1CQ9A

Peanut lectin-triclinic form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
232
structure length
232
Chain Sequence
b'AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PEANUT LECTIN)
publication title Crystal structures of the peanut lectin-lactose complex at acidic pH: retention of unusual quaternary structure, empty and carbohydrate bound combining sites, molecular mimicry and crystal packing directed by interactions at the combining site.
pubmed doi rcsb
molecule tags Lectin
total genus 53
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cq9A00
1JW6A 1JHNA 4XXPA 1H9WA 4GKXA 2ZGPA 2KM2A 4Y1XA 1KJLA 1ULEA 1ULDA 3WCRA 1QNWA 3AYEA 1WW6A 4YZ4A 3WDVA 1C1FA 4SLIA 1LJ7A 5T54A 4JC1A 3FFZA 3MPPG 5GLUA 1WD4A 1C57A 1FAYA 3ZXLA 4BLJA 1I3HA 2UWAA 4IQPA 3BOPA 4AVTA 1V6IA 3AYDA 2GMPA 4XTPA 1QDCA 2D44A 1OQ1A 4YG3A 4GKYA 5JOWA 1LHNA 3PMEA 4Y1YA 4FPKA 4BLIA 2VW2A 3L2YA 2TEPA 1W6PA 1Z78A 1IS3A 1CQ9A 2R1BA 2D6PA 3AZVA 4LBNA 3UL2A 1LULA 5F5QA 3ZSLA 3O0XA 1H30A 1SCRA 4W65A 3WG4A 1QMJA 1FNZA 1UMZA 2YMZA 4DQAA 1JYIA 5JDBA 3ZPYA 3NV4A 1G9CA 4Q1PA 2D6MA 2E7QA 2PELA 1FV2A 3VKOA 1SACA 4Y20B 1CPNA 1V6MA 1C1LA 1SLAA 1WW7A 1WW4A 2VH9A 5L73A 2A71A 4XE9A 4BMEA 2ZGLA 3FLRA 2BQPA 4YGBA 4DPNA 3V0BA 1YI7A 4YGDA 3H0OA 2SLIA 5H9RA 1UZYA 1OFSA 1F5FA 2AYHA 4FP3A 4DRRA 2ENRA 2A70A 4LBKA 4YGEA 1KJRA 4M3CE 1NLSA 1QDOA 2ZHNA 4XHBA 3FUOA 1D2SA 1HQWA 1BXHA 4U36A 1G7YA 1GNZA 1N1TA 5DZEA 4P9XA 2CY6A 1LODA 4Q26A 2ZA9A 3KM5A 2NM1A 2R16A 2R0HA 4Y22A 3N7KA 5GJ6A 5GZEA 4CRQA 5EXOA 2DTWA 2LALA 4YGCA 2PHRA 1URXA 2VW1A 3VKNA 1WLDA 3POWA 1LCLA 2C9AA 1ZM1A 1Q8QA 1SLLA 4GALA 4YM1A 5T5JA 2DV9A 3JUUA 4P14A 5DG2A 3WUDA 4FQ4A 3USUA 1N3OA 2GALA 1QF3A 4FPEA 1LOEA 5T52A 5DUWA 4AVSA 1R1ZA 1IS4A 3INAA 2A6WA 4BQ1A 5CB7A 3BTAA 1LESA 1UPSA 3ZYRA 2AREA 3TB0A 5FRAA 1W6MA 3AFKA 5DZFA 1MZ6A 1W0PA 1MS5A 4DFSA 3NWKA 1S0IA 3OY8B 1DQ2A 2EAKA 2GMMA 3FBYA 3UJQA 4FPJA 2WJSA 3HMYA 2DVDA 1AX0A 4NOTA 4XOGA 1CIWA 5E88A 5FREA 1LU2A 3MW3A 4ZXKA 4GXLA 2P2KA 5GLVA 4CZSA 3M3CA 1FNYA 1SCSA 2DWRA 2AUYA 3HN1A 1LHVA 1LHOA 4HANA 4XBLA 1LTEA 2D3SA 1AX2A 5HCFA 1IKQA 3UK9A 1HQLA 1CVNA 5JOZA 2OUJA 4YW5A 5H9PA 3VUOA 3PVOA 4YW4A 1ULCA 3N7JA 3AZXA 4YG6A 2ARBA 3B01A 2WKKA 1W6QB 3M2MA 3RQ0A 2R0FA 2A6VA 1W0OA 5EWSA 3ILFA 3NV3A 4FOWA 2EXKA 5SV8A 1LHWA 1WD3A 1B09A 1CONA 4JCKA 3WDYA 2ZGKA 1W6OB 2CTVA 4LBOA 4ITCA 3W59A 2H0BA 3IPVB 5GM0A 1S0FA 5DZGA 4AWDA 4M01A 1S0CA 2D6OX 2PHFA 5KXCA 2AENA 3OGGA 4BOWA 4NO4A 3FUQA 1QOOA 3D6EA 3ZXJA 3AZZA 1DGLA 2B7YA 3T1LA 3B9CA 2ZMKA 3MEPA 2NMNA 1CPMA 3OBRA 4R9AA 3RMYA 1AJOA 1G86A 2ZABA 1LEMA 2JECA 3ZSJA 2AR6A 1BYHA 2P3KA 3WHUA 5BYNA 4FVVA 1APNA 1Z0HA 3RG0A 1IKPA 1LEDA 3AP4A 1SBDA 4XILA 1LU1A 2EXHA 3V0AB 1S0DA 2A3XA 2ZMNA 5JOXA 3IMNA 2CWMA 3W58A 3N7MA 4LBQA 2DVAA 1RITA 1N1YA 1W6NA 1GZCA 2A6YA 3IM0A 1Q8SA 2D43A 1WCSA 2P3IA 2UWBA 4YZ5A 1BJQA 3SNMA 1AXKA 4F83A 5DUXA 4YM3A 4LBJA 3LSEA 2DU1A 3WCSA 1GV9A 4GA9A 3AXEA 2ARXA 2CNAA 1GSLA 3AXDA 4U2AA 3SLIA 5AVAA 3OYWB 3NV2A 1VALA 4C1XA 2A5ZA 1AVBA 1GZWB 2GNDA 1AZDA 2ZZJA 3MW4A 3QCWA 4PF5A 1QU0A 1GICA 1LOCA 1U0AA 5GZCA 2PHXA 2DUQA 2EALA 3WV6A 5JMCA 1DLLA 2AGSA 4AYUA 1N1VA 2ZBJA 1IS6A 1SLCA 4DS0A 2P34A 2WSUA 2WLQA 4UW6A 4AVVA 3RMXA 1S0GA 2FMDA 3SH5A 4Y22B 2DYCA 4LBQD 1N47A 2ZGQA 1BKZA 1F9KA 1V6JA 3WZ1A 4JRAA 4Y1UA 1V00A 2NMOA 3N36A 2GNBA 4AGRA 4YZ1A 4ATFA 5CBLA 1YRZA 1V6NA 2ZGSA 2UU8A 1ENQA 1N3QA 2YROA 4LBMA 5DXDA 2DVFA 1LGNA 2GMEA 3AP9A 4FOVA 5F9TA 1AF9A 3AZWA 1G9FA 2YZ4A 4Y20A 5IK7A 2LTNA 2OVUA 3M3QA 1MVQA 1QOTA 4YW3A 2A75A 2ZGOA 3AZYA 2W39A 4FOQA 2ZAAA 3ZVXA 3JU9A 2P3JA 2D3PA 5IK5A 3IN9A 3OPZA 3ZXEA 1KDMA 1KRIA 3WG3A 1UN1A 2NP0A 3WDXA 3ZXFA 3A4UA 4YW2A 1J1TA 4ISQA 4YZ2A 2OUHA 4ZKTB 4L8QA 4FOYA 4C1WA 1DIWA 2JE7A 4YM2A 2W08A 3CNAA 1LOBA 4BM8A 1MS3A 3KQRA 4XJUA 5DUUA 5HCAA 1JYCA 1DYKA 3ZYPA 1VAVA 2WQZC 1JXNA 4Z8BA 1MR5A 1CN1A 3SH3A 1UX6A 1X50A 2EXIA 5E89A 3U4XA 5GLTA 1MACA 5IUQA 3WNXA 4TZDA 5IK8A 4M3CA 4WVVA 2A3YA 3B69A 2GN3A 2GN7A 2ZGRA 5IT6A 3R4UA 1Q56A 4DRVA 4Q1RA 4WZFA 1G9DA 1KITA 3N7LA 3R05A 5KXEA 2WT2A 1IOAA 3HR9A 3WVJA 3QLQA 2ZHKA 3ZSKA 4XHXA 2WSVA 3WLUA 2DVGA 4FPFA 3VKMA 4FPGA 1YXWA 5T55A 3OY8A 5DG1A 3Q9OA 4YFWA 1DBNA 1AJKA 4Q27A 1I1EA 2E7TA 2E6VA 2ZHLA 1BZWA 3SITA 2XB6C 4Y1VA 4UW4A 1WBFA 4M3CF 4Q8LA 1S1AA 1Q8PA 3GNEA 4OZXA 4GWNA 2E51A 3O0WA 1ZA4A 3D5OA 5GZGA 3V65A 3O0VA 1FATA 3T2TA 4CTEA 4RL7A 1H9PA 3A0KA 4XIOA 1PZ9A 3AYCA 1KQRA 1D0HA 5GLWA 4FQZA 1AXYA 2UWCA 1Q8OA 3A0NA 1WUVA 1ONAA 5GLZA 1FX5A 1W6QA 3N3HA 4YLZA 4FPHA 1W6NB 2PHTA 3NV1A 1V6KA 4Q8KA 3T1MA 4YFZA 3LSDA 4WV8A 1O4ZA 4YZ3A 1A78A 2ES3A 1JOJA 1SLTA 1GANA 1W6PB 4FPCA 4Y24A 1W6OA 3RRDA 4HL0A 1HLCA 4K21A 1AXZA 1ULFA 3O12A 2I2SA 3IPVA 3B3QE 3PJQA 2RHPA 2EIGA 3VKFC 5T5OA 1IS5A 1SFYA 1KDKA 4FPLA 1HDKA 4R9BA 1S0BA 2DUPA 2JJ6A 3AP5A 3M3OA 4XIKA 4XDQA 4XJAA 3GALA 4Y1ZA 3WDTA 1BQPA 1SBEA 1DYPA 3ZSMA 1DQ1A 2V73A 1LOGA 2E53A 2W68A 1ULGA 4XJZA 5T50A 1CR7A 4AGGA 1DHKB 2Z42A 3DGTA 2D6KA 4P9WA 5HCBA 3SH4A 5CA6A 5CNAA 5CAZA 1JUIA 3V0BB 4ATEA 2Q5TA 4H55A 4YW1A 2GDFA 4XYXA 1SLIA 5GZDA 3V0AA 3R4SA 2YY1A 1XQNA 4BPZA 2ZHMA 1NXD1 2PHUA 5GALA 4XJ8A 1PZ7A 1YYNA 2R49A 3VV1A 5JLVA 3RS6A 1SBFA 5KXDA 2R1DA 4PBOA 4TYSA 2GNMA 1VLNA 1G9AA 1FYUA 1LOFA 3ENRA 1LGBA 4RA0A 5JVVA 2JDZA 4K1ZA 2ZMLA 1GLHA 3B00A 3AX4A 2VY0A 3WG1A 3WHTA 3USUB 1LOFC 2SBAA 4XJ9A 2W52A 1UKGA 2OW4A 3M3EA 4XZPA 3ILRA 4KBBA 2NN8A 5T5LA 2ZKNA 4M00A 3PVNA 3TAYA 1UZZA 1HKDA 3OYWA 1C4RA 4AGVA 1DQ0A 1GZWA 5JOYA 1AX1A 2NZ9A 1JBCA 4XBNA 1W6MB 2D3RA 2WT0A 4XTMA 1QOSA 2VUAA 1QNYA 3BIWE 5LK5A 3AJZA 1MS8A 3D4KA 4YG0A 1LECA 1GZ9A 3ATGA 4R9DA 1MS9A 2WNEA 3ASIA 1OKQA 3POYA 1G8WA 4XXAA 4UW5A 4K20A 1DQ4A 2A7AA 3VKLA 3MW2A 3AJYA 1N1SA 3SISA 3UJOA 2NYYA 2YV8A 1LOAA 4BMBA 4PBPA 4M3CB 2ZGUA 3OJBA 4XMIA 2JE9A 2JKBA 1GYKA 1QKQA 1DFQA 3WDWA 1TEIA 1WLWA 2G4IA 4FPYA 1MS0A 3WG2A 1MZ5A 2HYKA 3ZXKA 2CL2A 4D69A 1CESA 1LHUA 1F31A 4XJWA 3AYAA 4XBQA 4FPOB 1FV3A 3AK0A 3C2UA 2V5YA 3AP6A 1JN2P 4ISRA 4Y26A 3V64A 1UL9A 1WBLA 2WT1A 3OBTA 1VAMA 3APBA 3DUIA 3FLTA 1V6OA 4PQ9A 5IK4A 1SLBA 1PZ8A 2VU9A 4MYEA 2FHRA 4WVWA 3WUCA 3I4IA 1A3KA 4ASMB 1DZQA 5EYYA 1N3PA 3BODA 2ERFA 3M1HA 4FP2A 5T5PA 5KXBA 1ENSA 2DUOA 2PHWA 1O4YA 5H9SA 1V6LA 1WW5A 3WOGA 4PCRA 2D6LX 2CYFA 1QGLA 2D6NA 2DURA 3I8TA 4UW3A 5GZFA 2ZGNA 3O5SA 1DQ5A 1LGCA 1S0JA 2VXRA 5H9QA 2ZGMA 2YXSA 1YO8A 3AP7A 2GNTA 1LENA 3ILNA 1ENRA 3N35A 2UURA 2CWSA 1EPWA 1MVEA 1VIWB 1A8DA 5EYXA 4LBQB 2DTYA 2A6ZA 2DVBA 2A3WA 4K1YA 4P9YA 5E8AA 2DU0A 2VW0A 4LBLA 3PVEA 4XMAA 1Q8VA 3LCPA 1CJPA 3IKWA 2ZGTA 4Q2FA 1DQ6A 1RINA 1MS4A 1GKBA 4I30A 4R9CA 1GNHA 5DUVA 1WLCA 2AH2A 4GWMA 3RSJA 2XG3A 2C5DA 1Y7BA 2EF6A 3POSA 1UAIA 2JD4A 3FLPA 2ZACA 1GBGA 1MS1A 2A6XA 3WDUA 1YIFA 2D7FA 4YM0A 1G9BA 1S0EA 2EXJA 2P37A 1RIRA
chains in the Genus database with same CATH superfamily
4Z2WA 1JW6A 5E16A 5AVPA 1FPN2 2VMFA 2WWUA 4W6YA 5IVBA 3WQBA 4HN0A 2KM2A 4Y1XA 1ULEA 1S2KA 5J48A 1WW6A 4J6GA 4YZ4A 3WDVA 5HI0A 4MUVA 3FFZA 3MPPG 4L11A 2XPJA 4RR3B 1C57A 4PIZA 3POFA 2WQ8A 3JXSA 4XZUG 1CAXB 2UWAA 1ND2C 3I97A 2ZKLA 1RHI2 1OQ1A 1ZRIA 2YGLA 3ZFGB 4GKYA 4XUTA 5JOWA 1DZRA 1Y9QA 2V09A 1ZNPA 4BLIA 1ZZ8A 5BY5A 2JXAA 2VW2A 2P1BA 2TEPA 1Z78A 4CPBD 4FCAA 3UL2A 3ZSLA 1LULA 2RJ2A 2Y6KA 3LQCA 4QQ2A 2JG9A 2CAVA 3O0XA 1SCRA 3I2KA 3WG4A 1QMJA 1ZRRA 3UESA 3E6CC 3ZPYA 3PDQA 1G9CA 5FY5A 3PNAA 4Q1PA 2PELA 1YCIA 3BUCA 1SACA 1TG7A 4OYUA 4QU1A 1V6MA 2OQ6A 1SLAA 1GOHA 1UXXX 1WW7A 2VH9A 3LAGA 2WZR2 3H3UA 1HIXA 3GHNA 2IVJA 4LXLA 4BMEA 2IXKA 2LRPA 4YGBA 3TOJA 3ZFEC 4DPNA 1YI7A 1QEXA 4FFFA 5HV4A 2SLIA 3GZEA 4RN5A 5H9RA 2XVKA 1OFSA 5C4WC 1F5FA 4DRRA 3LEMA 3FBMA 1EUTA 2A70A 1KJRA 1QDOA 3E97A 1NQDA 1XYOA 3AKSA 3I2DA 1CAUA 2JDNA 3CZUA 1R1A1 2PLV2 1QWRA 3VBUA 4U36A 1N1TA 4P9XA 4BIOA 2ZA9A 4C0HA 2R16A 5CVRA 3WSOA 5LEJA 5E6HA 5GJ6A 4CRQA 5L7OA 4BISA 4YGCA 5LY2A 1KD7A 1SFPA 5CG9A 1LCLA 4GALA 3I3EA 4UT5A 1YJKA 4Z07A 4YVWB 4BHPA 3JUUA 2JDMA 2WAAA 4JGZA 5DG2A 4D8MA 1IZ3A 3USUA 4A41A 1N3OA 4IL7A 2GALA 1AR62 4FPEA 1LOEA 1JI6A 1JYTA 4AFDA 3W9AA 2FCTA 2WO3A 4QPWA 1PO12 1BEV3 2X8KA 3I2GA 3ZYGA 3U07A 5GKAC 3LIGA 3I2FA 2WDBA 1S0IA 2OQ7A 1PIV2 4TWTA 5A1FA 1AX0A 4KMQA 4ZXKA 4PI0A 5FP3A 1COV2 5M0TA 5CEHA 1IG0A 4CZSA 1QJFA 4NWVA 1FNYA 2DWRA 2R073 2AUYA 5EJ1B 1LHVA 4MZUA 4AFBA 3BPZA 3T09A 1PVC1 3GF6A 5JOZA 2RJKA 1P8JA 4LULA 3I49A 5HPOA 1QJX2 4YW4A 4L9BA 5FXVA 3AZXA 4OZOA 4OUEA 2ARBA 1W2NA 1AYN2 4WVMA 2XJQA 3RQ0A 5B4XA 4AEJA 3M7AA 4UFIA 4XFGA 5EJZB 2FDJA 1W0OA 5EWSA 3TN93 3WW2A 1ACCA 1K5MA 1YQCA 1RUC1 4FOWA 4RQPA 2EXKA 5SV8A 4AL9A 4QXKA 3IDEA 2VOVA 1W8HA 1B09A 3LOBA 4ZS2A 1WCDJ 3POJA 1D4M3 4JX0A 5FZ6A 3T4VA 2H0BA 3IPVB 2DBNA 1S0FA 2WR9A 5GM0A 1J58A 5LW9A 3J8F2 1QXPA 1ND3A 1IPJA 2VZTA 2QQVA 5DMYA 3D6EA 3LWCA 2YC4A 5IATA 1UMIA 1YLLA 3AMNA 2Z79A 5FXZA 4G3YC 4R9AA 2J22A 1AJOA 4JV4A 4QKNA 3RMYA 3KT7A 3MZHA 1HRV2 1BYHA 2P3KA 5BYNA 3BB6A 4NJ4A 3BTZA 1Z0HA 1LEDA 2HWB2 3FMGA 3POIA 3RZMA 3RZKA 2BEOA 4M0NA 1S0DA 2QTWB 4XQDA 2WZEA 2RS11 3W58A 3KZ4C 3KLSA 4CUCA 3MDPA 1D4VB 2DVAA 4JKKA 1JS9A 1QHDA 3VBSC 1W6NA 1TME2 1BHGA 4AZZA 3VD4A 5KR7A 4DZGA 2JG9B 1WCSA 2UWBA 4P9IA 3H50A 1NA1B 2BVBA 2WNVB 2C24A 4LO5B 1J59A 1RUI1 4YM3A 1NCQA 2RS53 3UV9A 5K8SA 2QQNA 2ARXA 2VL4A 3UYJA 4ASKA 5C70A 1EP0A 2QZ3A 1CD3G 1DGWA 3OTFA 2FMYA 2B5HA 4P9JA 1MQTB 1X8MA 1W06A 3MLKA 1NE4A 3LGRA 2J7MA 2GNDA 3QCWA 2B9VA 3NMBA 1VBE2 1GICA 1OXCA 1US2A 1VB4A 2VNRA 3FWEA 4AVBA 4DEVA 5F37A 2PHXA 1CX1A 5JXJA 3D3AA 4D6RA 3WV6A 3H3LA 3BU7A 1NY72 1CAUB 2PAMA 4LO7A 3LEIA 4UOJA 4AYUA 2P34A 5A3OA 2WSUA 3H8RA 1RYYA 1CAWA 3KVBA 1ZZBA 1H2KA 2R043 4CXXA 1S0GA 4N43B 4S2DA 4RR3C 3MIDA 5LATA 2GC1A 2ZGQA 1BKZA 4GB31 4FAGA 4DIQA 4L2NA 3BCWA 4H14A 3IDBB 4XF1A 4L0PA 4UFMA 4P5HA 1YHFA 3VBHA 3MLLA 4AGRA 1VBA1 1JZ8A 1RB8G 2BOJA 4XACA 5F5CA 5CBLA 1R64A 1RUNA 1VJ2A 3VBRA 2ZGSA 1VBB2 2QQLA 2HWE2 3BYWA 4IV1B 5J09A 2Y6FA 1R081 4FOVA 3WW3A 4CDWC 5F9TA 1AF9A 3AZWA 4A4AA 3I3BA 1O7FA 4R52A 2LTNA 2E7AA 2OVUA 3B94A 3M3QA 4E2QA 1OUSA 4NHKA 4S2FA 1OOPC 1ZBA1 2N7GA 5CFCA 5IFPA 2UY9A 5C3OA 3GM8A 3ZVXA 1KRIA 2D3PA 2ET1A 2IVIB 3OPZA 3H1YA 5FP8A 2IC1A 3KCYA 1HN0A 3J4UH 2WFF2 4LO6B 2ZEYA 3KHCA 4YZ2A 2OUHA 2XJRA 1WMXA 1X8EA 3ZLIA 3A21A 4AR2A 3TEWA 2HEWF 4QX1A 3T2QA 4HVRA 5FYBA 1MS3A 2RM22 1H8TB 3TYJA 4I3PA 5HCAA 2B39A 1CAVB 5FPUA 1QJEA 4Q4V2 2W94A 4Z8BA 4IE5A 1SDWA 5ERLA 5F6LB 5FMOS 3SH3A 1F15A 1UX6A 2Q1ZB 3HAGA 5E89A 3QH7A 4TZDA 1E57A 3ZN6A 1DF0A 2BP6A 3PTYA 4M3CA 1BBT2 2A3YA 2X29A 4PF1A 1IHMA 2YUEA 1VMFA 3RYKA 3LFIA 2VOWA 4OHYA 1Q56A 1XB9A 4Q1RA 1OF3A 1KITA 3CJIB 5KXEA 2WT2A 4YVWC 2Q8DA 3GYDA 1RUJ2 2WSVA 3WLUA 2DVGA 4FPFA 3QH6A 4QU2A 4W6WA 1G6NA 4FFGA 5FMCA 3VKMA 1YXWA 4AEDA 3J7LA 3F2ZA 3OY8A 4IGPA 1MEC3 4B7KA 1DBNA 1F4AA 1AJKA 2Y64A 4LJHA 3DXTA 4LKDA 2E6VA 2ZHLA 3A7QA 4K6BA 1TMF1 3SITA 3T3YA 5I8YA 4HKWA 4UW4A 4M3CF 1Z7S3 4PHZA 3BGAA 3K4ZA 4Q8LA 1UXZA 3GNEA 1W8WA 4XC9A 3WY6A 3RJRA 4CCMA 4E8CA 2G9GA 1ZA4A 3MF6A 2X05A 3BTYA 3O0VA 1IQDC 4CTEA 1YQ6A 5F6KA 3MLJA 3AFGA 4DXRA 1PZ9A 3TBDA 3DKWA 1FPN3 4XVHA 1KQRA 2V4VA 5GLWA 1OVSA 4EJRA 2VZQA 4QKFA 1AL22 2VE1A 4F3JA 3ZXDA 3MFCA 2NPIA 5JWPA 1RUE1 3HOBA 1ONAA 2VVEA 2EICA 4Q4X2 1W6QA 1HB1A 1RVF2 1KXGA 5FFOC 4N53C 1W6NB 1V6KA 2PQSA 4Q0UA 3I2JA 4EN8B 1J84A 1RHI3 1JOJA 1SLTA 1XPWA 4OULA 4BCUA 1HB2A 1OLRA 4QQOA 1W6PB 4CP2A 1XE0A 4HK9A 2HEYF 1C8M2 4NAMA 3B3QE 3VHPA 3VKFC 1D0GA 5T5OA 4GMP3 2B9UA 4FFHA 4FPLA 2OIIA 2W1WA 5A6QA 5A1LA 1S0BA 5L9VA 1YQ8A 2JDUA 2VXJA 3HBKA 4XDQA 4I01A 5DAXA 3WDTA 4WM8B 1BQPA 4B4PA 1LOGA 4EZ4A 1DHKB 2Z42A 4QPGA 2PQQA 5CA6A 3V0BB 1AUYA 1W2UA 2WZR3 4ATEA 3OF1A 2BGCA 4TLFA 2I45A 1CAWB 3R4SA 2YY1A 1WWYA 4BPZA 3EMRA 1ZZ6A 2PYTA 2EVXA 2R49A 4KWJA 1WA6X 4UYBA 4XJ8A 5JZGB 1E5HA 2JKXA 5LRSA 3WW4A 1W3XA 4WVMB 5DDJ3 1RJ7A 4A7ZA 1NT0A 3WW1A 1VLNA 2PLV3 4RA0A 1LGBA 2XH6A 4DEQA 4XW3A 3BN6A 2ZMLA 1O3SA 2XVGA 1NA1C 2VY0A 3WG1A 2WNVC 2SBAA 4JGYA 1BLZA 2GAUA 1UKGA 2O1QA 2LW8A 2YGMA 3M3EA 4PIXA 4XZPA 4EYUA 1W9YA 2ZKNA 1QJU2 3PVNA 1AR63 1UZZA 1HKDA 1CGPA 3MIFA 1DQ0A 1JMUB 1GZWA 3AVSA 4GH4A 4QB1A 5D2AA 2IXJA 2FCVA 5FZAA 3ZPOA 1JBCA 4Y26A 1OPOA 1W6MB 4XTMA 3K48A 1PK6A 3SXWA 5HXVA 4C90A 1MS8A 2P6CA 3A23A 3D4KA 5FKBA 1MQTC 3IDAA 4NVPA 1AL0G 4R9DA 5AFBA 2ZEXA 1JZ6A 3ASIA 4BQYA 1XNKA 3ECQA 4EN0A 1PGL1 1PIV3 3POYA 4NHXA 4JKLA 4FO9A 5JIUA 1RUD1 1POQA 3MW2A 1GZTA 3N9PA 1LOAA 4IEZA 2WYFA 2IFWA 3ZN6B 5F3CA 4M3CB 4N43C 1QQP2 2X5IB 1M4WA 2ZXQA 2Y0OA 1TEIA 2JIGA 2G4IA 2K9ZA 4UBGA 1KFXL 3E5XA 4QD2A 4A2UA 1HN1A 3MV11 3C7GA 3WG2A 4NIIA 1MZ5A 1SPPB 2TUNA 3CEWA 2CL2A 3PVBB 2F6BA 4PDWA 4YSFA 1AYN3 1LHUA 1ODNA 5FYYA 1FV3A 3AK0A 2RV9A 4IV1C 3N4MA 1JN2P 1V70A 3OCPA 5BNPA 3O1PA 1WBLA 3S5QA 1VAMA 3APBA 3FLTA 1V6OA 4PQ9A 4JDMA 4YVSA 2WNOA 2VU9A 5AFEA 1ZZ7A 4QX8A 3RZLA 2YG0A 4WM7A 1A3KA 1Y4WA 4CEWA 4CUAA 1BMV1 4JDNA 4LLFA 2H6BA 3OBAA 1N3PA 2LM3A 4F8AA 3J8F3 2EIDA 1NOVA 2VMIA 2JDAA 4Y5TA 2PHWA 1V6LA 4QX5A 3EXUA 4UW3A 4QX0A 5GZFA 1ZRDA 5FQ0A 2G19A 1DQ5A 5DAPA 2RDQA 1H8TC 1S0JA 4OI4A 4Q4W3 4MGTA 3GBWA 4CP0A 2HWD2 1HRV3 4Y4YA 1ZYBA 3HVDA 3AP7A 2GNTA 3WD5A 4M4RA 2B4KA 5D1IA 1W04A 1ENRA 2VJXA 3IT8A 4A45A 4F7ZA 2HWB3 2VM9A 4PIYA 4COZA 4UFHA 4OQ9A 5L9BA 2DTYA 5E8AA 3TN92 1PHMA 5FO7B 3WQ0A 1UIKA 1MEC1 2YB7A 4QMAA 5A1AA 1Q8VA 1R091 3I7DA 1XBFA 4AI0A 1PNFA 3CJIC 4QWNA 1GKBA 3VBOA 4I30A 2P5BA 4HFSA 1GNHA 5J1XA 3K51A 1D4M2 3VBFA 3S57A 2C5DA 1RUH2 4O9GA 5TSWA 4HVOA 2EF6A 3HQUA 3VN4A 4XFCA 3POSA 4GULA 3GZUC 4YW7A 2ADEA 3R6SA 3OUIA 1OLQA 1MS1A 1G9BA 1O59A 1YIFA 1AYM2 5BNNB 2BERA 4HPKB 2WNUC 4QPGB 1W05A 1XU2A 2JG8B 2ADDA 1JHNA 4BXSV 4H7MA 3RGBA 5J98B 3I2HA 5G05L 2QQUA 2ZEZA 4W8JA 1O8PA 3DPRA 3VGIA 1REDA 2JWPA 1EPZA 1VBE3 5GLUA 1WD4A 3D8CA 5AC91 3CQOA 4QPIC 4RS5C 1AR92 1DGWX 1NZIA 2RDSA 3MIBA 3KF3A 4BLJA 4IQPA 1RHI1 3BOPA 5A6ZA 2XUMA 2VR4A 3LDKA 2GMPA 4XTPA 1QDCA 1GWLA 2D44A 5JUVA 2WIIB 4LIVA 3POEA 2F17A 1KFUL 4XUOA 1POV3 1FOD3 3DXUA 5IVVA 1UD1A 2WZPP 3O1VA 1UZVA 4QX7A 2PAEA 2IXHA 1L7RA 4LBNA 4HK8A 4BWOA 2QKDA 3EYPA 3MYXA 1FNZA 3CL1A 1PX3A 4AG4A 2YMZA 1JYIA 5JDBA 4IV3B 5L36A 3ETQA 3KHBA 2RMU1 2D6MA 5A33B 3N9NA 1VBB3 1FV2A 4RHV2 4GH4B 4Y20B 5KHJA 1C1LA 4JHTA 3BIEA 5EFUA 4FAHA 4HKLA 5L7OB 3USSA 2A71A 3ZXAC 3W5NA 2VCMA 4BQ4A 4JQTA 2ZGLA 2Z2SB 2BQPA 4WM8C 1T2XA 2ZX2A 2VD7A 3HBZA 2VUJA 4XEZA 5CKNA 4YGDA 2VTXJ 2WUHA 1BK1A 2OT7A 4KU7A 5FP7A 2Q0AA 4EN9B 1DDLA 2AYHA 3T2PA 3WF3A 2BFUS 2PHDA 4WBBA 2FDIA 4QXHA 3N9LA 2ARAA 2WFF3 1GQGA 1BXHA 2R042 2IXLA 2I07B 5IAVA 2CY6A 4Q26A 4COUA 3PIJA 3NKGA 2NM1A 3ACIA 3POGA 4UI9L 2R0HA 5JZGC 1L7LA 3ES1A 5GZEA 1JZ7A 2DTWA 2EAAA 2PHRA 1URXA 2GH2A 4Q4V3 3POWA 4FTSA 2C9AA 1ZM1A 5F5IA 5B4NA 2RG4A 2DV9A 4P14A 3KV9A 1TQ5A 2FZ2A 3MO4A 5J96B 4I0BA 4PDWB 4AAPA 3UKTA 1QF3A 3T0BA 1BBT3 2V72A 3ZYHA 3ZX7A 4C91A 1R1ZA 5HCHA 4DMIA 1OMIA 4URAA 4GJYA 2KA3A 1J83A 4QKDA 1LESA 1PO11 3D0SA 1A8MA 5BNPB 1K3IA 3AVRA 2BWAA 3TNQA 1OHFA 5FRAA 5DZFA 1W0PA 5LRRA 5T3NA 2W1UA 2QNKA 3NWKA 2WA3A 5F3GA 4CU7A 1RMU1 2EAKA 5LB6A 5CISA 4DINB 1HRI1 4EQVA 1W3VA 2QQOA 4NOTA 2QQPA 1CIWA 5E88A 1COV1 3MW3A 1UY2A 3B02A 4K8FA 4B4QA 3OD4A 2VUCA 5FLJA 5A32A 4HSLA 2IZWA 3M3CA 4UF0A 1SCSA 1LHOA 3Q8BA 4XBLA 4XF0A 5DAVA 3ZYJB 2D3SA 2P4EA 2JB8A 1HV1A 1QJX1 1CZTA 4P00B 3UK9A 3IAPA 4BYYA 4FSJA 4OI1A 1UIJA 3VUOA 5BNOB 5JPMB 3Q8AA 1ULCA 3I59B 4YG6A 4LIUA 2OXBA 3B01A 3HNMA 4INDA 4NMIA 2WKKA 2GSYA 3KS7A 2X5IC 4S2GA 3ZDVA 1ZVFA 3QD6A 4NN0A 4DB5A 4Q4X3 1RVF3 1VRBA 4QQLA 1AR71 4LT5A 3ILFA 5ANQA 1JOBA 4XFBA 1X82A 1B35B 1CONA 2YC2A 3HT1A 3CDZB 2UYAA 3LDRA 1W6OB 3OG2A 4LBOA 2XHNA 1NUKA 3W59A 4ORFA 2R32A 4M01A 2D6OX 2AENA 4OHWA 1QXJA 1C8M3 2Y33A 5EP9A 4Y3OA 3FUQA 1QOOA 2GC3A 1OLME 3JD72 2J1SA 5FZBA 4EN7B 2B7YA 5FZOA 3O14A 3BKZA 5A3TA 3B9CA 5FYIA 5LBCA 2NMNA 2Z4FA 3VD9A 1G86A 2XBO2 3ZSJA 3ZKYA 1TE1B 2YU1A 3GJAA 2WS92 2HWB1 5I0DA 2HLEA 1APNA 3U37A 2ETEA 4AHWA 1QJZA 1PGW2 4XILA 2GZWA 3V0AB 3THPA 5JOXA 2J1EA 4EZHA 4CP9B 3N7MA 2CDPA 1XSQA 3AMPA 2HYXA 1TME1 1VBD3 1N1YA 3VDDC 1FI2A 4EWAA 4MSVA 3H1MA 1JYXA 3O1OA 1BJQA 1NCRB 3SNMA 2XUEA 5F1RA 1AXKA 2HWF1 1UX7A 3NKTA 3L2HA 3LD8A 5IVJA 2YU2A 3KCXA 3LSEA 5HBAA 1OQEA 1GV9A 1W2TA 1Y3TA 3AXEA 4GA9A 4ONUA 1OBNA 2W92A 2CNAA 4DNYA 2OPWA 1QIQA 5A7WA 2VUDA 4IEWA 3AXDA 4PLOA 3SLIA 2VNVA 2BNNA 3H9AA 2A5ZA 2BWCA 2D40A 1AVBA 4IERA 1VBE1 1QJU3 2ZX3A 2ZZJA 3MW4A 4PF5A 4Q0SA 1QU0A 5BNNC 1OF4A 2JE8A 3K4DA 3SKVA 2JG8C 2WL1A 5FZIA 4HKOA 1NY71 3ZO0B 2H6CA 2GP3A 2ZBJA 1IS6A 4DS0A 5F32A 5K0UB 2CSGA 3I3QA 1NZCA 1STMA 2HEVF 2G9FA 4LHNA 5EHDA 2DYCA 2J1VA 5DDJ2 1N47A 5FY9A 3ZIXA 1F9KA 4X8PA 4COYA 1X9TA 1XE7A 4JRAA 4Q0PA 1TVGA 2VMGA 4COWA 2GNBA 1H0BA 1YQ2A 4YZ1A 1CZVA 2CV6A 2WC2A 1YRZA 2HH9A 1V6NA 3SQOA 1YNAA 2HWE1 1QQP3 3J7HA 5DXDA 2MEV1 4Z92B 1LGNA 2GMEA 4AFAA 5A3NA 1G9FA 1Q43A 2YZ4A 2XJUA 5KBFA 2RVAA 4IV3C 2W1QA 4D7SA 1XNBA 2A75A 5JI7A 4CU9A 2ZAAA 1EV12 1KS4A 1XXNA 3ABZA 3JU9A 2XQRA 4OHZA 3ZXEA 4A44A 4LUMA 1UN1A 2W46A 3ZFFA 3CO2A 2NP0A 3A4UA 5L7OC 1PVXA 4YW2A 4ZS3A 3MIHA 1W9WA 1XNAA 4MH0E 4R4XA 5A32B 4AF9A 2FDGA 4ZKTB 4P9GA 4L8QA 4FOYA 2Z5WA 4UBHA 2JE7A 2RM21 3RWNA 4W50A 4K40A 1YQ5A 3DV8A 3KQRA 5DUUA 3U78A 3WF4A 3TEZA 2XLGA 1W0NA 2IXIA 5FJKA 3URFA 1PNGA 4KU8A 3P1IA 2VMCA 4HG6B 1YJLA 1CN1A 2EXIA 3ROUA 3WR0A 2G9ZA 3U4XA 3NL1A 1MACA 2GC2A 5IUQA 1BBT1 3O7OA 4AVCA 4CUGA 5JR7B 3I3MA 2QQKA 2WINB 2GN3A 5FOBB 1GOFA 5IT6A 5FYCA 3AL6A 5D8AA 3SHRA 1OVPA 2HWD3 4DRVA 1LAJA 4QHOA 3JBG1 4PQQA 1G9DA 3R05A 1E5RA 2BNMA 4LOSA 2CGNA 1RUJ1 3SCGA 2VNGA 3WVJA 5FOJB 1O5LA 4LO8A 1Y9MA 2IUWA 4UFJA 4NWWA 4FPGA 5LBEA 3QOPA 1UZ0A 3RZZA 2XDVA 2XONA 4MXVA 5T55A 3Q9OA 5FPAA 2R30A 1I1EA 4QHBA 2E26A 2BVVA 4G4FA 1LB2A 3PL0A 1OPMA 4M4PA 1V9U3 3DYMA 5C8CB 1UW8A 4TN7A 1RUH3 1Q8PA 4OZXA 4LK6A 5F3IA 5FZ8A 3ZSEA 4HONA 2E51A 5C5UA 1TZOA 2CAUA 5GZGA 1X9PA 3T2TA 5JSPA 5FXXA 4XUQA 4RL7A 1AYM3 4N9HA 3A0KA 3I54A 4COVA 5CG8A 1VAKA 1D0HA 1AL21 4Q4W2 4FQZA 4MHRA 1I6XA 2DDUA 5FXWA 3U11A 3ZYIB 4H3WA 4CDQC 5ABJA 1JYNA 4WVZA 3RZJA 4RYDA 3M4FA 4IXLA 3N3HA 4QX3A 4YLZA 5GLZA 4QM8A 2OX0A 1ULPA 3NV1A 5BNOC 4Q8KA 3T1MA 3Q8FA 1AR93 3ZN4A 2Y6LA 3VD5A 1PX4A 3P5BA 4WV8A 3QBQA 4YZ3A 3UNPA 2R062 5FP4A 3DYPA 4OUSA 3N9QA 2VPVA 4HL0A 2JDKA 4K21A 2YBSA 4GQ7A 3O12A 2I2SA 1E5SA 2JB4A 3PJQA 2RHPA 4CEYA 5IFTA 2VMDA 4CDUA 5A7WB 1BCXA 1B35C 5FTTC 1UYPA 1T6BX 1UMHA 5C9AA 2LS6A 3AP5A 3GALA 5LA9A 1VMJA 1DYPA 3ZSMA 1DQ1A 2V73A 3DCQA 2W68A 2E53A 5T50A 1ULGA 3LIHA 2C0ZA 4BZ4A 4AGGA 1RL3A 5SV5A 4RHV3 3DF0A 1PO22 4D7YA 5FWEA 5FZ4A 4HOOA 1W28A 4DY3A 2L9LA 4JQRA 4TSVA 4AI8A 1J3QA 4M0HA 2C6SA 5CADA 1KGYA 5I0TA 1C3HA 3N9MA 3SEEA 5JXHA 2UY8A 1PZ7A 1YYNA 3F95A 1AR83 4E8DA 5JLVA 2VO5A 4BA6A 2B45X 2R1DA 2KD7A 3MFAA 4HBNA 3VBUB 5FZFA 1W8NA 1JU3A 2ZPXA 4PBOA 2GNMA 4DUVA 1FOD2 2R6QA 3NAPA 1FYUA 4A7KA 4FT8A 1WMEA 1OD5A 4Y5Z0 1W9TA 2FBEA 5EIYB 3CLPA 4I3GA 2RJLA 5CU1A 2PFWA 2XL9A 4DO0A 1TNRA 3B00A 1NCRC 3AX4A 4N90A 3HJRA 4JAAA 2XQXA 3EHKA 4JGZB 3ZFGC 3USUB 1LOFC 4Z2AA 5CFDA 5C3PA 3O1UA 3RI8A 2QE3A 3E6BA 1QJU1 2OW4A 3ILRA 4KBBA 1H4HA 2R7EB 1UO9A 3C7OA 3OYWA 5FKCA 1ST8A 3MV01 4AGVA 2FCUA 2LUWA 3KF5A 5F3EA 3ZKUA 2D3RA 4SBVA 4YW6A 1JH5A 4BQ3A 2FDFA 4B8EA 5JXIA 1LRHA 4Q29A 1RC6A 3IZOA 1LECA 4YG0A 1GZ9A 2NQYA 4URTA 5CZKA 3ZR6A 1BVP1 3S30A 4CDXA 4K3UA 4E4DX 1DQ4A 2A7AA 1C28A 5FYUA 3O1RA 4L97A 5I91A 2XJSA 3NNJA 4FFIA 3H7YA 4NRQA 4YPJA 1XNDA 3RI9A 5K0UC 1W8OA 4BMBA 5A6YA 1O3TA 2JD9A 3HPNA 5J7MA 4XFHA 1QJY3 4HLTA 3NJZA 2JKBA 5D8AB 1GYKA 1QKQA 2WN2A 1WLWA 2I74A 5FY1A 2XGXA 1MS0A 2O8QA 3MUZ1 4O61A 4AHXA 4BJ0A 2Q1FA 2ZS6B 3B9IA 1CESA 3CHXA 3BI3A 1K5MB 5G04L 1BEV1 2E63A 2XHKA 3NO8A 4FPOB 4RQPB 3C2UA 1YFXA 2C1FA 2OZ6A 3SCHA 2V5YA 3WNKA 2D98A 3FHQA 4LLOA 3VD3A 3JB4C 2YBPA 1W8FA 4MGQA 4QGNA 5JI9A 3OBTA 3RFRA 2PXJA 1SLBA 2VZOA 2AACA 2WAOA 3OUHA 4WVWA 4X6RB 2F4LA 5I0RA 3WUCA 3I4IA 1ND3B 3C8XA 2VECA 2R071 2W0XA 2XWBB 3BODA 3PHMA 5LWBA 5T5PA 2CGOA 1ENSA 2DUOA 3WOGA 5FPBA 5FWJA 1WW5A 2WA4A 4GMP0 1NYWA 1I5ZA 1PMJX 1QGLA 3JD73 1FMD2 4IEOA 4RGGA 2QDRA 3UKVA 4LMFA 3BALA 4XQ4A 4QB2A 2WWJA 5H9QA 3RVHA 1JZ4A 2XBO3 4CXWA 2O0OA 3ON7A 3K3OA 1LENA 2WS93 2QQIA 2XXZA 3KQ4B 3Q8EA 3H8UA 2CWSA 4DUWA 4ES9A 3ZYBA 3LDBA 2GP5A 1VIWB 3TN91 1EAH3 5EYXA 1RUC2 5A3MA 2DVBA 5LA1A 1UY0A 4JDOA 3MHZA 4XAAA 1RUOA 2DU0A 2VW0A 4LBLA 2Y0IA 3PVEA 4LA3A 3ACGA 4Q2FA 4O7XA 4RGAA 3K77A 4V2VA 4AI9A 1F8VA 4CDUB 1D4M1 3HN3A 4R9CA 5DUVA 3T0AA 1WLCA 1NXMA 1ZZCA 5C9AB 1NCQB 3LA2A 1Y7BA 2C4XA 1LR5A 1OURA 3HQXA 5FLHA 2ILMA 2JD4A 2XJPA 1RXFA 1AYM1 1XSRA 3FLPA 4KGGA 2XWJB 2A6XA 2ZJCA 4NPLA 2D7FA 4OMCA 3CZJA 1S0EA 2EXJA 4XDOA 4YM0A 3ZN5A 2XL7A 4XJAA 2IWGB 1XJAA 4XURA 4XXPA 4RFRB 5C8CC 4GKXA 1ASJ3 1RTVA 3NNMA 4JVAA 3P6BA 1KJLA 5ACA3 1ULDA 3WP5A 2VVDA 1ND2A 4PLMA 1H1MA 2C26A 1XYNA 1LJ7A 4KNCA 1IPSA 3TWIA 5IVCA 5K7PA 4OVEA 1S2BA 2ORXA 1FAYA 5FPLA 5FY4A 3ZXLA 4AFMA 4BQXA 5JAXA 2BYVE 5DN2A 3RYRA 4AK3A 1V6IA 2EIEA 2IFRA 3AYDA 1VBD2 4YG3A 5EQUA 1LHNA 4C0BA 1BK0A 3ACFA 3PMEA 1JZ3A 3FFQA 3VBHB 1CQ9A 2R1BA 3J9SA 4GJZA 2PHLA 5JXGA 1H30A 4BU2A 1H4GA 2RS51 3MI8A 4TLGA 3NJYA 1UMZA 3VBRB 3LF7A 3THCA 3V56A 3NV4A 3SKJE 1A34A 5F5AA 4KG8A 4LR4A 2E7QA 2JG9C 3ZFEA 3VKOA 4D6QA 5EPAA 5L73A 5C4WA 2CHHA 5JCTA 5CFCB 4XE9A 1RUF2 4OCTA 5BNQA 4NPMA 1U5YA 5I0UA 5F2WA 3H0OA 4KG0A 4IGQA 2J1RA 2RR12 1EV13 4FP3A 2MHFA 1SQ4A 4CDXB 1U5ZA 2YDEA 4LBKA 4M3CE 4MVTA 3U0ZA 1C8NA 2R041 1HQWA 3POBA 5DAWA 1OD3A 1G7YA 1LODA 2FD8A 3KM5A 2X53S 1VBA2 2PN5A 5I8TA 5EXOA 3VBUC 2LALA 4QAWA 2VW1A 1SLLA 4YM1A 4XPVA 2Q8EA 1O3RA 3VDBA 4FQ4A 5T52A 1RGSA 3E6DA 1IS4A 3INAA 1ZBA2 4BQ1A 3BTAA 3LA7A 4JGZC 1WCKA 4LK7A 3TB0A 4GWIA 4HMZA 2BOIA 3E1F1 4E4HA 1MZ6A 4UFLA 5C3QA 2WABA 5FK8A 4AEDB 4MG2A 5A7SA 3OY8B 1DQ2A 3FBYA 2GMMA 2VZUA 1IG3A 2VQTA 5IVEA 5FZCA 2DVDA 2XKOA 4XOGA 1HXS3 1LU2A 4IEYA 3LOIA 4EE2A 2P2KA 5J3UA 1JZ2A 2ET7A 1K42A 3ZXGA 2VGDA 4ZU4A 4HANA 4CU6A 5BV6A 2DBIA 1LTEA 2XR4A 3RPQA 2GH8A 4AAXA 1AX2A 3OEAA 1IKQA 4LHSA 1HQLA 3WP6A 4YW5A 5FZMA 1HB3A 4OHXA 2OKXA 4CUBA 2W3JA 2CU5A 3KVAA 4BXFA 1HQNA 5IW0A 4XUNA 3WNNA 1W6QB 4A3ZA 1YIPA 4XFAA 3OEBA 3C7HA 2R0FA 2A6VA 2XVLA 2VZSA 1JYVA 1UYYA 2HWC3 3RNSA 1UOGA 4MADA 3WNPA 4D0QA 4JCKA 2VZPA 3WDYA 2K0GA 3U75A 2VCAA 2ZGKA 5E1RA 5B2GB 1IQAA 2R063 1K5MC 5FMOL 1RUG3 4B3NA 3ZIWA 1JODA 4RQPC 5DAQA 2RS32 5DZGA 4AWDA 3WQ1A 4CA9A 1EUUA 1S0CA 2PHFA 1POV0 3WNMA 3OGGA 1Z7S1 3PUHA 1JZ5A 4CCOA 1V9U2 3GJBA 4CCLA 1F35A 2BZDA 4NO4A 4Q4Y3 4XCBA 1VP6A 4MX3A 3T1LA 4P9LA 3MEPA 3SC7X 5C71A 4IGOA 4IW3A 1ND3C 1UQXA 1FPN1 2Z69A 2AR6A 5CYYA 3WHUA 4CCEA 1ODMA 4KQ7A 3VL9A 1PO23 1MZEA 1PGW1 2QBXA 3WQ7A 3VBSA 1W8ZA 2FDHA 1SBDA 4AW7A 2EXHA 2A3XA 3ZM8A 1M06G 4ES8A 4LKEA 4LBQA 2BBAA 3OGJA 4DXTA 4BQWA 2VQAA 5L9RA 4NROA 2VTFA 4QB6A 3IM0A 5FZLA 1X7NA 3D82A 4LPLA 4B1MA 2P3IA 3M8LA 2GC0A 4BQ5A 4QX2A 4GMP1 1UY4A 4LBJA 5CIRA 1PM4A 2QQWA 2E32A 2XLFA 5A7NA 5DPNA 3AKTA 3EQEA 2OZJA 5C4WB 1PMIA 4JGYB 1GSLA 4E9KA 1NCQC 1U12A 1O6UA 1X33A 2ZOEB 3FN9A 1VALA 3JQXA 2AZ5A 4C1XA 2W47A 3B7MA 4FBFA 1GZWB 2V4AA 4KL1A 1AZDA 5FUNA 2WZR1 4MXWA 1WLTA 1RXGA 3OGRA 4C8DA 5GZCA 1PK6B 2EALA 3W21A 4IEQA 4RR3A 1DLLA 2PTMA 5FZEA 1KEXA 2VOTA 1CAXA 5FZGA 2WLQA 4LNVA 3VB9A 4J25A 1AR82 4UW6A 4AVVA 1OH4A 3RMXA 2BW8A 5DDJ1 2FMDA 3TNPB 3AMHA 1FT9A 1XE8A 2PLV1 2BNOA 4LBQD 5JIAA 4K7JA 3PUIA 2LROA 4Y1UA 2ZAHA 1IPKA 1V00A 4LEJA 5C33A 2NMOA 1YEWA 3AM2A 3N36A 4DUXA 4CDWA 4ATFA 5C8WA 3R4DB 1UY1A 2FQPA 3FHIB 4LBMA 3VBHC 5LZ6A 2DVFA 1OOPA 2JDPA 3J7NA 3H3ZA 1AR61 5IK7A 1REFA 4MOAA 5IVYA 3S7IA 3VBRC 4A6SA 1MVQA 3U14A 4IEPA 4OHVA 4O65A 1EV11 3AZYA 2P3JA 1JUHA 3IN9A 4QXCA 3WDXA 3E5QA 3ZXFA 4YVSB 1J1TA 4I0WB 1OA3A 3IAQA 4ISQA 5CFCC 1PIV1 1SG3A 4WM7B 3ORJA 4C1WA 4CEWB 5ISLA 1O3QA 4NRMA 4BM8A 1LOBA 1SHWB 1W2AX 4XJUA 1E5IA 1GR3A 5FMDA 1JYCA 4HXCA 2W9XA 3MPBA 5FZ3A 2WQZC 1JXNA 4NE9A 5FQ0B 1JYWA 3H42B 1QJY2 2Q1MA 5GLTA 3WNXA 4JRLA 5FBZA 1FMD3 4YVWA 2DCTA 1DZTA 5C7GA 1NQJA 4FTBA 5C3SA 1SZBA 2YHJA 4WZFA 1WMDA 1AYN1 5A3WA 2DCJA 1IOAA 4LORA 1JU4A 5FO8B 2A1XA 3QLQA 2ZHKA 3ZYFA 3CU7A 4IE6A 4XHXA 1RUC3 3O1SA 4UWDA 2QFEA 2P3YA 1UWWA 2VMEA 3VBOB 5DG1A 2W1SA 3T4HB 1OA2A 1V0AA 2E7TA 3VBFB 1BZWA 4MV2A 1OT5A 1BMV2 4Y1VA 5HV0A 1OH3A 1WBFA 4AEDC 5J36A 1S1AA 3KV4A 3J8F1 2BPA2 3KWVA 4GWNA 2J42A 3O0WA 1H6YA 4L92A 5F39A 4XIOA 3AYCA 4Q4W1 4N53A 3DPRB 1HRV1 3THDA 1UY3A 2VNOA 2UWCA 5LCWL 4B7EA 1O4TA 1O91A 2W87A 5EZWA 3VZLA 4IUGA 2PHTA 2JIJA 1EAH2 2RS13 4LHKA 5FPVA 2ZEWA 3ZOIA 3HNBM 4LE4A 5F8PA 2DCKA 3LSDA 4OLLA 2R061 5KC5A 5FYZA 1A78A 2ES3A 4XETA 2QUOA 1H6XA 4EWDA 4S2HA 4ET7A 4P08A 1DU3D 1GANA 1HLCA 1AXZA 5IHRA 1ULFA 5KHHA 3NRUA 4AI1A 3IPVA 2VQUA 3T08A 2EIGA 1H1AA 1RUI3 3DYOA 1YUDA 1WCQA 1IS5A 3AB0A 4A7YA 2CDOA 1EY2A 3TEXA 2VBBA 3IB3A 4LE3A 4NR1A 4Y1ZA 3UT0A 1SBEA 3SCFA 1DCSA 3B93A 3I2OA 4PJYA 4IESA 5FZKA 4XJZA 4MXWB 4MGYE 1PO21 1CWPA 1EYBA 3SH4A 1ASJ2 2AC1A 4MLOA 4YYOA 5ACA2 1CX4A 5CAZA 1JUIA 4N7IA 4H55A 2GDFA 4XYXA 5AC92 5HXMA 1RUF3 1H2LA 4QDRA 2YBKA 1O5UA 1KS5A 5GZDA 2YPDA 3U4SA 1XQNA 3OBZA 4QPGC 4ZPIA 2RR13 2XOMA 3VV1A 3WINE 1TNFA 4Y4RA 2VQ0A 1SBFA 5KXDA 5BPXA 4N9IA 2XJTA 1POV1 1FOD1 4W6XA 1ZBE2 4TYSA 1W2OA 4CDWB 4GB33 5FCCA 1NA1A 1HV0A 4AEKA 2WNVA 1UYXA 3ENRA 5JVVA 2HBUA 1VBA3 3ZMOA 2ORZA 1OOPB 4E27A 2YYOA 4AHZA 4K1ZA 2RMU2 5FYTA 1GLHA 4AOCA 4OMDA 4XDPA 2VULA 3WHTA 1VBB1 3WNOA 4XJ9A 4EROA 2YPJA 4LQRA 5T5LA 1R083 2V5DA 2Y8KA 4L99A 4JZRA 3TAYA 4W4ZA 1MQTA 3K4AA 4TXWA 4DY5A 1AX1A 2NZ9A 2VZ1A 2DCZA 1ZBA3 4JGYC 5FPXA 4NUBA 4XBNA 4DQAA 4QKBA 1QOSA 2VUAA 1QNYA 2ZZQA 3BIWE 3VDAA 1US3A 3AJZA 3EO6A 5BUVA 4AQ2A 4AQSA 3PU3A 3TRSB 5C5TA 4GH4C 3ATGA 2WNEA 2WFF1 4IEVA 1H2MA 1PK6C 3MGUA 1K5JA 1QH7A 5IVFA 4N43A 3VKLA 4UF0B 5LEKA 2EIBA 1W03A 3AJYA 3LEGA 3G7DA 5J37A 4XF4A 3UJOA 1HJFA 2NYYA 2YV8A 1VBC2 4Z1VA 3I2IA 2W95A 1H2NA 4DXZA 4TTGA 2ZGUA 3R0RA 4Q4V1 2Y6GA 1GQHA 3NVCA 4V1PA 1DFQA 4E2GA 4META 4FPYA 1DGRA 3PTRB 4ZZ8A 4IV1A 2BFUL 3BU0A 1GP4A 4P02B 3S0MA 4OFGA 4D69A 4Q5OA 1F31A 4XJWA 3AYAA 3OPWA 3VHOA 3VLBB 1HJGA 3GZTB 1A6CA 3CIHA 3ZMNA 3RYPA 3AP6A 4EWEA 4XF3A 5KHIA 3V64A 5DQ0A 4LKSA 5A7PA 1RMU2 1H1IA 2DFBA 2WT1A 3DUIA 4PDWC 4KH9A 5IK4A 1HRI2 4MYEA 1PZ8A 4CCKA 1ZRFA 1Q3EA 5C3RA 1SMVA 5C6CA 1TMF3 1HXS2 4IE7A 4ASMB 5BNPC 3FL7A 3ZR5A 2RS33 1VRH2 4EV0A 3EBRA 4YVSC 1XYPA 1H8TA 2ERFA 3M1HA 1SFNA 5FZOB 2AEZA 3SEPA 1CAVA 1OFNA 4AE2A 1O4YA 4N53B 5A3UA 2X10A 3AL5A 4WM7C 1FMD1 1WGPA 2D6LX 2CYFA 3LZZA 3PLQA 4PCRA 4CEWC 2BTVC 3O5SA 3JCIA 1LGCA 4HSJA 4BK5A 5EV7A 3DKQA 3VHRA 1YO8A 4NIGA 2W5FA 2F4PA 2TBVA 3ILNA 3KD4A 4Q0QA 2UURA 1RUE3 1GU3A 3IMMA 2XLAA 1U5XA 1AR72 3CJIA 1RVF1 3HEIA 2QQMA 4HT1T 4Q4X1 4P9YA 4K1YA 2HWC2 2ATFA 4AEMA 1UF2C 5APAA 1HB4A 3G6JB 4XMAA 2ID4A 1CJPA 3IKWA 2ZGTA 3LCPA 1RINA 1MS4A 3SMHA 3RJ2X 4OI0A 1RUG2 2AH2A 1WZXA 2XG3A 2WNUA 1C5HA 1C8M1 5FYMA 2YFUA 1UAIA 3VBOC 3VZNA 3WXPA 1GBGA 2C9KA 4IDZA 4DOUA 2JENA 4Q4Y2 3VBFC 5KC6A 2P37A 1RIRA 1VE0A 3IIIA 1H9WA 5IYYA 2BU9A 2ZGPA 4QPIA 3WCRA 4RS5A 4B29A 1QNWA 3AYEA 3RZHA 1CZSA 1VB2A 1QXRA 2JEMA 4K9SA 1C1FA 2D97A 5FPZA 4SLIA 5FR3A 3GHMA 2ZX4A 4JC1A 5T54A 3THTA 1PMHX 1I3HA 3DPRC 3LPGA 4AI2A 4AVTA 4QGLA 1ALYA 1VBD1 1MZFA 1GP6A 3DEMA 2PMWB 4JTNA 5LBBA 4Y1YA 4FPKA 2QVSB 3OPTA 1WMFA 2HWF2 3L2YA 1W6PA 1IS3A 3AZVA 1DGRN 2D6PA 3MIGA 5BXXA 5F5QA 4NHMA 4W65A 4D94A 3JZVA 3H7JA 3UGHA 3T30A 2TNFA 5L19A 4KWUA 5IAXA 4WM8A 3PIGA 2VBDA 1CPNA 2OS2A 5K4LA 4HZFA 4WZCA 3OGVA 1WW4A 4GAZA 2YFZA 1RUF1 3C3VA 4GD4A 5FY0A 3ETPA 1UCXA 3FLRA 4XFFA 3V0BA 3GCXA 4XFIA 2RR11 2NLRA 4BIFA 3AKQA 1UZYA 3LKJA 1D2QA 3ZFFB 1OQDA 2ENRA 1UU6A 3H8OA 4YGEA 4BDVB 4XHBA 1NLSA 2ZHNA 3MF9A 1S4CA 3EJKA 5JPNB 5KHKA 3U10A 3FUOA 5JZGA 1D2SA 2BGOA 4CCCA 4GIQA 2Q8CA 3FE5A 3X29B 1GNZA 5A80A 1R1A2 5DZEA 1RUD3 5I8SA 4P5YA 4Y22A 3N7KA 5FZHA 3FX3A 3GGLA 3VKNA 1DG6A 2QQJA 1WLDA 3K2OA 3MICA 4RD7A 1Q8QA 1QQP1 2MEV2 5T5JA 3WUDA 2J1TA 3ACLA 3WT3A 5FMBA 1NKGA 3KV5A 5DUWA 4RGKA 4AVSA 5FJHA 2A6WA 2WQ4A 4X8NA 5CB7A 1NG0A 1GP5A 1UPSA 2QDNA 3PUSA 2AREA 3ZYRA 1NX9A 4Z82A 3RDIA 1W6MA 3AFKA 3K3NA 2X09A 1MS5A 2B46X 4DFSA 1W9FA 2VZ3A 1W39A 3GBFA 4QQHA 2O14A 3UJQA 4FPJA 2WJSA 5FUPA 3HMYA 3OB8A 4QT6A 4R8HA 5FREA 4GXLA 4ZU5A 2Y38A 2VBPA 1UNBA 3GBGA 4Y33A 5GLVA 4NIHA 3HN1A 3UETA 4IETA 5A70A 3PJYA 3WF0A 4UAPA 1ULOA 2IXCA 1W8UA 2KXLA 4IEXA 5HCFA 1PVC2 2VVFA 2X5IA 1CVNA 2OUJA 4K8RB 4E4SA 5H9PA 3PVOA 4LKFA 5ABJB 3N9OA 5FV3A 3LE0A 3N7JA 3P3NA 4X6QB 5CKQA 3M70A 3WNLA 2HWD1 3JBG2 4NPRA 3M2MA 3WEZA 1SPPA 2WLPA 4LA2A 4UXAA 4ARXA 3J7MA 5EJ3A 4ARYA 1D7PM 4IE0A 3NV3A 4OUMA 2HBTA 4N7UA 1LHWA 1WD3A 5JMOA 1GWKA 1R093 2WNUB 4MO3M 1YFWA 5FAXA 5K9YA 2CTVA 1UOBA 2W91A 1GQPA 2RS31 1YFUA 2Y6JA 3FC0A 3GZAA 4ITCA 4AFCA 3MIEA 4NHLA 5FY7A 1NLQA 2WO1A 4CEYB 4YARA 5KXCA 3O1TA 1V9U1 3GXUA 4FXKB 4A42A 3BOWA 1RUH1 2Q4SA 3KV6A 1PGSA 3PMSA 4I09A 4XUPA 1FXZA 2OYZA 4AI3A 4BOWA 3BPSA 4R4ZA 3HT2A 3ZXJA 3AZZA 1DGLA 2JICA 2HJIA 4NAOA 4GWJA 2ZMKA 4QPIB 4RS5B 4V2WA 1CPMA 3OBRA 4H7LA 4D7TA 3KT1A 1RJ8A 2ZABA 1LEMA 2JECA 1JOPA 4O9EA 1DLCA 4FVVA 2ZX1A 1GMMA 1IKPA 4I0AA 2Y34A 3RG0A 1GNYA 3AP4A 5FBJA 5LBFA 1LU1A 1J3RA 3VDDA 2ZMNA 2P17A 3S6PA 1Q5OA 3IMNA 4KBZA 2B42B 2CWMA 2VCBA 3GDBA 2WFPA 5AC93 4PT6A 3OSDA 2RS12 1AR91 3PU8A 1JTZX 1W90A 2Q30A 1RITA 2BRTA 3QACA 4JHZA 5FYVA 1GZCA 2A6YA 1UZWA 1Q8SA 2D43A 3UGGA 2PA7A 3NAPB 4YZ5A 3L9JT 1OKOA 2CGPA 2VZVA 1ZBE3 4MGSA 4LHLA 4LO4B 4MGZE 5DUXA 4NIAA 2VTXA 3OUJA 2VC9A 4F83A 3NNFA 3CBNA 2BUKA 1RUI2 1REEA 1VMHA 2DU1A 3WCSA 3DL3A 1NLRA 1X36A 1VPHA 3LPFA 4FI9A 5CFDB 2RMU3 4CVUA 5BNNA 4HPKA 4U2AA 2JG8A 3J26N 4XQWA 5AVAA 3OYWB 3NV2A 3K46A 4RHV1 1WA4A 4ZONA 4IE4A 3C7FA 1LOCA 2D5HA 2JX9A 5A3PA 1U0AA 3ACHA 5LA2A 2DUQA 2E31A 3LEKA 4I02A 5JMCA 2WBKA 4D3WA 2AGSA 1N1VA 1SLCA 1XOYA 1AR81 1W8TA 1BVVA 5LASA 5FZDA 2VZRA 5A7OA 3DN7A 3SH5A 2DCYA 3LB9A 4Y22B 4ZZ5A 4HN1A 1F2NA 1XNCA 1V6JA 4GZ9A 2AEYA 1DP0A 3WZ1A 4GB32 4ZHNA 5FZ7A 4B1LA 4Y5SA 5KHGA 1HX6A 1VBC3 4ZXEA 2WWSA 4QPYA 2ZTNA 1HW5A 1ZX5A 2UU8A 1OSGA 1SEFA 1ENQA 1N3QA 2YROA 3CF6E 4IV3A 4Q0VA 4YNIA 4AQ6A 3NSTA 3AP9A 4KI5M 3HNYM 3JQWA 5A33A 5IWFA 5LK7B 2J1UA 1R082 1YFYA 2JDYA 4Y20A 3H1WA 1LNSA 1QOTA 3ALQA 4QQPA 5ANNA 4YW3A 3VZMA 2ZCWA 3WF1A 3KCCA 1PO13 2ZGOA 2YC0A 1SDDB 2W39A 3FZ3A 4FOQA 5FZ0A 5IK5A 1KDMA 4MGKE 4CCNA 3WG3A 4I2OA 4FXGB 2OPKA 1RMU3 1UOJA 5A6XA 4LTAA 3WP3A 3H8XA 1HRI3 1DIWA 1K45A 1COV3 1YI9A 2VAUA 4BH9A 3GCWA 3ZFFC 4YM2A 2W08A 3CNAA 4A3XA 4XABA 5IJRA 2G1MA 3ELNA 2XJVA 1VRH3 1DYKA 2MPFA 4QDQA 4YWAA 3ZYPA 1U5IA 1K12A 4J1WA 1VAVA 1QJY1 3ST7A 1MR5A 1LKNA 5F2SA 5IK8A 4AVAA 1X50A 2RDNA 5KWRA 1F4HA 1QJX3 1UU4A 1ZZ9A 2UYBA 3A22A 4CXYA 3O1MA 3B69A 3T0DA 2GN7A 2K2SA 2ZGRA 3IBMA 3K75B 4ZY9A 3JB8A 3CJXA 3R4UA 3BTXA 3T2OA 5A3LA 4OQ8A 1JHJA 3N7LA 1BEV2 1UPIA 2Y60A 4MHUA 1UYZA 3HR9A 4BK4A 3ZSKA 1AR73 4XCAA 3RZGA 5D8AC 3NQHA 1DYOA 1W99A 2BV4A 2BDRA 3VDCA 4YFWA 4LITA 5CKMA 4Q27A 3C7EA 2XB6C 1XNTA 3ES4A 1GWMA 1IGOA 1TMF2 2H0VA 2R072 1UU5A 2VMHA 4B4RA 5JSOA 2P6HA 4LOTA 4BE3A 5I93A 2XMLA 1NAEA 3NW4A 1I9RA 3V65A 1FATA 1CJDA 3JD71 4YRDA 4CDQA 1MPXA 3LA3A 1H9PA 4CCJA 3IIAA 3ME2A 1ZREA 5FP9A 5FYHA 4CSWA 1F5JA 4XF9A 2XBO1 1OI6A 1ND2B 3VDDB 4EN6B 1AXYA 4CYDA 4HVQA 5BNOA 5LA0A 3I59A 1Q8OA 1AHSA 2WS91 3A0NA 1WUVA 4A6OA 2Q8OA 4NRPA 1FX5A 1RUE2 3KGZA 4FPHA 1XU1A 5D21A 1EAH1 4DXSA 5I0SA 1XC6A 2VG9A 3AMQA 5ABJC 3UGFA 4CCDA 4YFZA 3CKHA 1TME3 1O4ZA 3M3IA 4QM9A 1B35A 5FUIA 4FPCA 4Y24A 1W6OA 3S5AA 3RRDA 5F7UA 3WP4A 1Y9GA 2HWF3 4PI2A 4AXOA 2E33A 4QGMA 3IDCB 1NE6A 3NJVA 4UFKA 1SFYA 1KDKA 1HDKA 2D93A 4R9BA 3FHAA 2DUPA 2JJ6A 3M3OA 2D5FA 4XIKA 3ZFEB 3NNLA 4J1XA 2MNGA 4CEYC 4ASLA 4CDUC 1CR7A 1ASJ1 3DGTA 5C9AC 2D6KA 5ACA1 4P9WA 5HCBA 2WO2A 5CNAA 1WKYA 2QJVA 3PURA 3U1XA 5JR2A 3TEYA 2Q5TA 3KB5A 4YW1A 3VZOA 1SLIA 3FJSA 4BQ2A 2W2IA 3V0AA 1ZRCA 3ZDSA 1J1LA 4E4ZA 2ZHMA 1NXD1 4CP9A 1OLMA 2PHUA 5GALA 4AQTA 3RS6A 5FO9B 2WYSA 1XRUA 2VOXA 1ZBE1 3B5LB 2DFCA 3KT4A 3OOXA 3AKPA 1CIYA 2BGPA 2XKPA 2HKXA 1G9AA 1NCRA 1QH6A 3ZFGA 1R1A3 2RS52 1LOFA 3OD0A 2WN3A 2Y26A 2BJSA 4KGQA 5FLIA 2JDZA 5FK7A 1S55A 3NAPC 3LFMA 2HWE3 2BBVA 3AMMA 5JSRA 1T6GC 2MEV3 2W52A 2NN8A 2RE9A 4NHYA 4M00A 4N8MA 3ITQA 3I3DA 1C4RA 2JDHA 3VD7A 3HQRA 1OC1A 4H2AA 2B8MA 5CFDC 5JOYA 2QCSB 4PLNA 4JKMA 3P3PA 5FY8A 5LK5A 2WT0A 2OA2A 4AHYA 2A73B 3VZKA 5FZ9A 1GUIA 1MS9A 3CMGA 3KGLA 4OI2A 4HETA 1OKQA 2PAKA 1G8WA 5K0UA 4XXAA 4UW5A 2VCCA 3AC0A 4K20A 5FZ1A 5LY1A 1PGL2 2DF7A 2KR2A 2WZ8A 2RM23 1OUXA 1N1SA 1VBC1 1YWKA 1W9SA 3OGSA 1RUD2 3SISA 4CDXC 4PBPA 4XAEA 3BVCA 4RSUA 3OJBA 4XMIA 2JE9A 2ZX0A 3DECA 3D0JA 3WDWA 1PVC3 4CE8A 4G9SB 3KSCA 1PM7A 3S7EA 3VL8A 2FDKA 3E5UA 2HYKA 5FDBA 4MGIE 3ZXKA 1C5IA 4QHZA 4QXBA 4RFT0 3JBG3 3MBWA 4ZU7A 1GOGA 4XBQA 1ENXA 1RUJ3 2WO7A 3HD8B 3Q8CA 3WF2A 4FTEA 1UKRA 4ISRA 5FYSA 3W20A 1WCUA 3EB7A 1UL9A 3PUAA 2O8OA 1L7QA 3AKRA 4NIDA 2GU9A 1HXS1 2FHRA 2Y6HA 3IWZA 3NNGA 1QY4A 2WRAA 1VRH1 1DZQA 5EYYA 4CDQB 3NJXA 5KXBA 4FP2A 4KWKA 3HIFA 4E2SA 5H9SA 2DURA 3I8TA 2VOKA 2D6NA 3VHNA 1UOFA 2E9QA 3WX5A 1YC61 2FZ1A 2ZGNA 1H8VA 3VZJA 1L3JA 2VXRA 1OA4A 1AL23 2RDRA 1VR3A 2ZGMA 1S2EA 2YXSA 4D6SA 3VBSB 4LUKA 3N35A 3W5MA 4JTOA 1EPWA 3HWJA 1J3PA 1MVEA 3PUQA 2J1AA 4IEUA 4QDSA 1A8DA 2HWC1 4LBQB 3KMHA 2A6ZA 2A3WA 2EA7A 4CPBA 2QZ2A 1MEC2 1Y43B 1DQ6A 5A7QA 1R092 3UKNA 1RUG1 2ARCA 1O8SA 3RWKX 4GWMA 3RSJA 4BB3A 1Z7S2 1ZA7A 4CP1A 5FIXA 4KWLA 3MUY1 4WVVA 5DABA 5C8CA 2ZACA 4Q4Y1 2K46A 3WDUA 1I5PA 4CU8A 3D5OA 1GFF2
chains in the Genus database with same CATH topology
4Z2WA 1JW6A 5E16A 5AVPA 1FPN2 4W6YA 4HN0A 2KM2A 4Y1XA 1ULEA 1S2KA 5J48A 1WW6A 4J6GA 4YZ4A 3WDVA 5HI0A 4MUVA 3FFZA 3MPPG 4L11A 2XPJA 4RR3B 1C57A 4PIZA 1CAXB 2UWAA 1ND2C 2ZKLA 1RHI2 1OQ1A 2YGLA 3ZFGB 4GKYA 5JOWA 1DZRA 1Y9QA 2V09A 1ZNPA 4BLIA 1ZZ8A 5BY5A 2JXAA 2VW2A 2TEPA 1Z78A 4FCAA 3UL2A 3ZSLA 1LULA 4QQ2A 2JG9A 2CAVA 3O0XA 1SCRA 3WG4A 1QMJA 1ZRRA 3E6CC 3ZPYA 1G9CA 3PNAA 4Q1PA 2PELA 1YCIA 1SACA 1V6MA 1SLAA 1WW7A 3LAGA 2VH9A 2WZR2 3H3UA 1HIXA 3GHNA 4BMEA 2IXKA 3TOJA 4YGBA 3ZFEC 4DPNA 1YI7A 2SLIA 5H9RA 2XVKA 1OFSA 5C4WC 1F5FA 4DRRA 3FBMA 2A70A 1KJRA 1QDOA 3E97A 1NQDA 1XYOA 3AKSA 3I2DA 1CAUA 1R1A1 2PLV2 1QWRA 3VBUA 4U36A 1N1TA 4P9XA 4BIOA 2ZA9A 4C0HA 2R16A 5CVRA 5LEJA 5GJ6A 4CRQA 4YGCA 1KD7A 5CG9A 1LCLA 4GALA 1YJKA 4Z07A 4YVWB 4BHPA 3JUUA 5DG2A 4JGZA 1IZ3A 3USUA 1N3OA 4IL7A 2GALA 1AR62 4FPEA 1LOEA 4AFDA 3W9AA 1PO12 1BEV3 2X8KA 3U07A 5GKAC 1S0IA 1PIV2 4TWTA 1AX0A 4ZXKA 1COV2 4CZSA 4NWVA 1FNYA 2DWRA 2R073 2AUYA 4AFBA 1LHVA 4MZUA 3BPZA 1PVC1 3GF6A 5JOZA 2RJKA 4LULA 1QJX2 4YW4A 4L9BA 3AZXA 2ARBA 1AYN2 4WVMA 2XJQA 3RQ0A 4AEJA 3M7AA 4XFGA 1W0OA 5EWSA 3TN93 3WW2A 1K5MA 1RUC1 4FOWA 4RQPA 2EXKA 5SV8A 4QXKA 3IDEA 2VOVA 3LOBA 1B09A 1WCDJ 1D4M3 2H0BA 3IPVB 5GM0A 1S0FA 1J58A 3J8F2 1QXPA 1ND3A 1IPJA 3D6EA 3LWCA 1YLLA 3AMNA 2Z79A 4G3YC 4R9AA 3RMYA 1AJOA 4JV4A 3MZHA 3KT7A 1HRV2 1BYHA 2P3KA 5BYNA 3BB6A 1Z0HA 1LEDA 2HWB2 3FMGA 2BEOA 4M0NA 1S0DA 4XQDA 2RS11 3W58A 3KZ4C 3KLSA 3MDPA 1D4VB 2DVAA 1QHDA 3VBSC 1W6NA 1TME2 4DZGA 2JG9B 1WCSA 2UWBA 4P9IA 3H50A 1NA1B 2BVBA 2WNVB 4LO5B 1RUI1 4YM3A 1NCQA 2RS53 3UV9A 5K8SA 2ARXA 1EP0A 2QZ3A 1CD3G 1DGWA 3OTFA 2FMYA 2B5HA 4P9JA 1MQTB 1X8MA 3MLKA 1NE4A 3LGRA 2GNDA 3QCWA 1VBE2 1GICA 2VNRA 4AVBA 1VB4A 3FWEA 2PHXA 3WV6A 3BU7A 1NY72 1CAUB 2PAMA 4LO7A 4AYUA 2P34A 2WSUA 1CAWA 1ZZBA 1H2KA 2R043 1S0GA 4N43B 4S2DA 4RR3C 3MIDA 2GC1A 2ZGQA 1BKZA 4GB31 4FAGA 4L2NA 3BCWA 4H14A 3IDBB 4XF1A 3VBHA 4P5HA 1YHFA 3MLLA 4AGRA 1VBA1 1RB8G 5CBLA 1RUNA 1VJ2A 3VBRA 2ZGSA 1VBB2 2HWE2 4IV1B 5J09A 4FOVA 1R081 3WW3A 4CDWC 5F9TA 1AF9A 3AZWA 1O7FA 4R52A 2LTNA 2E7AA 2OVUA 3B94A 3M3QA 4E2QA 4NHKA 4S2FA 1OOPC 1ZBA1 2N7GA 5CFCA 2UY9A 3ZVXA 1KRIA 2D3PA 2ET1A 3OPZA 3H1YA 2IC1A 3KCYA 3J4UH 2WFF2 4LO6B 4YZ2A 2OUHA 2XJRA 1X8EA 2HEWF 4HVRA 1MS3A 2RM22 1H8TB 3TYJA 4I3PA 5HCAA 2B39A 1CAVB 4Q4V2 4Z8BA 1SDWA 5F6LB 5FMOS 3SH3A 2Q1ZB 1UX6A 3HAGA 5E89A 3QH7A 4TZDA 1E57A 3ZN6A 1DF0A 3PTYA 4M3CA 4WVVA 1BBT2 2A3YA 2X29A 4WVMB 1IHMA 2YUEA 3RYKA 2VOWA 4OHYA 1Q56A 4Q1RA 1KITA 3CJIB 5KXEA 2WT2A 4YVWC 3GYDA 1RUJ2 2WSVA 3WLUA 2DVGA 4FPFA 3QH6A 4QU2A 4W6WA 1G6NA 3VKMA 1YXWA 4AEDA 3OY8A 1MEC3 4B7KA 1DBNA 1AJKA 2E6VA 2ZHLA 4K6BA 3SITA 1TMF1 5I8YA 4HKWA 4UW4A 4M3CF 1Z7S3 4Q8LA 3GNEA 3WY6A 3RJRA 2G9GA 1ZA4A 3MF6A 3O0VA 4CTEA 5F6KA 3MLJA 3AFGA 1PZ9A 3TBDA 3DKWA 1FPN3 1KQRA 5GLWA 4EJRA 1AL22 4F3JA 3ZXDA 3MFCA 2NPIA 5JWPA 1RUE1 1ONAA 2VVEA 4Q4X2 1W6QA 1RVF2 1KXGA 5FFOC 4N53C 1W6NB 1V6KA 4Q0UA 4EN8B 1RHI3 1JOJA 1SLTA 4OULA 4BCUA 1OLRA 4QQOA 1W6PB 4CP2A 4HK9A 2HEYF 1C8M2 3B3QE 3VHPA 3VKFC 1D0GA 5T5OA 4GMP3 2B9UA 4FPLA 2OIIA 1S0BA 4XDQA 4I01A 3WDTA 4WM8B 1BQPA 4B4PA 1LOGA 1DHKB 2Z42A 4QPGA 2PQQA 5CA6A 3V0BB 1AUYA 1W2UA 2WZR3 4ATEA 3OF1A 2BGCA 4TLFA 2I45A 1CAWB 3R4SA 2YY1A 4BPZA 1ZZ6A 2PYTA 2EVXA 2R49A 4KWJA 4XJ8A 5JZGB 5LRSA 3WW4A 5DDJ3 1RJ7A 4A7ZA 3WW1A 1VLNA 2PLV3 4RA0A 1LGBA 2XH6A 4XW3A 2ZMLA 1O3SA 2XVGA 1NA1C 2VY0A 3WG1A 2WNVC 2SBAA 4JGYA 2GAUA 2O1QA 1UKGA 1CGPA 2YGMA 3M3EA 4PIXA 4XZPA 2ZKNA 1QJU2 3PVNA 1AR63 1UZZA 1HKDA 3MIFA 1DQ0A 1GZWA 4GH4A 2IXJA 1JBCA 4Y26A 1OPOA 1W6MB 4XTMA 3K48A 1PK6A 3SXWA 5HXVA 4C90A 1MS8A 3D4KA 1MQTC 4NVPA 1AL0G 4R9DA 5AFBA 3ASIA 4EN0A 1XNKA 3ECQA 1PGL1 1PIV3 3POYA 4FO9A 5JIUA 1RUD1 3MW2A 1LOAA 4IEZA 2IFWA 3ZN6B 4M3CB 4N43C 1QQP2 2X5IB 1M4WA 2Y0OA 1TEIA 2G4IA 2K9ZA 4UBGA 1KFXL 3E5XA 4QD2A 4A2UA 3WG2A 1MZ5A 3CEWA 2TUNA 2CL2A 3PVBB 2F6BA 4PDWA 4YSFA 1AYN3 1LHUA 1FV3A 3AK0A 4IV1C 3N4MA 1JN2P 1V70A 3OCPA 5BNPA 1WBLA 1VAMA 3APBA 3FLTA 1V6OA 4PQ9A 4JDMA 4YVSA 2VU9A 5AFEA 1ZZ7A 4WM7A 1A3KA 4CEWA 1BMV1 4JDNA 4LLFA 2H6BA 1N3PA 2LM3A 4F8AA 3J8F3 1NOVA 2VMIA 2PHWA 1V6LA 4QX5A 3EXUA 4UW3A 5GZFA 1ZRDA 5FQ0A 1DQ5A 1H8TC 1S0JA 4OI4A 4Q4W3 3GBWA 4CP0A 2HWD2 1HRV3 4Y4YA 1ZYBA 3WD5A 3AP7A 2GNTA 5D1IA 1ENRA 3IT8A 4F7ZA 2HWB3 4PIYA 4COZA 2DTYA 5E8AA 3TN92 1PHMA 5FO7B 3WQ0A 1UIKA 1MEC1 4QMAA 1Q8VA 1R091 3I7DA 4AI0A 1PNFA 3CJIC 1GKBA 3VBOA 4I30A 4HFSA 1GNHA 3K51A 1D4M2 3VBFA 2C5DA 1RUH2 4O9GA 5TSWA 4HVOA 2EF6A 3VN4A 4XFCA 3POSA 4GULA 3GZUC 3R6SA 1OLQA 1MS1A 1G9BA 1YIFA 1AYM2 5BNNB 4HPKB 2WNUC 4QPGB 1XU2A 2JG8B 1JHNA 4H7MA 5J98B 3DPRA 3VGIA 1REDA 1EPZA 1VBE3 5GLUA 1WD4A 3D8CA 5AC91 4QPIC 4RS5C 1AR92 1DGWX 4BLJA 3MIBA 4IQPA 1RHI1 3BOPA 2XUMA 2GMPA 4XTPA 1QDCA 2D44A 2WIIB 1KFUL 1POV3 1FOD3 1UD1A 2WZPP 2PAEA 2IXHA 4LBNA 4HK8A 4BWOA 2QKDA 3MYXA 1FNZA 3CL1A 4AG4A 2YMZA 1JYIA 5JDBA 4IV3B 5L36A 3ETQA 2RMU1 2D6MA 5A33B 1VBB3 1FV2A 4RHV2 4GH4B 4Y20B 5KHJA 1C1LA 5EFUA 4FAHA 4HKLA 5L7OB 3USSA 2A71A 3ZXAC 2ZGLA 2Z2SB 2BQPA 4WM8C 4XEZA 2ZX2A 3HBZA 2VUJA 4YGDA 1BK1A 4KU7A 2Q0AA 4EN9B 1DDLA 2AYHA 2BFUS 2PHDA 4WBBA 2WFF3 1GQGA 1BXHA 2R042 2IXLA 2I07B 2CY6A 4Q26A 4COUA 3NKGA 2NM1A 2R0HA 5JZGC 3ES1A 5GZEA 2DTWA 2EAAA 2PHRA 1URXA 2GH2A 4Q4V3 3POWA 4FTSA 2C9AA 1ZM1A 2DV9A 4P14A 2FZ2A 1TQ5A 5J96B 4I0BA 4PDWB 3UKTA 1QF3A 1BBT3 3ZX7A 4C91A 1R1ZA 4DMIA 1OMIA 2KA3A 1LESA 1PO11 3D0SA 1A8MA 5BNPB 3TNQA 2BWAA 1OHFA 5FRAA 5DZFA 1W0PA 5LRRA 5T3NA 2QNKA 3NWKA 2WA3A 1RMU1 2EAKA 4DINB 1HRI1 4NOTA 2QQPA 1CIWA 5E88A 1COV1 3MW3A 3B02A 4K8FA 4B4QA 3OD4A 5FLJA 5A32A 4HSLA 2IZWA 3M3CA 1SCSA 1LHOA 4XBLA 4XF0A 3ZYJB 2D3SA 1HV1A 1QJX1 3UK9A 4BYYA 4FSJA 4OI1A 1UIJA 3VUOA 5BNOB 5JPMB 1ULCA 3I59B 4YG6A 3B01A 4INDA 2WKKA 2GSYA 3KS7A 2X5IC 4S2GA 1ZVFA 3QD6A 4NN0A 4DB5A 4Q4X3 1RVF3 4QQLA 1AR71 4LT5A 3ILFA 4XFBA 1X82A 1B35B 1CONA 3HT1A 2UYAA 1W6OB 4LBOA 3W59A 4ORFA 2R32A 4M01A 2D6OX 2AENA 4OHWA 1QXJA 1C8M3 3FUQA 1QOOA 2GC3A 3JD72 4EN7B 2B7YA 3O14A 3B9CA 2NMNA 1G86A 2XBO2 3ZSJA 1TE1B 2WS92 2HWB1 1APNA 2ETEA 4AHWA 1QJZA 1PGW2 4XILA 2GZWA 3V0AB 3THPA 5JOXA 3N7MA 3AMPA 1TME1 1VBD3 1N1YA 3VDDC 1FI2A 4EWAA 4MSVA 3H1MA 1BJQA 1NCRB 3SNMA 5F1RA 1AXKA 2HWF1 3NKTA 3L2HA 3KCXA 3LSEA 5HBAA 1OQEA 1GV9A 1Y3TA 4GA9A 3AXEA 4ONUA 4DNYA 2CNAA 4IEWA 3AXDA 4PLOA 3SLIA 2BNNA 3H9AA 2A5ZA 2BWCA 2D40A 1AVBA 4IERA 1VBE1 1QJU3 2ZX3A 2ZZJA 3MW4A 4PF5A 4Q0SA 1QU0A 5BNNC 2JG8C 2WL1A 4HKOA 1NY71 3ZO0B 2H6CA 2ZBJA 1IS6A 4DS0A 5K0UB 1NZCA 2HEVF 4LHNA 2G9FA 2DYCA 5DDJ2 1N47A 3ZIXA 1F9KA 4X8PA 4COYA 4Q0PA 1XE7A 4JRAA 2VMGA 4COWA 2GNBA 1H0BA 4YZ1A 2CV6A 2WC2A 1YRZA 1V6NA 1YNAA 2HWE1 1QQP3 5DXDA 2MEV1 4Z92B 1LGNA 2GMEA 4AFAA 1G9FA 1Q43A 2YZ4A 2XJUA 5KBFA 4IV3C 4D7SA 1XNBA 2A75A 5JI7A 2ZAAA 1EV12 1KS4A 1XXNA 3JU9A 4OHZA 3ZXEA 4LUMA 1UN1A 2NP0A 3ZFFA 3CO2A 3A4UA 5L7OC 1PVXA 4YW2A 3MIHA 4MH0E 4R4XA 5A32B 4AF9A 4ZKTB 4P9GA 4L8QA 4FOYA 2Z5WA 4UBHA 2JE7A 2RM21 3RWNA 4K40A 3DV8A 3KQRA 5DUUA 2XLGA 2IXIA 3URFA 1PNGA 4KU8A 1YJLA 1CN1A 2EXIA 3ROUA 3WR0A 3U4XA 1J59A 3NL1A 1MACA 2GC2A 5IUQA 1BBT1 3O7OA 4AVCA 5JR7B 2WINB 2GN3A 5FOBB 5IT6A 5D8AA 3SHRA 2HWD3 4DRVA 3JBG1 1G9DA 3R05A 2BNMA 2CGNA 1RUJ1 3SCGA 2VNGA 3WVJA 5FOJB 1O5LA 4LO8A 4NWWA 4FPGA 3QOPA 3RZZA 5T55A 4MXVA 3Q9OA 2R30A 1I1EA 4QHBA 4G4FA 2BVVA 1LB2A 1OPMA 1V9U3 5C8CB 1UW8A 1RUH3 1Q8PA 4OZXA 3ZSEA 2E51A 2CAUA 5GZGA 5JSPA 3T2TA 4RL7A 1AYM3 4N9HA 3A0KA 3I54A 4COVA 5CG8A 1VAKA 1D0HA 1AL21 4Q4W2 4FQZA 3U11A 1I6XA 5ABJA 3ZYIB 4H3WA 4CDQC 4WVZA 3M4FA 4IXLA 3N3HA 4YLZA 5GLZA 4QM8A 3NV1A 5BNOC 4Q8KA 3T1MA 1AR93 3ZN4A 4WV8A 3QBQA 4YZ3A 2R062 4OUSA 2VPVA 4HL0A 4K21A 4GQ7A 3O12A 2I2SA 3PJQA 2RHPA 4CEYA 4CDUA 1BCXA 1B35C 5FTTC 5C9AA 3AP5A 3GALA 1DYPA 3ZSMA 1DQ1A 2V73A 4BZ4A 2W68A 2E53A 5T50A 1ULGA </