1CQMA

Protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
98
structure length
98
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVAILGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Designed protein tetramer zipped together with a hydrophobic Alzheimer homology: a structural clue to amyloid assembly.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
molecule keywords RIBOSOMAL PROTEIN S6
total genus 22
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cqmA00
1IBLF 1QJHA 4DV5F 4B3TF 2B7CB 3OTOF 2UUBF 4B3RF 1XNRF 4DR3F 1IJEB 5AJ3F 4LF8F 4X66F 4LF5F 4LFAF 2B7BB 1HNZF 1XMQF 4B3MF 5LMUF 4B3SF 2UXBF 4JI0F 4X64F 3T1HF 1IBKF 2YY3A 1XNQF 4DR5F 4JI1F 2KJVA 1XMOF 2HHHF 4NXMF 2VQEF 2UXDF 2UUAF 1I94F 4X65F 3R3TA 4DR1F 4DV3F 4JI2F 4DUYF 4DR6F 1G7CB 5BR8F 4DV4F 4AQYF 4JI3F 2BVZA 4JI6F 1FKAF 4NXNF 4LF7F 4JI8F 4JI5F 4JV5F 4LF4F 2F4VF 1N32F 1CQMA 2BXJA 5LMNF 4LF9F 4K0KF 4DUZF 1N34F 4JYAF 4JI4F 4OX9F 4YY3F 2VQFF 4DR4F 1HNXF 2ZM6F 1IBMF 2J5AA 1HR0F 4LFCF 1B64A 1J5EF 1VMBA 1RISA 4GKKF 4X62F 2RJZA 4DV2F 1N33F 4LFBF 1LOUA 4DV6F 1G1XA 1HNWF 4DV7F 4DR2F 1N36F 3ZZPA 4GKJF 1GH8A 2UXCF 1F60B 2UU9F 4DV0F 2UUCF 5IWAF 2E5LF 4LF6F 1CQNA 4KHPF 1IJFB 4DV1F 4JI7F 2KJWA 1FJGF 4DR7F 4YHHF 3T1YF
chains in the Genus database with same CATH superfamily
4LF7J 5A2QY 4NLQA 2YH1A 4O0IA 4KKOA 3BR9A 3M2VB 3UFCX 4F67A 3LH2S 5BYQA 1N36J 2AX0A 3FSYA 3NNHA 5I3PA 4B3OB 1UPPA 2HMIA 3MM7A 4DS5A 2V4RA 1W2IA 1S4FA 1CSJA 4G6VB 1N5YA 3W3SA 2BJDA 1ROFA 2B4UA 2B8QA 2IVYA 3PFEA 2H3EB 3L3CA 3EYZA 3PW2A 4USMA 2C3OA 1RHQB 1LWCB 1C4AA 1IKYA 2PIIA 1DAXA 4CLLA 4WBFA 1XERA 1S76D 3EGVA 3SSQA 3UDVA 1PGZA 4KJIA 1IKXA 3GG1A 3NRBA 4O44B 1MG7A 5EX0A 3UO0A 5E3CA 2VIHA 2XO6A 2Z2LA 2DJWA 2LXUA 3VV2B 3PYGA 4YQWA 1EJ7L 2CJ9A 3R27A 2HSEB 4O3QA 3PCOB 1WC6A 4RW6A 3UE2A 4PG8A 2DO0A 4ZPCA 3Q2TC 2OPQA 5ETMA 3G6XA 2E5JA 2HHXA 3BYPA 1UWBB 1Z1ZA 1GMVA 5CCLA 5H1SV 3K0JA 2QA4G 3FZBA 4LF4J 4EU0A 4DR6F 2WONB 1GFWB 2ZE2B 2XQCA 5BR8F 3RZAA 4ZCMA 2A0FB 3G6ES 4QZVB 3M30B 5F0UA 1QVFR 4CLSA 2FC8A 4EMDA 3NEKA 2V94A 2IM3A 2FHJA 2NCKL 3BS9A 2J9EA 5D4LA 2EXUA 3D6TB 1UVLA 2O01C 4XPEA 2FZGB 2Z57B 3NBPB 2OP5A 4XTTA 2CJBA 3PACA 1AROP 2FZCB 2KT3A 3ISNC 1C1CA 4TYBA 4CYUB 2C2DA 1LQ9A 3LGMA 5KFGA 2QSWA 2HGLA 3TZXA 3Q8SB 4GVBA 3RUBL 2CPEA 1JMTA 4ZPWR 4ZS6A 3R7NB 4IG0B 3MD1A 3DOLB 4TQSA 3AODA 4OLPA 4K4YA 4A8WA 1VQMS 1Q8BA 2OFGX 1SC4B 2DR5A 5KG3A 3F44A 2PI5A 2B3TB 3CDWA 4FXWA 4ZCIA 1WOSA 3RU0A 4DI6A 1IBMJ 2AEFA 2HURA 2Y0BB 4LBIA 4DV6J 1IBMF 1ZOTA 3EVMA 1VISA 1ZPVA 2MHNA 3OTBA 4H54A 2QGFB 1F2HA 1RU2A 1RHKB 2LLZA 1PBUA 1PKUA 2HWIA 1VBYA 2YPZA 4MJKA 3KK3A 5IM0A 1WSRA 2VQFJ 3NWRA 3GE9A 2QFJA 2VODA 3QGGA 4HI2A 4NA2A 4YFUA 2KG1A 4NI2A 4WP9A 3KMSA 5KG1A 1UEUA 3W5ZA 2C3PA 4DFJA 2QFIA 4UOCA 1FWPA 3ULHA 5CYQA 3OTEA 2NXJA 1FNMA 1REGX 4LVNP 4ES3A 4F4AA 4LMZA 3WHIA 1FRJA 4ZDNA 1NK4A 1UKUA 2XC9A 2XYGB 2BKOA 2F1FA 2M8HA 5I3UB 2NZCA 4HVZA 2XMAA 4RLEA 3EX7B 2LA4A 3BDEA 3CCUS 3JS9A 2LEBA 4NZ0A 2WBMA 3PW7A 4PPDA 5IWAJ 4RL1A 5GAHU 1U1LA 4JI7F 1ZM9A 3CO0P 1VRTA 3K5PA 2BW2A 1HBOA 4OHZA 2DR9A 1X9SA 1QDUB 3CCRS 1VC0A 2UU9J 1FFSB 2GMLA 5A8KB 1RTJB 4JV2A 4DR4J 1FRLA 2HAFA 2D9PA 1SC1B 1T9XA 1RK8A 2ASYA 2J7UA 1ULRA 2ZD1B 1OQ6A 5KG2A 1U7LA 2DGSA 1BQNB 1T9TA 2AYMA 2K06A 2V63A 2V8VA 3GCXP 3HSGA 4M5GA 2W9CA 3K5MA 1N52B 5CYQB 4G3IA 2K7JA 2RT3A 2EWHA 5C42A 1UP1A 1WORA 1VS3A 5DLFA 5C25B 1ZZNA 1K1SA 2LFVA 5B0DA 1LNQA 4DPUA 3KLEB 2QT7A 1S1TB 3HLUA 3PJ9A 5AJ3F 2A6OA 4C8YA 1EIYB 1N6QA 1RTDB 3HT3A 5FJ4A 2FVQA 1S9GA 3ELHA 3HHEA 4OHXA 3CDAA 1FEHA 4PQAA 1RBOB 4K8RA 4KHMA 1RWVB 4OI6A 3HZEA 3JAMY 2FJBB 1Z2LA 1RHMB 1GXLA 3G71S 1WEXA 4RUCA 2F8EX 1S12A 1E6VA 4MIAA 1IR1A 2ZOMA 3HSZA 3KHRA 2ZH9A 3EZUA 3F0NA 3GTYX 4DEZA 1DTQA 2MZ1A 2E1PA 2DEIA 3Q23A 2QLFB 3GR0A 2J9CA 1U6FA 3B54A 4OZNA 3FQLA 3DU6A 5LM7E 4EZ6A 4H4MB 3UDCA 4ECQA 4QR0A 4X84A 3AD8C 4X4RA 3T3FA 1D0EA 1EKRA 4K50A 4JYAJ 5J2QB 2C2NA 3N01A 3D7SB 1S72S 5J1EA 1U1MA 1H6KX 3PZPA 1S97A 8ATCB 2V8HA 4JI8F 1LWEA 4ED8A 2LKZA 2HQFA 1UZHA 3VAGA 4ECSA 2OTJS 3CJ5A 4FYWB 4JV5F 2L41A 1Q4RA 3KXDA 5KFXA 4J9MA 2HGMA 1DQ9A 3K5NA 1UFWA 3M8RA 3NXZA 2Q6BA 4F4YA 1X4GA 2AMCB 1UWBA 1KVJA 2RIJA 2ZVSA 2WVDA 5EHHA 4KPCA 4F0MA 5DDOC 2KU7A 2XMJA 3DGVA 3HFKA 3CO9A 3DRSA 3JSMA 2EPIA 2EG1A 3P49B 3A8EA 3BSOA 2GCFA 3M30A 2OD6A 2PSZA 2VKZG 1HFEL 4JI4F 1VK8A 2P6SA 4NA3A 3HZGA 5T7LB 4JUZA 2YX1A 4KYZA 4L76A 4ECWA 4DG1A 1X31C 4UOHA 1B0PA 4MIBA 4NLTA 2AJ2A 3NCQA 4KSEB 2BJEA 1RTIB 3ZXWA 2R8IA 5J2NA 4JI0J 2CQIA 2PFDA 4GRSA 2KRBA 4J9QA 2KT2A 2J76E 4QYZK 3CCES 4P2MA 1FD2A 4WU3A 4ZJQA 3M9NB 1QVGR 2B0GA 3MAAB 2R7XA 1FJ7A 1N33F 3MEDA 5HANA 3I31A 3RB6A 2R7TA 2BKPA 4K4VA 4YOEA 5AXKA 3DRPA 2DR8A 1C2PA 1A7GE 5KFZA 1NXIA 2C2KB 5LJ3Y 2QLJB 1N36F 4KTQA 2QIFA 2ZH7A 1HWKA 3OSPA 2HIYA 1WG5A 4NLGA 1D09B 2XEXA 3ET6B 1HYSB 3T19A 2VPYB 5D15A 3QWUA 2I6WA 5KFTA 1P9YA 3PFOA 3MFIA 4NLPA 4Y2CA 3TJ9A 1VBKA 3ISZA 2XSJA 5FLXU 1ACMB 3FUYA 3PDNA 4WPAA 3KK3B 2XMUA 2V9KA 3A1YG 4ECTA 5DGBA 2FGCA 2YQ3A 3SDEA 3KHHA 4QWCA 2ATLA 2KZMA 2ZBQA 2MQLA 3V4IA 5GAGU 1U6ZA 2HQGA 1W25A 1RT6B 2Y1IA 1AXQA 1ZTTA 1SL2A 2HKEA 3J7YU 2CQ3A 4M63A 2D3OR 5KT2A 2HNDB 3VAFA 3CJSA 2JVRA 3A8IA 4Q5VA 1SIWB 4PPZA 3H7HB 2L08A 2HG4A 2YNHB 4Y00A 1NH7A 3MDFA 5ETVA 4P75A 3DLLQ 4I68A 2YNGA 4ZPDA 4MIWA 4UUWA 2JLGA 3AD9C 3N4WA 4OYMA 3H40A 1Q8KA 4ED0A 3MURP 4F2RA 3ZZYA 2U2FA 3I96A 3CCMS 2FLOA 3JYTA 2E1CA 2JX2A 2W7AA 4A46A 5LL6d 3D1QA 3PHEA 4YN3B 4EO8A 1X4FA 2NYIA 4ZVGA 1Q5VA 2R7VA 1N8RT 1MROB 5L9XA 1PC4A 4X64F 4G1PA 4JI3J 3MOJB 4TVAB 3ZC4A 3BH6B 3HI9A 3R6GB 1KFDA 2CNNB 1HHSA 2POKA 4YB1P 3MUMP 4USVA 1FKOB 3AT1B 4WIIA 3TA0A 5HLFB 1T3NA 3FEYB 1ZAVA 3HXMA 4J9PA 1LW2A 3PJXA 1B4SA 4F4ZA 3D0HE 2UVVA 3SSRA 2WBRA 4EFAC 4CH7A 2P5VA 3BDPA 3KKFA 2ACYA 4ZPAA 1S6QA 4A8XA 2W2OP 5KFSA 1IBKJ 3BPDA 1R8HA 1X8DA 3EVWA 2PDAA 4YP3A 1S1TA 1FX2A 2BVZA 4I64A 2XO7A 5D3GB 1HW8A 3C16A 3ILLA 3TP2A 2KB2A 2HS4A 4HHHA 4PAAA 2W7PA 4DSIA 3H5XA 2ASJA 5HP1A 1LV5A 3ILJA 1X0PA 2A10A 4NMXA 5DO2A 1VIOA 4ZN1A 5C7PA 1LK7A 3GCWP 3M2UA 1PCAA 2GIFA 2BDPA 1NK8A 2OSQA 4O23A 2YNIA 3AQOA 4K0KF 2CDRB 1WOPA 3LQVA 4KE5A 3D9BA 4JV5J 3T9ZA 3K8VA 2MKKA 3PIOQ 5HP1B 1SJ3P 3BGRB 1T03A 1NO8A 3DRSB 4N77A 3RBZA 3JSMB 2Z2MA 1S7HA 3BO2A 2BZ2A 3JTOA 1T7PA 4IH6A 1KFSA 4KKOB 4IRKA 3MTJA 2CQ4A 1HQEB 1RT1B 2IVFB 4YY3F 4WFNQ 3MR3A 4EBDA 3G4SS 1KOHA 5FLXY 2O67A 4ZVPB 2WVCA 5B0GA 5L1LA 1EP4A 1SV5A 2AJ4A 4NRTA 3MMCB 2RUGA 1YG0A 2IRYA 3OFGA 5MAOA 1Q78A 2CQ2A 2KRRA 2RS8A 1YK9A 1V3SA 1NU4A 5H9FJ 2R8KA 1VJWA 1GAOA 5F41A 1KNZA 3RB4A 3PKMA 3DDKA 4TN2A 1OSDA 5KG6A 3MAQA 4V19X 4LFBF 3C6UA 4H4OB 3MM9A 3TZWA 1N5QA 3CJKA 3TWZA 2QO3A 4FYVB 1NDPA 3FNNA 4O3SA 4QR1A 4GKJF 1F0XA 1WKLA 4U8VA 1HL6A 2CZVC 3C66A 1CLFA 4IFYB 1KLNA 3B8HA 3UR0A 2DCLA 4K4TA 4KGMA 1KWMA 1R0CB 1XMBA 1KC8T 2VUGA 2AIRB 4K5SA 3VAMA 1TKXA 5CH7B 2JEFA 1TKZA 3H20A 3JXOA 4B02A 5CD4A 3LGNA 4DWIA 1NDLA 2EFNA 2XSFA 3IXQA 3PYDA 3QFHA 1JKHB 3BGUA 1RZMA 3SQOP 4DSJA 1AA1B 3CMAS 4FBTA 2J8SA 3AQPA 2VZ9A 4NEZA 4RW9A 4YUDA 2HNYA 1S1VA 1S4EA 2VG6A 3WIVA 3PW5A 2QMUB 4RNMA 3ADAC 5GAHI 1HWUA 4LREA 4NLVA 4FF4A 4C9DA 2OPSB 2IPOB 3QPIA 4J9NA 2HAIA 3MCSA 3N6MA 3NCPA 4OJ1A 4RW8B 3KLEA 3GV7B 2AGPA 2W2NP 3R5JB 2BA9A 5DM7Q 4IOAQ 2VBZA 1Y0HA 1BQNA 2ROEA 1YBUA 4DCOB 5GMEA 1VQ6S 1YVFA 4X66F 2DNRA 3SFGA 3Q89A 2IDLA 1X5TA 2LCWA 3KJVB 2ILZA 3PYEA 3ETMA 2E9ZA 2NR0A 2GC8A 3L09A 4MFBA 1V5VA 1PYOB 2JRSA 4PR6A 3CJRA 2CDQA 3EGZA 1WC1A 4EO6A 3DGPA 2BE2B 1RT2B 3MM8A 1WHVA 3DM2A 3NAIA 1VQ5S 2DXDA 1X5OA 4I7FB 1TKDA 1WI6A 2YKOA 2HLUA 1TP7A 1B7FA 3A8KA 1FFGB 3BBCA 1QAIA 3D67A 4W98A 3I5BA 3ONQA 1V9OA 5K5MA 2AF6A 1HW9A 3RRHA 2ZZNA 1SC3B 2XY7A 4ZITA 2LMIA 2X1BA 3HD1A 2HBYB 3ZTQA 1RT3A 4PG7A 2M5YA 4OYZA 1X9MA 5L38A 2ZH8A 4ZLLA 2F9DA 4CLFA 2VG6B 4PYDA 4Q2LA 2CZ9A 5IT4A 2BM0A 1GMWA 4OMFG 3U27A 1WTBA 4J9LA 2YKQA 1NUEA 1U8WA 3SMZA 3K5LA 2OLWA 5JVGQ 2JEGA 4DMZA 5SZTA 3BM7A 2UV8A 3BSAA 4ZCKA 3Q8QB 5J2QA 4DV0J 1EETB 2HVDA 3FQKA 2MKCA 3PTWA 4OX6A 1SKWA 1TAUA 3VGSA 4Y2KA 2CJQA 2H4WB 3C14B 1IR0A 3OXFA 1JJ4A 1JLFA 1FI4A 1UVIA 1C1BB 5IT0A 2HNYB 2PMZD 1RWXB 3N28A 2MDAA 3EPIA 2WHOA 4NMLA 1VHIA 4J9VA 1QUVA 2W2PP 1M0SA 2V68A 3CD0A 9ATCB 3CUNA 1H7WA 3BYRA 4EI2A 2A1BA 3FZ2A 3OL6A 4ECZA 3ZZ0A 4CT9A 1U1QA 1HBMB 3WBZA 2LA6A 1TZ0A 4HT7A 5HJYA 2CQBA 2CPZA 4DQSA 4AL6A 4KGKA 4FXVA 2VFVA 5GADI 3H25A 4CLZA 3J7Z5 1RYRA 1X5PA 4FYYB 3Q24A 2AX1A 4RR5A 2CJKA 5E3QA 4JI6J 4DX8H 1M5SA 1RDRA 3MMCA 4LF1A 4DPXA 1NKEA 4WP8A 5RUBA 4WCEQ 1S9GB 2HS0A 4DOZA 4X4OA 2P6TA 2KFNA 3MEEA 1IKWA 3CJ4A 4DR5J 1OPIA 1C0UB 2ZM6J 2I5JB 2VJVA 4AD6A 3HHNB 1KDNA 1NJIT 5KG5A 1HYSA 1NK0A 4OJ3A 4Q8EA 3I5AA 5KFYA 2DGQA 1X4HA 3V2UC 3CC7S 5K14B 1EQMA 4Q45A 1RAGB 2KYXA 4F3MA 2W2QP 2B43A 4LFCJ 1D9AA 4NYOA 4ZIWA 1EB0A 3HFVA 3P45B 2BR0A 1RCOB 2Q6CA 5E3AA 5IT9U 2LU1A 4QW8A 1JB0C 3EXYA 1HPZA 1R27B 3C15A 1JLGB 2RQKA 3D68A 2KFYA 1HNVB 3EICA 2FD2A 4OZ2A 1N34J 1YHQS 3GJSB 2G0JA 3UCZP 4CO1A 4CCHA 2MTLA 3NS6A 2GAHC 2RQCA 1F6TA 3DI6A 5HI7A 5GAEU 4CNZA 2YTCA 4PWWA 1QD1A 2MY8A 8RUCA 2AD9A 2PI4A 4ZVRB 1IBLF 1DJ0A 2IC3B 3U7JA 1ZM3A 4DQQA 2PT0A 3HT0A 2RHSB 4GKJJ 4DR6J 3DRYA 3QMQA 1HNZJ 1QM9A 5LMUJ 5HN0A 2DGTA 3P6YC 1WKJA 2OKQA 2AZ3A 3CULA 4WF9Q 5KT5A 3PEHA 4FPIA 4DZ6A 1Z4UA 5D77A 2V0NA 2AZ1A 2JZ5A 4QIWD 3VF0B 3T5KA 1K8AT 2I2YA 1LEOA 3G8SA 2XNQA 2Y0SD 3TA2A 1UA0A 2Q66A 3MCOA 2UVWA 3FSXA 1HMVA 1KTVA 1Q79A 4JI0F 4RUHA 2CQCA 3NGDA 5M2PA 4NI2B 1KBRA 1S1XB 1WG4A 2VG5B 4WU2A 3G96A 1N48A 5KT7A 3PYFA 1J5OB 4LSNA 1IKWB 1JNZB 1UFLA 2YWWA 3MECA 1YJVA 2CQHA 2RDIA 4I56A 4LRDA 2ZC4A 4V1Ak 4UW2A 4F7VA 4JI1F 3HVTB 4QU6A 4A8FA 5THWA 3FBCA 4DF8A 1NDKA 1XEZA 1JLBB 4DX7A 3EE3A 4CZCA 1RQ0A 1UL3A 1T05B 3B4MA 4UUXA 2AKWB 4OV6A 1S5ZA 1YX2A 2QLXA 2VL1A 3V6KA 1SIZA 3RB3A 3THTA 3AXMA 3UD5A 4YMEA 1FKAF 4P71A 5CYMB 4URGA 1TUGB 3TNVA 1YJRA 4A8KA 2K8GA 3OW2R 2CNKB 4GVBB 4OHWA 4URSA 3J7AN 5JUMA 3KK2B 2WONA 2ZE2A 1Q53A 4FPRA 2G2YA 2CPFA 2MHEA 3C14A 1R3NA 2RQMA 4MMOA 5A2QU 3LP0A 1X4DA 4NYZA 5HO4A 3ETOA 3Q8UA 1JWWA 2YQ1A 1RWPB 5IQQA 4NXNJ 3R2DJ 2BX6A 1LXNA 2ASDA 5C42B 2IYGA 4USJC 3I0SB 2JC0A 2H51B 3GFXA 2QTWA 1PG5B 2XSJB 2YWHA 4O44A 2YNIB 5IS2A 2MQOA 1S48A 2GQQA 3TX0A 2DRBA 2IA0A 1RTJA 1R8PA 4TYAA 3VQSA 3H5YA 4DR4F 5KFMA 3TQ1A 1URRA 2QMXA 1BHNA 3S6EA 4OHVA 2Y8YA 1TV6B 4CI0B 5KFLA 2Y8WA 2H48B 2RVJA 2COLA 4G65A 5DRKA 4R5PB 2H4YB 1RHUB 2Z0GA 1V6HA 1LFWA 1P6TA 2IJFA 2YKMB 2ZBRA 3EWGA 4LVOP 4CLUA 3CJ0A 3M8QB 2N7YA 4FZVA 1HNXJ 1RA6A 3DRPB 2BQ3A 1TL7B 2KXNB 4DLGA 4NZ7A 1VC6A 3QJJA 5L1IA 2QG9B 5B0BA 5F8NA 1WJ9A 3CWJA 3DOKB 3W8PA 2G1DA 2DY1A 2VH7A 3W65A 2QYCA 4TLRA 3RG6A 4AXIA 4DCJB 3ZTPA 4HACA 4N47A 4DV5J 4U6PA 2APOA 2I9SA 2KZZA 1JXLA 4CRJA 1NK6A 2DHAA 2ZJRQ 4K0KJ 4IOBA 4ED6A 5H9EK 1VQ8S 3I87A 5DDPC 4DFKA 1BQMB 1MROA 2GJFA 2BEFA 4DSFA 1CEZA 3SCLE 3L4BC 1OQ3A 1Q1KA 5I3QA 4CLPA 2IMWP 2E9TA 1HNIA 2KJWA 1L3KA 3P3DA 4TU8A 4Z7CA 5KFIA 3HJFA 1Y10A 2C2ZB 1EZZB 1LKZA 3ZZZA 1KTQA 1WACA 3UN5A 1XN9A 3M8QA 4WTYA 1HWJA 2NXNA 2KT5A 4UQGA 1CVJA 4UQTA 1UVKA 1RT2A 3MM8B 4Y65A 4ES2A 1R43A 1YBTA 4DV5F 1IVZA 4B3TF 4NLSA 2DPIA 2V2QA 2YVSA 3I9ZA 4KY3A 3LTOA 4OV1A 1SJFA 2V2KA 2MZTA 3I4HX 3OTCA 3P5BP 3OTOF 2JLEA 2XZWA 3BJYA 5CYMA 3DDNA 5K8OA 4Y2AA 1OIAA 4DU7A 4FP9A 3N0VA 4MYTA 4KV8A 1VQNS 2F4VJ 1FJEB 2WVFA 4U7UK 1QY7A 3AOAA 3NS7B 2WB1D 2G2ZA 3HSJA 4RWWA 1HNZF 4QYRA 2AGOA 2HHHJ 5LMUF 1OWXA 4B3MF 3PKYA 4N41A 1DQ8A 1AT1B 2QRRA 3IWNC 3H5UA 2OPSA 4NZ6A 2DHXA 1N5TA 1S1WA 2HK3A 1N6QB 3W63A 5KG7A 1BMQB 1Z2ZA 2DR6A 3VZHA 1S1XA 2MQ8A 2RU9A 1YRUA 1FRMA 2P8IA 3CIMA 4DQPA 2FGOA 3CCVS 2NZ4A 1IBLJ 3R5DA 2ACMA 2Z56B 3N5FA 1WTFA 4C8LA 1G2EA 2ZBCA 1KP6A 3AA9A 1XBWA 3KDNA 1HR0J 2MB0B 2Y9HA 2NQPA 4N8NA 3LP2A 2RILA 3ZZUA 3OL9A 3HHLD 4X4PA 4DR1F 1TAQA 5CZXA 2MZJA 2DK2A 2RUSA 4KH1B 2LDIA 4OI1A 3KG4A 5MLCV 3DDIA 3J80U 3PR4A 4FNIA 4EEYA 1PO6A 2BE2A 3PM9A 3R5AA 3B78A 2M4MA 3PY8A 2VONA 3DRRA 4ATNA 1U1NA 1BWVA 1LWCA 2Q79A 2VA3A 4DSLA 4LSNB 5ETKA 2EKNA 5I42B 3MMAA 4LF4F 3C6UB 3FDSA 1ZTWA 1NK5A 2JDJA 2CZ4A 2HFZA 1MNEA 4A48A 3THVA 3CDUA 3IAS9 5A6PA 4H4KC 1HMVB 5A8KA 2CPHA 3GU0A 4USWA 4ZVQB 1T3OA 2H5JB 3CIZA 3R5GA 2MKIA 2PN6A 4FVCA 3H98A 3JSYA 2GQ2A 1RBAA 3GLJA 3J7YI 2XS5A 3I0SA 1ZA1B 5CQGA 4ZVHA 2X3GA 3IP0A 4Z2XA 1TKTB 4RKUC 4C2MA 3CSKA 1YJTA 4WWSA 3FCWA 4OX9F 1RKJA 2F63A 1MN7A 1UCNA 2KXHA 3DLGA 1YBAA 4J9UE 2E5GA 2XY5A 1U0HA 2FUG9 2BRLA 5KFHA 3M6XA 5DZ7A 5H9EJ 1VDHA 3ENQA 1R0AA 4BWJA 2CJXB 2QL7B 1FEEA 3DHXA 3H59A 4HLBA 1F3FA 4ITSA 1TL3B 3W7BA 4LIWA 3QAEA 4LRAA 1VR6A 4X62F 2IA6A 1D9FA 3KG1A 3LWMA 1RCXB 1IM6A 3GYXB 3VGTA 2HZVA 4ZPVR 3QQCD 4CDIA 2IRXA 2ZJPQ 3NGUA 1RHJB 3UQSA 3JAMU 3NCRA 1S6PB 4O3PA 2FLLA 1CS4A 3KTQA 2RDDA 1UJ5A 3BN4A 1JLBA 3TA1A 2BQUA 2E1MC 3CC4S 1TFWA 3BZQA 4ANCA 2R2TA 2BRKA 4BHQA 1RAFB 3TUZC 1HPZB 2NPFA 2BE9B 4DV0F 3AD7C 1B3TA 1R6VA 3C46A 3LP1A 4PABA 5F3ZA 1SUQB 2MKSA 5IWAF 1CS4B 2FDNA 2FZKB 4AFFA 4ZKAA 3GP9A 4NLXA 2HGNA 2HFSA 1OJ4A 2XHCA 2OEJA 3M8ZA 4Z7YA 1R31A 3PHTA 4A8OA 2VOPA 1E6YA 1NZAA 1Y5LB 3R7SB 3T5LA 2YWEA 1DRZA 2J6SA 2UXDJ 4QR2A 4TU9A 4ES1A 3CW2C 5HJXA 1TL4A 1TK8A 1CPZA 2H5IB 1I1GA 4DFMA 2W4PA 2FVPA 2YNFA 2D3ZA 4AYBD 2ZZTA 4F0HA 3QT5A 4BWMA 4XO0A 1H2VZ 3UDEA 1WKKA 5E3PA 4XPCA 1U6BA 4WK3A 4LQ3A 3QJPA 1JLEA 4KT0C 4PWDB 1SB6A 2UUBF 4BLGA 2MLYA 2GFFA 1T0TV 1NB7A 1NBEB 3UD3P 3SFUA 1NMEB 2QZ8A 3FBBA 3D6FB 4LFAF 3KMQA 3PO4A 2F40A 3GONA 4UTGA 1WC4A 3PRVA 4QU7A 2FVCA 2DITA 1WF2A 4ZPTR 2J9DE 3C2PA 2CA9A 3VAIA 2CIMA 2KM8B 1R0AB 4JOUA 4R25A 2EKYA 1UETA 1Y3KA 1SI9A 3BB5A 4X4TA 5D0HA 2QSFA 5GMDA 1HA1A 4MKVA 1UJ6A 3OVBA 1XNQF 4K4SA 3AXKA 3M7VA 3MEDB 2MY7A 2OPRA 3IMQJ 1UAWA 2M3DA 3M2RA 4CWBA 3CD5A 4F50A 4DCPB 1I94F 2J9DA 3W9IA 1BY9A 1RLDA 2VD3A 1GX6A 5J2NB 5F8IA 3EMTA 5IFMA 3HP6A 5D0GA 2GV1A 2NXEA 3ET6A 1HI1A 1ZAWA 3CD7A 4YB5A 1WI8A 3RRKA 3CEDA 4OYXA 2ALZA 4ECVA 3L9ZA 1HQ2A 1NRKA 1LFPA 3HHLA 4EBEA 2DISA 2WRMA 2YPYA 2B6AB 4DN0A 4PG6A 5K9FA 2VPZB 5GVQA 4CO2A 4EZ9A 4W92B 1OMSA 1JLAA 3T6JA 4ED7A 1N32F 2WOMA 3W1YC 2YKMA 1N32J 4ZJLA 3TJ8A 3JTNA 4I69A 1GX5A 2V50A 4OQJA 2HBQB 2IYIA 2BKNA 2IM1A 3M6UA 5CABA 1NSQA 2DVIA 1TV6A 4DUZF 5C5JA 1EAYC 3MD3A 3UDLA 2BJ7A 3D1HA 2UZAA 3N6NA 1R89A 1UZDA 2V34A 4ED4A 4IG3B 4C7QA 4F3QA 2ZFHA 2R8GA 5E0OA 4QIFA 2UUCJ 2JLFA 1HBUA 2XMWA 4K2JA 2DR7A 9RUBA 1SL1A 2BW7A 3I4PA 3FCHA 4A4JA 2AYEA 4MKYA 4TXSA 3K5OA 1VMBA 3G87A 2X1GA 3ISND 5D8HB 1BQMA 4Y2IA 4N8OA 4WXWA 5IQ6A 1NJYA 3PRBA 2WZ1A 2GMHA 5U47A 2D3O1 4DX6A 1H73A 3QGIA 1EHWA 1SH3A 2L9NA 2ZWPA 4DQIA 1O6XA 3KK1B 2EBEA 2R8HA 1CJKB 3GIIA 3KHLA 3K89A 4OLOA 3X3UA 4AL7A 3L7OA 4DQRA 1F5CA 2ZNYA 2HFNA 4DF4A 3SI8A 1ZS6A 2N4CA 4CO0A 5KFOA 1RTHB 2PMHA 4O3OA 3TAMB 4NLYA 1QTNB 2R7OA 1JLAB 3G86A 4J91A 3PV8A 4IR9A 2HLTA 1JX4A 1WSVA 1K73T 4I7FA 2LQ9A 1FERA 2HWHA 5DETA 1CQNA 3MAAA 5HMWA 5EWGA 4DPYA 4X4NA 2C3MA 4DV1F 4G1QB 1AZSA 1ELOA 3TJAA 4DBQA 4HDGA 2KH9A 1CC7A 3BGRA 4LF2A 3KDOA 3I82A 2W9CB 2R2SA 1TK5A 4GO5X 4LR9A 2SXLA 4NCBA 1TL1B 1Q5YA 1X4EA 4PEOA 1NEEA 4P73A 3SQGB 2C1EB 3WIUA 1FXLA 5IZHA 2FY1A 3AA8A 1QJHA 3LA0A 3M2UB 2XM3A 1R6YA 3AHPA 1RWUA 2PEHA 3HVRA 2BJ3A 4NYPA 1HBOB 4WFZA 5E2QA 5E33A 3M9OB 2Q43A 2XG8A 1Y4ZB 3UPFA 3PW0A 4XAKA 2VDHA 1EX8A 3RAMA 1NM2A 1HQEA 1RT1A 2EFPA 2LYVA 2ZUAA 1A6LA 4FS1A 1FDAA 2FHKA 1U2RA 2Y3YA 4J7CA 4RX6A 5C25A 4DSEA 2OMLA 1CULB 3MPWA 3E2EA 1D8ZA 5F0WA 3ITHA 2UP1A 3BKUA 3C19A 5CD4H 4LFAJ 2ZD1A 5J1EB 3RGIA 3TRGA 5A8RA 2IM2A 3MUVP 4F4XA 3T1HF 2IMOA 1VBXA 1CJTB 1CJVA 3VGVA 1V3ZA 3ZZOA 1RT4B 4ILRA 1IBKF 3IRXB 4H4MA 4MKAA 3SV3A 4F4KA 1XMOF 2HNZB 4C8MA 1YKWA 2L9WA 2UXBJ 1IQTA 1F1BB 2QLBB 4C0HA 3MCNA 4RW4B 1U1KA 5IC6B 5HVHA 1UW4A 3LGHA 2NXCA 2WW8A 3MEGB 3O6QA 4XDCA 5KFAA 3CCJS 2HQDA 3UI3A 3RJMB 2LQ8A 1RTHA 4EYIB 4DJBA 1JLQB 5J1NA 4KFBA 1PAEX 1HQUB 3HHDA 4X65J 4DR7J 3QGPA 1HARA 1VC5A 3ZNUA 2L9DA 4LF7F 5HLFA 2RMLA 1LWFA 3D5MA 1TUWA 2E1AA 3MMBB 4QWBA 2VHGA 4B9LA 4IQXA 4P6QA 2FJVA 3WX4A 2UUWA 3H2UB 1WOOA 1B70B 2JC1A 2LEAA 1FE4A 3BBFA 4ENOA 4QPXA 2F4VF 4YDDB 3TR5A 5CXTA 1TR0A 2B51A 2BXJA 3A3PB 4Y2MA 1PC5A 1UJ4A 4C98A 3SCKE 1KLMA 2Y1RI 4ZCLA 2CNOB 2B56A 1RT5A 3GSDA 4F3OA 1YJUA 2CJYB 1BLUA 5L39A 2G0CA 2YX4A 3DLKA 3H8YA 3WQPA 4ETXA 1N34F 1VQ9S 2IBKA 4R0EA 4JYAF 3DKDA 2VG5A 2AQ4A 1RT4A 2V6AA 1GQEA 3P96A 2HHUA 2QN6B 2IVMA 3BREA 2P9EA 3LPYA 4YS2A 5DG8A 1RWWB 1F2GA 3R7BB 1SQGA 1HR0F 3EZOA 4LFCF 1AW0A 2BOPA 3CDBA 2K1RB 3RW7A 1D9DA 1HD1A 2CQDA 2O3DA 3IR6B 2FHOB 1S77D 4U67Q 3RW6A 2HFUA 3EDQB 2VG7B 3LUYA 3ENWA 3OTDA 4FNHA 4JBCA 4N56A 1ZBTA 2AYBA 4AL5A 1N0VC 4CLYA 3HHKA 4NPOA 2QJ3A 1LOUA 4ZVOB 1DHMA 1G1XA 3QRPA 1P1TA 4U7CA 4LF5J 1RWOB 2XTJP 4OZJA 3BO4A 4V19J 5E5NA 1DFDA 3CT9A 1FRKA 3ZZPA 5A76A 3MR2A 2EFGA 2AYGA 2ZJQQ 1CULA 1U2FA 2AEJA 2GHPA 2U1AA 2VC0A 2ZNZA 3CCTA 3MGJA 3K57A 2LU2A 2HIQA 5KFEA 4E98A 1R7IA 2VFSA 3RR8A 4ALZA 4QCLA 3LF0A 1P9QC 1NHKL 3K7RA 3V81B 3M4XA 4P52A 5I4MA 2ZKUA 1NK7A 4RW6B 4ECRA 3US5A 4OI0A 4LJMA 4OX9J 2V4QA 2G2OA 4ETZA 1AYEA 1X4BA 3WC2A 1JXVA 3O2IA 2MJUA 3TAMA 4X66J 3H5SA 3T41A 4WFBQ 2QLWA 2FPHX 5DJBA 3KYLA 2EI5A 4EBCA 3NGSA 1OYEA 1RI7A 2MYFA 4RZRA 3OL8A 2UUBJ 3Q8PB 1NSPA 2B7CB 3AB4B 4KGVB 4KBIA 3CE8A 3KLFB 4DL6A 1M1KT 4G1QA 2DCUB 2JEJA 5ETLA 5CAAA 1RACB 2BJ8A 2QE5A 3DLJA 3OR2B 5IOLA 2GVDA 2V9WA 4DUTA 1C0UA 3TYTA 3D0GE 2DKOB 4IFVB 4J37A 3I5CA 4ED2A 4JI1J 1QE1B 1SH2A 1RB0A 5KT6A 3DN9A 4I6WA 4KH0B 5K8NA 4PWDA 4CO3A 2AV5A 4K5RA 3M8PB 3CF5Q 3W5YA 1QUPA 3VHQA 2BUNA 2DH8A 4UF4A 2BV3A 4B3SF 1PYTA 1KLMB 2MQNA 3C6TB 3O3LA 1M5HA 2AP6A 2CWXA 4RUAA 3IBFB 2N3OA 3AOCA 2KO1A 2MLZA 2IIHA 3WDOA 1VQ4S 4IR1A 2QEXS 2KTQA 2ZKTA 1S1VB 3PEJA 3AJ1A 2IDEA 2YY3A 5E3RA 2N3LA 1R8CA 2MZSA 4ZHRA 4CLKA 1LWEB 3B4DA 2EFQA 3ZZRA 2NS1B 2UXDF 4F04B 2UUAF 5K8PA 5L46A 1X60A 4CO5A 4ZJOA 2YKNA 4I2QA 4YB6A 1S10A 1TKZB 5HATA 1U26A 1X9WA 2F7VA 4JI2F 4O4GA 5L8RC 2KKHA 2Q3PA 3M8WA 1TL7A 2HPUA 3R9LA 2FLPA 4F36A 4M1KA 1PSDA 2VKRA 3CTRA 4FYDA 4ID8A 3TQEA 3DM2B 4B9SA 1NSKL 2MMYA 3KLFA 3V81A 3PW4A 1IKYB 2C28A 5CA5A 3EM1A 4KRWA 4HT5A 1MU2B 3CMES 2RD5C 1NPRA 1MN9A 3NGRA 3FGVA 5C2GA 2E7XA 1IM4A 4EK2A 1RT3B 5LMNF 1K9MT 1GK8A 2B6AA 2HZAA 4ZVSB 3VVUA 2J6TA 1VRTB 3P5TL 5HVGA 3IM8A 2N82B 1FNXH 1T9YA 3I32A 3N9UC 1TFYA 4F0KA 5IT9Y 1FCAA 1ICEB 1SXLA 3DNCA 1VLYA 2ZOFA 3LP0B 1C4CA 4KGXB 4HL9A 4CIOA 2FTRA 1REVB 1TU0B 2GAGC 2FQQB 5FD1A 2ZM6F 3LAKA 4HTJA 5J2MA 4A8QA 1LWXA 1FO1A 1A0OB 4RO0A 3I55S 1I6JA 2K1RA 3FMWA 3HJVA 1U47A 3IBCB 1RISA 5D0EA 2LP4A 1RAJA 5LMNJ 5ETRA 4LFBJ 3GFZA 1HI8A 1AFJA 3DFEA 3DCAA 3IA0A 1S79A 5EWEA 4CO4A 1K0VA 4ELTA 1B7YB 2DNKA 1U02A 2R3VA 2YQ0A 3DHWC 3MCMA 3OD2A 1WHXA 4KC5A 1EQ0A 4YY3J 1NKCA 1IQZA 1S49A 4CM0A 5KFJA 4IRDA 4DL2A 3WC0A 2PEBA 1F3VA 2JOQA 4L3KA 2LVWA 4OI4A 2IHR1 2CPDA 1PYSB 3D3CJ 7FD1A 2DPJA 3QBCA 5DGAA 4B3TJ 2ZH2A 2XS7A 2KN4A 2E7VA 3N6LA 3CNQP 1RU1A 4ZOSA 3OTOJ 1H72C 2PC6A 2W9AA 1LWFB 1ZM2A 1AUDA 2JH3A 2OI2A 4YR0A 3HF5A 1IJFB 5KG4A 2PA3A 2ZC3A 4DUZJ 4UY85 3U1LA 2DHSA 2CJAA 3MM6A 4XDDA 2CWKA 3S1TA 1WELA 2N7CA 2MGZA 2F9JA 3H4DA 1KQSR 4IRCA 1TKXB 4NLRA 1U49A 1HD0A 1SJ4P 3NWGA 3NLCA 1L3TA 2DH7A 4BS2A 3DLEA 2ATCB 1CG2A 2J0WA 5D4OA 2V8DA 4IFYA 1HBNA 4ZA1A 2WB4A 4DPOA 1GEHA 2DGVA 4P10A 5HK4A 3PR5B 2H65B 5G0RA 2V4JB 4DU8A 1LW0A 3W9HA 5JVHQ 3DXBA 3NKYA 5D4PA 1DLOA 3QIDA 2RRNA 4YHHJ 4FN5A 3E01A 3EGWB 3IFEA 3VWSA 4DR3F 3DLBA 2EBGA 2GVZB 2G0IA 3M8SA 4X4SA 5A8RB 4W90B 1CC8A 2O1PA 4KHRA 3ZTOA 2X1FA 2R7UA 1GTEA 2DY9A 3FFIA 1JQGA 1WDTA 3TEHB 1RLCL 2J6UA 5DG7A 3V5RA 4ANEA 3M8YA 2FVRA 4CLTA 4ED5A 1JLGA 2G13A 4RBUA 3ZTSA 1KQGB 3D4JA 3P8BB 4L73A 2BMBA 4DV4J 2ADCA 1XR5A 1SQEA 1S6PA 3QNWB 4ELVA 3UCUP 2J8AA 1WHYA 1FX4A 2RU3A 4OL8A 1EETA 1Y3JA 3GYNA 3HHLB 2GZOA 1YTYA 3OFHA 1PILA 1T02A 2EEYA 4QJVA 2FJDB 5HAOA 2C2RA 4MK9A 1U8SA 2W8KA 3LW5C 3J81Y 3MM5B 2CVEA 1TQLA 4ZVTB 3I56S 1J2VA 3GG0A 3W64A 2X3DA 4DV3F 3TARA 4I4BA 3GJRB 4IOCQ 1KS2A 3T1AA 3DLGB 4B9MA 1T8EA 2H1YA 2OFHX 4CTAA 1UEVA 3FKBA 4HH0A 4WTOB 2FJEB 4NCAA 1VI7A 1N56A 2CQGA 3HVWA 4RJVA 4Y28C 1BWEA 1I51B 4USHA 4NXNF 3HD2A 5KAKA 4DUYJ 2BOAA 1S0MA 2ZHAA 3GJTB 2W24A 2BQRA 1GMUA 4L74A 3UD4P 2ZWOA 4FDFA 4C4WA 4NCGA 1XK8A 1D3WA 2GVZA 1RAOA 2VG7A 3NOCA 4HI1A 2WSFC 1TVRB 4HYKA 3G82A 4PG4A 4OZ1A 2M9KA 2ZITA 3TAPA 1SPBP 3HVAA 3AY0A 4DV3J 3JSBA 5F8HA 1FE0A 3TZZA 4DR2J 2CKWA 2D69A 2XHWA 3T9NA 4UY8T 1JK9B 2ZBIA 1C1BA 4K2XA 4JI2J 2HNDA 3NOGA 3C3LA 1P27B 2OEMA 2A18A 1RAHB 4M95A 3GR1A 1HLWA 2QA2A 2J5AA 1WDDA 2HBRB 3TVKA 4WKRA 5G4DA 1ZZFA 4RW7A 1SJ1A 4C0OC 5HQ8A 3B82A 3SDEB 5LT5A 3CC2S 4B17A 5F3TA 1IBCB 2E5LJ 1VQSA 3OR1B 4RWXA 2GHWA 1VFJA 3HHLC 5AXMA 1CBKA 4DV2F 3CJ3A 2AJ0A 3H4BA 3EZ5A 1AFIA 4U9RA 4AXJA 3PO5A 1HNWF 4ANDA 2IM0A 3LALA 2OD4A 1MWQA 2A3JA 3GILA 3LPEA 4NASA 4TY8A 3QZ7A 1H98A 1BC6A 3OR1A 4DZDA 2HRTA 1S1UB 2QL5B 3Q8RB 4E0DA 4O3RA 2D3UA 2MJNA 4MK7A 2HVHA 2OSRA 4FYXB 3TI0A 1FXDA 5AXLA 5DDRC 3K8WA 3TANA 2F5GA 4IYQA 1FRXA 2AJFE 2QMWA 4WJBA 1L3UA 2ZZMA 4HHUA 4B9VA 2GVDB 2DTJA 1HIYA 1FESA 3GV8B 4PQUB 2B4PA 2DT9A 3IR5B 2HRUA 2UV8G 5M2RA 3TUIC 3S7RA 5A8WA 2MPUA 2HHTA 1FJGF 3IGVA 3AH6A 2CPYA 4I67A 1AB8A 3PG9A 4CM2A 2VOOA 4WYWA 4JV0A 2WOMB 4DHVA 1YGYA 4UZBA 2JNJA 2W4DA 3GIRA 3UN3A 1YI2S 2DRAA 3KNAA 3BGLA 1RE1B 1H2TZ 2AWZA 5J2PB 2K7KA 3DOKA 4DSKA 1ZH5A 5KOWA 4K4WA 2W4CA 4GKKJ 4C6AA 7AT1B 2C22A 2H54B 5J2MB 1XNRF 5AXNA 5DZ6A 3G6YA 3TX8A 4LF5F 2GNKA 2ZH5A 2R4FA 1TKTA 4DL5A 1U1OA 4JI4J 4R5PA 1UA1A 4ZIVA 2M70A 3KLGA 3J81j 1M90T 1FJGJ 2JJ4D 4MFBB 2E9RX 1RTIA 2XBPA 5A8WB 1OSCA 2MSTA 3IAM9 5CZVA 2A2DA 3PX6A 1QAJA 1FKPA 3A13A 1QAXA 4M94A 2DNPA 1PJ6A 1PAUB 3DYAB 3W9JA 5F9LA 2C2EA 3EGNA 2GS8A 2KFZA 3BQ0A 2HHHF 4JV1A 3H42A 2JFDA 1XNRJ 4P2XA 1F9EB 3OUYA 1S0NA 3UWTA 2VASA 1HBNB 3D54A 3M9MB 2EFVA 5K20B 4DFPA 3BBBA 4DPWA 2DB1A 3JB9k 2NXUA 2H5EA 1X7VA 3ZO7A 1KQKA 3OVSA 1J27A 3M6WA 1GTHA 3MM9B 4WXOA 1R8AA 1WF1A 1YRXA 2M7SA 2YWFA 5D4NA 4I2QB 3E01B 4RNFA 5ADZA 5HSPA 2J0XA 3VGUA 5IV3A 5L9NA 4Q43A 4ZP9A 4AE5A 1U0SA 3RBXA 1CJKA 2KL8A 2M88A 4DR1J 2NSCA 3ILIA 4WK1A 1SH0A 5JMNA 2CVIA 4JI5F 4FF3A 4YR3A 3V6JA 3QRQA 2JL9A 3NMAA 2FJWA 2RE1A 2V2VA 2MKYA 3OLBA 2VU5A 5KFUA 3Q22A 1SKRA 1CQMA 2PD1A 2HQIA 1NKBA 4CNYA 5KT4A 2XNRA 4UOGA 2ROPA 3KK2A 4QW9A 1TMMA 2ZVIA 1RWKB 4QIGA 1SKUB 2NPIA 1RGVA 3HULA 1PIEA 3I6PA 3M1VA 3POTB 4LBHA 1AUSL 3EDRB 3NG8A 4PXDA 2JHEA 4MKBA 4RPFA 2VA2A 5KFNA 2F8MA 1H7XA 2MQPA 3KLVA 2D41A 3OXLA 4P2FA 4USUA 2ZH6A 3HKWA 4G1IA 4ERDA 3FSIA 2VBXA 1JJCB 4X62J 1M5VC 3OR2A 3CXCR 5HVFA 2LXIA 1SVDA 1VQLS 2ADBA 1JJHA 3GJQB 3ITHB 3QLHA 3EVOA 4RW4A 3W2VB 2HHWA 2FY8A 3OUYB 3WX8A 5JJBA 3QYYA 2OMOA 4OYWA 4B3RJ 2NYHA 4C8ZA 1FF2A 4J90A 1GXTA 1MMNA 2J7KA 2NUUG 3UVJA 2JWNA 3W8GA 4GC6A 2LECA 1Q81T 4A47A 3PX0A 4ED3A 3MPYA 2HK2A 2KVQE 4PCQA 3MR5A 3TW0A 4ECXA 4BC7A 1CJUB 2B5JA 2BYCA 2V5HG 4EWTA 3RBEA 1T03B 2ALYB 2UU9F 1LW2B 3DLHA 1WNEA 1A9NB 2HHQA 1Y00A 2IC3A 2W25A 3QT6A 4L3NA 1WF0A 4RU2A 4N7TA 2R42A 1TK0A 3UCGA 3TOQA 2V69A 2KDOA 4HKQA 1FRIA 2EFOA 5EDWA 4HACB 3K58A 4LF6F 5AJ3J 2NUHA 1U48A 4L75A 1VJQA 1HNVA 5IV4A 2R2UA 3H90A 1JNRB 3DXSX 4Y0FA 1T9WA 2MKHA 5D3GA 3OJSA 4TU7A 3NNCA 4DN9A 3RBDA 1QSLA 1NK9A 1NJWA 2C2OB 2EC2A 5KG0A 4DX5A 3IG1B 6AT1B 4D3HA 2R7QA 1VOMA 3E51A 3S8SA 3T1YF 5EUHA 4EUVA 2RRAA 2AHOB 2FYXA 2AW0A 4GO7X 4ZVFA 4HTIA 1S0OA 1OY9A 1VCTA 5KFCA 3SV4A 4U96A 1R8BA 2CPIA 4WKYA 2ABYA 2DNQA 1RSCA 3ZNJ1 4LUBA 4K4ZA 5ETPA 3W66A 2I5JA 4FS2A 3K17A 2E5HA 1DTTA 1S1WB 4S0MA 4AT1B 4Q44A 1X4CA 1RT6A 2ILYA 4A8SA 3RRGA 1XQIA 1XMQF 3HPOA 2WSCC 4PXEA 1RWNB 3PNIA 1H0HB 3I9V9 1NDCA 1YIJS 1FT8A 3JTPA 3DRXA 2BM1A 3TO8A 3UNGC 1VRUB 4Q0BA 3CVKA 3CJ2A 2GO8A 3FJ2A 5C2CA 1U25A 2GMJA 3G6VA 3MOZA 3CCQS 1WD6A 2CG8A 3MEGA 1KSPA 1U1RA 1MWYA 2L48A 4IG0A 4WE1B 1YZ7A 2KJVA 3TUJC 3BF4A 4Q0BB 3BR8A 4ECUA 1HQUA 3G82B 4UZCA 3AJDA 5E41A 1S7IA 2FHJD 4CYUA 1FK9B 5HROA 3IRXA 3OHAA 1XNQJ 5B7WA 2DGUA 5F8GA 4Z37A 2WTFA 2WCXA 1I3OB 1FKPB 1NLKL 2IJRA 1H38A 1HHTP 2C3UA 2VB6A 2W2MP 2HWTA 2XY6A 3HKZD 1IWAA 3OXGA 2Z2ZA 4O0NA 3VTIA 2P9GA 3G8TA 1M5OC 5H9FK 1Y5IB 4CTAB 2Z30B 1CJVB 2VFRA 3CGIA 3IG1A 1NPKA 4ZMMA 3UW1A 4LQ9A 3MM5A 1K1QA 2DXFA 1OYDA 4B3OA 2LQ5A 1N4LA 3HO1A 4ZP6A 1NNDA 1JXEA 1U24A 1N33J 2F65A 3PRDA 3D3BJ 3CCLS 2OPRB 3M2RB 2GW8A 2DXEA 1GT8A 2UXCJ 2DGXA 2QA1A 2WW4A 4B9TA 3AFGA 2L3MA 1UEKA 3A8JA 2R7RA 2VQFF 3V6HA 2M2BA 1NB2A 1TL1A 2BANB 2WSEC 4I2PB 1KD1T 1HNXF 5BYSA 2AJ1A 3VAKA 5T14A 3FMBA 1RBLA 5HMXA 2MSSA 1B64A 2LXFA 4GVLA 1VYAA 4LR7A 3R5BA 1NJZA 2QX0A 2NLWA 5B08A 1YITS 4LSZB 4OIXA 1RT7B 3E8OA 4DG1B 5L1JA 3DMJB 1DARA 3FRZA 4OZLA 3GQCA 1IKVB 2E66A 1WWHA 4OZ0A 5ITHA 2GA7A 3UVJB 4DV6F 2GHVC 3R2CJ 2UUTA 3OL7A 4DV7F 4NL5A 1FVSA 3W62A 1LW0B 3ZTRA 1HWIA 2PA8D 4WIQA 3DOMA 3GIKA 2UXCF 1Q0NA 1RT5B 2YKNB 3M05A 2LDYA 4JI7J 3C15B 2HHSA 4B3SJ 1FJCA 3QLHB 4M5NA 4OYIA 3W2VA 1W7WA 2FIUA 3I0RB 4FVMA 1XR6A 2IRUA 4RBVA 5ETSA 1IN0A 3W2WA 2XCAA 2CYYA 2GGPB 1RWMB 2IBOA 4U8YA 3PIPQ 4C11A 2ZEJA 3RTVA 4P2SA 2ZDOA 2HZCA 5BJRA 5IXUA 2DO4A 1DLOB 2EW9A 2ZUGA 4Y34A 5LXRA 3E3XA 1DURA 4USKA 2XMVA 4NLDA 3VZIA 3KK1A 4KFBB 1T9VA 2GJ2A 2RQ4A 3KJFB 4DV7J 4A8MP 2F8HA 2A2CA 3MTKA 2ZBPA 3QZ8A 3P4UB 3MFHA 1SL0A 3DLEB 2OH2A 2OUGA 1MSWD 4B9NA 1X4AA 2XS2A 4IFVA 3THPA 1IWGA 2VFUA 5EX3A 4ZP8A 5CCMA 2KVIA 1VQYA 2DYAA 2G4BA 2NSBA 3HVTA 1YJNS 3HSDA 2X51A 3GFYA 3TEGA 3G2XA 3F73A 1JKHA 4I1TA 3VVTA 4N76A 2QA4S 3Q83A 2W7OA 3BH7B 3IBWA 4C11B 1YZ6A 2B7BB 4IDKA 3MMJA 2B4OA 1ZETA 1TELA 4UOFA 2VFTA 3MF5A 5T41A 4C8NA 3MPUB 2YX7A 2KM8C 3FC9A 1Q7LB 2R8JA 5DLGA 1K44A 1YJ7A 3MWBA 2ZH4A 2UXBF 2XYHB 3BEGB 4U95A 2HBZB 1XMQJ 4X64J 4P9SA 4CQ1A 3MZIA 1EARA 5DS7A 1IKVA 4FKYA 4M5JA 3TAQA 3DMJA 4DR5F 4RNNA 4XK8C 3FBEA 4OYBA 4NXMF 4RNHA 3IR7B 1GNKA 4X65F 4F4WA 1VQ7S 1XR7A 3AAWB 3BQ1A 1UVNA 4DL3A 3R3TA 3VCDA 4W4MA 3PVXA 4C3MA 2FJXA 5GAGI 4R8UA 4ZLJA 1WC3A 1TTHB 3QGHA 4Q2MA 3W2WB 1G6BA 2YWGA 2VBYA 3I0RA 5LXYA 3NL0A 3GYGA 3MR7A 1NCLA 4D3GA 1GMWD 4P7VA 4JI6F 2ZHBA 3RR7A 4MH8A 2QYGA 2DNOA 2BJ1A 2G1HA 1VGYA 4NA1A 3A12A 4PXBA 4F26A 1D1UA 2X1AA 2OIHA 5LJ5Y 1F9HA 4PQUA 3KFWX 3TZYA 2UVRA 5KFFA 3M32B 3WZ0A 4WFXA 4A8YA 1HI0P 5ETNA 2F4FA 1N88A 2Z2YB 3C8YA 4LF9F 2HEKA 4L6V3 3SCJE 4JI8J 1BXNA 1X5SA 1FD8A 1O8BA 1RHRB 4NX9A 1G4CA 2E44A 4KGZB 3NS5A 1S9EA 1SBRA 1YDLA 2FB0A 2DNLA 4YR2A 1YJ9S 1WEYA 1U2CA 4IUFA 4KO0A 2W01A 1XC9A 3UR3C 3CDEA 3OSNA 4J9KA 2HVIA 2JVOA 1S57A 3MM7B 3ICLA 2AEMA 1LXJA 5IM0B 1N0UA 4C0BA 5HL7Q 4O4RA 4GMKA 2XLIA 4ER8A 1FK9A 5HROB 3CJTA 4OJGA 1QAYA 3IS9B 2VC1A 2XGPA 3ILOA 4RW7B 2K3KA 2PGCA 1B0VA 1J5EF 2GX8A 3J81U 2AJQA 5HQLA 1BUXA 1O51A 3OJUA 4KHPJ 4KAIA 2RJZA 4EGLA 1WC0A 2QL9B 4I0WA 2R2RA 3T5JA 3HK2A 2R7SA 5D78A 3MEKA 4HDHA 1VIXA 4OZ3A 2RS2A 4ILLA 1V3RA 5DG9A 1T94A 4RW9B 5F8MA 2XULA 4OJHA 5SUHA 1TMJA 4N5SA 2HFOA 2YNGB 5F9NA 2ZH3A 3KJNB 4QQBA 8AT1B 1VBZA 2JEIA 1F60B 1N5VA 4Y3CA 1T11A 3U1NA 4ZK7M 2CRLA 2XLKA 1C0TA 1RP5A 2E5IA 2UUCF 3QAUA 2KI2A 3O5TB 3D66A 4PZVA 4FF2A 3JYTB 3IGNA 4OX8A 2E7WA 5FDLB 2OJ3A 3NBPA 4KV8B 1Q16B 1IKXB 4ZPBA 2ZDPA 5AE1A 6FDRA 1S9FA 4KHPF 2W1BA 5KFWA 2XI2A 3MHYA 4DS4A 2FLNA 1ZM4A 2VICA 4ED1A 5DQHA 4JP8A 3ZFVA 2B4VA 3QIPA 3CJKB 1S6UA 2O5DA 5AE2A 3W61A 3VAHA 1U0HB 1BE4A 1SJQA 4E2FB 1REVA 2B9WA 1JLCB 2RHQB 1RA7A 5M2UA 1BD6A 2H9ZA 4O3NA 4QWDA 1VRUA 3IRWP 4NE9C 1Y9OA 3M32A 4DLEA 1P8GA 2XZTB 1I5OB 2J0QD 1HNIB 3BKFA 2BBEA 7FDRA 4B3RF 2AU0A 3RAQA 1H2UX 1BGXT 2AGQA 4BC9A 4LF8F 2DBBA 4LF8J 1Q8LA 2XWYA 1UVMA 3Q86A 4CH1A 3GIJA 4TKTA 1UW9A 2OTLS 4ILMA 3DRRB 4PRFA 4RUBA 3UN2A 4IKAA 4TY9A 2E1RA 4M5DB 3TVZA 1UPMB 2Y1JA 3GZ7A 1OO0B 2OO4A 2CQ0A 3BKTA 3QJLA 2DIVA 4M5IA 2HMIB 1UVJA 3DI6B 3NNAA 5AE3A 1HWLA 1KEKA 3K59A 1YLXA 3QWPA 2VQEJ 3X1LB 2RAQA 1KQFB 5GMKa 2B8PA 2VQEF 1R0BG 5KFKA 3LAMA 1RABB 1T95A 1FVQA 3QATA 2ASLA 4WE1A 2YNFB 3T1YJ 4DV2J 1S6QB 3NGKA 4R8UB 1G7CB 1O0PA 5BXIA 3CPWR 2DNMA 1FFWB 2KHCA 3Q2SC 4AQYJ 3RB0A 5F8JA 4Q8FA 4F8RA 3QSIA 4AQYF 3T1HJ 1WG1A 2DHHA 3LP2B 1JLEB 4XIUA 4JB8B 4K59A 5G0RB 2BABA 4OZ5A 3SXLA 5IC4B 4QBUA 1OY6A 4ZN3A 1KOOA 5HBMA 5C24B 1VQKS 1XWLA 3S01A 1VRQC 1HBUB 4P7TA 4LSLB 3A3NB 4MT1A 4BCAA 3OQ2A 4QWAA 1U45A 3R6LB 2MZQA 4C8KA 1IUJA 3NAHA 5B0FA 4NXMJ 1S9EB 2K3IA 1YSJA 3N79A 4H4OA 1JLQA 3U1MA 4DDFA 4OI2A 1PJ7A 4M5KA 3JQJA 3IM9A 1U4BA 2EVZA 3BV8A 4NLWA 4F02A 2BJ9A 1JJ2R 3HMJG 2OEKA 2Z8QA 3CCSS 2W9BA 2VDIA 2XMTA 2DEJA 3JQKA 3K2YA 4LBPA 2OAUA 4UT4A 5EGYA 3CMQA 1DTQB 3D0IE 2V2ZA 2PMWA 4GKKF 2D74B 1OS5A 4B3MJ 3MECB 1DBDA 5FIIA 3FVYA 3LANA 4Q7AA 4LSLA 3DYAA 3B6BA 5B0CA 2HW3A 2VV5A 4OYPA 2LQJA 3FRYA 3LWLA 3SIPB 4ID5B 1KKHA 3M6VA 1FDBA 1RT7A 1RAEB 1WC5A 1HHQA 3FEXB 4URQU 2EG2A 1TL3A 1M1HA 4J5OA 1FDNA 1W2BR 3H2VE 3U02A 2QC3A 3HDSA 3HX9A 1KN6A 2CPXA 1XJWB 2HS3A 1RUSA 5BR8J 1RYSA 4EYHB 2J0SD 2XGQA 3QT8A 1XTZA 1BQXA 3HFZB 4NWBA 2WVBA 4QOTA 3CB4A 4PUOA 1URNA 2P2CB 1KONA 1RJJA 3JSRA 1YJWS 2CFXA 4KB7A 1P1LA 2HQCA 2V67A 3J80Y 2DGOA 4RU9A 3IN5A 3KG0A 2C42A 4PYAA 1X0FA 3AJ2A 2RKIA 1OPZA 4NOHA 2B9YA 4YHHF 1QSSA 4MYUA 3L95X 3D28A 2I1RA 3W60A 2RRBA 2KHDA 2YKAA 1D8YA 2FVSA 3DGPB 4DR3J 3NMRA 3MPDA 4IQMA 3Q8VA 5ETQA 2RSQA 3GMGA 3SZ2A 3H2LA 4ECYA 2V4JA 1NHVA 1U09A 3R8YA 3KLGB 2Q1LA 2MEWA 4ZHRB 1H74A 3ZZTA 5A0YB 3LO3A 4QPTA 4B08A 4KPYA 5T7LA 4BBYA 4FKXA 4OYOA 2CQ1A 4HHJA 4PXCA 4NLOA 3G9CA 4O4GB 4CLWA 1S0VA 2ZOGA 4WZMA 5KOXA 3MMBA 4OYAA 2FHMA 2IAJA 2MKJA 2W9BB 1MMLA 1HKAA 1TUVA 2HQ3A 2YXLA 3CJ8A 4PWUA 5KFPA 5J1PA 4FXDA 2ZH1A 1ZAXA 3BSCA 3PXGa 3W5XA 4U7UD 4M5HA 1VHFA 4ICLA 2RF2A 4IH5A 5AT1B 3OV7A 5DQGA 4ZVUB 3EPGA 3A4TA 2VF3A 4M5MA 1S6OA 2WVEA 2DNNA 3GIMA 4C3KA 2K2PA 3IWXA 2R7WA 3GFHA 3OPKA 4OX7A 3H0PA 3MR6A 1FA0A 1IXKA 4BDPA 4M5LA 4LRCA 2OGUA 2HVEA 3HCXA 3KNGA 3BQ2A 4YDXA 3D6MB 3V4MA 2DHGA 3MPVA 5B09A 3KLHA 1SC6A 4DUYF 1QSYA 3R1LA 4RBTA 2JSXA 2ZHOA 3FK4A 5HMYA 5CHCB 4JI3F 3EJMA 4LR8A 1S99A 4MAKA 1HBMA 1KVKA 4M5DA 4DL4A 1NJXA 3IWLA 2LEPA 1SCJB 2VBWA 3CCZA 3NGTA 4QIVA 4R0JA 3OLAA 3J7A1 3F56A 1C1CB 3UNYA 1RKIA 3SSSA 5A6WA 2UUAJ 3R97A 3QO9B 2BANA 4I2PA 4X4QA 2RF2B 2KYZA 4C3LA 5BYRA 1SJRA 4NCGB 3PX4A 4FF1A 4NRUA 2MQQA 1QLNA 1FTRA 2X7IA 1WEZA 2OPQB 1H3DA 1YWXA 3GB0A 3KUHA 4L72B 4QIEA 1DQAA 2IAJB 4USIA 1L3SA 5F8LA 3G8QA 1B0TA 3IS9A 5J2PA 1F5BA 2MZRA 1O5JA 2I0XA 3BO3A 1Y11A 1DTTB 2DD8S 1XIQA 2DH9A 1LK5A 3ENVA 3AOBA 3L7UA 5B0AA 5DQIA 4PKDB 1S59A 1VLOA 4TLQA 3BGFA 4ZLNA 4KO0B 1Y5NB 2YBVA 2N4DA 3DU5A 1MU2A 3SEOA 1VK3A 3D2WA 2MQMA 5GAEI 5K8MA 5LSRA 3J7ZT 1OY8A 1FWKA 4YEAA 4QWEA 1QTMA 2QV6A 1TVRA 5KTQA 4HH1A 3Q0AA 4LF6J 4HR2A 4I6YA 5D0RA 1B99A 2MLXA 3A3OB 1U1PA 2RH3A 3KUGA 3GV5B 4LRFA 4J9OA 1KVIA 1FNOA 1N5SA 2XI3A 2A6MA 4ZP7A 2CADA 3KUEA 5DDQC 4IO9Q 4WFAQ 2PFFB 1GH8A 2VJUA 1MLAA 3SYZA 2XZDB 4X4VA 3C16B 3OT9A 1YRTA 1S1UA 1PBAA 1FXRA 2C2MB 3HM9A 2CAJA 3L7PA 2DNGA 2HFVA 4FBUA 4OHYA 1FRHA 3MUTP 1UTAA 2BACA 4WZQA 4LF9J 3F41A 2KXFA 2DIUA 3CJQA 4ICLB 4J9SA 3QIPB 1NSAA 3R1HA 2PE8A 3OHBA 2UVUA 2DNYA 3DLKB 3OVAA 1E6YB 1ZA2B 1L3VA 2DRDA 2BE7D 4LRBA 1WHWA 3RYLA 4C8OA 1ZPWX 2EK1A 3M1VB 2CQPA 3KHGA 1F5AA 4ID5A 1FHTA 4WYLA 3M8PA 1FDDA 2B9XA 3O44A 4C48A 4ZLPA 4E8UA 2PO4A 3KLIA 4LT6A 4P72A 3BGOP 1SUQA 3IC1A 3KLHB 3SBMA 2GJIA 3KOAA 3LP1B 2Y1LB 1C0TB 2VPXB 1KHWA 2YH0A 1Q86T 2XYPB 4Y6IA 1I94J 1J5EJ 3D6HB 1DZ5A 4LIRA 3TUPA 3FFIB 3EUNA 5GADU 3GWCA 4TNOA 2CNLB 1KR4A 1J5OA 4X2BA 2WAQD 5CYJA 1IJEB 1NAQA 2W8LA 2YWKA 1JLFB 3VQTA 1Q7YT 2HRYA 2XMMA 2O66A 3AB2B 4PG5A 5LOQA 2RKIB 1T05A 1KHVA 2MXYA 3MAHA 5L1KA 2FJAB 1MMDA 1Q8IA 2LQBA 1Y7PA 3RAXA 1EP4B 1SV5B 4MTPA 4CP5A 4TQRA 1K0TA 3R5CA 5E7OB 3EXCX 4K4UA 1SKSA 2DNZA 4K7QA 5KFVA 2EK6A 4PUOB 1RTDA 5EN1A 2GO9A 1DY3A 3KLIB 6FD1A 2OPPA 4H4KA 2I8EA 3MXHP 3OBIA 3V4IB 1Q95G 2JFKA 3PJWA 3NY0A 5ETOA 5A0YA 1PJ5A 1UWAA 4OFZA 3CD6S 3QT7A 5LSLA 1IR2A 2YKPA 3V6DB 4WP3A 2HYIB 3IO1A 4DL7A 3DC2A 1CJUA 2B5JB 1NZ8A 2XLJA 1KRPA 2XMKA 3SQGA 1YQHA 2FC9A 4MK8A 4DL0C 1UFKA 3MMAB 3O1LA 4JI5J 2I38A 4DV4F 1ZYQA 1N54B 4HEA9 2WK4A 5B0EA 5KFDA 3GSIA 1NHUA 2RDJA 1RTZA 1M1GA 4P74A 4J9RA 4F25A 1VQPS 2OHDA 3QFWA 3DOMB 3VALA 2D9OA 2EC0A 2V8PA 2DNHA 3D1OA 3O8WA 4X4UA 1WUUA 4KQZA 1RADB 2HVZA 2RNEA 2XWXA 4ZVEA 3CCWA 4IDKB 3KJVA 1MWZA 2F3JA 3QRRA 2P9CA 2D1CA 3Q8YA 2IY5B 5ETTA 3OFFA 2Z58B 5HQMA 2KG0A 3QSYB 2ERRA 3SCIE 5I42A 4GC7A 3T5HA 5JXSA 3KJQB 2NREA 4B9UA 3FBFA 1F9FA 5K14A 2J7WA 3V6DA 4AUKA 1K47A 3POTA 5KFQA 1FKOA 4ELUA 2IJNA 1AZSB 4WFYA 4QYZJ 1NH8A 2B9EA 1G3OA 2Z4PA 1FTCA 1N5YB 1EKSA 2OPPB 3T6BA 3NP5A 4RNOA 5I3UA 3FEZA 3MEEB 2CXEA 2IFXA 5KFBA 1APSA 3GPAA 2HHPA 4USTA 4DXLA 1MW7A 1HNWJ 1JIHA 4DV1J 3OFEA 5C24A 4KR0B 1SQFA 1W26A 5HBMB 2CPJA 1Q82T 3MM6B 2MGZB 3M2VA 2XB2D 1ITPA 2GIQA 4RW8A 5KFRA 1V5IB 1T9UA 3BN7A 1RAAB 4TY8B 4F2SA 1JLCA 2C3YA 3JQMA 3N5BA 4IO1A 5DM6Q 2R9LA 3VAJA 4YB7A 3QO9A 4K4XA 5EWFA 2GGPA 4KIAA 2AT1B 4M8LA 3VR1A 4DR2F 3TVYA 2E29A 2M0GB 3LOUA 3ENAA 2ROGA 3C6TA 5KT3A 2DGWA 1UMJA 2CG4A 4CH0S 2HNZA 1XMOJ 1M5PC 2V8GA 2XCPA 2D7SA 2RB7A 1FWLA 3BSNA 5FDLA 1M5KC 2M8DB 1RAIB 1QE1A 2OELA 4I6AA 4NLUA 2G9OA 4IG3A 2E5LF 1CJTA 5LSOA 4OI3A 2HHVA 1RXOB 3BPSP 4CT8A 1L5UA 1TL5A 2M52A 3DOLA 5HMZA 1GXUA 2CUYA 2GIRA 2VPWB 2GQCA 2YNHA 3MI7X 5D6GA 3KWMA 1VQOS 4IH7A 1E6VB 4DR7F 3FCVA 4NEYA 4C97A 1NPPA 4DPTA
chains in the Genus database with same CATH topology
5A2QY 4NLQA 2YH1A 4O0IA 4KKOA 3BR9A 3M2VB 3UFCX 4F67A 3LH2S 5BYQA 2AX0A 3FSYA 3NNHA 5I3PA 4B3OB 2HMIA 3MM7A 4DS5A 2V4RA 1W2IA 1S4FA 1CSJA 4G6VB 1N5YA 3W3SA 2BJDA 1ROFA 2B4UA 2IVYA 3PFEA 3PW2A 3L3CA 3EYZA 2C3OA 1LWCB 1C4AA 1IKYA 2PIIA 1DAXA 1XERA 1S76D 3SSQA 1PGZA 4KJIA 1IKXA 3GG1A 3NRBA 4O44B 5EX0A 5E3CA 2Z2LA 2DJWA 2LXUA 4YQWA 2CJ9A 3R27A 4O3QA 4RW6A 3UE2A 4PG8A 2DO0A 4ZPCA 3Q2TC 2OPQA 3G6XA 2E5JA 2HHXA 5CCLA 1UWBB 1Z1ZA 5H1SV 3K0JA 2QA4G 3FZBA 4DR6F 4EU0A 2WONB 2ZE2B 5BR8F 3RZAA 4ZCMA 3G6ES 4QZVB 3M30B 5F0UA 1QVFR 2FC8A 2V94A 2IM3A 2FHJA 3BS9A 5D4LA 2J9EA 1UVLA 2O01C 4XPEA 3NBPB 2OP5A 2CJBA 3PACA 1AROP 4TYBA 2KT3A 3ISNC 1C1CA 2C2DA 1LQ9A 3LGMA 5KFGA 2QSWA 2HGLA 3Q8SB 2CPEA 1JMTA 4ZPWR 4ZS6A 4IG0B 3MD1A 3DOLB 4TQSA 4OLPA 4A8WA 4K4YA 1VQMS 1Q8BA 2OFGX 2DR5A 5KG3A 3F44A 2PI5A 2B3TB 3CDWA 4FXWA 4ZCIA 3RU0A 1IBMF 1ZOTA 4H54A 1ZPVA 3OTBA 2MHNA 2LLZA 2HWIA 1VBYA 4MJKA 3KK3A 5IM0A 3GE9A 2QFJA 2VODA 3QGGA 4HI2A 4NA2A 4YFUA 2KG1A 3KMSA 5KG1A 1UEUA 2C3PA 4DFJA 4UOCA 3ULHA 5CYQA 3OTEA 4LVNP 1FNMA 4ES3A 4LMZA 1FRJA 4ZDNA 1NK4A 1UKUA 2XC9A 2F1FA 2M8HA 5I3UB 4HVZA 4RLEA 3EX7B 2LA4A 3BDEA 3CCUS 2LEBA 4NZ0A 2WBMA 3PW7A 4PPDA 1U1LA 4JI7F 5GAHU 1ZM9A 1VRTA 3K5PA 2BW2A 1HBOA 4OHZA 2DR9A 1X9SA 3CCRS 1VC0A 4JV2A 2GMLA 5A8KB 1RTJB 1FRLA 2D9PA 2ASYA 1RK8A 2ZD1B 2J7UA 5KG2A 1ULRA 1OQ6A 1U7LA 2DGSA 1BQNB 2AYMA 2V8VA 4ZPTR 3K5MA 2W9CA 1N52B 5CYQB 2K7JA 2RT3A 2EWHA 5C42A 1UP1A 5DLFA 1VS3A 1ZZNA 5C25B 1K1SA 5B0DA 3KLEB 2QT7A 1S1TB 3HLUA 5AJ3F 4C8YA 1N6QA 1RTDB 3HT3A 5FJ4A 2FVQA 1S9GA 3HHEA 4OHXA 3CDAA 1FEHA 4PQAA 4KHMA 4OI6A 3HZEA 3JAMY 2FJBB 1Z2LA 1GXLA 3G71S 1WEXA 4RUCA 2F8EX 4MIAA 1E6VA 2ZOMA 3KHRA 2ZH9A 3EZUA 4DEZA 2MZ1A 1DTQA 3Q23A 3GR0A 2J9CA 1U6FA 4OZNA 3FQLA 3DU6A 4EZ6A 4H4MB 3UDCA 4ECQA 4QR0A 4X84A 4X4RA 3T3FA 1D0EA 4K50A 5J2QB 3N01A 1S72S 5J1EA 1U1MA 1H6KX 3PZPA 1S97A 2V8HA 4JI8F 1LWEA 4ED8A 2LKZA 3VAGA 4ECSA 2OTJS 3CJ5A 4JV5F 2L41A 1Q4RA 4J9MA 5KFXA 2HGMA 1DQ9A 3K5NA 1UFWA 3M8RA 2Q6BA 4F4YA 1X4GA 1UWBA 1KVJA 2RIJA 2ZVSA 5EHHA 5DDOC 2KU7A 2XMJA 3HFKA 3CO9A 3DRSA 3JSMA 2EPIA 2EG1A 3P49B 3A8EA 3BSOA 2GCFA 3M30A 2OD6A 2PSZA 2VKZG 1HFEL 4JI4F 1VK8A 2P6SA 4NA3A 3HZGA 5T7LB 4JUZA 2YX1A 4ECWA 4DG1A 1B0PA 4MIBA 4NLTA 3NCQA 4KSEB 2BJEA 1RTIB 2R8IA 5J2NA 2CQIA 2KRBA 4J9QA 2KT2A 2J76E 3CCES 1FD2A 4WU3A 3M9NB 1QVGR 2B0GA 2R7XA 1FJ7A 1N33F 3MEDA 3I31A 3RB6A 2R7TA 4K4VA 4YOEA 5AXKA 3DRPA 2DR8A 1C2PA 1A7GE 5KFZA 5LJ3Y 1N36F 4KTQA 2QIFA 2ZH7A 1HWKA 3OSPA 1WG5A 4NLGA 2XEXA 1HYSB 3T19A 2VPYB 3QWUA 5KFTA 3MFIA 3PFOA 4NLPA 4Y2CA 3ISZA 2XSJA 3PDNA 3KK3B 2XMUA 2V9KA 3A1YG 4ECTA 5DGBA 2FGCA 2YQ3A 3SDEA 3KHHA 4QWCA 2ATLA 2KZMA 2MQLA 3V4IA 5GAGU 1U6ZA 1W25A 1RT6B 2Y1IA 1AXQA 1ZTTA 1SL2A 3J7YU 2CQ3A 4M63A 2D3OR 5KT2A 2HNDB 3VAFA 2JVRA 4Q5VA 1SIWB 4PPZA 2YNHB 2HG4A 2L08A 4Y00A 1NH7A 3MDFA 3DLLQ 4I68A 2YNGA 4ZPDA 4MIWA 4UUWA 2JLGA 3N4WA 3H40A 4ED0A 3MURP 4F2RA 3ZZYA 2U2FA 3I96A 3CCMS 2FLOA 3JYTA 2E1CA 2JX2A 2W7AA 4A46A 5LL6d 3D1QA 3PHEA 4EO8A 1X4FA 2NYIA 4ZVGA 2R7VA 1N8RT 1MROB 5L9XA 1PC4A 4X64F 4G1PA 3MOJB 3ZC4A 3HI9A 1KFDA 1HHSA 2POKA 4YB1P 3MUMP 1T3NA 1FKOB 4WIIA 3TA0A 5HLFB 3FEYB 1ZAVA 3HXMA 4J9PA 1LW2A 3PJXA 4F4ZA 3D0HE 2UVVA 3SSRA 2WBRA 4EFAC 4CH7A 2P5VA 3BDPA 3KKFA 2ACYA 4ZPAA 1S6QA 4A8XA 5KFSA 1R8HA 1X8DA 2PDAA 4YP3A 1S1TA 2BVZA 4I64A 2XO7A 5D3GB 1HW8A 3TP2A 2KB2A 2HS4A 2W7PA 3H5XA 4DSIA 2ASJA 5HP1A 1LV5A 1X0PA 2A10A 5DO2A 1VIOA 1LK7A 3M2UA 2BDPA 1NK8A 2OSQA 4O23A 2YNIA 3AQOA 4K0KF 3LQVA 4KE5A 3T9ZA 3K8VA 2MKKA 3PIOQ 5HP1B 1SJ3P 3BGRB 1T03A 1NO8A 3DRSB 4N77A 3JSMB 3BO2A 2Z2MA 1S7HA 1T7PA 2BZ2A 3JTOA 4IRKA 4IH6A 1KFSA 4KKOB 3MTJA 2CQ4A 1HQEB 1RT1B 2IVFB 4YY3F 4WFNQ 3MR3A 4EBDA 3G4SS 1KOHA 5FLXY 2O67A 5B0GA 5L1LA 1EP4A 1SV5A 2AJ4A 4NRTA 3MMCB 2RUGA 1YG0A 2IRYA 3OFGA 5MAOA 1Q78A 2CQ2A 2KRRA 2RS8A 1V3SA 1NU4A 5H9FJ 2R8KA 1VJWA 1GAOA 5F41A 1KNZA 3RB4A 3DDKA 4TN2A 1OSDA 5KG6A 3MAQA 4V19X 4LFBF 3C6UA 4H4OB 3MM9A 1N5QA 3CJKA 2QO3A 3FNNA 4O3SA 4QR1A 4GKJF 1F0XA 1HL6A 2CZVC 3C66A 1CLFA 4IFYB 1KLNA 3B8HA 3UR0A 2DCLA 4K4TA 4KGMA 1KC8T 1XMBA 2VUGA 4K5SA 3VAMA 1TKXA 5CH7B 2JEFA 1TKZA 3H20A 4B02A 4DWIA 3LGNA 2EFNA 2XSFA 3IXQA 1JKHB 3BGUA 4DSJA 3CMAS 4FBTA 3AQPA 2VZ9A 4RW9A 4YUDA 2HNYA 1S1VA 2VG6A 3PW5A 4RNMA 4FF4A 5GAHI 4C9DA 1HWUA 4NLVA 2OPSB 3QPIA 4J9NA 2HAIA 3MCSA 3N6MA 3NCPA 4OJ1A 4RW8B 3KLEA 3GV7B 2AGPA 2BA9A 5DM7Q 4IOAQ 2VBZA 1Y0HA 1BQNA 2ROEA 1VQ6S 1YVFA 4X66F 2DNRA 3SFGA 1X5TA 2LCWA 3KJVB 2ILZA 2E9ZA 2NR0A 2GC8A 3L09A 4MFBA 2JRSA 4PR6A 2CDQA 3EGZA 4EO6A 3DGPA 2BE2B 1RT2B 3MM8A 1WHVA 3DM2A 3NAIA 1VQ5S 1X5OA 4I7FB 1TKDA 1WI6A 2YKOA 2HLUA 1TP7A 1B7FA 1QAIA 3I5BA 3ONQA 1V9OA 5K5MA 2AF6A 1HW9A 3RRHA 2ZZNA 2XY7A 2LMIA 2X1BA 1X9MA 1RT3A 4PG7A 2M5YA 5L38A 2ZH8A 2F9DA 2VG6B 4Q2LA 5IT4A 2BM0A 4OMFG 3U27A 1WTBA 4J9LA 2YKQA 3K5LA 3SMZA 2OLWA 5JVGQ 2JEGA 4DMZA 5SZTA 3BM7A 2UV8A 3BSAA 4ZCKA 3Q8QB 5J2QA 1EETB 3FQKA 2MKCA 4OX6A 1SKWA 1TAUA 4Y2KA 2CJQA 3OXFA 1IR0A 1JJ4A 1JLFA 1UVIA 1C1BB 5IT0A 2HNYB 2PMZD 3N28A 2MDAA 3EPIA 2WHOA 4NMLA 3CUNA 1QUVA 1M0SA 3CD0A 1H7WA 3OL6A 4ECZA 2A1BA 3FZ2A 1U1QA 3ZZ0A 4CT9A 1HBMB 3WBZA 2LA6A 1TZ0A 4HT7A 4DQSA 2CQBA 2CPZA 4AL6A 4KGKA 4FXVA 2VFVA 5GADI 3H25A 3J7Z5 1RYRA 1X5PA 3Q24A 2AX1A 2CJKA 5E3QA 4DX8H 1M5SA 1RDRA 3MMCA 1NKEA 4WCEQ 1S9GB 2HS0A 4DOZA 4X4OA 2P6TA 2KFNA 3MEEA 1IKWA 3CJ4A 1OPIA 1C0UB 2I5JB 3HHNB 1NJIT 5KG5A 1HYSA 1NK0A 4OJ3A 4Q8EA 3I5AA 5KFYA 2DGQA 1X4HA 3V2UC 3CC7S 5K14B 4Q45A 4F3MA 2KYXA 2B43A 1D9AA 4NYOA 2BR0A 2Q6CA 5E3AA 2LU1A 4QW8A 1JB0C 3EXYA 1HPZA 1R27B 1JLGB 2RQKA 2KFYA 1HNVB 2FD2A 1YHQS 4CCHA 3UCZP 4CO1A 3NS6A 2RQCA 3DI6A 5HI7A 5GAEU 4CNZA 2YTCA 2MY8A 2AD9A 2PI4A 1IBLF 1DJ0A 2IC3B 3U7JA 1ZM3A 4DQQA 2PT0A 3DRYA 3QMQA 1QM9A 5HN0A 2DGTA 3P6YC 2OKQA 3CULA 4WF9Q 5KT5A 3PEHA 1Z4UA 5D77A 2V0NA 2JZ5A 4QIWD 3VF0B 3T5KA 1K8AT 2I2YA 3G8SA 2XNQA 2Y0SD 3TA2A 1UA0A 2Q66A 2UVWA 3FSXA 1HMVA 1KTVA 1Q79A 4JI0F 4RUHA 2CQCA 3NGDA 5M2PA 3G96A 1S1XB 1WG4A 2VG5B 4WU2A 1N48A 5KT7A 1J5OB 4LSNA 1IKWB 1JNZB 1UFLA 3MECA 4I56A 1YJVA 2CQHA 2RDIA 3Q22A 4JI1F 2ZC4A 4UW2A 4QU6A 3HVTB 4A8FA 5THWA 4DF8A 1XEZA 1JLBB 4CZCA 1RQ0A 1UL3A 1T05B 3B4MA 4UUXA 2QLXA 2VL1A 3V6KA 1SIZA 3RB3A 3THTA 4YMEA 1FKAF 5CYMB 4URGA 3TNVA 1YJRA 4A8KA 2K8GA 3OW2R 4OHWA 4URSA 5JUMA 3KK2B 2WONA 2ZE2A 1Q53A 4FPRA 2CPFA 2MHEA 1R3NA 2RQMA 4MMOA 3LP0A 1X4DA 4NYZA 5HO4A 3ETOA 1JWWA 5IQQA 1LXNA 2ASDA 5C42B 2IYGA 4USJC 3I0SB 2JC0A 3GFXA 5IS2A 2XSJB 2YWHA 4O44A 2YNIB 2MQOA 1S48A 2GQQA 2DRBA 2IA0A 1RTJA 1R8PA 4TYAA 3VQSA 3H5YA 4DR4F 5KFMA 3TQ1A 1URRA 2QMXA 3S6EA 4OHVA 1TV6B 4CI0B 5KFLA 2RVJA 2COLA 5DRKA 4R5PB 2Z0GA 1V6HA 1LFWA 1P6TA 2IJFA 2YKMB 4LVOP 3CJ0A 3M8QB 2N7YA 4FZVA 1RA6A 3DRPB 2BQ3A 2KXNB 4DLGA 3QJJA 4NZ7A 1VC6A 5F8NA 5L1IA 5B0BA 3CWJA 3DOKB 2G1DA 2VH7A 2QYCA 4TLRA 4AXIA 4N47A 4U6PA 2APOA 2I9SA 2KZZA 1JXLA 1NK6A 2DHAA 2ZJRQ 4IOBA 4ED6A 1VQ8S 3I87A 5DDPC 4DFKA 1BQMB 1MROA 4DSFA 1CEZA 3SCLE 1OQ3A 1Q1KA 5I3QA 2E9TA 2IMWP 1HNIA 2KJWA 1L3KA 3P3DA 4TU8A 3HJFA 5KFIA 1LKZA 3ZZZA 1KTQA 1WACA 1XN9A 3M8QA 4WTYA 1HWJA 4UQGA 2KT5A 1CVJA 4UQTA 1UVKA 1RT2A 3MM8B 4Y65A 4ES2A 1R43A 4DV5F 4B3TF 4NLSA 2DPIA 2YVSA 3I9ZA 4OV1A 1SJFA 2V2KA 2MZTA 3I4HX 3OTCA 3OTOF 3BJYA 2JLEA 2XZWA 5CYMA 3DDNA 5K8OA 4Y2AA 1OIAA 4FP9A 3N0VA 4MYTA 4KV8A 1VQNS 1FJEB 4U7UK 1QY7A 2WB1D 4RWWA 1HNZF 4QYRA 2AGOA 4B3MF 5LMUF 1OWXA 4N41A 3PKYA 1DQ8A 2QRRA 3IWNC 3H5UA 2OPSA 4NZ6A 2DHXA 1N5TA 1S1WA 1N6QB 5KG7A 1Z2ZA 3VZHA 1S1XA 2RU9A 1YRUA 1FRMA 3CIMA 4DQPA 2FGOA 3CCVS 2NZ4A 3R5DA 3N5FA 1WTFA 4C8LA 1G2EA 2ZBCA 3AA9A 1XBWA 2MB0B 2NQPA 4N8NA 3LP2A 2RILA 3ZZUA 3OL9A 3HHLD 4X4PA 4DR1F 1TAQA 5CZXA 2MZJA 2DK2A 2LDIA 4OI1A 3KG4A 5MLCV 3PR4A 4FNIA 4EEYA 1PO6A 2BE2A 3PM9A 3R5AA 3B78A 2M4MA 3PY8A 2VONA 3DRRA 4ATNA 1U1NA 2VA3A 1LWCA 2Q79A 4DSLA 4LSNB 5I42B 3MMAA 4LF4F 3C6UB 3FDSA 1ZTWA 1NK5A 2JDJA 2CZ4A 2HFZA 1MNEA 4A48A 3THVA 3CDUA 3IAS9 5A6PA 4H4KC 1HMVB 5A8KA 2CPHA 2MKIA 1T3OA 3CIZA 2PN6A 4FVCA 3H98A 3JSYA