1CQWA

Nai cocrystallised with haloalkane dehalogenase from a rhodococcus species
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
295
structure length
295
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGVLPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNEIPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPGLASGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Haloalkane dehalogenases: structure of a Rhodococcus enzyme.
pubmed doi rcsb
source organism Rhodococcus sp.
molecule tags Hydrolase
molecule keywords HALOALKANE DEHALOGENASE; 1-CHLOROHEXANE HALIDOHYDROLASE
total genus 101
structure length 295
sequence length 295
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 1999-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cqwA00
2Y6VA 4BBZA 3L1JA 2AJLI 1MAHA 5HKAA 4AN0A 2H7YA 3LIIA 4B0OA 4PSCA 4ARAA 5IVKA 4H7EA 2PSJA 4KAJA 3ICWA 2WIDA 3VVLA 3ZLUA 4C88A 4J0CA 3EIOA 1U65A 5AP9A 1E8MA 3QMMA 3DNMA 2OG1A 5EHXA 5CT4A 2VAXA 2E3JA 1E89A 5ALTA 1F0NA 3A2MA 3LCRA 4ITVA 2BUBA 3WL8A 3C6BA 1QIJA 2IX9A 3I1YA 4WFJA 2PKYX 1L7RA 1QIIA 5D3KA 1BCSA 2J4FA 4B83A 1AGYA 1WB4A 2V96A 5KREA 4NMWA 4B85A 3AINA 3QBJA 3WK6A 4Y2QA 1EA5A 4N8EA 4BDTA 4B84A 1ZI6A 4K6GA 3F67A 3VKFA 3JW8A 4AXBA 3Q0TA 1HL7A 1QIKA 3IUMA 1WCYA 3DKRA 1J1IA 3DS8A 2RAUA 1JI3A 3H18A 3EQ7A 1BE0A 3HABA 4CFSA 4AX4A 2WTMA 4NVRA 1UOOA 1R4ZA 4W1QA 1J06A 1VOTA 2XQKA 3A6ZA 4H7HA 4PSDA 1RP1A 4HAIA 1F8UA 1VXOA 4U2GA 4GHWA 1U8EA 3N0TA 4JNCA 5HQ3A 3HACA 3WKAA 5CTAA 4JUIA 4DNPA 3AFIA 4UBOA 1ISPA 5KWIA 4KACA 3IUQA 3R3YA 5AK6A 3GUUA 2WJ6A 5DYYA 3I2JA 2Y1KA 2BCEA 4UHBA 5ALRA 2HA0A 2OAEA 1ZICA 2WSLA 2HU5A 4B80A 5DLPA 1BEZA 3EQ8A 3C43A 3H2GA 3WWDA 4NS4A 1Z68A 1CUGA 3H1BA 4WY5A 1EVEA 3QPAA 3B5EA 4EB0A 1XKLA 1Y7HA 4OUKX 3V1NA 1CUXA 6YASA 4AQDA 3ESCA 3O4JA 5A7FA 5BWBA 2RIPA 4CG2A 5KWJA 4FKBA 2Q0XA 4UHCA 4BVJA 1YS2X 4BTLA 2ACKA 3K6KA 5CXXA 4UHHA 2D0DA 2QJRA 4DYHA 2P8SA 2AJBA 1YS1X 1G4HA 3WIOA 5AI9A 4KYVA 4DSAA 1I6WA 3KXPA 4BZZA 4DMKA 4I19A 4KJXA 1GXSA 1LPNA 2XMCA 3FAKA 5JANA 5E4JA 3L1HA 5JAPA 3I6MA 2RONA 2ES4A 1CQWA 1C7JA 1UOQA 4HRYA 5ALJA 1JU3A 2EEPA 4BYMA 3KSRA 2Y6UA 4XJVA 3OG9A 2VT6A 2WFMA 4Q3LA 4V2IA 4XVCA 2CBGA 2ZJFA 3VDXA 1QFMA 1VE7A 3UMJA 3PI6A 1CLEA 3FYUA 5K5EA 4DNFA 3H2KA 1B41A 3V9AA 4BP8A 2Y2UA 3G9XA 1XRMA 3IVMA 3IBTA 2O7RA 3WZMA 1MJ5A 4H0CA 2Y2VA 5FPPA 1AMNA 4FLEA 5JZSA 1LPSA 1USWA 4RGYA 3ICVA 3VJMA 5LP1A 1O6GA 4Q1VA 1C7IA 3R3XA 5EFZA 1EX9A 2DCMA 5T4FA 4YASA 4RNCA 3DJYA 3G7NA 4N5HX 4W1PA 1KU6A 2YASA 3I6YA 3BDIA 4W63A 2JGKA 2PSHA 4G9EA 5ALKA 2QMQA 3O4HA 3W9UA 3H1AA 2ZYHA 5LZ9A 4K6HA 1XROA 3CCCA 2PU7A 1MNAA 5IH7A 3WMRA 4KE6A 2DHEA 3LLCA 2HA3A 2Z3WA 2WIGA 1ZD3A 3NWOA 1EHYA 2FJPA 3QZUA 3NUZA 3C6ZA 1QIEA 1WB5A 5EHNA 1Y37A 1XZHA 1FSSA 4I3FA 2VJAA 4QE3A 5JASA 1MO2A 4QDTA 4ZV7A 2QT9A 4FBLA 4KAFA 5AOCA 1QO7A 1H22A 3HLKA 3EBLA 4MQMA 4Y2XA 2DSNA 4IH1A 2OQVA 3RKSA 2LIPA 2AJDA 3SX4A 3TEJA 1JT2A 1ORWA 5LKAA 1CUCA 4INZA 2Z8XA 1CR6A 2CJPA 1LBTA 1MPXA 5AI5A 2W6CX 2XQGA 1OILA 5EI5A 3PFBA 4KE9A 5CURA 5HF5A 1YASA 2HM7A 3R0VA 3WK7A 2XUHA 1AUOA 2ZSHA 3F9CA 1HDEA 5FUMA 2ZYRA 4LKOA 3H19A 4C89A 3S8YA 1OXMA 2BFNA 4U2DA 4AMZA 3DQZA 5A62A 4H7FA 1XRNA 3G9ZA 1DU4A 4QDUA 4DSZA 2HHAA 1HBJA 1DTEA 1ETHA 4HXEB 1S8OA 5CXUA 1U4NA 1LPPA 1JFRA 1CUSA 4H35A 4Y2YA 3WA6A 4FWBA 3STUA 3I28A 3RARA 3PUHA 4F21A 1O6FA 3V48A 1D07A 3BIWA 3F96A 4EY5A 4YK7A 3WK5A 3WYNA 1WHTA 4BRSA 5AM4A 2C0PA 3ZPXA 2K2QB 3D2CA 2QKYA 2X8BA 1QIMA 2Z3ZA 2GBFA 3H04A 4DGQA 4CCYB 3QM1A 4K5QA 5IKXA 1DWQA 5JD4A 3O9MA 4MYDA 2CKMA 4QZVA 3PF8A 5AKHA 2XUQA 2WU3A 3JYHA 3G9UA 3ZLVA 5FXMA 5C8ZA 5AOAA 2R8BA 3FOBA 4JYMA 4HTAA 2DQZA 1ACLA 1IZ8A 1EB8A 5YASA 2QM0A 4A23A 1OCEA 4UHDA 3E1GA 2HL6A 2QXUA 4ROTA 1BN6A 2R11A 3IDAA 3M81A 2QXTA 4C01A 3A70A 5FDFA 3C70A 3BIXA 1N5RA 1XRLA 4ARBA 4QA9A 1UKCA 1R9NA 1BEEA 5ALVA 2XQFA 4WY8A 4ZI5A 2BKLA 1LPAB 2VSQA 3ZLTA 4JEIA 1AC5A 5CH5A 1WPXA 2J4CA 1M33A 2XUFA 4B0PA 2JF0A 3OOSA 1CIJA 4WDRA 2O2GA 5LKRA 1XZKA 1TAHA 1CVLA 5EIHA 1T2NA 1XRRA 4CCYA 5LLSA 4BE4A 4TVKA 1YA4A 2JGLA 4OD0A 2G5PA 1QTIA 1IUNA 1BROA 4G5XA 4HZGA 2HDWA 3STVA 1W76A 4BE9A 5DTJA 1QJ4A 5ALZA 4OYYA 2QS9A 2GZRA 5EHQA 5JZ9A 3WA7A 1MT3A 4B7ZA 2WLSA 4Y2SA 1EVQA 4P92A 5AO9A 3WK9A 1ZD2P 3M83A 1CUYA 3WYDA 2OCLA 1PFQA 2QJWA 1EDEA 3I2FA 1DT3A 1UWCA 3D4LA 4OB8A 4ZGBA 2QRUA 4BVLA 1GKKA 1JMYA 4NZZA 1SOMA 4J7AA 4B9EA 4DNQA 5DNWA 2VQ6A 1GGVA 1H2WA 4Y2TA 2WTNA 2O2HA 3CXUA 1A7UA 3SK0A 2WIKA 3R3ZA 2WHQA 4HXGA 4YPVA 2UZ0A 1ODCA 5JAUA 2DFPA 1J2EA 1R3DA 4MQLA 2O7VA 4MWTA 1WB6A 4B81A 3EQ9A 4X3CA 4BCBA 3O4IA 1TKRA 1NX9A 5AJHA 1CV2A 1EK1A 5JZBA 1SCIA 3L1IA 4IHAA 2XMDA 3PDCA 4L9AA 1CRLA 4Y7DA 3WWPA 5D7BA 4CIAA 4OPMA 5E4TA 3QH4A 4N8SA 4CIBA 4X94A 2WG0A 2ORYA 2JGEA 1QFSA 4JH0A 1XQWA 2PPLA 4B9AA 1GQSA 2CUTA 5AH0A 4J3JA 4KR0A 1HPLA 2GYUA 5AKGA 1XFDA 5K3AA 3ILSA 3AJAA 2BGRA 4MYSA 2QUAA 1TQHA 4LXHA 1JJIA 2DQYA 1CPYA 1XZLA 2XUPA 1NU8A 3QMVA 5DYTA 4C4YA 1GPLA 2OPHA 1SC9A 2ACEA 5H3HA 4QDOA 5AIBA 1EB9A 2I3DA 2V97A 3WLAA 1IUOA 2C0QA 4X95A 4E11A 2WHPA 5C81A 1THGA 4G9GA 3G02A 4IO0A 3IB3A 2DR0A 2C4HA 3FYUC 4EBBA 1KEZA 4CI9A 4G4JA 1AQLA 4X6XA 4BZWA 1LGYA 3W05A 1ZD4A 3NOXA 4BDSA 5BWCA 2HA2A 2JGJA 5JD5A 5CT9A 5D6OA 2OGZA 5FKJA 4X85A 1DX4A 4J0HA 4UBLA 5IVIA 3IUJA 5ALNA 1FFDA 1XZGA 2PSDA 4QDZA 5CRIA 3BJRA 2PM8A 1EH5A 3OURA 3KDAA 1CUDA 1AKNA 5CBKA 1YB6A 2O2IA 3HRHA 5JIBA 2XUOA 4C4ZA 3VXKA 1EDBA 2VA9A 2XT0A 3F98A 5K3EA 3WWCA 2BUCA 5ALHA 2JEZA 5FLKA 4PW0A 4FLFA 5A7HA 4OU5A 4KRYA 1ACJA 3WIBA 2WU4A 1XLWA 5HK8A 1HLGA 1FJ2A 3Q8WA 4UHFA 3OPMA 2Z5GA 4GI1A 2PSFA 4FNGA 3AZPA 1W1IA 1YB7A 3I1IA 3CCBA 4DM7A 1UFOA 4X97A 1VE6A 2G4LA 3FCYA 3ZI7A 5K3FB 5AM2A 4F60A 5A71A 1K8QA 1UK9A 5HZGA 5LZ5A 4ZXFA 4RPCA 2AXEA 2WJ4A 3IUNA 4KAAA 5AM0A 5AI0A 3EF3A 1Q83A 5LZ4A 4DMHA 5KBYA 1MTZA 1CUBA 2XMGA 2HIHA 5HQ3B 4GXNA 3MVEA 2QVBA 4U2BA 2VT7A 1BN7A 4N5IX 4WJLA 5EIEA 5BV7A 3FVTA 5JATA 3E3AA 3X3HA 1H2ZA 3C8HA 1DQZA 4FFWA 5AK3A 4G8DA 3STWA 2XQJA 1MX1A 4X7BA 1Y7IA 2H7CA 2ZSIA 3HC7A 5E2IA 2H9YA 1J07A 3AUKA 4UFNA 1JMKC 4H7IA 2CMFA 4Q05A 1VKHA 4L72A 2XMZA 3VISA 4I4CA 4ZV9A 3KWFA 3KWJA 3DD5A 1CUAA 2WUFA 1XQYA 2B61A 5JAOA 3R3WA 3WKDA 4X6YA 3OTQA 3C6XA 5DYWA 3STXA 4UBKA 1GT6A 4J0DA 1PV1A 2WILA 3D59A 3T52A 4AZ3A 3B12A 1A8SA 2V98A 1YSCA 4GWLA 3K9BA 3C87A 4BVKA 3PE6A 5K3FA 3RK4A 2XQIA 2VEOA 1XLVA 2XE4A 4WFKA 3OC0A 3BWXA 5FRDA 3HYSA 5SYNA 4QLAA 4DLNA 1X70A 2B9VA 2XMRA 1ZIXA 5K3CA 2HU7A 1UK7A 2OLEA 5HF6A 5ALYA 4PF1A 2BJHA 1EK2A 1JJBA 1CUVA 4PQEA 3GROA 1XZAA 1F6WA 2FJ0A 4UPDA 1W4LA 5ALWA 5AM3A 3F97A 3A2LA 5HF9A 4X71A 3I6ZA 2WG1A 2BGNA 2GZSA 4QWMA 3GZJA 3IA2A 1TCCA 3O9VA 1BU8A 4AMYA 4BCCA 3R41A 1RYYA 1ZI9A 2G5TA 4ZWNA 3WJ2A 3G0BA 5JADA 2GYWA 3AZOA 2VF2A 3BE8A 2ZJ6A 3QMWA 3ANSA 2D5LA 2H1IA 2C5FA 1LBSA 3D3NA 2XUAA 4BAZA 3BL8A 3G0CA 2JIDA 3AIKA 3WWEA 5LZ2A 2XUJA 3T4UA 1VJ5A 4OB7A 3D2BA 4GLBA 1EDDA 3MGAA 5IVHA 5AIAA 3P2MA 3DYIA 3F8SA 1XLUA 2YXPX 2QR5A 4BRZA 5A6VA 1A88A 1ORVA 2CZQA 4Q3KA 2XMQA 1P0PA 4UBJA 2WFLB 3QPDA 2OXEA 3BXPA 1LPBB 1NU6A 4MWSA 4D9JA 2RI6A 3FLBA 2OCIA 4J0IA 2GBIA 3SC2A 1MN6A 1WHSA 4G4GA 3W04A 1TCBA 3O4GA 1YAHA 1ZOIA 3QPCA 3G0IA 1MX5A 5ALFA 3G8YA 1THTA 5AKKA 2YYSA 3QVMA 3U0VA 1L7AA 5I9IA 5A7GA 1UKAA 1B6GA 1N1MA 5FOQA 3KOOA 4KE7A 3VVMA 4H7JA 2HFKA 5LZ7A 4AO8A 5F4ZA 3H0CA 1TIBA 5AM1A 3DOIA 1QIGA 4KEAA 5FP0A 2CB9A 5DTIA 3WQHA 2JBWA 1FFBA 4P08A 2I78A 3WWOA 2RGUA 5CH8A 5CH3A 1QO9A 2GBGA 4IH4A 1XRQA 4MEBA 3DCNA 5K3DA 3RM3A 1YCDA 3ESBA 3GELA 1YAJA 2B4KA 5AKJA 1BRTA 2J3DA 3BJMA 3PFCA 1GQRA 3SWWA 3C6YA 4Y2UA 4Y2RA 4EZIA 4F5ZA 4LXGA 4U2FA 1MNQA 1E66A 4XWGA 4A5SA 3C8DA 4JYPA 2ECFA 2XUIA 5ALIA 1CUWA 2RHTA 2HRRA 4C4XA 3BDVA 2HA7A 4X91A 1W6RA 1WPRA 1XRPA 3RLIA 4BCDA 4CG1A 4J03A 3HZOA 2XUDA 4WCVA 2WHRA 3I2KA 4KRXA 5HF8A 5IVDA 1XKTA 3WJ1A 2DHDA 3KD2A 5ALOA 1Q0RA 2W22A 3FCXA 2JGMA 3BF8A 1AURA 4PNZA 4GDMA 5CT5A 2GBCA 1K6EA 4RE6A 4FLMA 1RWQA 3H17A 1DWPA 2QOEA 5JD6A 2QTBA 1ODSA 4KE8A 4OU4A 5LIPA 5BOVA 5CT8A 2PVSA 2PX6A 2PU5A 4WDQA 2RHWA 1HKHA 5C7YA 3YASA 3IULA 3WZLA 3FBWA 4M0EA 4UFOA 4AZ0A 4C6HA 1UT6A 1XZMA 4EY7A 3ED1A 3PF9A 1E8NA 5EIAA 4FOLA 2WJ3A 3O95A 3E0XA 4HS9A 5LYYA 3HI4A 2NW6A 3HXKA 4DIUA 2ZYIA 1XQXA 2I03A 5ALLA 4UBNA 4A16A 1QONA 1CUIA 3D0KA 4PV7A 4H18A 3H2JA 2WKWA 4QEKA 4BATA 4UHEA 5ALEA 3O0DA 1WOMA 2EDCA 1BCRA 3WL7A 1IMJA 2VTVA 1Q84A 3QITA 3LIPA 3I2IA 3FYTA 1AZWA 3FWHA 3M82A 4PO3X 4UBMA 1H2YA 2WM2A 4K2AA 3VJKA 4H77A 2WG2A 4MEAA 2WQZA 4TGLA 3G0DA 4WFIA 4OB6A 1XZFA 1ZJ4A 3JWEA 4E14A 3GA7A 4BC0A 1QIFA 1VZ2A 4BAUA 2J3QA 1A8QA 2G63A 4YX9A 4Y2PA 5ALXA 4GECA 1MX9A 4LHEA 1VZ3A 1XZBA 3H2IA 3U1TA 1H23A 5AOBA 3QYJA 1VA5A 2HU8A 1P0QA 2WUEA 3MUNA 1GZ7A 3HSSA 1YR2A 1QIDA 1GPNA 5FV4A 4MJ3A 4QDXA 4OCZA 2XB6A 4P93A 4OYLA 1QLWA 5AKLA 1CEXA 3BF7A 4XX1A 3ZWQA 1VLQA 1UK6A 1L7QA 4L0CA 1W52X 5ISMA 1R50A 4Q34A 1MU0A 3GFFA 5AKZA 1TCAA 1QZ3A 2WIJA 1E3QA 4P9NA 4B6GA 2BUAA 2JGFA 2HA6A 2XI4A 5ESRA 1LZKA 4HRXA 1XZCA 4ETWA 4TPKA 3UUFA 3HEAA 4ZRDA 1PJAA 2PL5A 1DWOA 2IITA 1QGED 1CUZA 1HQDA 4FDMA 4E46A 2QUBA 1K4YA 1R88A 5J3JA 4W9RA 3A2NA 2XMSA 3TRDA 3N2ZB 3DLTA 5HCUA 5A2GA 1N8SA 4FNMA 2XLCA 1T4MA 2WIFA 1IZ7A 3W9BA 5C8VA 4H7DA 1C4XA 1UKBA 3H2HA 2HRQA 3V1KA 3CN7A 1LPOA 2PUJA 5T4EA 3WK8A 1CUEA 2X76A 5ALPA 3WL6A 5AKEA 1A8UA 3WKCA 3LS2A 5AHXA 2JEYA 2V9ZA 2AJ8A 2Z8ZA 3I2HA 4EY8A 2WFZA 5DWDA 3STYA 4G1FA 2XDWA 2OGTA 3D5EA 1QE3A 4W1SA 4FHZA 4J0GA 1LNSA 3V1MA 4DMFA 1CFJA 4FTWA 4K6KA 5AK5A 1Q0ZA 5I7UA 2WFLA 4M0FA 2AJCA 4FBMA 2QZPA 3S2ZA 5JAHA 3FLAA 3WL5A 4AO6A 2XLBA 1F0PA 3R40A 3FNBA 3HJUA 3MUOA 2WUGA 2PSEA 1X2BA 3PICA 1UOPA 4BB0A 3DL4A 5DNUA 1CUJA 2VJDA 5T4BA 1P0MA 5ALSA 5T4HA 2HA4A 5FPQA 4DMCA 1ZD5A 4ZREA 3ESAA 4X92A 3IIIA 2I3ZA 1SFRA 4N8DA 4UFPA 5AI8A 2X5XA 4S0XA 4PSUA 2XUGA 1UXOA 1XZEA 3VJLA 4AO7A 3E4DA 2C58A 1JJFA 4RE5A 4UUQA 5AM5A 2EDAA 4X90A 5AICA 1QOZA 1CQZA 1E5TA 4EY6A 1GPKA 3B3QA 5ALDA 5HK9A 3NGMA 4QWWA 4OSEA 1BS9A 2PUHA 1G42A 2YH2A 5AI6A 3R3VA 4E15A 2HADA 4X6UA 1ZGCA 4HXFB 5AI4A 4O08A 2OAGA 3G9TA 4L3WA 1ZJ5A 4QLOA 3DEAA 4LXIA 1W75A 3I2GA 1ZI8A 5DJ5A 5AKXA 3D2AA 3FSGD 3WI7A 1DX6A 3AZQA 4EHBA 4MXDA 3WKEA 5AKIA 4DNOA 3PUIA 5C8XA 4LIPD 3IURA 2GYVA 4EY4A 4G4IA 1U2EA 3C45A 1LLFA 1XZJA 5I8PA 4GBGA 2FUKA 4CCWA 2DHCA 4FFVA 2ONCA 1H2XA 1LPMA 4XIIA 5AKYA 4Q82A 4G8CA 5HFNA 3DKKA 3WKBA 1TRHA 4B82A 4U2CA 1EI9A 1EXWA 2HFJA 3ESDA 5EGNA 3FVRA 1FFCA 1X2EA 1UZAA 4W1RA 5K3BA 4Q3OA 2OCGA 2H7XA 4BP9A 1LZLA 2HA5A 1E8DA 1VA4A 5HKBA 3R3UA 3WK4A 4EUSA 4Y2JA 3OM8A 4LYEA 1K5PA 1QIHA 1R9MA 3DOHA 4BTVA 2WUDA 3M3DA 3C5WP 4QNNA 4AB1A 3W2TA 3DL7A 5JARA 4F0JA 5SYMA 5ALUA 1ZIYA 5AK4A 3ANTA 4H7KA 1DT5A 1FFAA 1DINA 4CG3A 3V1LA 3AIMA 5JYCA 1EINA 5HFAA 1CUHA 1JKMA 1FFEA 4J0KA 1UK8A 2ZJ7A 3STTA 1CUUA 3DYVA 1JU4A 4EA6A 1VXRA 1IUPA 2PBLA 2ROQA 4M0MA 4G8BA 3G0GA 1CUFA 4FMPA 2ZVDA 3TGLA 2IIVA 4Y2VA 4BC1A 3K2IA 2VAVA 5JALA 1G66A 1XZDA 2FX5A 4HVTA 1XZIA 1DQYA 4X00A 3FLEA 5ALMA 1TK3A 2XUKA 4X93A 2JGIA 3UUEA 2BAGA 1GKLA 4J0JA 5LZ8A 4UBIA 2B20A 3W06A 4C87A 5ALQA 5CMLA 3AILA 3C5VA 4IQ4A 3GBSA 2OQIA 2C7BA 1AX9A 1MAAA 3FSGA 3LP5A 1WM1A 4DTCA 1KU0A 1K63A 5D3ZA 4Y9SA 3DDUA 3CN9A 2XMBA 5CW2A 1ODTC 4GEGA 3D7RA 2OCKA 1YA8A 1R1DA 2ZYSA 5EHZA 1SCKA 2C5GA 3TJMA 2VJCA 4LYDA 2CEKA 4AN1A 4Z49A 2WHPB 3FYUB 1N5MA 5E4YA 3ZV7A 4U2EA 2OGSA 1G5FA 2VJBA 2VATA 1IVYA 5DNVA 1SCQA 4BAGA 1QTRA 3AIOA 1P0IA 4GW3A 4IH9A 5CT6A 7YASA 5ALGA 1ZGBA 1XQVA
chains in the Genus database with same CATH superfamily
5FUYA 2YWXA 4JCCA 1WMAA 1WMBA 3M1YA 1CY2A 3CZCA 1A2BA 4J16C 4EA7A 5EPOA 1RCTE 3L1JA 1HTTA 4EDFA 5A4IS 3T9CA 3S4YA 2HMTA 1MAHA 1QHEA 1FUIA 3BXGA 4IV0A 1ZJJA 1TJNA 4WGFA 5BUZA 3IA7A 2QN2A 3LL4A 4PSCA 2ZULA 3TFWA 5JTTA 1CYEA 4XASA 4ARAA 5IVKA 4NOKA 1Z4IA 2Q0QA 5AVKA 4H7EA 5ENDA 1XDUA 4KAJA 1IM8A 3ICWA 3OIVA 1AKWA 5FQNA 2EQ5A 2FLVA 4MVJM 1IOLA 3S29A 1U1EA 4J0CA 5KSYA 1DNPA 1PNTA 1U65A 3ENQA 3WB1A 3HB0A 3GFQA 4CKZA 1GEEA 2ZRKA 1T9GR 3DBRB 1QCZA 4MMZB 2PXAA 5EVJA 1E9RA 3E9DA 5HRAA 1RQ7A 4OQPA 1N92A 3ICOA 5CT4A 4BEBA 2E3JA 3DB2A 3JQFA 3NBXX 3U6KA 1YK0A 1MG5A 4YH1A 2WPDA 3BQNB 4MI1A 5K8LA 4JJIA 5DLYA 5TDHA 2BUBA 2Q3DA 3HDQA 3AFGA 3LCJA 3GCWA 2XF2A 4IDNA 4A82A 1F1BA 2NVWA 4TQUS 3W2GA 2F62A 1QVRA 1L7RA 1QIIA 1RPJA 1QDLB 3PBKA 5F77A 4POAA 3VKWA 3R6TA 2Q5FA 4AW9A 1HUQA 3KUUA 3W6NA 3ZKAA 5E1OA 2FOLA 5H80A 3SVTA 4GO1A 3AJRA 1Y42X 3D3WA 4S1WA 4NMWA 4E5MA 4XWYA 2ZR0A 1BQ4A 1BE1A 4UNQA 4CPDA 5K6TA 3U61B 1KZ9A 3RFVA 2PGJA 5FA5A 3DMFA 4U5XA 4N8EA 4ZVQA 4E3WA 3ZJUA 3KFLA 3G5MA 5CDFA 5LSAA 3WV4A 1RIIA 4K6GA 2A5FA 3KEQA 2V54A 5ECDA 1HEYA 3VKFA 4GIBA 3DDOA 2R6ZA 1Y4SA 2ZSUA 1LDMA 2D1YA 1OIVA 4A2CA 4ROSA 1A5ZA 3DYBA 5CVJA 2O8EB 1E1CA 1HL7A 1QIKA 3LX6A 4Q1EA 4LI0A 2Y99A 4R54A 4ZVSA 3PD0A 3SGLA 1XCOA 3FUVA 4G4SO 4PGAA 1OQAA 3DS8A 3EEQA 3TL3A 2W2MA 5JYEA 1GNLA 5HEKA 2WVJA 2C3OA 1NNUA 1SOWA 4Q18A 1X92A 4NBTA 2P1RA 3PG5A 4MS4B 5KTYA 5IUNC 2BTQA 1SOAA 3HABA 3AL3A 3EQ7A 1B2RA 1BE0A 1Z6QA 3B5JA 3H83A 1BKDR 2BEWB 2Q4DA 4G6ZA 2VF7A 1NJ5A 4W1QA 2WJGA 5C8YA 1J2UA 2XQKA 2HQRA 1DJLA 3V6MA 1CCWA 3OIYA 4GP7A 4XQEA 1RCUA 2LUOA 2IYOA 2G1PA 5LQSA 4JEHA 4PSDA 2GPAA 4TWAA 4A2PA 1ECGA 2R1UA 5E6UA 5JI2E 2ODQA 1RP1A 1ECLA 4JLDA 3V8EA 1F8UA 4AD8A 1VXOA 4AWXA 2G36A 4CIYA 1OWLA 4UM9B 1L9XA 1RQRA 3EXIB 3PUVA 2EZ9A 1SQGA 1NE2A 3LFHA 3COSA 2P67A 2GF2A 5PGMA 1JDUA 4IOJA 4DA8A 4JNCA 3HACA 3IDOA 3RRXA 4RZHA 4FZJA 3WKAA 4BO5A 3L06A 4M6WB 2W2KB 2RHRA 4TV9B 1YQXA 2QUHA 2HJSA 2CFOA 4XEHA 3TMKA 2YWJA 4P80A 3VTFA 4RVHA 4MMXB 3FDIA 3DTYA 4CDMA 3KLOA 3G9QA 2BSAA 2CFCA 2C3UA 1MOQA 4ZOLF 2OV8A 1NVFA 3G23A 3IUQA 3R3YA 3E5NA 5DGXA 5K4GA 2WJ6A 4P3XA 5ARBA 4LXUA 3I2JA 3GXBA 2VQFB 3R7WA 2PFSA 3UT6A 3LKVA 3AU8A 2AVNA 4DE5A 1JAIA 4M9RA 1Q50A 2OORC 2ZI3A 3FPHA 3L8FA 4OI4A 3THXA 3MW8A 4QOSA 3C41J 3F3SA 2UYOA 3RIYA 5DNYB 2PUTA 2WT8A 4DV5B 2RGWA 5KQMA 3AM3A 4NFLA 2WSLA 3BAZA 4B80A 3OPYB 4BYGA 5L51A 4PHTA 4QODA 3FSEA 1Z4OA 3EQ8A 2PO7A 3OEED 3WBKA 3IPLA 1P72A 2W6QA 2XTNA 1P7PA 1YONA 4Q3AA 3B1YA 1MGPA 1V3VA 1Z8HA 1Z68A 3OUUA 3H1BA 2YJ3A 3NHZA 4WY5A 3TAHA 3WYGA 4EB6B 1HEIA 5BURA 2W58A 1VFPA 3GMSA 4LHWA 5D51S 3LHFA 1ZZGA 1Z35A 2P40A 2WWVD 5JEDA 1MQAA 1DPFA 1PFYA 3WLQA 1Y7HA 4BNTA 4OUKX 3K9QO 4Q12A 3KQNA 2LTAA 3V1NA 4NZOA 3MCTA 1CUXA 4JLVA 5DX0A 4CBVA 3AFOA 6YASA 1OGYA 1BTOA 1DUVG 1JPNA 3EDYA 4WW0A 4MPRA 3LT2A 1DKUA 4MW9A 4PX2A 4RH1A 4JWKA 3SD7A 4RD0A 3T5PA 4FQ7A 1FSPA 1JLLB 3N2GB 3DPIA 4NBRA 2FMTA 3OFNA 3C97A 1BXGA 1JPJA 2B8NA 4RIEA 1D2NA 3SEFA 2B98A 4AQ7A 2Z5LA 1OI3A 1JG2A 4BVJA 1G38A 1Q2UA 2NU6B 3ACCA 3OLVA 4NP6A 1BA2A 2YIJA 1KOGA 1YS2X 4P22A 1IHOA 1H05A 5EQTA 5HNKA 3DAPA 1LX7A 3DBRA 4BTLA 2O2CA 1QKKA 2ACKA 4QAJA 4C4PA 2WKRA 2IH2A 3GUHA 5CXXA 4RQBA 4UHHA 2D0DA 4GPEA 1FMJA 4FXOA 4KSBA 1UQRA 2X8JA 3TRKA 2FZKA 4GYYA 4MV4A 1UODA 5TGTA 4KGDA 4BZZA 4QPCA 1YB1A 3TFOA 1E3EA 4ON9A 2LR0A 2YFKA 5DCWA 4RFLA 2YV1A 4CV1A 2ZJ3A 1LPNA 3V55A 3F6EX 2A88A 5IJ9A 1WUKS 3T0IA 2NSDA 5A1JA 1D0SA 5JANA 4A36A 1KH3A 2YOHA 4P7FA 1M1YB 5IDWA 4AY2A 4G1EB 3L4BA 2AZTA 3DNFA 4I9HA 4R8KA 4ISBA 3WB0A 2H2AA 3R7WB 3MXTA 3EEBA 5I9MA 1WF6A 1YIAA 2HSZA 3UVEA 2XJ4A 1OR8A 4BX9A 3GRVA 2B37A 1ODFA 1JE0A 4UZEA 1YDEA 2OWDA 5MDHA 4HGOA 2JHGA 3B9BA 4B6FA 1PK7A 1XNGA 2WJZB 4HRYA 2IOFK 4KHZA 4YP0A 3VYRB 1DE0A 1ZHHA 3WL4A 4DCOA 2EEPA 1CHDA 2VUHB 4MWOA 4P86A 2Y6UA 3RS9A 5IHPA 1OE0A 2R7MA 1L4FA 1NHWA 2VUUA 2WY2D 3K72B 4K87A 4X0EA 5KPJA 3SFZA 4XVCA 1N25A 3F5QA 1QFMA 2YQ4A 3GAMA 2KS6A 2AJTA 2PX4A 5JXWA 4P5DA 5JCJA 3S1AB 2J3MA 4HFRA 1YVRA 3DO6A 1QGDA 3KHUA 1SWVA 1NWCA 2ISCA 4QQFA 4DLPA 5K5EA 4H31A 4A6PA 1YZGA 4C5BA 1B41A 1YMVA 2A4MA 2HKIA 2VSFA 2ZI7A 1BW9B 1X7GA 3G9XA 1DO0A 2P9HA 3R3HA 3NGXA 4EO7A 4HC4A 1UXHA 3FG9A 3AR6A 2PX8A 3IBTA 1S9HA 4OJQA 2C7OA 4IXTA 2GF9A 3ENWA 3D4IA 3KM0A 4FEYA 4ZT2A 1XV5A 3SLKA 4BGUA 4B3MB 1O94A 1YOVA 2ASVA 3ZE9A 1SA0B 2Y2VA 3FYHA 3FFTA 3QX7A 2FFQA 1P1BA 1TQ2A 4MVCA 3UK6A 4EIWA 1QRAA 4FLEA 3IHKA 1LPSA 3OKAA 5DM1A 3ZW7A 5ADVA 4DQXA 3FDXA 3ADCA 1XXLA 1GFZA 4Q1VA 4XB2A 1PYDA 1J8YF 5A04A 1CF4A 2PR7A 3TQQA 4DRXB 4K9KA 4I2NA 3OPNA 2QNRA 1OLXB 1JR4A 2Q27A 5T4FA 4DY4A 4QXQA 1PTJA 3OZVA 1DSSG 4RNCA 4ZT6A 2QTWB 4NWIA 2P9CA 1E69A 5F2EA 3L79A 4P31A 1Q1EA 3NHBA 3NRBA 4S1OA 5DHRA 2E89A 1Z7YA 4F7DA 1MG0A 1KU6A 4C4TA 4DSUA 3JZIA 3BDIA 2HBRA 3A4TA 4D4LA 4CLRA 1I2BA 2RGEA 1EFTA 3OZAA 1E92A 5E9WA 4UCFA 2D54A 3DJFA 4V0MA 3QPVA 3CCCA 5SICE 3T54A 2WU0A 2PU7A 1UQUA 3LC0A 4KDRA 3AVTA 4RD6A 5BR1A 4KE6A 3RVBA 2DHEA 1YH3A 4Y9RA 2Z3WA 4QXPA 2WIGA 3DC2A 5DB4A 1TVEA 4A1FA 2XGJA 4QTXA 1PFVA 3WGTA 3QZUA 3GAZA 1KJZA 1ZK2A 1ZKMA 3OQIB 3LZ6A 1W4BA 1X38A 2H7VA 3GA5A 1HFKA 3C6ZA 5D1HA 2BM8A 1NQUA 1QIEA 2A78A 2WA1A 2PJUA 1M2OB 3G1UA 3CG4A 3CS3A 5DCUA 5EHNA 1G8HA 3PFHA 3CLRC 1DC3A 1KYYA 1Y6QA 2BCGY 4UU1A 1I3LA 4DCVA 4DQ0A 1SQ0A 2O7NA 2W6IA 3NQ41 2WV9A 2J0UB 4QE3A 5JASA 2WMYA 2C03A 1Z2CA 4MVXA 1XMSA 1PDWA 2PMCA 4YMIA 4ZRMA 1QHXA 4U39A 1GUAA 4ZV7A 3FHCB 5L6MB 1UDWA 2YRWA 4LVNA 4Q0MA 1OLOA 3T7JA 1OMOA 1IVSA 2RHLA 1V3UA 4Q1DA 2EEZA 3NV7A 4LWQA 2ZKLA 2EG5A 3KE9A 2DSNA 3H5NA 4B45A 5F23A 4LHVA 1V47A 2G08A 1LLQA 1M34E 2GVZC 3I53A 4BMNA 3B60A 3L4SO 4EG4A 2CBZA 4RTPA 3T5CA 3TQOA 3RKSA 3WMEA 2CVPA 2WI8A 2ZUSA 3AUAA 3C6MA 2IS1A 1JHYA 4TKVA 4KQ9A 1ZRSA 1RAAA 2JFQA 2J9GA 4M9UA 1C9MA 3PC3A 3R5TA 2QAGB 3WTCA 3THYA 3OTGA 4KZPA 1XZPA 5TPWB 1U0NA 2PIDA 4QBHA 3IOEA 4INZA 1TYAE 4HNAA 2Z8XA 2CJPA 1LBTA 5J63A 3FKSA 5DW0A 1W85A 5ICCA 2FN4A 1TM1E 2XQGA 1I4TD 1Z28A 3KSZO 4IHJA 1JAZA 3R1IA 2DSTA 4KX5A 1GADO 2Q7DA 4E1VA 5L7TA 4G67A 4KFCA 4GZMA 1M6EX 2JHFA 3NAMA 4RK6A 4KE9A 5HF5A 3Q5EA 2B2CA 3RCBA 2TMKA 1KSFX 2AFHB 2VF8A 3AU9A 5IM4F 2IT1A 2D59A 3R0VA 4JD5A 1UOEA 5DN6A 1KSGA 4F04A 2MR6A 5F5LA 3FUWA 4LYJA 2X0FA 3SR0A 3BS4A 4RIHA 5LFAA 3BORA 4LC0A 3MBIA 2NWQA 4QO8A 4KMOA 1ZH8A 5LDDC 3CLUC 4X1YA 1OWPA 1TEXA 1W0JD 3HRKA 4BNJA 3C6KA 3H2BA 1ZL0A 3D8SA 3H19A 2GCOA 5GIPE 3RR2A 1JKJA 2Y4OA 4KQWA 4AULA 4LX0A 4RANA 5IBPA 1ICIA 1K3UB 4CEIB 2Q5OA 1XRNA 3SC6A 3VC3A 2ZSFA 5MFZA 1W5AA 3TVDA 2CXOA 3BZBA 4O4JA 4DSZA 2WFAA 3CINA 3FJYA 3H1GA 4KXWA 1DTEA 2VKQA 2FP4B 2P90A 4DCUA 1ETHA 1C3VA 4XFJA 2V4ZA 1S8OA 1HA3A 2B4AA 5JQGA 3ET4A 5EIXA 1Z88A 3UA4A 5DV9A 3ZNQA 3SZUA 4FCCA 1WA5A 4J1NA 4WMLA 2PGDA 2ZRIA 1EXMA 3IEKA 3MRVA 4Y2YA 3Q1LA 3STUA 4RDIA 1USVA 3PUHA 1YCHA 5JPIA 1QHFA 2X8AA 5IZCC 4R1OA 5JRJA 1D07A 2HN9A 4OQLA 3BIWA 3L7OA 4H17A 4QARA 4FB4A 1B00A 1NY5A 4L0QA 1GTVA 2W11A 1AHIA 4MCIA 1HSOA 4PQYA 3ENNA 5CBPA 2RKWA 3F6CA 3AEKB 4DFDA 2RJ3A 4TMFA 5FPTA 3NBYC 4I1PA 5JECA 1RMQA 2C0PA 2O5RA 1GGFA 4J07A 4NFHA 3CZ5A 2CYBA 3MJDA 2X8BA 3T3EA 5KX5A 4G07A 1NTRA 3VOSA 4CKCA 2FR0A 1CIPA 2JRCA 3H04A 4I55A 1DHTA 3G2IA 4WACA 4XGIA 1SVIA 4I1IA 4CCYB 1RVDA 2L0XA 4D2IA 4DGQA 2ZXUA 2QRPA 1Z6GA 3X1WA 4K5QA 5JCPA 3O1JC 3Q9UA 4HWPA 3LW8A 4TROA 4NYJR 2H9AA 1QQBA 1NUPA 3PVZA 4MYDA 2CKMA 4ESHA 3FPFA 4MHSA 1U02A 2HPHA 3PF8A 4PWZA 1ZNYA 1JDBC 2PKXA 3HXPA 4WNAB 4ZIRB 5IM4A 4K8RB 4TLAA 1FFXB 1F2UA 1OAKA 1XVAA 4IM7A 3IV6A 3DZHA 3SM3A 3CUEF 3JYHA 3ZLVA 1MLDA 5FXMA 4NK4A 1NR7A 1X0VA 5C8ZA 2VPXA 4FC7A 3OAAA 5EE1A 4EYSA 4B74A 4HTAA 1DIGA 3EUWA 4HDNB 4AJIA 1IZ8A 3FRJA 1T3LA 1CTQA 1QYXA 3WWZA 3LXUX 3ZWBA 2OV4A 1V5FA 3BCHA 3CWQA 4KH1A 5YASA 2DUJA 4JYCA 5DT2A 5LU9A 3ZE8A 2YCLA 3DLBA 2OYCA 3DR3A 2GASA 2C82A 3LWBA 4IYJA 1PYGA 1NUHA 2Q1YA 2ZRDA 3QBDA 3UWOA 2EX1A 1MB0A 2AG1A 2HL6A 1FVFA 2OHXA 2VYVA 4MVJG 5FBKA 3U4HA 3ZWMA 2LW7A 5CDTA 1WMFA 2H2HA 1VRCA 1R8JA 2ZI9A 2PRIA 1NQAO 1COZA 3BGVA 3IDAA 1PD1A 2Z6QA 3VSDA 1N57A 3VQTA 1UZNA 2EKLA 3M81A 3P52A 3F3MA 1AOXA 1I6KA 2O50A 4RC9A 5B37A 3JU3A 2LPMA 1JWBB 2ZVJA 4FDTA 1T1GA 1S89A 3BZWA 4ARBA 4E31A 2IY8A 3RABA 1W2GA 3N7UA 4DAEA 1P1RA 2R7LA 3CUVA 4H3SA 3TIFA 4QNRA 2XQFA 5ALVA 1ZJYA 2YV3A 2W6MA 3I12A 4CT4B 1D4OA 3JQ7B 4ZI5A 2BKLA 3T9BA 5IANA 2WYOA 2GTHA 2QV7A 2CXHA 3PQ2A 1M67A 3P5BA 4R68A 4U3JB 5BVGA 1STOA 3ND5A 2EBWA 3VVBA 2DWUA 3VDRA 1NV8A 5IG2A 1W46A 2BRUC 5BNWA 4F5DA 3OWHA 5CH5A 1G3MA 3HA7A 1WPXA 5KJFA 2UZ3A 2VPZA 1M33A 1QH8B 3F5DA 3ELYA 5K8VA 1GTL1 2JF0A 2QZ4A 3VH3A 3U4QA 1FTWA 1F38A 3OOSA 4WDRA 3ND7A 4OMDA 4B4UA 2G9ZA 3QJ5A 4KTVE 2EW8A 3DVLA 4PR3A 5TPZD 4O59O 1GQFA 1W34A 2QRVB 2IKQA 4P36A 4EI7A 4Z1OA 4K88A 4F7WA 3ROZA 3JQ9A 2R5FA 5CPBA 4UCXA 4IDGA 1T2NA 1QFXA 3PNKA 1XXHB 2P3LA 4RENA 5COBA 3ORRA 5BNIA 1C9KA 1FS4A 1E2KA 4LY0A 3IKVA 1DDGA 1DAKA 3KAPA 4TWRA 3F1LA 4NTZA 1ZOOA 1QAOA 1YMUA 3DGFC 3HKBB 4NMHA 2OXFA 1MB3A 4L8LA 1XAJA 4OXQA 3DR5A 2G5PA 3QOFA 4H16A 4YJHB 4BNNA 4FOSA 4CKBB 3VR5A 1IN1A 3IEIA 5E7QA 3P2YA 1IHYA 1NOIA 4IHKA 4OL9A 3IDSA 5IDVA 5DN6D 2EJWA 3LY9A 3KTAB 1T5SA 4IG9A 4KOEC 3CMMA 2AQHA 1OC2A 3SS9X 3HU3A 4O4HA 3STVA 1G2OA 4F4UA 4MPTA 3VPAA 1W76A 4KNWA 2APJA 4M88A 4QT0A 4TMYA 3ZGNA 4FGUA 4M46A 1A04A 3VMFA 1E1DA 3VR6A 2EL7A 3QUQA 4X1IA 2HZBA 3JPWA 3L1VA 4RU1A 3VTZA 1N5IA 2AR0A 1Z08A 3LGXA 1P9LA 1X19A 2PUDA 4HZIA 5EHQA 4ZQIA 1XCBA 2UYYA 4FOOA 1R4MB 2CL5A 1GPDG 2QORA 3NANA 4YV2A 5FIUA 2W0MA 4PSKA 4CLEA 1R6VA 4HUJA 3DLHA 2ZR8A 5COQA 3UG7A 5K0CA 4RVOA 4Z5XA 5C3UA 1UJ4A 4MDEA 1IN8A 3IPAA 4P92A 4CMAA 1NT4A 2VSNA 2W4MA 3M0EA 3TX2A 3GIDA 3JPYA 4UCWA 1GRCA 5IS2A 1C9EA 3T9DA 1ZD2P 1ZM7A 1ZNXA 2NYUA 2B4QA 4YIHA 1VL6A 2FSHA 1X77A 2IYVA 4LDNA 4N6OA 3WYDA 3U7GA 4IVRA 1M8PA 3BH6A 1F2VA 3I2FA 4OB8A 1X9HA 2HQOA 3E35A 3VYTB 1YTLA 5E3HA 3C3JA 2CVQA 3DH0A 3TSOA 2VLBA 1VE3A 4FD2A 3ACDA 1SUFA 4AT1A 4EZEA 1CJKC 3WRWA 5I4CA 1C9DB 3OWOA 3V7NA 1GT91 1T4GA 4AJPA 4EJSA 2GEVA 1SOMA 5KAMA 3P9ZA 5EKSA 4Z7NB 2JZNA 4J7AA 4TLCA 4DNQA 4LTMA 3ZTWA 2O8BA 1L6RA 2VQ6A 4PANA 5KX5B 1VMDA 2Z9BA 3KJQA 4GMGA 2QK4A 3Q5GA 4IJ6A 4XJXA 3X1YA 3TG2A 1ZXBA 4BU1A 5A0VA 2GD6A 2PV7A 1YS4A 3N6RA 1ECPA 1N6IA 1U8AA 1RFGE 1U3WA 1FP6A 1RHQA 2OILA 3CUSA 2F00A 4L5YA 1CZRA 1MZVA 5KVQA 3FOZA 3OD5A 3AEZA 1Y34E 1C4KA 2WTNA 3EEOA 2O2HA 1A7UA 4WLEA 2WIKA 2ZBFA 1JEYB 3R3ZA 1RMYA 3LUGA 1SKQA 1TQ6A 3H2SA 5ER9A 4BE7B 4E6PA 1MB9A 3FOEC 1D4FA 1E9EA 4CKEA 4YPVA 4MWGA 2UZ0A 3RIXA 3GJ0A 4Q9DA 5JAUA 1GLGA 3N86A 3PL5A 2DFPA 5DSZA 4C06A 1J2EA 3W3AD 2IDZA 3TX6A 3CO5A 2NU9B 3FDJA 4M86A 1LCIA 3M4JA 1XTQA 2PKWA 2O7VA 1FDRA 5U4XA 4JKYA 1U7OA 1R6AA 3SAJA 3A6KA 3KQLA 3E9RA 4BCBA 4F4FA 1P6UA 3DBLA 3OJOA 3SX2A 2PLRA 1TKRA 1NXSA 2X1HA 3HKDA 5CYOA 4HEA1 1AA9A 1VG0B 4Q7JB 2IV3A 4BRUA 5M34A 3NHPA 2FB9A 3E53A 1NMQA 2WAOA 3EG9A 1XAHA 4RH3A 1I7DA 4E94A 5JZBA 1VSQA 3FB1A 1L4MA 4EA8A 4HX5A 5C7LO 2JLYA 4JBNA 1N1EA 1KJQA 1Q44A 4WLUA 3HCOA 1G2PA 1SUAA 1II8B 5L4NA 3FNHA 4DLBA 5CP8A 3OOWA 3PSAA 1OHHD 4XCXA 3ZV4A 3PC6A 1UR5A 4NYIQ 5C1IA 2FX2A 1QJCA 5GJVC 4BPBA 3LVRE 3KQYA 3ONWA 5E4TA 2P1DA 2YWHA 3C3MA 3QH4A 1ZKDA 4N8SA 4PQGA 3ILXA 1N0VC 3G85A 2CCKA 2EV9A 1AN0A 3OCUA 3WMXA 2PL9A 4K2HA 2D0IA 4L07A 4KDEA 2IYZA 4RMIA 4TLEA 4JH0A 1EJ2A 2AWOA 2N9UA 5E3IA 1NLZA 1ULZA 4RYLA 3W5DA 5LOVF 2FVYA 3V4OA 4NNPA 1TM5E 4D7AA 1GQSA 3R5FA 4HDAA 2UUCB 2FZLA 2P2YA 1QNFA 2IHKA 4PYLA 1GGEA 4MK4A 4KR0A 2PQ2A 3JQ8B 2O8EA 2HYIC 3PXUA 1HPLA 2C2OA 4KV9A 1DCKA 1AXRA 1SGWA 3ZCRA 3ILSA 2B5WA 3DLCA 3AJAA 3QU2A 3IALA 2CNLA 2H1VA 2PJRA 1TQHA 4R8RA 2X4IA 2BEUA 4K26A 2WJPA 5FI1B 1B7GO 4DSNA 4F71A 2QTTA 1T5OA 1JJIA 2DQYA 3OBBA 2W5UA 4TTRA 1OBVA 1RIFA 4NNOA 5FYQA 4FEGA 1CPYA 2XUPA 1CULC 3SF0A 2RHGB 4UM7A 2OG2A 2H16A 3CEHA 4FM9A 1KI2A 3GNSA 2BJWA 3CF0A 1W88A 4KFRA 4C4YA 1E2GA 2IBMA 1E4EB 1GPLA 2ACEA 3LZDA 5H3HA 3AESA 1GIAA 2JH9A 4I4TA 4KDCA 3P97A 1UFKA 1PR9A 1Y5IA 4IDOA 2I3DA 2RJOA 3THOA 2CHUA 1YCGA 3A3KA 3H8VA 3LYAA 5CK4A 4CM4A 5B3JC 3EVNA 4C9BA 2ECOA 2DKOA 1MB4A 1NUAA 4ZK6A 5FPKA 4FI3F 1ESNA 2IOHA 2OK8A 4MQEA 1WDKA 2EBHX 3IQWA 2BFEA 3DUFA 3WFJA 2AW3A 4MKXA 1THGA 5LR6A 1Y7TA 2AFRA 2HTFA 3VU8A 1LS6A 4BNLA 1OWNA 3PR2B 4JN6B 3SFVA 4OQXA 2C4HA 3FYUC 2J3EA 4HEHA 5KKCA 4QICA 3TD2A 2EJUA 5LA6F 4KIUA 5DTMA 3DA8A 2NIPA 2I71A 3O8QB 2OZVA 2Z2IA 3UAOA 2NU7B 3A28A 3V7FA 1T2CA 4BZWA 5LJIA 5CAEB 1ZMBA 1WQ1R 3CNQS 1A71A 1ZYUA 4HQOA 4JT2A 4FW8A 2C59A 5HILA 4LRXA 5CT9A 3OAAD 2ZKIA 3HH8A 4PG4A 5L3SB 2VPYA 1II8A 3BOSA 4GEKA 1OYYA 1ZESA 1DX4A 1PZFA 1XK7A 1MOPA 3WC4A 1YGYA 3T1QA 1T9GS 3WGLA 1PLJA 2JCYA 1ZRMA 3PDIB 3A4IA 3FYCA 5IVIA 3SQWA 1UEJA 2V59A 1N6PA 3GGGA 3VOAA 5HHTA 4TN1A 2HC9A 2ZRAA 2IOYA 3ZTYA 1XZGA 1B42A 1BWPA 1E63A 3C1OA 1XTUA 1YR6A 1PG2A 1QZTA 2GVNA 4XE5A 3PC2A 1EH5A 1RRKA 3MSXA 3IHLA 3WNVA 4FIZA 3GFOA 1CUDA 2VZEA 3KR9A 4UMEA 3M1IA 1ZFNA 2ONKA 5CBKA 4UOQA 4E1BA 1N6NA 2AEEA 4RLSA 1Z38A 1YC5A 2BM9A 2CCGA 3H5WA 2VHEA 5EMLA 3TLGA 3M6LA 3BX1A 4DUGD 2FXIA 2ZB2A 3CKLA 3H97A 3DE5X 5JIBA 4C4ZA 1G9TA 4D92A 1OT3A 5TT1A 3Q40A 1L8LA 2XVYA 1US8B 4L85A 3F98A 2VBGA 4N9QA 3TUIC 2FK8A 1GFSA 4IEEA 3UJ7A 3RRBA 4HNSA 5J5AA 1AB5A 2OLJA 2VKTA 2BFEB 2BC9A 2DBZA 1U0FA 2QTGA 3L2OB 3E7PA 3VDQA 4WECA 1A9QA 2FRXA 4QU0A 5BW5A 2JIMA 4PICA 1TDJA 3ADKA 3UNXA 2F1IA 8ADHA 3H1PA 3AETA 1RKXA 5KOJA 3UMRA 2RDMA 4G5HA 4PW0A 3LVBA 5JE8A 3DDHA 3QPUA 5FNVB 5A7HA 4ONEA 1XTSA 2YTZA 4UZSA 4MB2A 2WU4A 4YXWD 1KI7A 1RC8A 1Z4LA 4O0MA 4I0WB 4ZJYA 4MW5A 5A4AA 3MIZA 5DH9A 1DG3A 3BTVA 4J2TA 1C0PA 1EBFA 1KC1A 1HLGA 3EC7A 3Q8WA 3SYMA 1D2GA 5I7FA 1EYZA 4WL0A 1JVSA 3AVOA 3TI9A 3FKSD 4L5AA 2Z5GA 3UV7A 3PHJA 4AMGA 2HW8A 4E32A 2HBQA 4N3NA 4CDNA 4PGGA 2NSYA 2NZ8A 4XR4A 3O26A 1UBNA 3ABRB 1S2DA 3R76A 3ZY3A 4YAUA 4FNGA 2O3RA 1XDWA 3AZPA 4GZ5A 2DUUA 1W1IA 2AT1A 3JYOA 2P3OA 4DM7A 2ZRQA 5J1SB 1BJRE 1I4WA 2G4LA 2AOUB 3FCYA 2LCQA 1U8CB 2FDCA 2B82A 2HZ7A 4HCJA 4EL0A 1HMPA 2C92A 2JAWA 2WF8A 3CU5A 4L22A 3I76A 1EXNA 3JZDA 3LSYA 5A0FA 5LZ5A 4DMRA 3N74A 1FQWA 3AUUA 3HYRA 4CG0A 3N2YA 4R1NA 4Z7JA 4F5YA 4ZMBA 4QHSA 5HGJA 2WZBA 4M7PA 2O3QA 4RM2A 4KAAA 5AM0A 2JB9A 1Q83A 4ZICA 5LZ4A 1JP7A 4IX1A 3TZLA 1P1KA 4RLQA 1RHUA 3OJXA 1MTZA 2VP0A 2Y1CA 4KNYA 1W36B 3PWZA 2JK0A 5ESWA 3KUXA 4GQIA 2X8LA 4HDKA 3OI7A 1SKYB 3AT1A 1ZN7A 1ZQ9A 4KK4A 4MQ5A 3BMNA 4V1CA 3CUUA 4G01B 3RC7A 5HQ3B 2VT7A 5G0SA 4II3A 4N5IX 1BFDA 1G1AA 2UXCB 3FVTA 3HCCA 2GHTA 4G1UC 1OXTA 3GPIA 4NCHA 4RIGA 5JATA 1FQJA 3GMDA 3SEZA 5LVAA 4Z53A 3FN4A 4MVWA 1HE4A 5FOUA 1KI4A 3L6EA 3C8HA 3T7SA 2VUTA 1IRXA 1GDDA 3DD1A 5IBRA 5J40A 4N0EA 2CLOB 3RSFA 4BMDA 3Q7PA 2IHJA 3EVCA 5KZMB 1CBUA 1SZJG 1U99A 2MYUA 2PUVA 3OIWA 3Q9LA 2C42A 5T5QA 1QX3A 4WBNB 1PNQA 1OFHA 1R6UA 2WSYB 2XQJA 3CPHA 3GJQA 1ZSNA 4LS3A 4RTLA 1RBZA 3W5CA 1QUFA 5T3UA 1RI1A 3HC7A 2H9YA 3OH8A 4LF4B 5JJKA 4PX3A 5EP2A 2COKA 2QTVA 3DXZA 3AUKA 4CL2A 1RJEA 1XJCA 2C4NA 5TMPA 4HQ0A 4UFNA 4N5DA 4BKOA 1LWOA 2GPSA 4TXNA 1R0LA 1XHLA 1XX6A 1JAHA 3W7VA 1ZM2A 1JDTA 1MFZA 2X6RA 1IOWA 1HRDA 1WW8A 1XA3A 1S8NA 2FZCA 4YJGB 1YUBA 2QD3A 1VKHA 3LT4A 4L72A 4N7BA 5DXJA 3AKEA 1TUEA 4GGOA 1HM5A 4RACA 4RK5A 1H8HA 1KE1A 3UB4A 4EG7A 1V7CA 1QH0A 1LQTA 2P9QA 1L4YA 1RD4A 1SIBE 3B2QA 3UMBA 2IXGA 5J5VA 1T0IA 1RWKA 4CQMB 2R8RA 3PD1A 5F76A 5AJWA 1A9YA 2YWRA 3H7IA 4ZYUA 1Z63A 4XGQA 5JAOA 1GGNA 2Q9CA 3I1FA 1A98A 3BGIA 4S2UA 4X6YA 4P83A 1YR7A 1NBWB 1VDMA 3C6XA 3EIWA 2P5UA 4U63A 5DYWA 4QM7A 2DRIA 4QUDA 3I9NA 1Z8DA 3PGLA 2J41A 2J9XB 1JX6A 2QLTA 4XX0B 4QM6A 4UMFA 2JFUA 4C05A 2VDLB 3E9NA 4YMSA 1Z8FA 4S24A 5ITZB 1ABBA 1JR6A 4HNHA 1GV0A 4UAJA 5C5DA 2BHTA 2BH9A 1Z2EA 5F1OA 2WRZA 4YR7A 3K9BA 1Q77A 5FTMA 1UJBA 3KYJB 2QIOA 1JEJA 2GN4A 3ODGA 2OTCA 4A3SA 2ANCA 5H70A 4MGIR 1JG3A 1KNXA 1P2SA 5K3FA 1B1AA 2AB0A 4HLNA 4B3RB 1XLVA 2Y0DA 3U37A 2NQ8A 1SU8A 3OQMA 1C14A 3LF1A 3VJRA 1WD7A 1MVOA 3K35A 1UM8A 3OLZA 4WK4B 3U16A 4KREA 1G7RA 4WZAB 3DBHA 3NT2A 3UYLA 1LC3A 3OC0A 1REQB 3BWXA 4FX2A 4GOOD 5FRDA 3VX4A 4BLVA 4TRMA 5ITWA 3S2IA 2DHRA 5IAJA 2QDKA 1JUDA 3G5UA 1IG3A 2X6TA 3VR2A 4YT4A 5L3SA 1E4YA 1RDFA 2XMRA 4OBEA 3IRVA 1S3GA 2QRVA 4AL4A 1LUAA 2HU7A 1UK7A 2JFFA 5HF6A 2JDID 1QNLA 3U7JA 3WGYA 1TNDA 4FP9A 3AGPA 4D5EA 3A6GA 2BGTA 4DR7B 3GGDA 3P9KA 2BEKA 1JJBA 1CUVA 3EWSA 1DX9A 2RARA 2XY4A 4IIVA 1M0TA 3BG5A 4LOIA 4M1OA 3QF4B 4QAQA 5K1ZA 3URMA 1RHMA 2AFIB 4JLUA 1NVVQ 1SVNA 4Z4HA 4MVJA 3UGTA 2QX4A 3AKYA 1HZZC 4EL5A 5EA2A 1KWKA 3O2JA 1JHQA 2XXAA 1V95A 1W1WA 1C7ZA 4UMDA 3MBKA 5CYPA 5LLDA 3AFMA 3WP1B 1GA6A 3ONVA 2PYIA 4IKPA 3K1AA 1K2WA 4OM7A 2I9KA 2AFIA 4LMBA 5HF9A 1GGJA 5I9NA 1M6VA 4JXJA 4DCSA 3A4LA 1GYQA 1L7VC 2P7HA 1RMTA 1U81A 4X71A 4AZ3B 1GSOA 2PRKA 3KCQA 4O4LA 3NFYA 3VPXA 3WMWA 4Y98A 3VR4A 1G291 4QUBA 3BFPA 2BGNA 4DPKA 2GZSA 4MUAA 3NTUA 4QWMA 4MP8A 1HZJA 3T1OA 3IA2A 1RJFA 3N2KA 1TCCA 1Y98A 3FPAA 3T7KA 2B30A 3UWDA 4AMYA 4LDJA 1W59A 1K5DA 4HI0E 1A2KC 1EE2A 2G5TA 2VSYA 3L7KA 3W2HA 8OHMA 3EZ9A 2H1OA 3KV3O 5B53A 1G8SA 2B1IA 2AX4A 3G0BA 2RHCA 4QASA 2DMRA 1VYUA 1P4SA 2DPMA 5LQUA 3LBHA 4IIXA 4ZQHA 2GYWA 1A9ZA 1PJ3A 3Q3IA 5AHKA 3TPFA 2JG3A 4NU6A 1CDEA 5JVDA 3BE8A 4GZ3A 1PT9A 4KPYA 1I14A 2C5FA 3EJWA 4KLZA 5G4KA 3VYVA 3T3HA 1BWRA 4I46A 2GAAA 3D3NA 3K6RA 1EJ0A 1H9BA 2BISA 2XUAA 3QI7A 4MQFB 1AE1A 3HJRA 1GP2A 2CSXA 3BL8A 3V8MA 2ONYA 3OOHA 1NVBA 3LKZA 1K97A 1KXJA 1J97A 4D5GA 1W5EA 3D1JA 1UP4A 3IS3A 1XN1A 3TIIA 4NLLA 1JDVA 1RLUA 2JAXA 2UZ1B 1MXFA 4YONB 4WX2B 3C16C 5BMOA 2UUBB 1VJ5A 3NJ4A 1Z73A 5JNWA 1UAAA 1Y4DE 4OB7A 3OVMA 4PWYA 3TIGA 3HR8A 2GWRA 3KLMX 3IC5A 2O5CA 4PHFA 1COWD 2N47A 1AQ6A 1I9GA 2IEBA 2CMKA 3KYDA 1UC9A 1FP2A 2QG4A 1Y0BA 2TMGA 3MK31 2R7KA 4HP8A 4ILKA 3VAYA 1EQAA 4AJOA 2YZKA 1LVGA 3QG1A 3TVTA 2WOOA 4IP0A 4PBSA 3TM4A 4MKIA 3F8SA 4C21A 4KNVA 5IABA 4HADA 1MHTA 2JJ2A 4C03A 3HB9A 1EWRA 1FDIA 2ZZKA 1F6BA 4EW2A 2GZMA 1ORVA 2BW0A 4MV5A 1DO8A 3I4LA 1P4RA 1DAIA 2FZWA 1WVIA 5EVCA 4Q9HA 4ZAVA 1F3LA 1BKSB 3AW8A 3BXPA 3D3JA 1JYSA 4M8IA 2PXHA 4OQ4A 5L3ZA 3WLPA 3ZU6A 2XDQB 1JH9A 2OO5C 2D1TA 2IIBA 3FPKA 1Y6ZA 2ODBA 3JD1A 2ZR9A 3WISA 2J30A 5JHGB 4OAQA 1T1SA 4HFNA 5U1PA 2HBZA 2Q8QA 2W2QA 5K4AA 2QR2A 1JKXA 3BFJA 2QAIA 3G82C 4M1QA 4AY3A 1QRUA 2VH2A 2GBIA 3HN2A 2X9NA 1TLTA 4XQCA 1Y5NA 2Y3IA 2FP4A 4L15A 4DLRA 4EARA 3OPYA 3W7AA 1S01A 2EZUA 1BE8A 2V0NA 2B2XA 2GGSA 2MMCA 2DETA 1YRBA 4FYYA 4HQKA 1ZOIA 1LI5A 2QAGC 5F73A 2QE7A 3UK7A 4JI4B 2GT1A 4EP1A 4R0NA 4WEOA 5ALFA 2K2WA 3GRCA 1SQ5A 4MWEA 3UT5A 3ZHUA 5J43A 2NO5A 2Z4SA 5D3QA 1ST3A 2UUPA 2XUZA 4M83A 5B12A 4AY6A 3NI2A 1V5GA 5AKKA 2O2EA 4ATNA 4YMVA 3ZZMA 4F92B 4PLZA 1E1LA 1RXEA 1X9IA 2MSNA 3H4IA 5LA6A 1MP0A 2TS1A 4GX2A 4B3HA 3LMKA 2VRNA 3U3DA 4DRZA 1HX7A 1KQNA 1BDJA 3CUKA 3R7SA 4D9MA 1PFKA 3EVGA 3IGFA 4S1TA 4BX0A 1JTFA 3IUPA 3T7CA 2XSZA 2FG5A 5LMZA 4D80A 2GRAA 2OO7A 4UM8B 4EUEA 4JVSB 4NPAA 2YBDA 5EZYF 1E1QD 3HA3A 5FOQA 3GLFB 4KE7A 2ZWIA 1SBNE 4ZJPA 1XE3A 5F3RA 1QV6A 4V3BA 3VVMA 5K0BA 5JDIA 2G0NA 1RQNA 1P4GA 1RWWA 2PLFA 3DE7X 4HDOB 1SAYA 1TIBA 2A4KA 2J7PA 3NEJA 4N03A 4UOEA 1FX0B 3ETEA 4BLQA 2V55B 4J9UE 4DZTA 2C78A 1GYRA 3JVIA 3UH1A 2Q2NA 3OJLA 1JQ3A 1L5ZA 3TNLA 2F8LA 4OXXA 2PA0A 4KN8A 5HR5A 4HWRA 1Z25A 3ZGYA 4BNDA 2FEWB 1CJCA 5CB4A 1YJ5A 5FP0A 1P5RA 5DXAA 5HKKD 1SCUB 2I6SA 2WLTA 5TGDA 3WQHA 1SUPA 2UVQA 1FFBA 2QX7A 3DDNA 4Q4JB 5K05A 3LUDA 3EFHA 1TT5A 3H3XA 4YHBA 2Y77A 5C51B 4MRPA 4CJXA 4N65A 4CR8A 3BD8A 3VU9A 1OX5A 1PGJA 1GLVA 1XEAA 1D1QA 2NP6A 4WZ6A 2EJVA 4IOMA 3JVVA 1UKZA 3EA5A 4MUGA 4BZQA 1JQLB 4O2RA 3AF1A 3RUHA 1B76A 1X0XA 1VGQA 4BLRA 4YTEA 3QRWA 2IX3A 6ADHA 1D8AA 1DC6A 2XNJA 4FYVA 1SEPA 2PTHA 4RZIA 1WBDA 1CDZA 2PAAA 3C39A 1ZX1A 4F86A 2NGRA 2E4AA 1J9GA 3HKBA 3PFCA 1P2DA 1G98A 3OFVA 5MN4A 1T2AA 1AS2A 1NW9B 3KKMA 4QLBA 1CJMA 4Y2UA 3DFIA 4JNKA 4Y2RA 1LLDA 2Q0SA 4MI3A 4RPJA 4XQGA 1D0VA 1TJ3A 1C7RA 2QGNA 4EZIA 1VLJA 4IDCA 5EZ5A 4LXGA 1DOAA 2XOEA 3C4JA 4OGKA 2JBAA 2I7XA 5B3LA 1HYHA 5KJEA 2NUTA 2ECFA 2V6JA 2XUIA 5ALIA 4XRGA 4B3DA 4QATA 1EJ6A 2RHTA 1C29B 1NXQA 1DQRA 4C4XA 5FBZA 5J2UF 3AHEA 3OLCX 3N75A 2VUSA 3D3WB 3IE0A 3NJRA 1NBMD 2ZRCA 1Z0SA 3GB9A 4CRWB 5EL0A 4X91A 3FDZB 4KQIA 5KYTA 4H4EA 3IT0A 4PLPA 4YPFA 4A03A 2ZZNA 3HKCB 2VYVD 5EWMA 3HJAA 4BCDA 5E1MA 4CG1A 1MH9A 2ZT5A 3B1VA 2VAMA 2PWPA 3HZOA 3S5UA 2XUDA 4HT3B 1PHPA 1WMDA 4GKAA 5JD3A 1Q0HA 3CH5A 1R15A 3FI9A 2YKGA 4JJZA 2IHTA 2PEYA 4BQFA 4DLKA 2X7JA 1JEQA 3QX8A 2B34A 4QNMA 1V5EA 2G07A 2FMFA 3EPRA 4JUAA 4JZYA 4LECA 3N28A 4TWBA 3RUCA 2JCXA 1F4PA 3CYFA 3UKDA 4CQMD 4ZI7A 3RC8A 1FFYA 1Q0RA 1E7SA 2OA0A 4M9SA 4NBLA 3H8WA 1WMSA 4MCJA 3KZCA 3H8SA 2PDAA 2UKDA 3GVCA 3FCXA 5I48A 2FSIA 1FB5A 1VKRA 4TQAA 3I8XA 1Y5LA 1ZMXA 3B85A 3GDFA 3IXLA 5I3CA 3BSYA 2CWWA 2FF7A 4IJWA 5EUCA 3Q8LA 4YGXB 2Z2ZA 1QQTA 1C30A 5TPZA 4DXDA 1DBRA 1Q12A 3MTGA 5FUQA 4NC9A 3K32A 3WSTA 3NVKI 4XYMA 3V3TA 5CT5A 4F93B 1V7ZA 2QPAA 5IFLA 1XQ1A 2YC4C 3LPCA 2GBCA 2R8PA 1XDSA 1SK9A 3M2TA 4IMJB 1EFUA 1O2DA 1Y1RA 2VZ8A 2KM1A 4A8HA 1J5PA 1RWQA 1VQ1A 4I4TB 1L0BA 3GUCA 1VRWA 1JG4A 2G7ZA 3HE3A 1YR3A 2BMFA 3FIJA 4JI1B 4BN5A 1IN5A 1K6IA 4C0JA 3GJ4A 1V8OA 3D4BA 4OU4A 4IUBS 1RVV1 2R8YA 5CT8A 3KHKA 4CLXA 4MIYA 3QEAZ 1AKVA 3NJ8A 1XKQA 2RAVA 2VDWB 2OXTA 5BR4A 4TT3D 5EUQB 1GGHA 2YW2A 1SBHA 3FMPB 2O2DA 2RHWA 2XEXA 3DTTA 3H4MA 4OXYA 3QGMA 5CA0A 3IULA 2M1ZA 2QG6A 2ZXEA 3GBPA 4JK3A 4O8ZA 4D0GA 3K0AA 5CB8A 3FBWA 4M0EA 2CNWD 3PNBA 4YMTA 3FF1A 2XVXA 4HYTA 1TK9A 1ZEJA 1JHXA 3S1AA 1RKBA 5HCIA 3KQMA 3Q98A 4IV8A 1H1TA 4RLFA 3VDMA 2PUBA 1DKMA 1HQKA 1W8IA 3F2IA 3P9XA 1GPH1 4BY9E 2YVUA 3CUWA 3RS8A 3KWMA 16PKA 1NGSA 1H65A 1W4ZA 2I3AA 2WICA 3CT4A 1V37A 3L4BC 4Q00A 1NYRA 2H4WA 3T15A 1WZCA 2WJ3A 3CVWA 1SQFA 3AERA 3PJGA 4CEHA 3QY0A 2H0QA 1I1HA 1E1QA 4IDDA 5B36A 3KYBA 1XAIA 3PPXA 1HT0A 1P5HA 1T2UA 2RBGA 4E5YA 2QN9A 2C9CA 5DNAA 4C1NA 3H6HA 3W1EA 1D3AA 4QD3A 3TOZA 4URVR 4RTSA 2JAUA 1T91A 3IHWA 3TD6A 2Q5HA 2X4GA 2ADOA 3U7QA 3RSSA 3VR4H 5GAJA 1XD8A 2RB4A 1RR6A 1Y1QA 1Z0JA 3NIFB 4G26A 2I03A 5ALLA 4UBNA 4C6TB 4A16A 3I34X 2Y0CA 1QONA 3MF4A 3NP9A 4KV7A 1L3IA 3VX3A 1H66A 4IWYA 5GP1A 1IN4A 4NARA 4B76A 2ECPA 5JJBA 3QF7A 1IBKB 5BO5A 4TN5A 5F7JA 3OBIA 3UAVA 4YPOA 2Z98A 3LTNC 1N2GA 5EIOA 4XD7A 3EZFA 1SBCA 4II2A 3SP1A 3V1TC 1D0IA 1JKJB 4MDHA 4ITRC 5IEBA 2J0SA 2V5AA 3O0DA 121PA 2CUZA 3FHTA 4DR3B 3R09A 2A3RA 3GH1A 3WL7A 3UJHA 2FY8A 2GS9A 1VPWA 1V3QE 5D5HA 2OHHA 3EXHA 3LIPA 1XNJA 3I2IA 4D3FA 1IWOA 5F98A 3IE2A 1P4HA 2JJMA 2NU6A 2DH6A 1G8GA 5CFNA 2A7XA 4Y8VA 3ZHCA 1FFHA 4NABA 4XM2A 3L0SA 2Q3BA 3WZ2A 4ALKA 1RACA 5KUTA 3WAGA 3N5KA 1Y63A 3NDPA 3FFXA 3DMRA 3OTHA 4MEAA 3HBJA 1IH8A 2R7AA 2G67A 1QVVA 3OZDA 3G7UA 2ZWPA 2NO6A 3G0DA 5TQJA 5IZCA 1RRMA 1ZN8A 3E27A 4P34A 1YZLA 4DYDA 1ZJ4A 1TTPB 3TTYA 1JT9A 4BEVA 3T1YB 1AU9A 1ZMTA 3CLTC 3GRZA 2QDXA 2K6GA 1OXUA 1O95D 1M75A 3LVQE 2GA8A 2C8VA 2VWPA 5A3RA 3COJA 1NKTA 1I2DA 3NH6A 3WO1A 3FX2A 3VUFA 1OBFO 5CEEA 5AJYA 4YJFA 1KDPA 4F4CA 1THZA 5A9TA 5I8ZA 2JVJA 4RPKA 3WYBA 2X4LA 2VNKA 3SJZA 4FFRA 1ZJWA 2ZE6A 3INYA 1U2GC 2NU7A 1XZQA 3ZWNA 2I6GA 2HLHA 2C2WA 2R79A 4EX7A 4KZKA 5FR2A 1UXGA 2IKSA 3SJCA 5FJJA 1YB5A 3LQKA 1Y9JA 5BYBA 1IUKA 2SECE 1RWVA 2MSWA 3QUTA 5H4HA 3I05A 3E3OA 1AMUA 1VA5A 5A4KA 3D8RA 1UWVA 1HG1A 4TXLA 5B1SA 3ER8A 1HOXA 4OFBA 5LC1A 3OX1A 3TZCA 5TLSA 2WUEA 3NYIA 3HWX1 2WB4A 3HDHA 4K46A 3SJBA 3HSSA 1YR2A 3NC1C 2F4VB 4R1SA 2NX2A 1QIDA 2BMDA 4MIOA 4CVNA 4I5FA 1G20A 5DEIA 3SSMA 1KMHB 5TJ9A 4MJ3A 5JVDF 4GZ6A 1LSJA 1BH2A 1H2RS 2C9DA 3ZY6A 1E5LA 2WDPA 5AW6A 1KQFA 3FHOA 4U6NA 5BRJA 1EFAA 4ARCA 3PU6A 2EFEB 1KZ6A 2GTIA 3G2PA 4MI6A 3MTAA 1Y4AE 1UBKS 2HMWA 4RD4A 5SZKB 5B6JA 2CCJA 4HUQB 1UUFA 5DOVA 4HNAB 1FDOA 1EVLA 1WP4A 2I80A 3NAQA 3PGJA 3EN0A 1G41A 3HJGA 4N82A 1F2DA 2OV1A 1J7KA 4X1OA 1CERA 1FU7A 2FFJA 4IVNA 5JHHB 3ZGZA 4YMWA 4Q34A 2ZRLA 1TCAA 5HTKA 3AGQA 2L69A 1D5WA 1QZ3A 2WIJA 4P9NA 5EJAA 3VTKA 1W8DA 4TT8A 5K51A 3ZWDA 2SKEA 3HUUA 2R6DA 1IJFA 2WSSA 3AL2A 3QWAA 5HKLA 1HT3A 4HRXA 1XZCA 1F1JA 4L9WA 1HLFA 4TPKA 1Z15A 4R9RA 1Y4ZA 4I66A 2HJWA 3UUFA 3VNAA 1N2SA 3COWA 3LQRA 1S6YA 3DPSA 2QTCA 1PJAA 4B87A 5HRUA 3NX4A 4HB4A 4ZCQA 3WGKA 1IZ9A 1R37A 1AUVA 2RAPA 1PEAA 2IIQA 3FA2A 3C1UA 1PSZA 3CIFA 1P7VA 1ZVVA 1CRQA 4FDMA 3O93A 5CIWA 4BNXA 4Y3UA 2H1LA 5KU1A 1L5HB 3E9QA 4P4SA 3P9IA 1K4YA 4MZXA 3IIJA 3UOAB 4MUIA 3MYYA 4TV8F 1R88A 3AW9A 3PKZA 1FC0A 2MINA 3A2NA 4W9RA 2XMSA 4PN3A 1AQJA 5J3JA 3N2ZB 2ZAMA 1M1UA 4GNKA 4CM9D 2EZTA 4O4IF 5P21A 1P29A 1W29A 4U6QA 2PUCA 2ZRGA 2RBEA 1Z6AA 2ZS8A 4DARA 4QG3A 1LS1A 4NBSA 2JS7A 3Q6IA 3GG9A 1IEQA 5AVUA 3TLXA 3GLIA 4XYGA 2F3PA 1GEGA 4RF3A 5IMBA 4EAQA 2J6IA 4GSLA 4MS1B 2FW6A 1YI1A 3ETJA 3KQVA 1ZUD1 1T1EA 3KT3A 3V1KA 1V1JA 3U40A 2NG1A 3CN7A 2PUJA 3RHZA 4AJJA 3ML1A 2HHCA 3SXPA 2NV2B 1E79D 3QU5A 4HY3A 3U48A 4KMRA 1OBCA 1EBUA 5AKEA 2HRZA 4M38A 4ALNA 3FBGA 1A8UA 2F4NA 9GPBA 3QUCA 5J4LA 3LS2A 3UJCA 1IIBA 2V9ZA 2X5NA 1AKQA 2AJ8A 2Z8ZA 4JL5A 4OI2A 4M36A 1NVMB 1OVMA 3Q11A 4DLAA 4ABTA 2I9PA 4MDYA 3T4PA 5C4IA 4URHA 2K4MA 1FLDA 4RNDB 821PA 3B6IA 3SHWA 5I8WA 4MYCA 3JX9A 4BPRA 1K98A 1LV7A 3OE4A 3PRKE 4JYBA 2OGTA 5CXQA 3EEIA 1KYQA 1Z6XA 3AY6A 2VEDA 1QX4A 3E15A 2BBOA 3K5IA 3QKUA 4R01A 4IIFA 4MA4A 3MAAC 2ZTHA 3BXXA 2OEPA 3FCOA 1LNSA 1ONSA 4MPPA 4NIMA 2YIMA 4TXMA 3MOGA 4FW9A 4EPYA 2I2AA 4HPXB 3GW8A 1XTKA 2OZLB 1E2LA 3CCFA 3JYLA 3EVEA 3A3NA 3UYKA 4TMTA 4UZFA 5AK5A 4DVGA 5DX1A 2XF8A 2DY1A 2VBIA 3KT8A 4MZDA 4JXZA 3GJ3A 4EHNA 1ZRHA 4OFXA 4G5OA 3NG1A 4E08A 3JASA 1OH8A 2OV6A 3S2ZA 2ODTX 3TD9A 1RE0A 3AF0A 3WL5A 1G3UA 4N6NA 5C0OE 2UDPA 3O8BA 4K6MA 3ZU3A 1L7NA 4PAWA 4COKA 1SXJD 3WYCA 3QA9A 4UTVA 1YHYA 2B8JA 3ABQB 2XCTB 1EVYA 4WLNA 2XLBA 1H0HA 1TF7A 2QW8A 1RHKA 3ASYA 2C5SA 1F0PA 3OE7A 1VYHA 3TE6A 4BNIA 1FNSA 4X60A 4YRNA 2FPSA 3GNLA 3G88A 4UAGA 1EZ1A 4CU5A 1XVLA 3WLFA 4KK3A 5BSGA 2WUGA 4JXXA 2W2XA 4Z0PA 2ZSDA 4RJKA 1CZUA 2ZJBA 3F74A 1QC5B 4TL6A 3IAM1 4TYMA 4B75A 1KARA 5DNUA 3GFTA 4E88A 1OHHA 3OJCA 4UVIA 4XLTA 5E0OA 3LYUA 4J49A 1N2HA 5G3YA 3SBEA 1OYOA 4LNUB 4F96A 5CG1A 2F1RA 3VR1A 2DFTA 1R7RA 2JI9A 2YR0A 2Q2OA 1OX6A 1RYEA 3PHLA 1G5RA 1N6KA 2X9VA 4DQUA 5F78A 3NXKA 3ESAA 2QTRA 4BQSA 5KTPA 1TADA 3ZOKA 1U9CA 1QCCA 2VT3A 4CMEA 5T8KC 2C3PA 4PC2A 3O0TA 5C18A 4DMMA 1AMOA 3AY3A 4Z1MA 1R74A 4NEQA 2I3ZA 2XIQA 1KYXA 2H5JA 1KH1A 3F7TA 3LDFA 4RHCA 3R24A 1YB2A 1X7ZA 2ALJA 5AI8A 3RYFA 3OKPA 1LF5A 3USCS 3F6PA 4IMPA 2YC2C 1QM5A 1B8OA 3GR6A 3G5AA 1TM4E 3PXAA 4NE2A 4S0XA 4WZZA 3OEEA 2XUGA 1I3KA 1UXOA 2H54A 1SKUA 1XVIA 2J7KA 1ZWLA 3BWVA 2QD5A 1OB5A 2ZRJA 1ZC4A 3ZE2B 3VC7A 1GPMA 1U6KA 1K8XB 5K6RA 5FNVA 1YZHA 2R1TA 4ZJUA 2C58A 3R44A 4IY1A 4Y6PA 1YF3A 1DWUA 4R1QA 4CKWA 5FLXA 3P0HA 4HLQB 2FPIA 2GJ8A 1VFNA 4I1UA 3MS4A 1BQEA 3G8CA 3T61A 3F7OA 2EDAA 2V65A 1DIOB 5B30A 3FNGA 4X90A 5AICA 1CS0A 1QOZA 1CQZA 2MYNA 4UTPA 6ABPA 4DCGA 4ERXA 2HGZA 1IEVA 1GPKA 2DH5A 3CVOA 3ZWKA 4AUMA 4CODB 2QYSA 3T06B 1AT1A 1LJ8A 1PGQA 1B2LA 1SULA 4ZQCB 1M34B 5TB5A 3H84A 2FPKA 3WGNA 3ZHZA 1YKSA 3SPXA 3AG5A 1F7UA 1YS9A 4FZVA 3IIMA 4MVJI 2E6UX 4KP7A 4JI2B 1PVDA 4IS2A 3WNDA 1CQPA 1SJ9A 4OOFA 3HYLA 4LZOA 4GKBA 5AW8A 2VFAA 5AI6A 4X63A 4O33A 3R3VA 1QO0A 4K9PA 1JEQB 4IJVA 2CC2A 3VHQA 4HLUA 3RSZA 1GOTA 2PWYA 2BGGA 3HY6A 3IJ5A 5IKPA 4BOYA 5AI4A 5ICGA 2WSBA 1DKRA 1HDIA 3DZ8A 1ZJ5A 4KI7A 3NAGA 1OH5A 4OLAA 2GK7A 3K15A 4QPNA 2PLWA 4FFSA 4LY9A 4QLOA 5F33A 2Q1SA 4RK7A 1UFVA 1U31A 3NHAA 5H02A 5EYPA 4EQ6A 3X1ZA 5JZMA 2NV6A 1UC5B 2JFBA 3DEAA 4HDSA 2QRQA 4LXIA 4M37A 4PZYA 4CUJA 5CA1F 4U4AA 1ZI8A 1KEWA 3WXMA 4D4MA 3R20A 1VLVA 3TG8A 1PYOA 1V9SA 4RKQA 3KOMA 2J0QA 2R6GA 5KTMA 4NZYA 4ZIRA 3MJVA 3HV2A 3ME5A 3NHSA 3FFAA 3FSGD 4M1ZA 2Y92A 1QGUA 1HYQA 1LTQA 1UBUS 3AZQA 4R2KA 2DR2A 1YZUA 3UJ6A 2XAAA 5E6RB 4DQKA 1OLSB 1KNQA 4AJ4A 2Y9MB 2J6BA 3WLTA 4LOKA 2Z2KA 4K9LA 1T35A 3RS7A 3B1FA 4ZRNA 2C1EA 2IDMA 2X1LA 4JA0A 5F7OA 3RU3A 2GUGA 1QWOA 3E6AA 4YCSA 4HWOA 5JRDS 4TM8A 4K0RA 4ACAA 1OH6A 3K9FC 2BOVA 2CDNA 3I62A 4WTOA 2XKBA 3C45A 3Q1KA 5IXJA 4HNQA 2YZNA 3SIWA 3P0RA 1Y3FE 2VDWA 4JJKA 3CW2A 4NBNA 3HU2A 4ZQGA 3CJRA 1F4LA 1E6MA 5BMVB 3LQ4A 3A8TA 3G2OA 3GJZA 4EG8A 4QG7A 3INNA 3RUPA 4JELA 3KCNA 4DG9A 1UZUA 5CVEA 3TJZA 4TLLB 1JR2A 3ETGA 4UJ3A 5CR9A 421PA 2AC4A 2VOEA 3IPYA 1EBBA 1EMDA 3N7AA 1XL0A 2PX3A 4HX9A 1YOVB 4Q82A 2EFHB 4G8CA 5AKYA 5HFNA 5JNRA 4D9IA 1PVOA 2GJAA 5JS1A 5LLTA 1JYFA 4AIIA 1JEEA 1YQTA 3D7LA 4RM3A 1NFRA 4O4JB 4XEUA 4Y18A 4LW8A 2WJVA 5DHUA 4MS4A 3PNYA 3RTCA 4YMHA 5GOTA 1ZM4A 2IHYA 1U7WA 4E0BA 4Q3OA 2O05A 2AN9A 1FJGB 2Q4TA 1LZLA 2HEGA 3IUSA 1P9WA 4RV9A 4YUAA 1VA4A 1ISRA 4FT4A 3FLMA 4ZOEA 3QUAA 3S0JA 5THXA 2Z09A 3E7FA 3R3UA 2FWBA 3JR3A 2YIVX 5CM2Z 3KOUA 4HUQA 3R7LA 4Y2JA 4M54A 4Q21A 1GL3A 2CBXA 4IXDA 4JP2A 4LC9A 4YCJA 2GZHA 3TDMA 3BB1A 1R9MA 2YFYA 4DLWA 5LWQA 1TZ2A 4RVUA 3N3AC 1FFGA 2X14A 3QXXA 4DJJA 2JGDA 1ND6A 5M29A 5ERGB 2WUDA 2ISQA 4OAPA 1H1DA 1EIZA 2VNSA 4IPTA 4CNQA 5D3MB 1ZVJA 5I7OA 3ZKWB 5GGXA 2A9FA 3DL7A 1XEXA 5JDCA 1KZ1A 5JARA 4FFDA 5B57C 1NA5A 3UFXB 1MC4A 4F0JA 5EJ6A 5IYZB 1JB9A 4WWHA 1OZFA 1C1XB 2PHZA 3ANTA 1EUCB 4FSDA 4FYPA 5IT0A 1DT5A 3O4VA 1EP3B 1FFAA 4NYJQ 4DC0A 1FRZA 1NXXA 1VMEA 3V1LA 3AIMA 2P9ZA 3EGVA 3BPSA 3Q7RA 4Q9AA 3BHMA 3REGA 1ATIA 2JFZA 1T10A 1L4NA 1C3EA 4TQGA 5E1BA 3VNRA 1PAUA 4ZK2A 2ODPA 4R3WA 2G9QA 3CZAA 1KZHA 1TK2A 5TGZA 2Z04A 5GVSA 3GAAA 1SRQA 2Q0HA 3BB3A 2HRDA 5I51A 5KYKA 1UDAA 3DYVA 1NF8A 2NADA 2HO5A 4PYIA 4ENWA 1Z5PA 4DCPA 1FXUA 1DJPA 1VXRA 1I7NA 5JOQA 1R9GA 2R48A 3K9HA 3W77A 4RTKA 2IXAA 4UE3S 3W79A 3TQFA 4MA5A 1ZUIA 4MPJA 3G0GA 4FONA 4LPSA 3TB4A 5K2MA 5CFMA 1K0FA 4DC9A 3IE1A 2CNNA 2PO5A 4NDZA 1QMPA 2V6BA 4BC1A 2P9BA 3DMPA 3GRKA 4S35A 1GA1A 3K2IA 5IN4A 4ZHQA 2NVBA 1A69A 2VAVA 3HJBA 2GFIA 1JBKA 1QR2A 1KETA 1I4EB 1V26A 2AC7A 1QHSA 3L8DA 4HWGA 1Z7BA 1NZDA 5TR9A 2PZAA 3PTLA 2QL9A 5FLYA 4MDFA 1KYWA 1G3IA 1GAJA 2XCQA 3L0YA 2OHGA 2H08A 4HVTA 4M89A 1VBKA 4IKOA 4Y67A 4HNGA 4QGBA 4X00A 2GPYA 3TTXA 2ZRMA 1II9A 1E32A 2P6MA 2V7WA 4MYHA 2NNLD 3RBXA 2XUKA 2BZ0A 1B26A 1QMGA 2JGIA 5DK4A 1E3DA 1CF9A 3UUEA 4KO8A 3UT0A 3GLSA 3PK0A 4DZZA