA 5FLHA 3RJ2X 2W92A 3BN6A 4MO3M 5C8CC 5EHDA 3O1SA 3SEPA 1PO21 2R1BA 1AX0A 1K5MB 2WWUA 3CO2A 5C5UA 5DDJ1 4XFCA 3LDRA 1SLAA 3E5QA 3OGVA 2FBEA 4CDWB 3T2PA 3B7MA 1SPPB 4XQ4A 5FYVA 1ZBA1 3RDIA 3O7OA 3MIFA 1IS3A 2W1QA 5EP9A 5FZHA 4WM7C 3WVJA 4YZ5A 1QF3A 1RUOA 4IE0A 3DN7A 2XL7A 3E1F1 3I2HA 3PUHA 4PF1A 4AAPA 3IWZA 4CDUC 5FWEA 4CEYB 5F2SA 4BQ4A 2YXSA 1JYCA 3UESA 4KNCA 1VBC2 1D0HA 5E8AA 4B4QA 3A7QA 4FP3A 4LOSA 4EN8B 1YIFA 2DCJA 3WEZA 3VKNA 2D6LX 3FBMA 4CCCA 1UY3A 5EJZB 1RITA 1SLBA 1AR61 2EF6A 4RHV2 4M0HA 3J4UH 5GZCA 3OYWB 4K21A 2W5FA 1BMV2 1FOD2 2DUPA 3OBRA 1W6PB 2PAKA 4XETA 4YZ3A 4AAXA 3LEKA 4BQWA 3R4SA 4GWMA 1W8OA 4RQPC 1ALYA 3WF3A 4I0BA 5CFCC 3LWCA 1GZ9A 1KGYA 1W8FA 2PLV3 3S5QA 5IVFA 4NHYA 4FFGA 5JMCA 5GJ6A 4BM8A 4W6WA 4X8PA 3AM2A 5GKAC 4XVHA 2VG9A 3NNFA 4FP2A 5GALA 1APNA 2XJSA 4C8DA 2ES3A 1I6XA 3VD7A 3T3YA 5ISLA 2J1VA 3D0JA 1SFYA 3ACHA 2WUHA 3P6BA 4RR3C 5IVJA 5JSPA 4XMAA 2CV6A 1SHWB 3LIGA 2ZGSA 4LE4A 4LHLA 5FCCA 1SPPA 1TNRA 3MLLA 1PVC3 1GUIA 3JQXA 4AE2A 1A34A 3RPQA 4C1XA 2WFF1 3H8RA 1EUUA 2VGDA 1YQ2A 4GH4B 4BYYA 5LRSA 1U5IA 1ZNPA 3LIHA 3N36A 5K4LA 2ZGKA 3EQEA 3PVEA 4CXYA 4PBOA 2IUWA 4LBJA 4JQTA 3E6DA 3HQXA 3T2TA 3ON7A 5FY4A 3RZZA 4EYUA 4OI0A 5K0UC 3S6PA 3AP5A 3WF1A 1Q8PA 2P3YA 2WNVB 3IPVB 4NN0A 1C3HA 3MIDA 4DRVA 3OB8A 1V9U1 1CAUA 2QQJA 4Y20B 4META 3CJIB 2XDVA 4OZXA 4LO4B 3VBRC 4ES9A 5KHKA 1Q8SA 4N7IA 4GB32 2J1UA 1O8SA 2IXHA 2JD9A 3JU9A 1COV2 3GZTB 4A2UA 1RUD2 3MGUA 1SFPA 2VOVA 3AMNA 4LXLA 2DURA 4J1WA 1AR72 2XONA 1LGNA 4H7MA 1J1TA 2FZ1A 4FFFA 1C5IA 2ZCWA 2G4IA 4FPOB 1WCUA 2B45X 4WM7A 3Q8CA 2HJIA 5FZMA 3PU8A 2ZJCA 2Y0OA 1WW7A 4CDUA 3H8UA 1MZ6A 3IMNA 4V1PA 4LK7A 4Y22B 5DZFA 1QEXA 3BPSA 1PO11 3SISA 4OUSA 2WN3A 2OXBA 3ZLIA 2IVJA 4C1WA 5BNNC 2JDUA 2WNUC 1M06G 5CKQA 4FCAA 4MGZE 1MS4A 5JLVA 2R062 1QKQA 3ZYRA 5K7PA 1W9TA 4JKMA 2R49A 2JIGA 1S0BA 4E8CA 1H8TA 1RUE2 3C7GA 2VVDA 1ND3B 1UCXA 2B8MA 1MS9A 1F4AA 3ZR6A 2CSGA 5F5IA 4N90A 1CD3G 4RGGA 1GYKA 1AR81 1QJU2 1URXA 5FZ8A 2V5DA 4K7JA 5EXOA 3GGLA 1LOAA 3VBOA 3O1OA 1Y9QA 3I49A 3K77A 5FY7A 1NXD1 4YVSA 2R043 3HT1A 2GC1A 3N3HA 2EICA 1CN1A 1LOFA 1SDDB 3B02A 3NVCA 3DPRB 3E6CC 3ROUA 3J26N 2XQXA 4CTEA 1Z78A 5IVCA 5F6LB 1RUI1 1XNTA 5FYCA 1HN1A 4P9IA 2FMYA 4QXHA 2P34A 4RGAA 4FQ4A 3IKWA 3BI3A 1Z7S3 2VXJA 1JN2P 4E4ZA 5A3UA 2UWAA 5CFDC 3N35A 4CCLA 5FK8A 5KHJA 3VHOA 1HB1A 3AVSA 5DDJ3 5BY5A 2Y6JA 1UNBA 5I8TA 1DGWX 5CEHA 2GH2A 2XVKA 2DWRA 2PHUA 1C1LA 1WMXA 2RDSA 1T2XA 2FMDA 1YNAA 1LRHA 1HJFA 2XJPA 3FLTA 4V2VA 1BHGA 4WZFA 1XC6A 4XPVA 5JXHA 1NA1A 2X05A 1V9U2 1E57A 3QLQA 4M00A 3VL8A 1DFQA 1AR62 2ADDA 1EV13 1RVF3 4JX0A 1I3HA 4UYBA 3NNGA 4DPNA 1GOFA 2C5DA 3K48A 2FQPA 1NA1B 2I74A 2VCAA 5C9AB 4FPYA 4YPJA 5FUPA 1PGSA 5FP3A 1JZ6A 3O0XA 1BEV2 2XHKA 3LEMA 2WO3A 2WZEA 2Y34A 1PVC1 4IGQA 4PDWC 2DCYA 2QDRA 2OUJA 2WQ4A 5FZOB 3WNPA 4UWDA 4S2DA 2JX9A 3GXUA 1E5HA 4NWWA 2E63A 4Y1UA 5C5TA 1XB9A 3WNMA 5LK7B 3T2OA 1YIPA 1VBE3 5FMOS 2QNKA 2ZKLA 4IEVA 2Y6GA 4AI8A 4F83A 4BXSV 3MZHA 4LJHA 5F39A 5J09A 3P3PA 4LHKA 3Q9OA 2AUYA 2MEV3 1YQ5A 5FZIA 3A21A 3NO8A 2ZPXA 4BXFA 3ALQA 5T5PA 1RJ7A 1NLSA 1LHUA 1WLTA 1H6XA 1RUC3 2RS11 3HJRA 3VBUC 3MLKA 4LBQD 1PO22 2E53A 1OF3A 5DABA 3OSDA 4GAZA 3THDA 1J59A 1XNCA 2UWCA 4CEWB 3LB9A 2QQOA 2WZR3 4CXWA 1AYN3 3UGFA 4F7ZA 2RVAA 5C9AC 1NOVA 3VL9A 2CAVA 5F7UA 2IFRA 2ZEXA 3BTYA 2WS91 4P9JA 3RSJA 1FXZA 4AEDC 4OI4A 3KT4A 3M3EA 1RUJ2 5A6YA 1WMDA 2HBTA 1RUE3 2P4EA 5DPNA 1ENSA 1BEV1 1O4ZA 3AKSA 5FQ0A 2RM22 3KS7A 1JHNA 1AYN1 3ZYIB 4M3CB 3JBG3 2P3KA 4IESA 5L19A 2A6XA 3O1RA 5LASA 3MW2A 5AFBA 4UXAA 2XVLA 4I30A 5IK4A 3VUOA 3OD4A 1Q43A 1YI7A 2V4VA 1Q8VA 2FDIA 1C1FA 4GA9A 2O1QA 3USSA 1QJY1 1KFXL 1N3PA 4QDRA 1WBLA 2VY0A 3N9LA 1HN0A 4YZ1A 1W6NA 2EIDA 2ZHLA 1L7QA 1MEC2 4YNIA 3AP6A 3VD4A 5CBLA 1RMU3 3UJQA 1AX2A 5EV7A 4PT6A 3AKQA 3ZVXA 2QTWB 2RDQA 1WCKA 2JICA 2VBPA 3C2UA 1VBE1 4U36A 5FZAA 1HX6A 3HPNA 3CJIA 2QUOA 1UU4A 2Y33A 3ME2A 3OOXA 1PMHX 2VBBA 3MO4A 2ZGPA 4E2SA 1JODA 4BQ3A 2C6SA 2WNVA 4NROA 4Z1VA 4PQQA 4HVOA 1Q56A 4CXXA 3FLPA 4QPGB 3J7HA 4DMIA 1OQEA 3E5XA 1UU6A 1NA1C 3ZYBA 1NCRB 2OVUA 4Q1RA 2ZA9A 3DYOA 3LDKA 1TME1 3PJQA 5BNNB 4AZZA 4COZA 1PO13 1W8NA 2Q0AA 2WT1A 2XBO3 4LLOA 1ZZCA 1RUD3 2VUAA 4Q4W3 5FBZA 2CGOA 2IXLA 4JZRA 4ATFA 1F2NA 3EHKA 1I5PA 2PTMA 2BNMA 2E7TA 4QWNA 1RUE1 4IE4A 4PDWA 4XQWA 1XNAA 1OPOA 4RQPA 2UU8A 5F9TA 2PXJA 1HRV3 4QU1A 5K9YA 1FI2A 3FHAA 1NCQC 2I07B 3OPTA 3JD73 2EIGA 1CESA 2VUCA 3HWJA 3NKTA 5IK8A 1ND2C 1D4VB 1QXPA 1ZBE2 2OPKA 2GC2A 4XMIA 4AI1A 1AJOA 4C0HA 4CDUB 4ZU4A 3WP4A 5B4NA 3UYJA 2UYAA 3LA7A 2O0OA 1JUHA 2BBAA 1RMU1 2ARXA 3NJYA 5IHRA 4J25A 2CU5A 1RUC2 3RG0A 3UV9A 3ZPOA 1GP6A 3WG3A 4AK3A 3DUIA 4AVCA 5ACA3 4NIAA 2RDNA 2W47A 3HNMA 4PLNA 3FJSA 1RUG1 3M3OA 2QKDA 3ACLA 3LOIA 1OVPA 1CR7A 1R083 1CAUB 1XOYA 4LA2A 1X9PA 5F5CA 4DB5A 1R091 2MEV1 3J8F3 3TRSB 2R042 2CYFA 5LATA 2BDRA 5C7GA 1S2EA 4WVVA 1REFA 4IEZA 2BU9A 2Q8EA 4XFIA 4QX7A 3OTFA 1C8M2 4AXOA 3CDZB 2HWD1 4FPKA 5FZKA 1NE6A 5CU1A 2XB6C 5IVEA 1ASJ3 5FJKA 3RYPA 4CUBA 2D5FA 5FIXA 4R52A 1OLRA 1RUH3 1AXZA 5HI0A 3WHUA 1IG0A 3D4KA 3VHNA 2OPWA 3CZUA 4EN9B 2HWB3 1WW4A 2KXLA 1H8VA 3D82A 4JDOA 3U4SA 5JSRA 1GNHA 4IEPA 1LAJA 1VBA1 1GNZA 2W1UA 3NAPA 5D8AA 1D4M2 3MF9A 4CEYC 3X29B 3RYRA 4OFGA 4P02B 5HXMA 1O5LA 3LD8A 3P1IA 1VAKA 2JENA 5DN2A 5FV3A 5F3GA 2A75A 2E7QA 4H2AA 1K5MA 2ATFA 3S30A 3WUDA 3N7MA 3H8XA 1LKNA 3CJIC 3LF7A 3AKPA 2A3YA 1QXRA 2CDPA 1GANA 1FMD1 1XPWA 5DUVA 2J1AA 1VBD3 2BEOA 1AR92 1UY4A 2X5IC 2Y6KA 2VD7A 2BWCA 3PUSA 5LBEA 5L7OC 3HAGA 1EAH3 3OCPA 2JB8A 2G9ZA 4AFMA 5KC6A 4WM8B 4FOWA 3THPA 1VP6A 3ZX7A 4FOVA 4Z8BA 1YI9A 1OBNA 5AC91 2BTVC 3FN9A 1OD3A 5I0UA 2Y64A 1BK0A 1UY2A 2QQIA 2Q5TA 1DYOA 4KQ7A 3Q8AA 2E32A 1KS4A 5F2WA 3GBWA 4CP9A 1CZSA 1AL23 2ZBJA 3DL3A 4HKWA 3WDVA 4EE2A 5DAPA 4QGNA 5ANQA 2VMEA 3TB0A 1NCQB 2WAAA 3KF5A 4UAPA 4CCKA 2FDFA 2BP6A 2EXIA 4AOCA 3I8TA 5APAA 3QCWA 5FRAA 4GALA 4Q0SA 2VW0A 2WT2A 1VB2A 4OYUA 2YFZA 4YM0A 4NIDA 4LORA 1J3RA 3AKTA 1O3RA 1PM4A 2WO2A 1IKPA 3TNQA 3AZYA 5DAQA 3ZSEA 2BGOA 2DUQA 5F8PA 1C57A 1FV3A 1Q5OA 4HOOA 4EJRA 1O4TA 3HBZA 2C4XA 4PDWB 5JXJA 1O3TA 2VQTA 4QPIC 2OUHA 2BFUS 3VZOA 2G9GA 1RIRA 1HXS3 4L11A 2FHRA 4NIGA 3KLSA 3OEAA 5ACA2 3PMEA 2GU9A 1ENRA 3LCPA 5J48A 3KF3A 3ZFFC 1NLQA 3IT8A 1X8EA 1TME2 4LKFA 1JYWA 2DCZA 2J7MA 5ABJB 4XF4A 5HV4A 5LRRA 4LKSA 3L9JT 2PHWA 5DAXA 5JIAA 3OD0A 2GALA 4HPKA 1VPHA 2BV4A 4XIKA 4QQOA 3B5LB 2VQ0A 2RS12 5FZEA 1OOPA 3WSOA 5A7SA 2RS32 4CUAA 5BNPA 1RB8G 4I2OA 3AX4A 3WQ1A 4NPLA 1HJGA 1EP0A 4COVA 1QNYA 1LGBA 1GZCA 2BYVE 4ISRA 1UX7A 1J3PA 2JE8A 1PX4A 2JD4A 1Z0HA 3TEYA 3HEIA 3H7YA 2RV9A 5FYBA 5LZ6A 2UYBA 1MS0A 2VAUA 1QH6A 4Q29A 4AEMA 1HIXA 3GNEA 4QGMA 3J7NA 3RI9A 3S7EA 2DFBA 1CX4A 3D8CA 3R4UA 3GBFA 4Y4YA 2A3XA 2B4KA 3LGRA 1UPSA 5D8AC 1D4M3 3UK9A 4FTBA 4N43C 3ACGA 3ZXAC 4OHVA 2QQPA 3H0OA 3IDBB 4MGQA 3NSTA 3BIWE 2BJSA 3N9QA 5FXXA 5JZGA 2XLGA 2NN8A 1ULEA 5J1XA 1V0AA 4XE9A 3PU3A 2GMMA 4AVSA 3ZDVA 4MX3A 3KT1A 1RGSA 2WFPA 4Q4W2 2X5IA 3MUZ1 2HEYF 4PIZA 5L7OA 2ZXQA 5FPVA 2JG9C 1KDMA 1SBEA 2A6YA 4YW4A 4OHZA 4B8EA 2PHTA 3L2HA 2D93A 1RUJ1 1UOFA 5IFTA 3TEZA 1PO23 2WO1A 1XYOA 3QD6A 4L8QA 4B7KA 4XJAA 3VLBB 4CU7A 2OKXA 1AJKA 3I2FA 1B09A 5GZDA 2E33A 1LOGA 2H6CA 2VVFA 1JYXA 5GZFA 2NPIA 4MLOA 3BGAA 4D7YA 1RUJ3 1ZVFA 2W08A 2ZGOA 5FYTA 3I7DA 4WVMA 1JH5A 4ET7A 3W5NA 1A78A 1BXHA 1JYTA 4JTNA 4F8AA 1W2AX 4GZ9A 1U5XA 2ZABA 1MZ5A 3RVHA 1YFYA 2VNVA 4OHYA 4CCMA 1RUI2 4UF0A 1BZWA 4HSLA 2QVSB 4UF0B 2VZRA 4CPBD 1XE0A 1NAEA 3ZXDA 3BU0A 1S0IA 2OQ7A 1F15A 1JS9A 2CNAA 2W1WA 2JE7A 1LEDA 3FE5A 5HCAA 1ZRRA 2DTYA 1NLRA 3PUAA 3B00A 1R082 3EB7A 4KGQA 5T55A 1DLLA 4XXPA 1AR82 4Q27A 4DXZA 3T08A 3MEPA 3FWEA 4WZCA 4A7YA 4FPGA 5EPAA 1WD3A 1W0OA 1UYXA 1NQJA 1IZ3A 3WNKA 1OPMA 4AHYA 1RUNA 2UY9A 1GLHA 2GNTA 1NE4A 1W0PA 1O3QA 1IPSA 4KH9A 3HNBM 3VV1A 4FPCA 3EMRA 4C90A 1F4HA 4SLIA 4RS5A 5GLTA 4BK4A 2K2SA 4GKYA 4MZUA 1AXYA 3I2IA 1N1SA 2RS51 4ARXA 4CCNA 5LY1A 1DHKB 5T50A 1CGPA 3N9PA 5JIUA 2CAUA 1HKDA 1YJKA 3WOGA 3CKHA 2LROA 3WP3A 4EZHA 1WLCA 2HYKA 4CDQB 1R1A2 2VTFA 4K8RB 4KWKA 1O59A 1AL0G 1MS8A 2RDRA 3N9OA 1ZA4A 1W6OA 5FLJA 3T09A 5B2GB 2RMU2 1XBFA 2TBVA 4BISA 2VXRA 2ET1A 2WA4A 3WHTA 2R073 2VOTA 1N1YA 2WLQA 3I3BA 3LZZA 3PVBB 2TUNA 4GQ7A 4CE8A 3BKZA 3PDQA 2XQRA 1BBT2 4AG4A 2ZMLA 3AZWA 3NMBA 3WNLA 1UZWA 5T5OA 2C0ZA 3WQBA 3B9CA 2LTNA 1QJU1 1STMA 3AVRA 2QBXA 1JZ3A 1E5RA 1JZ5A 1SACA 1BK1A 2BWAA 4BA6A 3MPPG 3TN93 5AVAA 4CSWA 3H3LA 4IEUA 2JG9A 1HB4A 3FX3A 1GKBA 2YC4A 3MV01 5FXZA 3CU7A 1LNSA 4PCRA 4ZS2A 2ORXA 2Z4FA 1FNYA 1W3VA 2QJVA 2OZJA 2R061 2XXZA 3RZHA 2AC1A 5FKBA 1QJU3 4JKLA 4N53C 2JKBA 1W9WA 4UW6A 3NJZA 3AP7A 3T30A 4Q4W1 2WNEA 1VRH2 1XE8A 3KD4A 5DG2A 4K3UA 2VUJA 3UGGA 2HYXA 1LR5A 4HL0A 3VBRB 1ZREA 4WM7B 1DGLA 2W68A 5FY1A 3POSA 2XR4A 5C3PA 3V0AB 3ZYPA 4QX1A 4AVVA 2HWF1 3OY8B 1OI6A 2VZOA 2Y26A 1RUI3 4JQRA 3O0VA 2PYTA 2RE9A 1MQTC 2B7YA 3BPZA 4BJ0A 4CP2A 2ZZJA 3JB4C 3PVOA 1RHI3 4HXCA 4KMQA 1UYYA 3I2GA 5FMCA 3MDPA 4CDXB 3ZN5A 4YFZA 4XDPA 3R6SA 2VOXA 3ZFEB 3MW3A 1EV12 1RVF2 4MXWB 3HN1A 2NLRA 1QDOA 2ZKNA 2VUDA 1W0NA 2VTXJ 4RHV1 3WLUA 2D5HA 1V9U3 4JGYC 4IV1C 4Q4Y1 1UYZA 2KD7A 3I3MA 2WC2A 4O9GA 1GBGA 1DIWA 1RUC1 1AR63 1W6QA 2RS13 3R4DB 4LIVA 2ETEA 2QCSB 3HQRA 4YVWC 3V56A 4CU9A 5AC92 2PFWA 3VBHC 5A6ZA 3WCSA 4FTSA 4KBBA 1HV1A 4QX0A 2LS6A 2YPDA 1V6IA 2ZAAA 4EN6B 2JDNA 5F3CA 3BYWA 1AYM3 1CJPA 1GQGA 1H2LA 4CP1A 5A80A 3VB9A 4QPWA 4Q8KA 3CQOA 1OA4A 1UZVA 3DYMA 4JGZA 4XBLA 1GWKA 5FZ9A 4CZSA 1GWLA 3I3DA 1Q8OA 3KCCA 5FMDA 4ZU5A 5JVVA 2WDBA 1WBFA 3AC0A 2ZZQA 1C4RA 4LO6B 1RTVA 4LR4A 2ZOEB 1H6YA 2PLV2 3AYEA 1ZBA2 2J22A 2P2KA 2HKXA 3KHBA 1SFNA 4BK5A 1A6CA 1COV3 4HBNA 5T52A 2VU9A 2VQAA 2J1EA 3K4AA 4FPEA 4YW6A 3WZ1A 4V2WA 4MADA 2XLFA 3C7FA 1VBA3 3LE0A 4ZY9A 3ZKUA 1W90A 4KU7A 3FL7A 3RJRA 3VD3A 3IBMA 2XHNA 1QY4A 1XSQA 2DYCA 1KD7A 3JBG2 3KQRA 3M3IA 4LBQA 4RR3A 2FDHA 5CAZA 4N8MA 5A3TA 5JOYA 4MH0E 1GP5A 3ZMOA 2H0BA 2D3PA 1VMFA 5H9RA 3O1TA 5LA2A 2P3IA 3WW2A 3W5MA 3ILNA 3INAA 4Y3OA 1FOD1 3OYWA 2WQZC 4MXVA 4BQYA 3U78A 1IS5A 1JXNA 3HNYM 2AYHA 4BZ4A 1BKZA 2PAEA 1FAYA 5C33A 2GDFA 3DXTA 3DYPA 4FPFA 5DUWA 4E8DA 4LIUA 3PVNA 4CRQA 4RYDA 5FP4A 2IXJA 2HWD3 1LJ7A 3ZOIA 5FZLA 1ZZ8A 4MSVA 1VJ2A 2LALA 3O14A 3POJA 3VDCA 1OOPC 4Y5Z0 5JR7B 1VBC1 5AFEA 3O1VA 5BNPC 2JDPA 1AL21 5E1RA 1RMU2 4YZ4A 1KQRA 2CY6A 2ZX3A 4UI9L 1VAMA 2VZTA 3V0AA 1SLIA 1W06A 2C9AA 3AL6A 2B42B 3VBRA 4CDXC 3S5AA 5HCFA 2WZ8A 1ZRCA 1UD1A 3FHIB 1D7PM 2WIIB 3MPBA 5F37A 1QMJA 4C91A 1OQDA 5A3NA 5LA1A 1WKYA 1Y4WA 3AYAA 3MW4A 4UBHA 1D0GA 1H2NA 1HLCA 3WQ7A 1MS5A 3OPZA 4XDOA 1S55A 5C3OA 3M1HA 4Q2FA 3PLQA 4MGYE 5DDJ2 2YYOA 1RL3A 5JOWA 1KDKA 3KQ4B 4HKLA 3OJBA 2JDMA 1UY0A 3NV4A 3AP4A 2X53S 4OHXA 3AZVA 1JU4A 4QX3A 5KBFA 3H3UA 3AP9A 1VBB2 3WF4A 5A7QA 1PNFA 2W46A 3ES4A 4NIHA 1OT5A 1C8M1 3GZAA 1U12A 3AMQA 3POFA 4RA0A 2LRPA 4IXLA 3DKWA 4GIQA 4XJWA 4Y26A 1SZBA 4YW3A 5FY8A 5AC93 1NXMA 3W58A 5FPBA 3ZYJB 3MLJA 2Q8DA 5A7WA 5JR2A 2ARAA 2YDEA 2QQMA 5T3NA 1JZ2A 3SLIA 2EIEA 3NKGA 3ZFGB 1YQCA 2D97A 3GBGA 4XC9A 4HFSA 4LBOA 1DZRA 1FPN1 3CJXA 1PGL2 2YV8A 4XUPA 1V00A 3R0RA 1W8ZA 1DGRA 1QXJA 4QXKA 5CB7A 4QT6A 2ZGLA 5GLWA 3WG4A 2E7AA 2YC0A 2GC0A 4NPRA 3K51A 1WA6X 4R8HA 5F5AA 1UL9A 1VRBA 5L9BA 1PZ7A 1GU3A 1ASJ2 1OA3A 1HXS1 2ZX4A 1YJLA 1O7FA 1RYYA 1W03A 4WVWA 2G1MA 5FQ0B 2EXJA 1NZCA 1I9RA 2B39A 4IERA 3MBWA 2FD8A 3J8F2 3OGSA 2DVDA 2R30A 4NOTA 1R081 2GP3A 3NQHA 5B4XA 2YC2A 1C8M3 1KITA 2ZGQA 5FLIA 3JQWA 5LCWL 4ASLA 5FTTC 4MGKE 1JBCA 3M3CA 1MVQA 4HVRA 1OH4A 5LW9A 4ORFA 1PIV1 2X09A 4WVZA 3GHMA 1FX5A 1QQP2 1V6MA 3H1WA 5CKMA 4YG6A 3J7LA 2B9VA 2JG8B 1SG3A 1SLLA 1ENQA 2HWC1 4IE7A 3THTA 4R9DA 5IW0A 1BYHA 3S57A 4M01A 5GZEA 4ZXEA 5E6HA 3C7OA 3VZJA 3RNSA 2VE1A 4IGPA 4RN5A 4AEJA 2WSVA 4QKNA 3VBSC 2VR4A 4A7KA 4CP0A 5JXIA 1SLTA 3CNAA 2VPVA 3IIIA 4N53B 1H30A 4LPLA 4AFAA 1QJY2 1YLLA 2WWJA 2YBPA 1DYPA 2C26A 1XYNA 3M8LA 3U14A 5KXEA 3RZMA 4BMEA 1VBD2 1Y3TA 2Y6FA 2VMIA 3LDBA 4EWEA 2J1TA 1CJDA 1US3A 2BW8A 4UFJA 2WT0A 4KWUA 1JW6A 4YSFA 3KGZA 2Y6LA 2BVVA 4LULA 2XMLA 2EXHA 5A1LA 5F3IA 1JZ4A 3WF0A 5C9AA 1N3OA 1LESA 4URTA 3RI8A 2QZ3A 5LA0A 3AK0A 3DKQA 3RQ0A 4DOUA 1KJRA 5L9VA 4BLIA 3NNLA 3SITA 1WD4A 2RMU3 4W4ZA 1D2QA 1VB4A 1DP0A 2WBKA 3BALA 4D6QA 4N53A 4YGBA 2JG8C 4D3WA 5LBBA 2EIBA 4W8JA 4BOWA 5HV0A 4LBLA 1TMF2 1WMFA 1U5YA 1YHFA 3HVDA 1XJAA 4NRPA 5KXBA 5LEKA 1I5ZA 4H14A 3N4MA 4NRMA 2HWF2 1V6OA 4I02A 5H9SA 1S2BA 4BIFA 4XJUA 5C3QA 1Q3EA 3AKRA 5I0SA 3WNOA 4XAAA 1VRH3 5GLVA 1OOPB 4IEOA 2BRTA 1UMHA 3WW1A 3IDEA 3ORJA 1BQPA 1UQXA 5L73A 4OUEA 3BUCA 1UW8A 5EYYA 3B94A 4IDZA 1DZQA 5CFDB 2WQ8A 4O7XA 4QPYA 4YYOA 5FFOC 3WINE 4IQPA 4IV3B 2WFF2 4JGYA 4RL7A 5A32A 3VD5A 2IXCA 4CYDA 2GC3A 1TME3 1LHOA 2ET7A 3TBDA 1DDLA 1TVGA 5T5LA 1X7NA 2CDOA 2GN3A 2K9ZA 4DUVA 5KWRA 3PL0A 1IOAA 3AFKA 4XW3A 1G9CA 3O1PA 3FFZA 3I2KA 2X5IB 1WZXA 4FFHA 1RUF1 2VBDA 3U37A 5F1RA 3POYA 4MGIE 1FYUA 1Y43B 2DU1A 1XE7A 4XTPA 5C3RA 3BIEA 2RMU1 4Q0UA 4MGTA 5FY0A 3IM0A 3SMHA 5JZGB 1NY71 2JXAA 1AYM2 1HRV2 4RGKA 1OH3A 2UY8A 2WNUB 3ASIA 3ZSJA 1CPMA 5A6QA 5DAVA 1NCQA 1ND2A 4QQ2A 4NIIA 4BWOA 2TEPA 3WQ0A 2Y38A 2LW8A 1ST8A 1DF0A 2GMEA 2XBO2 1JMUB 4Z07A 4QB1A 1H1MA 4LBKA 5HXVA 1ULFA 5FO7B 2VO5A 2NM1A 1W8HA 3ES1A 5C8CA 3A0NA 4COWA 4ARYA 5FMBA 4BU2A 4D7TA 1U0AA 3H7JA 4X8NA 4BLJA 4CVUA 5IK5A 4FPHA 5F5QA 2L9LA 4Y1XA 4RHV3 3VKLA 2D40A 1CQ9A 3CF6E 4OLLA 2ZX0A 5A1AA 5KR7A 3JD72 5EWSA 1FMD2 4QPIB 1ZBA3 5FZ7A 3WNNA 5T54A 4HT1T 5FOJB 3AMPA 5ABJA 4DNYA 1LOBA 2JECA 2NQYA 3A22A 3IAPA 1CAVA 1DYKA 3C3VA 4W50A 1FATA 1HRI3 1R64A 4GWJA 4X6RB 2FCUA 2W1SA 1CPNA 3RZLA 5BUVA 5D8AB 1QHDA 1POV3 5BV6A 1GZWA 4IEQA 1QJZA 2D6OX 5A70A 2BOIA 2XL9A 1VAVA 3WNXA 2HWF3 3K3NA 1AZDA 1CZVA 1UOBA 2W9XA 2DBNA 3B69A 4IUGA 4D0QA 5A3MA 5M0TA 1W9YA 4EV0A 1OLME 3FC0A 1LENA 3SKVA 3NAPC 1NG0A 1LHWA 2A70A 2BGCA 1R1A1 2BUKA 5JPMB 3ZDSA 2OX0A 2VOKA 3ILFA 1HV0A 2KA3A 4PQ9A 2IFWA 3MUY1 4Q8LA 2R041 1O8PA 3FBYA 3WF2A 4OI1A 2XOMA 4ZKTB 4IE5A 4A4AA 2KR2A 3D5OA 1DQ1A 1O4YA 2JWPA 1S4CA 2EXKA 5LBCA 1OHFA 3HMYA 4YM1A 1HXS2 3T0BA 3UKNA 4XF1A 5A1FA 4CU8A 5CFCA 5FWJA 5FY5A 1IQAA 4CUCA 4EN0A 4QMAA 4XXAA 4A41A 4EWDA 1SEFA 2HLEA 2I2SA 1YO8A 2VZUA 1UMIA 4XHXA 1RUH1 1UOJA 1HQWA 2VL4A 3AB0A 3HOBA 4L9BA 4OULA 3USUB 1HB3A 3WX5A 4D94A 1LULA 2HWB1 2WABA 5LEJA 3WDTA 4LHNA 3GF6A 2WRAA 3BU7A 2ADEA 5IWFA 1DQ0A 4Y4RA 3WW3A 4Z2WA 1SCSA 1ZRIA 3KCXA 4PLMA 2W2IA 5K8SA 1WCQA 2RR11 3AXEA 4BHPA 1EPZA 5KHGA 1CAWB 4P9LA 4IETA 2E26A 4OHWA 4DY5A 2Z42A 3VBHB 1ZM1A 2ZHNA 1G9FA 3NAPB 5H9PA 1X36A 2WNOA 1Y7BA 3H8OA 2ZGNA 4IV1B 4Q4X2 5FPAA 3IDAA 4NHXA 4BCUA 4ZHNA 2W39A 3OPWA 3HQUA 4P14A 3SH4A 3ZYGA 2J1RA 2GP5A 3K46A 3NNJA 5I0DA 5JUVA 1GOGA 1SBDA 4W6XA 3W20A 4DXSA 1U5ZA 1X33A 3OF1A 4CUGA 3EXUA 2MNGA 1L3JA 1OURA 3BCWA 4XQDA 5FZ3A 5JOZA 2XKOA 1KXGA 1PK6C 3U75A 4H55A 4Y1ZA 2PQQA 1PGW1 4GJYA 1IPKA 1H9PA 1QOTA 3B9IA 2VZQA 2P6HA 1GP4A 4JDMA 3VN4A 3ZYFA 3VZLA 4GMP3 5C8CB 4GMP0 3HIFA 5HBAA 3IZOA 1LCLA 3CIHA 4DEVA 3W9AA 1POQA 1UPIA 5K0UA 4Z82A 4XUTA 1CIWA 3AL5A 3WDXA 4CPBA 1CZTA 3WDWA 2VZPA 1A3KA 1Q8QA 2FDJA 2WNUA 4GMP1 2VC9A 3NJVA 1IKQA 4FI9A 4UW4A 4GKXA 2OYZA 3CL1A 2HH9A 3AZXA 4DXTA 5LB6A 2D6MA 2ZEWA 3FMGA 3J9SA 1EPWA 5JOXA 3CMGA 3H9AA 5C4WA 4BPZA 3ZXJA 1ACCA 4QX8A 3LA3A 1PGW2 4RQPB 5J3UA 4X6QB 4TZDA 4FTEA 2WR9A 2RS53 1YC61 1SDWA 4QPGC 1PMJX 4YARA 5BNNA 1UXZA 1VMJA 2UWBA 3OEBA 4Q4V2 5FK7A 1Y9MA 4Q0QA 1REDA 2E31A 5DUXA 3MIHA 5C70A 3RWKX 4R9CA 4H7LA 2DVBA 4FOQA 4UFKA 1F5FA 1O6UA 5CFDA 4JAAA 2VCBA 3T1MA 3KZ4C 1JOPA 1V6LA 3DF0A 2JDHA 5FZ4A 4KWJA 4URAA 4NO4A 3RGBA 2VZ1A 5DZGA 1WA4A 3KV9A 4TLGA 4AQ6A 4A42A 4IEYA 1YFUA 1ENXA 3I97A 5KXCA 1W6OB 3MFAA 1D4M1 4YZ2A 2HWE2 3PHMA 3NL1A 1VBA2 3VBOC 5CNAA 1PNGA 1X82A 5C71A 1EAH2 1AHSA 1HB2A 4BDVB 1K12A 2ARCA 4L2NA 2J42A 1AL22 1K3IA 1HRI1 1DQ5A 4I3GA 1R093 3AFGA 4P5HA 5KC5A 1OUSA 2A6WA 1DGWA 4O65A 1GQHA 3ST7A 2BVBA 4CCDA 4Q4Y3 2XVGA 4B4PA 3T1LA 2G9FA 1G6NA 4OUMA 4ASMB 4BH9A 1MS1A 1F9KA 1AX1A 4NHMA 1ONAA 2HWD2 2YFUA 3MV11 4CDWC 2BGPA 4XBNA 2D6PA 5FPUA 1KEXA 4RS5B 5FZGA 1HDKA 1S0GA 2R063 3D3AA 2P17A 2XJUA 4KGGA 4DS0A 5DMYA 4Q4Y2 2IVIB 4AEDB 2JEMA 3BTZA 3TYJA 1IS6A 5FYUA 4DZGA 4LBMA 4RD7A 3ZO0B 4R4ZA 2O8QA 4M3CA 2XJTA 4NMIA 2DU0A 5I8SA 1RUG2 4ZPIA 3LFIA 2W0XA 4PI2A 4DXRA 4QGLA 4COYA 4B29A 3MICA 3HBKA 1W2OA 3FHQA 1JI6A 3VBUB 3WV6A 4JCKA 3B3QE 1F31A 4I01A 2NMOA 1X9TA 2OS2A 2OW4A 4YG0A 3WG1A 4RS5C 2YHJA 3K4ZA 2Q1ZB 1W39A 4LMFA 4YW2A 2OIIA 3G7DA 5HCBA 2DTWA 1OQ1A 3KB5A 4WBBA 3I54A 2VM9A 2WZR1 3KT7A 3DPRA 2A6ZA 2DF7A 2WL1A 1W05A 4FPJA 2E51A 5J37A 2GNDA 1WCSA 3ITQA 5ANNA 3TWIA 3OBZA 3POBA 4ISQA 2PLV1 4LNVA 1HW5A 2QQKA 4HG6B 4M4PA 3HN3A 2JDYA 2DCTA 2F17A 2XWJB 1PX3A 4F3JA 1LB2A 5BNQA 3W59A 3D6EA 3JCIA 1G7YA 1WCDJ 3MIEA 2RJKA 3JUUA 5ERLA 3VDDC 3O1MA 1CVNA 2ZTNA 4Q5OA 1X8MA 1IPJA 1VALA 1ND3A 4P08A 5FUIA 3POIA 1OFNA 1GNYA 5A7OA 4E4SA 1J84A 5FYHA 3VBUA 3FUQA 4IL7A 2BNNA 3SQOA 1A8DA 4XCAA 3PIJA 4EN7B 1PO12 2MEV2 3ZXKA 1W8UA 2W3JA 4HMZA 3VDDB 2D44A 4Y22A 4C0BA 2W94A 1B35C 2VNOA 4AEDA 3O12A 4GH4C 2YGMA 1QJX3 3T4HB 5IT6A 1EYBA 2G19A 2QZ2A 4KU8A 3WP5A 2JIJA 2GZWA 2D98A 3LEGA 5FZ1A 4AFCA 3NV1A 4AVBA 2QDNA 1AR71 4QKDA 1VBE2 1VLNA 4Z92B 4FVVA 4LK6A 5KXDA 2CWSA 3ZIWA 3JBG1 5C8WA 4J6GA 2H6BA 3C7HA 1R1ZA 4YLZA 4GXLA 1WUVA 1H1AA 4K9SA 1UIKA 2WN2A 1HRI2 3POEA 4JHZA 4KG8A 4Q0PA 4QHBA 5LWBA 3AMHA 5CADA 1W28A 1VRH1 1OLMA 1FOD3 1ZA7A 4LKDA 2ERFA 3K3OA 5E89A 3C8XA 2AEZA 5FDBA 2P6CA 3HD8B 5EJ3A 4TYSA 2XWBB 1AYN2 2GNBA 3ABZA 2R0HA 1RHI2 3ZSMA 2RM21 4Y1VA 4AF9A 5BNOB 4XUNA 3H1YA 3KGLA 2YGLA 4ZXKA 3K75B 2CWMA 1S1AA 3ZFGC 3PTRB 4LQRA 3NW4A 4IV1A 2AH2A 1Y9GA 3M70A 2YB7A 4YVWA 5A3PA 3S0MA 1QNWA 1BBT1 2GN7A 2D6KA 4PIYA 4JHTA 4AQ2A 3LSDA 1CAWA 2VW2A 3SNMA 4RFRB 4Y5TA 3IDCB 4XJ8A 4E2GA 4NR1A 1YRZA 1WW5A 5C4WB 5HPOA 1EV11 1RVF1 4W65A 4JDNA 4GB33 3V64A 4XOGA 2VVEA 2ZEZA 1IG3A 3KSCA 5FZBA 1ZZ9A 2H0VA 3SXWA 3WD5A 3U4XA 2F4LA 2Q30A 5DQ0A 2PHRA 5J96B 4BMBA 3V0BB 1NY72 1AR73 1N47A 1UAIA 3F2ZA 1MZFA 3DPRC 4MYEA 3SCGA 3WDUA 3K4DA 4AI0A 4L99A 4AFDA 2HWC3 2RS52 4QXBA 4QX2A 3JXSA 3MYXA 2D3RA 4WM8C 1W6PA 2VMHA 4QD2A 5AVPA 4AVAA 4XFAA 1PZ8A 1R1A3 1PK6B 5A33A 5A7NA 1XSRA 1OUXA 3AZZA 1KRIA 2WYFA 5CFCB 1PHMA 2ZS6B 4A3ZA 2WLPA 1ND3C 5FYSA 1YFXA 1REEA 4A45A 2BNOA 2P37A 3T0AA 2AEYA 3GDBA 4TN7A 2ILMA 4ZS3A 4XUOA 4Q4X3 1RXGA 1NKGA 1T6BX 3ILRA 4PF5A 5FZ0A 3GZEA 5GLUA 1LOEA 3EJKA 2A73B 2K46A 4AQTA 4DIQA 4R4XA 4RR3B 1QJEA 2DVAA 4XFFA 2AACA 3CLPA 3ZR5A 3OGRA 1OA2A 3RYKA 2XLAA 4NAOA 1SLCA 4GH4A 2OT7A 1DBNA 1QJX2 1UU5A 4NE9A 5FJHA 2E6VA 5IFPA 1DQ6A 1S0CA 1ZZ7A 3VKMA 1NUKA 1XYPA 1YQ6A 1JYVA 1QQP1 5I0RA 3QBQA 4E4HA 3VZKA 1PIV2 1YYNA 3SCHA 2WZPP 2GNMA 1S0EA 1LU2A 3VGIA 4AL9A 2RR12 4OVEA 1GOHA 2R16A 5L9RA 3Q8FA 4A44A 1W6MA 4UFHA 4AW7A 5LY2A 1ULCA 2CHHA 1JHJA 4Y33A 2ZMNA 1OMIA 4G3YC 2VMCA 4SBVA 4ZONA 5FZ6A 4LTAA 3RMYA 3ETQA 1ZZBA 3CBNA 2VCMA 3PTYA 3OUIA 1UF2C 2PELA 2HWB2 2R6QA 2Y60A 4G9SB 3VZMA 4J1XA 1KS5A 1LECA 1JTZX 4BQ5A 4UFIA 3WT3A 1LOCA 1W6QB 4HANA 2EAKA 4CEWC 2EALA 4Q26A 3AYCA 1OSGA 5EQUA 3D0SA 4MXWA 1ND2B 4W6YA 5EZWA 5JWPA 2RS33 1DGRN 2WYSA 3ECQA 4QQPA 1XNBA 4Q1PA 2LM3A 4OMDA 2ORZA 1IQDC 4AQSA 3IN9A 2QQWA 2BBVA 1JU3A 1UMZA 3V0BA 3LA2A 4OZOA 4XURA 1NX9A 4FOYA 4HN1A 3DCQA 1TEIA 4CA9A 3T0DA 3OY8A 4KI5M 5DG1A 1PGL1 4KWLA 3VBFC 3WDYA 1G9AA 5D1IA 4YM2A 3ZFFA 1WLWA 3THCA 5KHHA 5L36A 3ZN6B 3KVBA 3NWKA 1KJLA 4M4RA 2DV9A 4OMCA 2ZGMA 4FT8A 1GZWB 5CIRA 3WG2A 4AGVA 2VMGA 4CDWA 2HBUA 2AZ5A 4M0NA 4XILA 4XTMA 5A32B 4DO0A 4ZZ5A 3MFCA 4YW5A 2QQVA 1FMD3 3A23A 4GWNA 5J98B 4AR2A 4UW5A 1C28A 1AR91 1MS3A 2VNRA 4ITCA 2ZEYA 4DEQA 5EIYB 3QOPA 4HONA 4QPIA 1UN1A 2VZVA 3LFMA 4I0AA 1JYIA 1O3SA 4EQVA 4Y24A 4AGRA 3I59B 4YW1A 4UOJA 1SBFA 5FUNA 4N7UA 4ONUA 2QQNA 2QQUA 3AJZA 4N43A 1IHMA 2AGSA 1S2KA 4K20A 1A8MA 5GM0A 1ZRDA 4KG0A 2X29A 4Y5SA 5FAXA 5JZGC 3E97A 2PHLA 2YBKA 3H3ZA 2XBO1 1TQ5A 4P9YA 4UT5A 5BYNA 3WR0A 2WJSA 3S7IA 4EZ4A 3WUCA 2SLIA 4QHOA 3L2YA 3BOPA 1Z7S1 4CDQA 1X50A 2JB4A 2OA2A 2FZ2A 2ZGTA 1F5JA 1HRV1 1SCRA 4YFWA 4CCEA 1LTEA 1RINA 3FFQA 3H42B 1H8TC 4Y1YA 2RR13 2D6NA 1CWPA 1UY1A 1W2TA 3T4VA 3VDDA 5SV5A 1DQ2A 2A5ZA 4A7ZA 3E6BA 1J58A 1UZ0A 3A4UA 3GJBA 4IEWA 4LE3A 4YGEA 1J83A 1NZIA 2AREA 1WW6A 5A3WA 5JAXA 4LOTA 1RUF3 5IUQA 1OLQA 1V70A 2A1XA 3FZ3A 3E5UA 5E88A 2N7GA 1VMHA 2BQPA 4AWDA 3TEXA 5G05L 1PVXA 5FY9A 3SCFA 3EBRA 4AFBA 1AR83 4CEWA 3VD9A 4MOAA 4FO9A 1SQ4A 1C5HA 1TE1B 4K6BA 2MHFA 2B9UA 1B35A 2J1SA 3N7LA 4NAMA 1ZBE1 1VR3A 4LO5B 4NHKA 4EROA 5CG9A 2Q4SA 1FNZA 2BERA 4S2HA 4UBGA 1OF4A 2JG8A 1MACA 3M4FA 2E9QA 4NHLA 4QHZA 4RFT0 5IVVA 3KV4A 1GWMA 1KFUL 3AJYA 1HQNA 3AYDA 3VBSB 5JSOA 5JMOA 2FDGA 3QH6A 4QXCA 3B01A 2YZ4A 4B1LA 5JCTA 3MHZA 1LHVA 4Z2AA 2X10A 3N7JA 1ZBE3 3O1UA 3VBFA 2PA7A 3H50A 2JJ6A 4DINB 3CHXA 4HVQA 1G9BA 4XABA 3TN91 4AGGA 2GMPA 1VBB3 4GULA 2XGXA 1K5JA 4L0PA 4E2QA 1GICA 1TG7A 1XU1A 2I45A 4YW7A 1OKQA 2CTVA 2RJLA 5FO9B 3DV8A 3I2DA 3SH3A 1XNKA 2YU1A 4DFSA 3M2MA 5D2AA 4QM8A 1TNFA 2V09A 5IVBA 2Q8CA 3KM5A 1NQDA 4AI2A 3I2OA 1POV1 5CA6A 3EO6A 4B7EA 3O5SA 4NRQA 1VE0A 1GR3A 3BB6A 2GH8A 2ARBA 2B5HA 3PUIA 4INDA 3VKOA 4QU2A 5J36A 4XDQA 3M7AA 4P9GA 3TN92 1ULGA 4QDSA 1UIJA 1XQNA 3VHRA 5JXGA 2B46X 2JDKA 3ELNA 4COUA 2WFF3 4LKEA 2IC1A 2Z5WA 5A3OA 3CEWA 2A71A 4QB2A 1G8WA 4FBFA 1NT0A 3RZKA 2Z79A 2VTXA 4XAEA 4YVSB 3ACFA 2JKXA 2Z2SB 4N43B 3ZYHA 2BZDA 2BFUL 3ZSKA 4AVTA 3Q8EA 5BNPB 3RS6A 1K42A 1J3QA 2PHFA 3F95A 1W8TA 1ODMA 4N9IA 4QAWA 4GD4A 1H4HA 4U2AA 5LK5A 2K0GA 1JOBA 1XRUA 4M3CF 5CG8A 3ZKYA 4K40A 2PN5A 1AVBA 1GFF2 3N9MA 4Q4V3 4R9AA 3MIBA 3KV6A 5JI9A 2EA7A 1UO9A 1POV0 4P9WA 2QE3A 5H9QA 1K45A 4AHWA 1MPXA 3GCWA 3MF6A 5CVRA 5I0TA 1UZYA 2VOWA 4XEZA 4NUBA 4OQ8A 2Z69A 4YGDA 3OBTA 1R092 3AMMA 2F6BA 2R0FA 4Q0VA 4K1YA 4BQXA 5JDBA 2HEVF 3ZSLA 4IE6A 1MQTA 1MR5A 1QJX1 4QKFA 3ZMNA 4FAHA 1QU0A 2A6VA 5ABJC 1AR93 3B93A 2ZX1A 1E5SA 1N1TA 4YGCA 1O5UA 5FMOL 3IAQA 3I2JA 5FREA 3ZFFB 5J7MA 3O0WA 5IAVA 1ULDA 5GZGA 4ES8A 4LUKA 2RG4A 4IW3A 2HWE3 2DCKA 2Y0IA 3DXUA 3KMHA 1UX6A 2VH9A 3OUHA 3M3QA 2WNVC 3RWNA 5I93A 1OD5A 4MVTA 1RJ8A 2ZACA 3U1XA 4AEKA 4XFBA 5K0UB 1BVVA 3TAYA 2NP0A 1W99A 2YROA 4HETA 1S0JA 1UYPA 2VULA 2YBSA 5FPLA 2AENA 3GM8A 3C7EA 2ZHMA 4LLFA 2R7EB 1WWYA 1XXNA 2ZMKA 2VNGA 3IPVA 4HK8A 4CP9B 3LKJA 3BTAA 4BQ2A 1S0DA 5IJRA 4O9EA 2DVFA 3EYPA 2RJ2A 1LODA 4JGZC 4OCTA 3KWVA 1BVP1 1SMVA 2NMNA 5A7WB 5FP9A 5FPZA 4BE3A 3Q8BA 1H9WA 3UGHA 2XH6A 4LBQB 3U07A 4AYUA 3U10A 3I4IA 2P3JA 5C3SA 1N1VA 4S2GA 4XZUG 3LQCA 5BPXA 5SV8A 1F8VA 4Q4X1 4XF3A 1W8WA 1VBB1 1W6MB 1YEWA 2ZGUA 3ZFEC 4JKKA 1IGOA 2W95A 4LHSA 4LO8A 4NJ4A 3VBHA 3VZNA 3NJXA 5GLZA 4UFLA 4B3NA 2O14A 4H3WA 4MG2A 4MHRA 4XF0A 3RMXA 3ZXEA 2IZWA 2DBIA 1L7LA 3IMMA 4QKBA 3U11A 5BXXA 4XFGA 2WAOA 1PM7A 2NYYA 3ETPA 3P3NA 1H2MA 3PIGA 3BOWA 1ZRFA 4QM9A 1YFWA 4JC1A 2V73A 3HT2A 3USUA 5A3LA 5HCHA 3ZM8A 4LITA 3N7KA 3SEEA 3WXPA 4WV8A 2OQ6A 3UETA 1W9FA 5FYIA 4IV3C 5I8YA 3I3QA 5FXWA 3SHRA 4AHZA 2AR6A 3W21A 4B4RA 1S0FA 4XF9A 5FYZA 3TOJA 4OQ9A 1LEMA 2W87A 2ZAHA 2MPFA 2VZ3A 2ID4A 2KM2A 3GALA 3GCXA 4CDXA 4CCOA 2R1DA 2R32A 1QGLA 4R9BA 4EWAA 4ZZ8A 1PK6A 4L97A 5A33B 2ENRA 1P8JA 4LBNA 4TLFA 1BCXA 1BEV3 1T6GC 3DEMA 3WW4A 2P1BA 1G86A 4BIOA 3LSEA 5C6CA 4FFIA 3UJOA 3ZPYA 4PJYA 4K8FA 1NYWA 4CEYA 1AYM1 1BLZA 3PMSA 1QWRA 3TEWA 2Q1FA 5JPNB 1YUDA 1K5MC 3SH5A 4P9XA 5FYYA 2YU2A 2VMFA 1GMMA 1MQTB 1VIWB 2A7AA 5IYYA 5FKCA 2DFCA 3CZJA 4A6SA 1JZ7A 1UOGA 5LBFA 5FZDA 4CDQC 1LHNA 1EY2A 1OKOA 2YUEA 4P5YA 2ZGRA 4FXGB 1CAVB 4FQZA 4LA3A 4GJZA 1TZOA 4MUVA 1DU3D 2Y6HA 1DCSA 4XJZA 4JGZB 2WINB 4YVWB 5IVYA 2V5YA 2C1FA 5C4WC 1OVSA 3LPFA 5EYXA 5LA9A 2IXKA 4D7SA 3SKJE 4CCJA 3PUQA 2RM23 1JOJA 1PVC2 5ACA1 1DZTA 1NCRA 3VDAA 3AXDA 2XJVA 3ENRA 3PJYA 2JDAA 5BNOA 1RHI1 1RUH2 3WCRA 3WP6A 1RUG3 4QPGA 2WZR2 4NVPA 1CAXA 3QACA 3DGTA 4DQAA 4IEXA 2PAMA 5DZEA 4IGOA 1H2KA 2O8OA
chains in the Genus database with same CATH topology
5TSWA 3ZFEA 3GHNA 2XG3A 1N3QA 4XIOA 3GYDA 3ZXGA 2JDZA 3G6JB 3POWA 2PHXA 1C8NA 1JUIA 2RHPA 2W52A 1XNDA 4HLTA 2JE9A 4LT5A 1W6NB 1DG6A 4GB31 5E16A 2YMZA 5KHIA 3NV2A 2DVGA 1RUF2 4FPLA 4YRDA 1M4WA 4OI2A 4D69A 4YM3A 1GV9A 1FT9A 2XPJA 4JTOA 1WMEA 2D3SA 1AF9A 1PMIA 4PIXA 1LGCA 2QFEA 2NZ9A 4HKOA 1FV2A 4NWVA 4XJ9A 1RC6A 1BBT3 4DY3A 4IV3A 4JGYB 1MZEA 1UZZA 2CL2A 3ZXFA 4HZFA 3ZXLA 4XYXA 2JG9B 2UURA 2XUMA 1EAH1 4HSJA 4E4DX 3UKTA 1QOSA 4M3CE 4XHBA 3JD71 1ZX5A 2ZHKA 3ZN4A 3ZIXA 3LOBA 1YXWA 1UKRA 3VBSA 1H0BA 3TNPB 4FAGA 3RRDA 2WKKA 1V6KA 2YPJA 4QQLA 1FPN3 4JV4A 4HN0A 3UL2A 2EAAA 2WSUA 1UKGA 1PIV3 3UKVA 4S2FA 1TMF1 2F4PA 1QOOA 4I09A 1BJQA 2VECA 2YY1A 2IXIA 3J8F1 4QX5A 1RUD1 1ZYBA 2D43A 1COV1 3WY6A 2WS93 4JRLA 1H4GA 4BQ1A 4N9HA 1MVEA 5F6KA 1ASJ1 1OFSA 1AXKA 2A3WA 2GSYA 3H1MA 2XJQA 1NCRC 1HQLA 3FLRA 1G9DA 1Z7S2 1QH7A 2TNFA 1DQ4A 3U0ZA 3HR9A 4YVSC 5BNOC 1LOFC 4XBQA 2WWSA 4LEJA 5K8SA 2Q8OA 1QDCA 2SBAA 2OZ6A 1QJY3 1H1IA 3APBA 2PHDA 3NV3A 3FUOA 4MV2A 5FO8B 1QQP3 1XU2A 1CONA 1WGPA 3GZUC 5FPXA 3BODA 3PNAA 5IK7A 4TWTA 4L92A 3VBFB 4XFHA 2XJRA 3URFA 4ATEA 2DUOA 4QQHA 4I3PA 1VBC3 5I91A 5FOBB 3I59A 4HPKB 1W2UA 3OGJA 4JVAA 2R071 3MI8A 2GAUA 4WVMB 4FSJA 3VBOB 1V6JA 1B35B 2LUWA 2ZX2A 1TMF3 5EFUA 4JRAA 4DRRA 2R072 1D2SA 1H8TB 4LUMA 1LU1A 3VKFC 4UW3A 1I1EA 1O91A 1BMV1 4HK9A 4ZU7A 5DXDA 3ZN6A 2HEWF 4LO7A 2D7FA 3IIAA 5L7OB 1AUYA 1YCIA 2CGNA 3A0KA 3QH7A 4PBPA 1PZ9A 1WLDA 4KL1A 5JI7A 2EVXA 4TSVA 3V65A 1MEC1 1VBD1 4YG3A 1V6NA 3MIGA 2BPA2 4FXKB 4RSUA 3LAGA 1YWKA 1FPN2 2HWE1 1GSLA 1ZZ6A 4E27A 2XKPA 4I0WB 4E9KA 3ATGA 2X8KA 1CAXB 1IS4A 4G4FA 1MEC3 3R05A 4AHXA 3KCYA 4Y20A 5T5JA 2Q1MA 2HWC2 5DUUA 4AI3A 2VW1A 3OGGA 4WM8A 4A3XA 2CGPA 2RS31 2IWGB 4K1ZA 3JB8A 2WS92 3VHPA 4Q4V1 2WA3A 4XZPA 1J1LA 3JZVA 4PLOA 5FLHA 3RJ2X 5C8CC 1PO21 2R1BA 1AX0A 1K5MB 3CO2A 5DDJ1 4XFCA 1SLAA 3E5QA 4CDWB 2FBEA 3B7MA 4XQ4A 1ZBA1 3RDIA 3O7OA 3MIFA 1IS3A 4WM7C 3WVJA 4YZ5A 1QF3A 1RUOA 3DN7A 2XL7A 4CDUC 3IWZA 4CEYB 2YXSA 1JYCA 4KNCA 1VBC2 1D0HA 5E8AA 4B4QA 4FP3A 4EN8B 1YIFA 2DCJA 3VKNA 2D6LX 3FBMA 1RITA 1SLBA 1AR61 2EF6A 4RHV2 4M0HA 3J4UH 5GZCA 3OYWB 4K21A 1BMV2 1FOD2 2DUPA 3OBRA 1W6PB 2PAKA 4XETA 4YZ3A 3R4SA 4GWMA 4RQPC 1ALYA 4I0BA 5CFCC 3LWCA 1GZ9A 2PLV3 5JMCA 5GJ6A 4BM8A 4W6WA 4X8PA 3AM2A 5GKAC 2VG9A 4FP2A 5GALA 1APNA 2XJSA 2ES3A 1I6XA 3D0JA 1SFYA 4RR3C 5JSPA 4XMAA 2CV6A 4LE4A 2ZGSA 4LHLA 5FCCA 3MLLA 1TNRA 1PVC3 3JQXA 4AE2A 3RPQA 4C1XA 2WFF1 2VGDA 5LRSA 4GH4B 4BYYA 1U5IA 1ZNPA 3N36A 2ZGKA 3EQEA 3PVEA 4PBOA 4LBJA 3E6DA 3HQXA 3T2TA 3RZZA 4OI0A 5K0UC 3S6PA 3AP5A 1Q8PA 2WNVB 3IPVB 4NN0A 1C3HA 3MIDA 4DRVA 1V9U1 1CAUA 4Y20B 4META 3CJIB 4OZXA 4LO4B 3VBRC 4ES9A 5KHKA 1Q8SA 4N7IA 4GB32 2IXHA 3JU9A 1COV2 3GZTB 4A2UA 1RUD2 3MGUA 2VOVA 3AMNA 2DURA 4J1WA 1AR72 1LGNA 4H7MA 1J1TA 2FZ1A 1C5IA 2ZCWA 2G4IA 4FPOB 2B45X 4WM7A 2HJIA 2ZJCA 2Y0OA 1WW7A 4CDUA 3H8UA 1MZ6A 3IMNA 4V1PA 4Y22B 5DZFA 1PO11 3SISA 4OUSA 4C1WA 5BNNC 2WNUC 4FCAA 4MGZE 1MS4A 5JLVA 2R062 1QKQA 3ZYRA 5K7PA 2R49A 1S0BA 1H8TA 1RUE2 2VVDA 1ND3B 1UCXA 2B8MA 1MS9A 4N90A 1CD3G 4RGGA 1GYKA 1AR81 1QJU2 1URXA 4K7JA 5EXOA 1LOAA 3VBOA 1Y9QA 1NXD1 4YVSA 2R043 3HT1A 2GC1A 3N3HA 3NVCA 1CN1A 1LOFA 3B02A 3RI8A 3E6CC 3DPRB 3ROUA 3J26N 4CTEA 1Z78A 5F6LB 1RUI1 4P9IA 2FMYA 2P34A 4RGAA 4FQ4A 3IKWA 1Z7S3 4E4ZA 1JN2P 5CFDC 2UWAA 3N35A 5KHJA 3VHOA 5DDJ3 5BY5A 5I8TA 1DGWX 2GH2A 2XVKA 2DWRA 2PHUA 1C1LA 2XJPA 3FLTA 1YNAA 1LRHA 2FMDA 4WZFA 4XPVA 1NA1A 1V9U2 1E57A 3QLQA 4M00A 3VL8A 1DFQA 1AR62 1EV13 1RVF3 1I3HA 4DPNA 2C5DA 3K48A 2FQPA 1NA1B 2I74A 5C9AB 4FPYA 1PGSA 3O0XA 1BEV2 2XHKA 1PVC1 4PDWC 2DCYA 2QDRA 2OUJA 2WQ4A 4S2DA 2JX9A 4NWWA 2E63A 4Y1UA 5LK7B 1YIPA 1VBE3 5FMOS 2QNKA 2ZKLA 4IEVA 4AI8A 4F83A 3MZHA 5J09A 3P3PA 4LHKA 3Q9OA 2AUYA 2MEV3 3NO8A 2ZPXA 3ALQA 5T5PA 1RJ7A 1NLSA 1LHUA 1WLTA 1RUC3 2RS11 3VBUC 3MLKA 4LBQD 1PO22 2E53A 1J59A 1XNCA 2UWCA 4CEWB 3LB9A 2WZR3 1AYN3 4F7ZA 5C9AC 1NOVA 3VL9A 2CAVA 2IFRA 2WS91 4P9JA 3RSJA 1FXZA 4AEDC 4OI4A 3KT4A 3M3EA 1RUJ2 1WMDA 1RUE3 1ENSA 1BEV1 1O4ZA 3AKSA 5FQ0A 2RM22 3KS7A 1JHNA 1AYN1 3ZYIB 4M3CB 3JBG3 2P3KA 4IESA 5L19A 2A6XA 3MW2A 5AFBA 4UXAA 2XVLA 4I30A 5IK4A 3VUOA 3OD4A 1Q43A 1YI7A 1Q8VA 1C1FA 4GA9A 2O1QA 3USSA 1QJY1 1KFXL 1N3PA 1WBLA 2VY0A 4YZ1A 1W6NA 2ZHLA 1MEC2 4YNIA 3AP6A 5CBLA 1RMU3 3UJQA 1AX2A 5EV7A 3ZVXA 3AKQA 1WCKA 2JICA 3C2UA 1VBE1 4U36A 1HX6A 3CJIA 2QUOA 1UU4A 3ME2A 4E2SA 2ZGPA 2WNVA 4Z1VA 4HVOA 1Q56A 3FLPA 4QPGB 4DMIA 1OQEA 3E5XA 1UU6A 1NA1C 1NCRB 2OVUA 4Q1RA 2ZA9A 1TME1 3PJQA 5BNNB 4COZA 1PO13 2Q0AA 2XBO3 2WT1A 4LLOA 1ZZCA 1RUD3 2VUAA 4Q4W3 5FBZA 2CGOA 2IXLA 4ATFA 1F2NA 3EHKA 2PTMA 2BNMA 2E7TA 1RUE1 4PDWA 4XQWA 1OPOA 4RQPA 2UU8A 5F9TA 1HRV3 5K9YA 1FI2A 1NCQC 2I07B 3JD73 2EIGA 1CESA 3HWJA 3NKTA 5IK8A 1ND2C 1D4VB 1QXPA 1ZBE2 2GC2A 2OPKA 4XMIA 4AI1A 1AJOA 4C0HA 4CDUB 4ZU4A 3WP4A 2UYAA 3LA7A 2O0OA 1JUHA 1RMU1 2ARXA 1RUC2 3RG0A 3UV9A 3WG3A 4AK3A 3DUIA 4AVCA 5ACA3 4PLNA 3FJSA 1RUG1 3M3OA 2QKDA 3ACLA 3LOIA 4LA2A 1CR7A 1R083 1CAUB 4DB5A 1R091 2MEV1 3J8F3 3TRSB 2R042 2CYFA 4WVVA 1REFA 4IEZA 4XFIA 3OTFA 1C8M2 4AXOA 2HWD1 4FPKA 1NE6A 5CU1A 2XB6C 1ASJ3 3RYPA 2D5FA 4R52A 1OLRA 1RUH3 1AXZA 5HI0A 3WHUA 3D4KA 3VHNA 4EN9B 2HWB3 1WW4A 2KXLA 1H8VA 3D82A 4JDOA 5JSRA 1GNHA 4IEPA 1VBA1 1GNZA 3NAPA 5D8AA 1D4M2 3MF9A 4CEYC 3X29B 3RYRA 4OFGA 1O5LA 1VAKA 2JENA 2A75A 2E7QA 1K5MA 2ATFA 3S30A 3WUDA 3N7MA 1LKNA 3CJIC 3AKPA 2A3YA 1QXRA 1GANA 1FMD1 5DUVA 1VBD3 2BEOA 1AR92 2X5IC 5L7OC 2BWCA 3HAGA 1EAH3 3OCPA 4AFMA 5KC6A 4WM8B 4FOWA 3THPA 1VP6A 3ZX7A 4FOVA 4Z8BA 1YI9A 5AC91 2BTVC 5I0UA 2Q5TA 4KQ7A 1KS4A 3GBWA 1AL23 2ZBJA 3DL3A 4HKWA 3WDVA 4QGNA 3TB0A 1NCQB 2EXIA 3I8TA 5FRAA 3QCWA 4GALA 4Q0SA 2VW0A 2WT2A 1VB2A 4YM0A 1J3RA 3AKTA 1O3RA 1IKPA 3TNQA 3AZYA 3ZSEA 2DUQA 1C57A 1FV3A 1Q5OA 4EJRA 1O4TA 3HBZA 4PDWB 1O3TA 4QPIC 2OUHA 2BFUS 3VZOA 2G9GA 1RIRA 1HXS3 4L11A 2FHRA 3KLSA 5ACA2 3PMEA 2GU9A 1ENRA 3LCPA 5J48A 3ZFFC 3IT8A 1X8EA 1TME2 2DCZA 5ABJB 4XF4A 5LRRA 3L9JT 2PHWA 5JIAA 3OD0A 2GALA 4HPKA 4XIKA 4QQOA 3B5LB 2VQ0A 2RS12 1OOPA 2RS32 1RB8G 5BNPA 4I2OA 3WQ1A 1EP0A 4COVA 1QNYA 1LGBA 1GZCA 2BYVE 4ISRA 1J3PA 2JD4A 1Z0HA 3H7YA 2UYBA 1MS0A 1QH6A 4Q29A 4AEMA 1HIXA 3GNEA 4QGMA 3RI9A 3S7EA 2DFBA 1CX4A 3D8CA 3R4UA 3GBFA 4Y4YA 2A3XA 3LGRA 1UPSA 5D8AC 1D4M3 3UK9A 4FTBA 4N43C 3ZXAC 4OHVA 2QQPA 3H0OA 3IDBB 5JZGA 3NSTA 3BIWE 2XLGA 2NN8A 1ULEA 4XE9A 2GMMA 4AVSA 4MX3A 3KT1A 1RGSA 2WFPA 4Q4W2 2X5IA 4PIZA 2HEYF 5L7OA 2JG9C 1KDMA 1SBEA 2A6YA 4YW4A 4OHZA 4B8EA 2PHTA 3L2HA 2D93A 1RUJ1 1PO23 4L8QA 1XYOA 3QD6A 4B7KA 4XJAA 3VLBB 1AJKA 1B09A 5GZDA 2H6CA 2VVFA 1LOGA 5GZFA 2NPIA 4MLOA 4D7YA 1RUJ3 1ZVFA 2W08A 2ZGOA 3I7DA 4WVMA 1JH5A 1A78A 1BXHA 4JTNA 4F8AA 1U5XA 2ZABA 1MZ5A 4OHYA 1YFYA 1RUI2 1BZWA 4HSLA 2QVSB 3ZXDA 1S0IA 2CNAA 2JE7A 1LEDA 3FE5A 5HCAA 1ZRRA 2DTYA 1NLRA 3B00A 1R082 4KGQA 5T55A 1DLLA 4XXPA 1AR82 4Q27A 4DXZA 3MEPA 3FWEA 4WZCA 4A7YA 4FPGA 1WD3A 1W0OA 1NQJA 1IZ3A 1OPMA 4AHYA 1RUNA 2UY9A 1GLHA 2GNTA 1NE4A 1W0PA 1O3QA 4KH9A 3VV1A 4FPCA 4C90A 4SLIA 4RS5A 5GLTA 2K2SA 4GKYA 4MZUA 1AXYA 1N1SA 2RS51 1DHKB 5T50A 1CGPA 5JIUA 2CAUA 1HKDA 1YJKA 3WOGA 3WP3A 1WLCA 2HYKA 4CDQB 1R1A2 4KWKA 1AL0G 1MS8A 1ZA4A 1W6OA 5FLJA 5B2GB 2RMU2 2TBVA 2VXRA 2ET1A 2WA4A 3WHTA 2R073 2WLQA 1N1YA 3LZZA 3PVBB 4GQ7A 2TUNA 1BBT2 4AG4A 2ZMLA 3AZWA 5T5OA 2C0ZA 3B9CA 2LTNA 1QJU1 1SACA 1BK1A 2BWAA 4BA6A 3MPPG 3TN93 5AVAA 4IEUA 2JG9A 3FX3A 1GKBA 3CU7A 4PCRA 1FNYA 2QJVA 2OZJA 2R061 1QJU3 4N53C 2JKBA 4UW6A 3NJZA 3AP7A 4Q4W1 2WNEA 1VRH2 1XE8A 3KD4A 5DG2A 4K3UA 2VUJA 1LR5A 4HL0A 3VBRB 1ZREA 4WM7B 1DGLA 2W68A 3POSA 3V0AB 3ZYPA 4AVVA 2HWF1 3OY8B 1OI6A 2Y26A 1RUI3 4JQRA 3O0VA 2PYTA 2RE9A 1MQTC 2B7YA 3BPZA 4CP2A 2ZZJA 3JB4C 3PVOA 1RHI3 3MDPA 4CDXB 3ZN5A 4YFZA 3R6SA 3ZFEB 2VOXA 3MW3A 1EV12 1RVF2 4MXWB 3HN1A 2NLRA