1CQWA

Nai cocrystallised with haloalkane dehalogenase from a rhodococcus species
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
295
structure length
295
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGVLPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNEIPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPGLASGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Haloalkane dehalogenases: structure of a Rhodococcus enzyme.
pubmed doi rcsb
source organism Rhodococcus sp.
molecule tags Hydrolase
molecule keywords HALOALKANE DEHALOGENASE; 1-CHLOROHEXANE HALIDOHYDROLASE
total genus 101
structure length 295
sequence length 295
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 1999-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cqwA00
1UOPA 1P0MA 3OM8A 5FV4A 3C45A 4H7FA 1DT3A 4OYLA 1YB7A 4A16A 2O2GA 2ACKA 4LKOA 1SC9A 4AMZA 2XUOA 2HA6A 1VE7A 4TVKA 4FLEA 1USWA 1VZ2A 3W06A 3G9ZA 5AKXA 3G0IA 1NU6A 3C6YA 5JD6A 1TCAA 1VE6A 4INZA 3VXKA 4B83A 4FBMA 4H7IA 5JZSA 3O4JA 3ZLVA 1EK1A 4X00A 4DNOA 5ESRA 5AI6A 4B7ZA 3PFCA 2PM8A 3WMRA 5JATA 1XZMA 5IVDA 4J0GA 3HI4A 2OQIA 2W6CX 3WA7A 1VXOA 3QBJA 2WUEA 2H7CA 2NW6A 3O9MA 1WCYA 3FCYA 2WIKA 5AM4A 4GI1A 3G9UA 3H0CA 4J03A 4K6GA 2HHAA 3M82A 5K3EA 5JANA 4U2FA 1WB4A 1G4HA 5CXUA 1TK3A 3M83A 1MU0A 2BUAA 1UXOA 3F8SA 4DNQA 3WI7A 4H18A 4MYSA 4M0EA 1Q0ZA 2X76A 1CUEA 5AKHA 4J0DA 2AJCA 1JMKC 4WFIA 4DNFA 4J0KA 5K3BA 3AZOA 1XRPA 4G4JA 3D5EA 2WKWA 1GXSA 5DNWA 3S2ZA 4E14A 4HRXA 1ZI9A 4C88A 5A7FA 4P08A 3QITA 4LHEA 4I3FA 3WYDA 4IH9A 3C6BA 3D2AA 1T2NA 4EY5A 3I28A 1BCRA 4BAUA 3M81A 4B0OA 1OCEA 2ZJ7A 3Q0TA 4KRYA 4Q3KA 5CT6A 1W76A 3R3UA 4H7DA 2XUDA 5JASA 4UFOA 1U65A 4AN0A 3VJMA 4GLBA 2ZYRA 3AUKA 4E11A 1UK6A 4Y2UA 3N2ZB 3C6ZA 3DJYA 4CI9A 2WU3A 4QDOA 2Z3WA 3QPDA 4FLMA 5AI5A 3ZLUA 3ANTA 2WILA 3QMMA 4KRXA 4PSCA 4DSZA 1X2EA 3ILSA 1JJFA 4BYMA 5DYWA 3QMVA 4JEIA 2CJPA 2WG0A 1QO9A 1CV2A 1C4XA 4Y2YA 3AZQA 3WJ1A 3I2GA 2QUBA 2HFJA 4MEBA 5KWJA 3R3YA 1EVQA 2C7BA 2GYVA 1LGYA 2D5LA 1ZGCA 3NGMA 2I3ZA 6YASA 3VKFA 2QS9A 1MX1A 1QIIA 3G02A 1X2BA 3C87A 2WIFA 4DMCA 2ONCA 4PV7A 4NMWA 4X6YA 5FLKA 3FYUA 1ODSA 1XZBA 5FKJA 4CG3A 4Q3OA 2PBLA 3ICVA 1GQSA 5HFAA 3IB3A 3FYUB 1W1IA 4BE9A 1GZ7A 2QT9A 2DQYA 2QZPA 1IUOA 1VKHA 3HACA 2R8BA 4FFVA 5CT9A 3I2HA 1JU3A 5AKLA 5AK5A 3STTA 1ZI8A 1J2EA 5KREA 3LIPA 1DTEA 2EEPA 1IZ7A 3FLEA 2WSLA 3C8DA 1CUUA 3IUNA 5ALZA 2G4LA 1CUFA 2OXEA 3KWFA 4C6HA 5H3HA 1ODCA 3FOBA 5AIBA 1LZLA 2G5TA 4WFKA 2G5PA 3GBSA 1HQDA 2ES4A 3AIOA 4X97A 2C0PA 1YASA 1JJBA 4FOLA 4PF1A 1QE3A 4BVJA 4AB1A 3KD2A 3WKCA 4UBNA 2WHRA 3BIXA 2GBIA 1QZ3A 1U8EA 3IURA 2WJ3A 1BN6A 4KACA 2GZRA 4OB7A 4WCVA 1MN6A 1AGYA 2QOEA 1MO2A 3V1KA 1FFCA 1JJIA 1YSCA 1CUVA 3R0VA 4W1SA 4UFNA 3A2MA 1S8OA 3IIIA 3OC0A 2QXUA 1H2WA 3R41A 5ALLA 3V48A 2Q0XA 3E0XA 1ZI6A 3O95A 1GPKA 1XRNA 3GFFA 3EQ7A 4WY8A 4XIIA 2QKYA 1BEZA 1CUHA 1H2XA 4MJ3A 1RYYA 1CRLA 1GT6A 1F0PA 1LNSA 2J3DA 4WDRA 2VJDA 3KXPA 2YYSA 3ESDA 1YR2A 1QLWA 3JWEA 4U2DA 4V2IA 4OSEA 3GA7A 4JNCA 2FJPA 1L7QA 5T4HA 2QM0A 4ZV9A 2PSEA 3WZMA 1W6RA 4EHBA 3FLAA 4FKBA 3AZPA 2JGMA 1AKNA 5LZ4A 4X7BA 4CCWA 2PKYX 4BAZA 1UZAA 1QOZA 5ALWA 4BVKA 4W9RA 2ZJFA 4ZXFA 5ALVA 4FDMA 1TKRA 3BDIA 4M0MA 4IH4A 4MEAA 1PV1A 1VA4A 4H7EA 4CFSA 3G0GA 1E3QA 2OG1A 2XMQA 1FFDA 1ZICA 4UHDA 5AKGA 2JGEA 4MQMA 1UOQA 3D59A 2BUBA 1XZDA 1DQYA 1UK8A 5EHQA 4G8BA 2DR0A 1ZIXA 3WK7A 3FVRA 1XLUA 5AI0A 4UBJA 1QTRA 2VAXA 5AHXA 3A2NA 2XUKA 3L1IA 3O0DA 4J3JA 3H1BA 1MTZA 3QZUA 4UHCA 1EI9A 2X5XA 2C4HA 2XMBA 3H2HA 2WIGA 1FFEA 4K6HA 5CH5A 1Q0RA 1G42A 2RI6A 1UOOA 1XZHA 3L1JA 2RAUA 1MNAA 1FFAA 3TRDA 1GGVA 5JYCA 5ALUA 1ZD2P 2HIHA 3WL6A 2VATA 4UBIA 3F67A 1TQHA 4F5ZA 2E3JA 1H22A 3UUEA 4O08A 3AJAA 5JARA 4X6XA 4D9JA 3UUFA 2WFLA 3LCRA 3GROA 2RONA 4UUQA 5AKIA 5AK4A 2Z8XA 5HKAA 5DLPA 5FUMA 3O4GA 2WFLB 5EGNA 3FBWA 2XMCA 5D3KA 4HXEB 2C58A 4H7HA 2XT0A 3WA6A 4EUSA 1LPNA 3FYTA 4BE4A 5AO9A 4BCBA 1Q83A 1XQVA 4J0CA 4OB6A 2UZ0A 4AO8A 1ZD5A 5AI8A 5EI5A 4FLFA 4QEKA 1KEZA 4BAGA 1SFRA 4HTAA 1HL7A 2WG1A 1N5RA 4UHEA 3PF9A 5E4TA 2WIJA 4K6KA 5CMLA 5IVHA 7YASA 2V98A 4ETWA 1F6WA 2I3DA 3V9AA 1QIKA 2XUFA 5CRIA 5ALPA 4ARBA 1YB6A 2DHEA 1VLQA 2WHPB 5LIPA 3O9VA 4FMPA 5AM0A 3S8YA 5ALIA 3KWJA 3DL7A 3DD5A 5EIHA 3DOHA 4DIUA 3HZOA 4QWMA 3NUZA 5AM1A 5ALYA 4ZV7A 3WK8A 5DJ5A 4QLAA 1N5MA 5IVKA 4X85A 1WPRA 3BWXA 4EY6A 3KSRA 1BU8A 4EA6A 1BRTA 3WL7A 4X94A 3AILA 3L1HA 1JI3A 5AJHA 3F97A 1I6WA 4AQDA 5AICA 2PSJA 1ZJ4A 3F96A 3BIWA 1G5FA 1HPLA 1BN7A 3PDCA 2Y1KA 4KEAA 1CFJA 2CBGA 4CCYB 2I78A 3I2FA 1EB9A 3STWA 3W04A 1WB5A 5AI9A 3O4HA 2OCGA 4UBOA 2O7RA 1XROA 1FJ2A 4XWGA 5JALA 2XMGA 3PF8A 1CUBA 4KR0A 5BWBA 3QH4A 2QMQA 2VQ6A 4KAFA 1R9NA 1OILA 3IBTA 2XUJA 4H77A 1E5TA 1YAJA 4LIPD 5E4YA 4WDQA 2XQGA 4XVCA 4GECA 4BC0A 2VSQA 3ZPXA 5BOVA 2QRUA 1XLVA 4L72A 3QPAA 1GPNA 3WWCA 5EIAA 4UBKA 1P0PA 3IUQA 2WG2A 3IUJA 2OPHA 2HA7A 2HADA 4GBGA 4GWLA 3B3QA 2WHQA 5K3CA 4KE9A 1SOMA 2D0DA 3C6XA 1RP1A 2WIDA 3MGAA 3AIKA 2HU5A 4W1QA 1FSSA 1L7AA 2WUFA 4X3CA 4N5IX 1BS9A 3STYA 1K5PA 3WYNA 1CUSA 3X3HA 3V1MA 1XKLA 3CCBA 5EHXA 2FJ0A 2PX6A 1QGED 3H2GA 2V96A 4CG2A 2WJ4A 1ZGBA 4LYDA 1JU4A 4FHZA 3R3ZA 2VA9A 2W22A 5HQ3A 4M0FA 3CN7A 4U2CA 3B12A 2DSNA 4OU5A 1EDDA 5HF5A 1CUYA 2RGUA 2OAEA 5KBYA 1C7JA 2B4KA 3I2KA 2K2QB 3NWOA 3WKBA 1LZKA 2OCLA 1A7UA 1DWQA 1DX4A 3AINA 2GYWA 3PE6A 4PSDA 4C89A 3CCCA 4FTWA 4FFWA 5AIAA 4EZIA 1XZFA 2ZYHA 5K5EA 1FFBA 4AN1A 1L7RA 4QDUA 3E1GA 3I2JA 1XZAA 5JAOA 5FOQA 1IMJA 1JMYA 3H2KA 4GW3A 2XUHA 4I4CA 1QONA 2CKMA 4MYDA 3O4IA 1EB8A 2HU7A 3A6ZA 1Y7IA 1B41A 4KE7A 5HK9A 4ZGBA 1H23A 1QIJA 5I9IA 2GBGA 4OU4A 3QYJA 3FCXA 4LXGA 1YCDA 2AJBA 5DTIA 2B9VA 4KAJA 1MNQA 1A8UA 3MVEA 2AJLI 5BV7A 1XLWA 3N0TA 2Z3ZA 4L3WA 1AX9A 4W1PA 1EINA 4UHFA 5K3FB 1XQXA 2CEKA 2GZSA 1QIGA 2JGIA 3TGLA 3ESCA 4U2GA 3WL8A 4YK7A 2CMFA 2WTMA 4WFJA 4RPCA 4U2BA 3FSGD 5E4JA 3EQ8A 2IIVA 2OCKA 4KAAA 3EF3A 5AOAA 4BRZA 1XRLA 4JUIA 4AMYA 1AMNA 3WWPA 3BDVA 1HLGA 4E15A 1IVYA 1MJ5A 2XUQA 3AFIA 3C70A 3V1LA 4X71A 2ZSIA 3OG9A 5BWCA 5C8ZA 5FXMA 3E4DA 1YS1X 1DT5A 4B0PA 1E8MA 3ZV7A 3R3XA 4G9GA 5A62A 5LZ9A 3DLTA 3RKSA 4BP9A 4YASA 3HLKA 1UKBA 4GDMA 4PSUA 4EY7A 3FNBA 2AJDA 5FDFA 3MUOA 4JYMA 5CBKA 3EBLA 1LPPA 3ZI7A 1LPBB 1LPOA 2ECFA 3DDUA 3W9UA 2RHTA 3MUNA 3ESBA 4N5HX 5ALMA 1R1DA 1UT6A 2PPLA 3GZJA 3VVMA 4DLNA 1AQLA 2VJCA 3ED1A 1BROA 1C7IA 2XMRA 4QA9A 2CB9A 5A7HA 3H19A 3DS8A 1GKLA 4HVTA 5C8XA 1CLEA 3D2CA 5JAUA 1CUXA 3R3VA 5DYYA 1CVLA 3EIOA 3Q8WA 4Y2RA 4C4YA 5EHZA 2Y2VA 2P8SA 4UBLA 3H17A 2PVSA 3H18A 1EH5A 4AX4A 2BGRA 4ZI5A 2VJBA 4XJVA 1XZJA 2O2HA 3I1YA 4RGYA 4BZWA 4XX1A 2HM7A 4DMKA 1H2YA 4Y2SA 5IH7A 3BJMA 4C87A 2BKLA 1AURA 3IUMA 3R3WA 1UWCA 2V9ZA 5FRDA 1XZIA 2RIPA 3F98A 3HYSA 4Y2PA 1VA5A 4B84A 1SCIA 2GBCA 5HKBA 1A88A 1XZCA 1GQRA 2XMDA 5JZ9A 2ACEA 4G8CA 4X92A 3VDXA 4OCZA 1DQZA 4DM7A 5LZ8A 1QFSA 1WB6A 4UBMA 1GKKA 1THTA 1AZWA 1QIDA 2WFMA 4QE3A 3WKEA 4F21A 4K2AA 5HF9A 5HCUA 4OB8A 2JF0A 3BL8A 2LIPA 2XMZA 5AI4A 5DNVA 3VISA 1F0NA 3QM1A 4WY5A 3UMJA 2XMSA 1TCCA 2RHWA 2PUHA 3LIIA 2Z8ZA 5HZGA 3I1IA 1N8SA 3G8YA 1ODTC 3WK9A 4X6UA 3SX4A 4PQEA 1YAHA 2Y2UA 4IHAA 2BAGA 2HDWA 1UK9A 4DNPA 3K9BA 2YASA 3WIBA 4X93A 2WU4A 1IUPA 1RWQA 2WUGA 2XUPA 4DMFA 4MWSA 4QDTA 1TCBA 1UKCA 4CIBA 4X90A 1XZEA 4NS4A 2JGKA 3AIMA 4P92A 1H2ZA 4C4XA 3DCNA 1WHSA 2HA5A 2JIDA 2GBFA 4FWBA 2O2IA 3STXA 1JT2A 2OLEA 3WQHA 1ACJA 4BBZA 1O6FA 2HA3A 4CG1A 4H0CA 2WLSA 2XB6A 1BE0A 2WUDA 3WJ2A 4B80A 2ZYSA 2HFKA 3TJMA 4AZ0A 1EHYA 4G1FA 3FYUC 1XZGA 4RE5A 4BC1A 4JYPA 4W63A 5A7GA 2XUIA 4N8DA 1AC5A 2DFPA 3ANSA 1A8QA 1WM1A 4EBBA 5AK3A 4FNMA 2R11A 5CW2A 4UFPA 3OTQA 3G0DA 2QXTA 1VJ5A 2X8BA 4PNZA 3LS2A 2PSDA 3WL5A 5AKKA 3F9CA 4AO6A 3VJKA 4KJXA 4BCCA 5CH8A 4QNNA 3A2LA 1LBTA 4NZZA 1WOMA 3QVMA 3VJLA 3IVMA 2H9YA 4DGQA 4A23A 2XLBA 1PFQA 2HU8A 2QJWA 2DQZA 2WFZA 2OQVA 3LP5A 5KWIA 1XRQA 1IUNA 4ZRDA 3U0VA 2XUGA 4G9EA 4NVRA 4F60A 2AJ8A 3ZWQA 2VT7A 2PUJA 3YASA 5CT8A 4G5XA 1N1MA 4BDTA 4ZREA 4DMHA 2JGJA 3DQZA 2WTNA 1CUCA 2ORYA 2J4CA 3JYHA 5AM5A 5E2IA 4QZVA 2H7XA 1OXMA 3D7RA 3FVTA 2I03A 3WK5A 1CUJA 1XQYA 3CXUA 4BP8A 1VZ3A 2YH2A 4Z49A 5JADA 5FPQA 1CR6A 1ORWA 1XQWA 4LXIA 2WHPA 1VXRA 3EQ9A 4FNGA 3H1AA 3RARA 2XLCA 5SYNA 3DEAA 5AKEA 4L0CA 1R3DA 4E46A 2BFNA 2JEZA 1UFOA 4MQLA 2XQKA 1HDEA 4UPDA 5C8VA 2C0QA 5AP9A 1CIJA 1X70A 3RM3A 2FX5A 4DTCA 3FWHA 5C81A 3W9BA 2QR5A 4I19A 1TAHA 4AXBA 4N8SA 3FLBA 3FAKA 4BTVA 5ALRA 3WK4A 4OUKX 4HS9A 1F8UA 1UK7A 3BJRA 4AO7A 4FBLA 2J4FA 4AZ3A 2XUAA 2ROQA 4X95A 1W52X 5EHNA 5AKJA 3HABA 5LYYA 5IVIA 4HXFB 2VT6A 2Y6VA 1YA4A 4YX9A 1LPSA 3KOOA 4KE8A 2XI4A 4PO3X 5K3DA 3STVA 1EVEA 4J0IA 3WKDA 4HAIA 2B61A 2CZQA 1XZLA 1EX9A 3WLAA 5ISMA 3PI6A 4GEGA 3I6MA 5LZ7A 2GYUA 4BCDA 1DU4A 5HF8A 1ZIYA 5ALTA 2BGNA 1J06A 5HF6A 1SCKA 4BVLA 1YA8A 3SK0A 3C5WP 3GELA 5J3JA 1T4MA 2QVBA 3WZLA 3D4LA 1EK2A 2ZJ6A 5ALGA 5IKXA 1XRRA 1MAHA 4MXDA 2JGLA 5EIEA 2JEYA 1XRMA 3I6ZA 1BCSA 1E89A 3IULA 3PUHA 1D07A 3WWDA 3DYVA 1CPYA 4H7JA 3OOSA 3IDAA 1MT3A 2HL6A 5T4BA 1CUGA 1CUAA 3BXPA 3C8HA 2PL5A 1MAAA 2Z5GA 1MPXA 2XE4A 2C5FA 2ZYIA 1Q84A 4OYYA 1ETHA 4WJLA 1EDBA 2QTBA 1K8QA 3G9TA 5D7BA 3DKRA 2V97A 1WHTA 5CH3A 1GPLA 4ROTA 4Y2QA 3CN9A 2BJHA 2DHCA 3BF8A 4ITVA 5ALDA 1NU8A 1QJ4A 3H2JA 2HA2A 3HEAA 5CTAA 1E66A 2H1IA 3IA2A 3HJUA 1XKTA 4LYEA 3WIOA 2H7YA 5JZBA 3D3NA 1J07A 2XDWA 2PU5A 5DNUA 3T52A 1IZ8A 2VEOA 1SCQA 1LPAB 4PW0A 3T4UA 2QJRA 2C5GA 2VTVA 4K5QA 1K6EA 2VF2A 5EFZA 3E3AA 3P2MA 2B20A 3C5VA 1TRHA 1YS2X 3GUUA 2WJ6A 5AH0A 3RK4A 4BB0A 2Y6UA 3D0KA 3I2IA 3H04A 3G0CA 3ICWA 4CCYA 1K63A 4W1RA 3WKAA 5LLSA 5ALEA 5ALKA 4Y9SA 4H7KA 1U4NA 4IQ4A 5YASA 1QFMA 2OGSA 4J7AA 1LLFA 4LXHA 2EDAA 3DL4A 5ALSA 4BZZA 3A70A 2CUTA 4QWWA 5K3FA 3ZLTA 4B9EA 1KU0A 1CUDA 3HXKA 2EDCA 1R88A 4J0HA 4CIAA 3K6KA 3RLIA 2WQZA 3HRHA 4DYHA 1VOTA 2IX9A 2HA0A 4MWTA 1WPXA 2BCEA 1CUWA 4H35A 2XQJA 1JKMA 3BE8A 1A8SA 1NX9A 4TPKA 5D3ZA 3DNMA 4G4IA 2OCIA 1J1IA 3C43A 1R4ZA 3V1NA 4EY8A 4Q3LA 5SYMA 1QIFA 4Y2XA 2ZSHA 2G63A 2OGZA 3HC7A 3OURA 3DKKA 4G4GA 4B6GA 5LP1A 2HRQA 3KDAA 1ZJ5A 3STUA 4Y7DA 3PFBA 5AKYA 3G7NA 3K2IA 4IO0A 4Q34A 4U2EA 3ESAA 3G9XA 1B6GA 1QIHA 1QIMA 5CURA 1DINA 5D6OA 4HRYA 1THGA 1CUZA 2XQIA 4OPMA 4IH1A 1UKAA 3HSSA 4P9NA 4BATA 4A5SA 4KYVA 5FP0A 4UHHA 3QMWA 2OAGA 5JAHA 2PSFA 3WWEA 4ARAA 4B81A 1JFRA 4X91A 3B5EA 5AKZA 5CT5A 1PJAA 3W05A 4B82A 5LKAA 2JBWA 2VJAA 4Q1VA 4C4ZA 5C7YA 5ALXA 4S0XA 1EA5A 4Y2JA 4J0JA 4B85A 3PICA 5JD5A 5DWDA 5FPPA 1TIBA 1LPMA 1XZKA 1ACLA 4YPVA 1G66A 1XFDA 4B9AA 4BTLA 1W75A 3TEJA 1ISPA 3NOXA 5LZ2A 1ZD4A 1K4YA 4QDZA 5I7UA 2AXEA 2VAVA 2FUKA 3JW8A 5JD4A 1BEEA 4G8DA 2DCMA 2JGFA 5AOBA 2HRRA 4HXGA 5K3AA 3FSGA 4P93A 4QLOA 1W4LA 2YXPX 3OPMA 4KE6A 5DTJA 1CQZA 3M3DA 5A6VA 1M33A 3DYIA 5ALQA 1LBSA 4OD0A 2ZVDA 4BDSA 2OGTA 2O7VA 1CQWA 4GXNA 1HKHA 1R9MA 5JIBA 3DOIA 4JH0A 2PSHA 5I8PA 1Z68A 5HFNA 5LZ5A 1AUOA 1P0QA 5ALOA 4C01A 5AOCA 4GHWA 4RNCA 5ALNA 4Y2VA 3H2IA 5LKRA 3BF7A 1CEXA 4BRSA 5ALHA 2WM2A 2XQFA 1DWPA 5HK8A 2IITA 1P0IA 3G0BA 4QDXA 5HQ3B 5A2GA 3W2TA 3SWWA 4L9AA 1EDEA 5AM3A 3WWOA 1QIEA 2J3QA 4Q05A 4EB0A 4UHBA 1QO7A 5F4ZA 1DWOA 1E8NA 1ORVA 4F0JA 1QTIA 5AM2A 1Y7HA 2BUCA 4Q82A 1DX6A 4ZWNA 5T4EA 4EY4A 3LLCA 5JAPA 5ALFA 3SC2A 1HBJA 2DHDA 3VVLA 3U1TA 1KU6A 1CUIA 1MX5A 4HZGA 5DYTA 4DSAA 1EXWA 2QUAA 4Y2TA 4RE6A 2HA4A 5ALJA 3D2BA 1R50A 1ZD3A 1E8DA 1Y37A 3PUIA 4N8EA 5CT4A 3QPCA 5AK6A 1U2EA 5CXXA 1ZOIA 3I6YA 2PU7A 5A71A 4TGLA 5T4FA 3R40A 3WK6A 1MX9A 1O6GA
chains in the Genus database with same CATH superfamily
1RD4A 1RQPA 3VVCA 1M8JA 4K03A 2C20A 3OM8A 2GJKA 5ITVA 1DT3A 5TMEA 3U4GA 3FRIA 2QIPA 2ZSFA 3DYBA 4OYLA 1EP1B 2ERCA 3NLLA 3TOXA 5H4GA 1E1QD 3P71T 4NF2A 4JJEA 2O2GA 5J4KA 3ECAA 1EVLA 4XLZA 2ACKA 3EXIB 4LKOA 4LDRA 1CDEA 5DOVA 5JVDB 3SF8A 3URKA 4MWDA 3PNLA 1ZQ9A 1SC9A 3BGOS 5AJUA 3A9SA 4AMZA 2OTCA 3A6DA 3CINA 3LFHA 4A82A 2GZMA 1N5KA 1QHIA 3IE1A 2X0RA 2HA6A 1VE7A 3GJ6A 4IDNA 2QMEA 4TVKA 1C8VB 5B30A 2YMQA 4PXSA 2VA8A 2C2ZA 3NALA 3ENKA 5J5CA 4MP8A 3F7OA 1KP2A 3OY7A 4LRUA 1BMQA 3PXUA 1M6VA 3G9ZA 4TUYA 3ZKWA 5IYZB 1AKVA 3G0IA 1GLNA 3D81A 3NIBA 3RJZA 2NO7A 3C6YA 1USKA 1KGSA 2GRJA 3ONVA 4XCVA 3O8OB 2AXNA 3WQRA 4LDAA 1VE6A 3KELA 3QQPA 3CH4B 1BGXT 2Z9DA 2LV8A 4FBMA 1Y33E 4H7IA 4WCDA 1N0IA 3O4JA 5E7QA 2JD1A 4BQQA 2A0XA 4U9HS 2RGGA 3Q10A 4DNOA 3FUTA 1RXEA 2FQXA 1T5TA 2V7UA 2JIZD 3EEFA 2RG7A 1IJEA 4WSOA 2JJYA 4G85A 1E9DA 2GK6A 2CHVA 2C8KA 2D5BA 1A5SB 3CLRC 2YFQA 3LX8A 3LX6A 2W6NA 5IVDA 3TVTA 5LOVB 1J6UA 3DFIA 1K75A 5LMNB 3NHYA 3CLVA 2QUZA 1BFDA 2NM0A 3HI4A 4GKAA 2OQIA 3TLGB 2JFPA 5LU8A 3WA7A 3QBJA 1NNEA 3TGWA 4FDLA 1DKOA 3KPWA 4G89A 2ZTLA 4PG8A 3RT9A 2F6RA 4RDXA 1Z2PX 3RD5A 4ZQHA 1TA4A 3H0CA 4L02A 3VO8A 3OEED 3NV9A 4Y1RB 4Q5IA 4K6GA 1PVDA 3BA1A 3UAWA 3NZEA 2J0SA 1SHUX 3T7DA 1QH8A 2A4MA 1X7GA 1DUIA 1PDOA 1A5ZA 1GGJA 4MLCA 4XIFA 1Q3TA 2QM8A 4U2FA 3RG2A 2Z5LA 4LMPA 4HS4A 4RVDA 5DE3A 4JYAB 1JEAA 1ELOA 3OE5A 4IV5A 4MAFA 3BRSA 3EJ6A 4PRKA 5DDIP 3FTEA 2CDAA 5EMNA 5IH3A 4EG8A 1N2JA 4CNBA 3RJ5A 2E85A 4WVFA 4P4SA 2BUAA 3VI4B 1JFFB 4B44A 1ZH4A 3GCZA 2R65A 1W34A 3JRNA 1PFGA 1TJNA 1HF3A 4I50B 3JAKB 4WK4B 3TBKA 2DWOA 2HWKA 1GZSA 1V8OA 4PVDA 4NCBA 2YMPA 4CEHB 3KALA 1SH7A 1ZAKA 4BJ1A 4J07A 4ZHQB 5BW6B 3K70C 2HJSA 2UXBB 2ZM6B 5EKXA 2FLKA 2LD4A 3ORYA 4GOKA 1H4TA 1HL3A 1M3SA 3AX6A 1C4OA 3T41A 1ZIDA 3IKLA 3AF6A 4S2EA 2XDAA 3WE7A 1MKYA 1GCGA 1EVZA 1H69A 2F43B 2OB2A 2HXGA 4F2DA 5AW8A 2YWJA 1KTVA 3B78A 3RVBA 5IM4F 1GXSA 5ES3A 4PR0A 3QU7A 1LQTA 3EA5A 3GW8A 4WRRA 5EA2A 1UPTA 3QXXA 4KR3A 4UVDA 5KSYA 4R3WA 4Z86A 3OQIB 4C0BA 2KI5A 2VJMA 3F9RA 1NWHA 2EP8A 1DO8A 4NKRA 5CJJA 3A9VA 3MZ0A 4Q3EA 1SKYE 3QVLA 2JHCA 2ZT7A 3LPAA 1RWOA 1KERA 1T34A 3C6BA 2OD9A 4NI5A 2IS2A 1QMPA 2WF7A 3D2AA 4MSUA 3BULA 1T2NA 2IU6A 3F4BA 1Y7TA 3WO0A 4JWKA 1VKRA 3U60B 1CQPA 1YZKA 3WIDA 3TFOA 1SUBA 2ZDQA 4YUYA 1UMDB 4MCJA 4WE3A 2IZOA 5JXWA 1ZR4A 2O3RA 1URPA 2DBVO 2V6JA 4MDHA 2KM1A 1W9MA 5H9VA 1FU8A 5AW4A 3AHHA 4CT0A 2CY0A 2ZRBA 2YVLA 5JW6A 1G6KA 5U1PA 1HDGO 3T1OA 1F2TB 3U6KA 4RK4A 2EV9A 2FR1A 4Q3KA 4RSGA 4D8WA 4HLDA 2RGAA 3LSYA 4BIIA 1MB9A 3HJNA 3BGDA 4BO5A 4HPXB 4KXYA 5K9ZA 1YJ5A 1T5SA 2QRLA 5F51A 4GXRA 3R3UA 1SUDA 5IFLA 5TE9A 1TJ4A 4PHGA 4JY7A 3LWZA 4RK6A 3B70A 1CJSA 1OV4A 3KHSA 3WB0A 1VIVA 4MGKR 1MA0A 1Y6ZA 3MA0A 4RA6B 4Y1FA 4AZ3B 4UFOA 2AMYA 1QP8A 1VB3A 4MCAA 1WXXA 1PG2A 4IIUA 3U9SA 2FPOA 4HT3B 1L5OA 3SZ3A 4CDNA 4ES6A 1ZD8A 4FDTA 2ZYRA 4GLBA 4FNAA 2D74A 1KFEB 3FVQA 2YY6A 1UK6A 1XMJA 1Y9DA 2CBZA 3IT0A 3IILA 4Y2UA 2TMYA 1XCBA 5D86A 1FDUA 2YOHA 1W73A 2ZWIA 4Z9AA 3GJ8A 4W7IA 3WYEA 1GGEA 4EYQA 1Z39A 3HYNA 1IN8A 4HQLA 4YGYA 1EBFA 3QPDA 3LKBA 4FLMA 4MX8A 4QICA 4QASA 1UMCA 1C3OA 3O92A 3ZIUA 1YDGA 4TMKA 1ZJZA 3ANTA 4UTXA 2WILA 5BN3A 3QE9Y 3GGJA 4KRXA 2V1UA 2XXBA 2Q2OA 3L05A 3O8OA 1X7HA 4I1VA 1WU7A 4K86A 4YMIA 1KSFX 3ILHA 1ZGHA 3NETA 4DSZA 2JVIA 1GYRA 5FNVF 3HJAA 1NAHA 3X2SA 3C7CB 4FEGA 2ECPA 1TB4A 3N58A 3OZUA 5FNVB 4B47A 4EGQA 4YMLA 3QMVA 1K6MA 4IX1A 5KVQA 3P2OA 1U3CA 4R1LA 4DM3A 2FWRA 1GPJA 2WG0A 3AEQB 3N5CA 4EFNA 1QO9A 2N1MA 5GZ3A 4JBNA 5ECWA 1KYXA 4NBNA 4U8GA 3CVVA 3UJ7A 3X1JA 4NFYA 3P97A 2CE7A 1A5BB 2HZ7A 3RYTC 4FR0A 2VQEB 3LBAA 3RTCA 4MEBA 2G8NA 3FNIA 5IARA 4GKJB 1N4AA 5JTUA 1AHIA 1UEJA 1EVQA 1M34E 2JAQA 3I64A 4JVMA 4BGEA 5LA6B 3QVUA 4FFNA 1N1GA 2OUIA 2ZT6A 4BQPA 5J63A 3DP9A 1L4HA 5JAZA 2X0EA 3O94A 1DIOB 4A5OA 2XSZD 2GYVA 1R00A 4B0PA 3PC4A 4BNGA 1KSGA 4JDPA 5ES4B 3NGMA 2IOFK 4PZCA 1X9GA 3EXHC 2Z8YA 3TJRA 1GFIA 4YJFA 5TQ0A 1HETA 2QS9A 5FI0B 1QIIA 1BHJA 3TDMA 2YJZA 3UVEA 1GZ6A 4JVLA 5AW0A 1GPH1 3C87A 2D2IA 1UJMA 2ZTHA 2QQFA 3ELDA 1ZU5A 3Q7SA 4PV7A 3M6UA 4MJ7A 3U4IA 5F3DA 4NMWA 4X6YA 4Y0AA 5FLKA 4B3SB 2BGGA 2FHPA 1Y3CE 2A30A 4I4TA 4OHKA 1ODSA 4OI4A 1XZBA 4I14A 3MTJA 2CK3A 4MKXA 3LCUA 1QF7A 2ID4A 1KE2A 5IWCA 4KO2S 2O5EA 3D8SA 1PK8A 2PBLA 1BYUA 3IJRA 3JATB 4KN8A 3ZVRA 1GQSA 3MBOA 4D3FA 4ZZ1A 9LDTA 3O2JA 2XXJA 1J8MF 1Q0UA 4MVJG 4PC7A 4YXWD 4L8GA 3IB3A 5KI6A 4OP1A 2PA0A 4B8WA 4I4TB 4D3XA 1Q7GA 3BM5A 1VL2A 4HGOA 5KSPA 2Q5EA 1W1IA 4WK2B 3H8WA 4B3DA 4X6LA 2P11A 4BE9A 2A0WA 2BY4A 3T5PA 2QT9A 2AKEA 3DZKA 2KPOA 3A0UA 3HO6A 3K70D 5EN4A 2XE8A 1CP2A 3UCFA 4EFKA 5DN6D 2VJLA 1D2NA 2IUTA 3DV0B 2R8BA 2Y4OA 4FFVA 4O2AB 5DLQC 3FUWA 5FPQA 5JTTA 1FDVA 3STTA 1H1LB 3MD0A 2BIFA 2X86A 4OY3A 2YIVX 2DP4E 3G1UA 3OQIA 1FBNA 2JI4A 3P9NA 4CFYA 2UYQA 3IQEA 5EJ2A 3VM6A 1U0LA 1IRXA 2FP4A 2D7JA 3P9ZA 1M10A 3IKMB 3P9KA 1ZVQA 3V4RA 3EWAA 1QUFA 2PTGA 1FFXA 3GF4A 3PUWA 1G8MA 2PMFA 1CZNA 3R5JA 2QORA 5ADWA 1H3NA 5D3MA 1O58A 3EVTA 3C8DA 3KJEA 2QVGA 5ALZA 2G4LA 5HRCA 1E5LA 1O89A 2LBPA 4F3KA 5H3HA 1ODCA 4C7XA 5HFJA 4HDMB 5KVAA 1UMDA 2DMRA 2P5YA 2QMHA 3EFHA 3U4DA 1XAHA 4Z4HA 3VA7A 4IMIB 2CXTA 3HUFA 2PBFA 2PS0A 3UY4A 2ACVA 2AJTA 2ES4A 4X97A 1VIAA 5GPBA 3V34A 4DREA 3JV7A 5ELXA 2BGMA 3ZGOA 4NYMQ 5CDSA 4ZO6A 5DO9A 3X1MA 2EP7A 4PLZA 1JG2A 3ECSA 4GC5A 4DR4B 2IPMA 4CODB 3PFWO 4OIFA 5AJTA 3SEFA 4B17A 4FT4A 2AWOA 5E2BA 1H8HA 1NQTA 3RYCB 4XEHA 1TQ8A 1KQOA 1ZM3A 3ZW9A 1C1DA 2ZJBA 3BIXA 3HBFA 1T3LA 2WHYA 4BJ6A 4DY4A 3LL4A 2R86A 4Q3BA 3WOVA 3UKDA 1M34A 1U8EA 1K7CA 2IVZA 1T8PA 3IURA 3S28A 3UJ6A 3W2EA 5GGYA 1XI2A 5A6SA 4C0SA 1WAMA 3DDCA 2JGAA 4BXOB 4UE6A 1OAOC 1X7YA 1UXKA 5F98A 1NN5A 1AGYA 2QP9X 5IZCA 3I1FA 3LY8A 3KKEA 4EMSA 3IIJA 4QQ8A 1ESDA 1Y9EA 4JASB 4REQB 1R10A 1YSCA 4WKBA 1CUVA 2WNIA 2NO5A 3EPPA 1AMUA 2PO5A 3KLOA 4RO0A 4UFNA 3RNOA 4GP9A 1QQAA 3WO1A 1S8OA 1C0IA 3OC0A 3PGA1 1JNXX 1WY5A 2QXUA 3AFNA 4L8YA 3I0ZA 1PJ8A 1E1LA 3CZMA 3QUAA 1DPFA 3S0JA 2E5LB 3V7NA 3LH5A 4KFUA 1W4RA 2H9AA 3JQQA 1XL1A 3L07A 2W6OA 3U7QB 4X7PA 4A0FA 2R47A 3U7FB 1XRNA 4U39A 2ONYA 4IJVA 3BHMA 4F3CA 1R6AA 5LXTB 4GGPA 2G1KA 2X0NA 4JJ7A 4MJ3A 5B4UA 3LC1O 3MJCA 5FLXA 3IAEA 4KXQA 1GT6A 1LNSA 3D4PA 4QU5A 4RXMA 4OQYA 5K0NA 3ZOKA 3DBRB 2VJDA 5ICFA 1A71A 2YYSA 3ESQA 2XKAA 1KK0A 1LX7A 1VGVA 2B1IA 3ZU5A 3H2ZA 1DC3A 2A1UB 3KQNA 3O8DA 3RWMB 2OCBA 1P1JA 1JJ7A 1KSHA 3B7GA 1IG3A 5T6MA 3AI2A 4DABA 1ADJA 1HTTA 2FMXA 2YOFA 3CZ5A 3JD1A 2KE5A 4RMGA 2FJPA 5G4KA 1DKMA 4JIMA 4TTAA 1BOFA 4R8LA 2XGMA 2QM0A 5KYWB 1FTWA 1I2CA 1CWUA 3CUTA 4N03A 5C4MA 1LD3A 1RPZA 4TLLB 2DC1A 3WZMA 5DH9A 4EHBA 3H13A 3MS4A 4IXWA 4K81B 1X0VA 4N6NA 1JLLA 3FF4A 1J5EB 1AKNA 4MK4A 4YYZA 4X7BA 4TXHA 1YDMA 2PKYX 3RS8A 5CCXA 3SS7X 4DLSA 4F8JA 4CE6A 3DTVA 3FCEA 1M2WA 1WBBA 5BR4A 5A5VA 1RJDA 3GA0A 1ATIA 2ZJFA 2XCRB 1FVFA 3KEMA 1TJPB 3R4CA 4UPEA 4ZXFA 1KXJA 3TVYA 4II7A 3SYKA 4S0ZA 4JXZA 1RQ7A 1ZDMA 1O96A 3KKQA 4DFDA 4DCTA 3GNSA 4EZEA 2H1OA 4UKDA 4JR1A 1V7CA 2RDMA 3BBPA 4LUCA 1TKRA 3CLHA 5IXYA 1IU9A 1P1RA 2P62A 3AGQA 3DWGA 3BDIA 4R8RA 4LSGA 5I3CA 3M6AA 4M0MA 9GPBA 5L40A 5C7LO 4HX2A 3KQUA 4AVYA 4MUYA 5DM2A 2B9EA 2QVLA 4IH4A 5CPBA 4DB4A 2CSXA 5DGIA 3OU2A 4X84A 1VA4A 1XDUA 2JCGA 2GETA 4CKBA 2CL6X 3RU7A 1A9TA 4KUHA 5IBQA 4J2OA 3JX9A 3HJFA 4LGCA 2QZJA 3OJLA 1E3QA 4FPXA 4AKEA 2JRCA 4FCCA 1G3UA 4OHPA 5IW8A 3SXUA 4EP1A 2O19A 4P84A 4JXJA 2XMQA 3D0QA 5JV5A 2UZ1B 1B76A 3W8FA 1K7YA 4U2KA 4IIBA 4K9MA 1UM8A 2DTXA 2HOQA 2R00A 3QPBA 4QBFA 1WABA 3ZZNA 3FFTA 3GNTA 3OX3A 3PXDA 4JJKA 4K9OA 4EITA 5C8DA 2JGEA 3AF3A 4UEOA 3OT5A 1G7TA 2MTBA 621PA 2MSLA 2R1UA 4MR8A 4D80A 5JH7B 4FR5A 2AZMA 2BUBA 3KBBA 2RKBA 5ERXA 3ZY2A 3WLMA 5M29A 2D1QA 1HQCA 3KV1A 3EVGA 4I55A 4OHCA 2VYFA 1EG7A 4HZUA 3T0IA 4G8BA 4IDGA 3UK7A 2DHQA 5KQMA 5LQCA 3VJRA 4XJTA 4XR4A 5LB2A 2WD8A 3RRBA 1DRJA 2H59A 5TC4A 1UPXA 2QNBA 3MIIA 4QTUB 4C43A 1RPNA 4BS9A 5AI0A 5H80A 1QTRA 1T9HA 2OXFA 1XWWA 5AHXA 4RD1A 1TZJA 3A2NA 4WV3A 1MW8X 1P81A 3O0DA 3D3WB 4GOJA 4IQ0A 4BV8A 1XV5A 3VPDA 1SC1A 1A69A 1PYGA 4ND6A 4P32A 5DNYB 3UMSA 5L3SB 4IIFA 4QOSA 5FLEX 1K2VN 4PNPA 4FZ5A 3BGVA 3ZGVA 3UYKA 3BL5A 4K40A 3OZCA 3FCSB 2UYGA 5C4GB 3N8DA 1TT7A 2F3SA 4UHCA 3WLEA 5KNLA 5J2TF 2EKDA 3ZE8A 5M04A 2XMBA 3H2HA 2GLTA 3HYTA 4EEXA 3GIWA 2ZIUB 2Q3MA 3OESA 3P2IA 2PX2A 5CH5A 1ZH6A 1JKFA 3IJPA 3B1WA 2TMDA 3M6MD 2JJ2D 4RMHA 4DA4A 1XVVA 2BGUA 1TIPA 3VYTB 2K2WA 4R2IA 1GU1A 3INGA 2OFWA 2H1CA 2XVZA 3UAOA 2HU2A 2RAUA 2UZ4A 4PTYA 3TRDA 4BUZA 2FWBA 4M36A 1DJMA 3AOEA 1BVUA 2R68A 1PO7A 3O8NA 1Y9AA 2X6QA 2FFJA 3R7DA 3QKUA 4Y9TA 2BRUA 1TQHA 3ZW7A 3EGWA 2VTKA 3CWZA 4DV0B 2X3YA 1ODFA 1YF3A 4DIEA 1WR8A 1H22A 1DQSA 1EJ0A 1PIWA 2MR5A 2OQRA 2B2CA 4O08A 1SVWA 4WUVA 4ZC1A 1L4FA 4CM8A 5REQA 5ICCA 5BMVB 2FZLA 3OQHA 1HDCA 4HWSA 2WHXA 2XOKD 2ZIZA 2RC5A 3OY2A 5EGSA 5B57C 1QQBA 2FRXA 2VPIA 3TCXB 4ZYWA 2J09A 3ZYZA 5C3MA 4DLLA 3WWYA 7REQB 1X8LA 4GS5A 4LF4B 2WFLA 2ZXEA 5CFNA 3CF4G 2NUPB 3MT8A 1RT9A 2RONA 2AD5A 1VL0A 4CUZA 1Z0JA 1DAEA 1NN0A 2AE1A 3RH0A 3RHZA 1EKXA 5AXCA 4UM9D 4GWGA 2CNOA 2AF3C 5HKAA 3SKVA 4FHCA 1NQOA 4MWGA 5IWAB 1QORA 3AEXA 2WFLB 3WGYA 1TECE 2DULA 3KVYA 3D7LA 4AY6A 4QREA 1T0JB 2NUPA 2VRCA 2GZAA 4KWCA 2FV8A 1YHYA 2Y0DA 3H6KA 4F4DA 4YRZA 3TR0A 5KYVA 2VZLA 3GGDA 3JARB 4PZAA 5AO9A 4Q66C 5KWEA 1JT9A 2QD5A 3Q3VA 5IT9A 3D6MA 1XQVA 1KDOA 4Q4AA 5IHPA 2IYZA 4TMXA 5CB4F 5FWYB 2C29D 1TVCA 1Z6PA 2UZ0A 4WBSA 5DM1A 5T67A 4FFSA 4Q37A 1M0SA 2GAAA 5JROA 4FLFA 1CF2O 3HY6A 4MITA 1YKSA 4WCFA 4R1OA 3ROTA 3HCWA 4ZMRA 5AFSA 3K0SA 1TRKA 1SFRA 3WNQA 3R5KA 1V1RB 4FHFA 1I0ZA 2WWTA 4W9MC 1RZUA 3OIVA 1R4NA 3PWSA 4EELA 4CQMB 3K0CA 4WH0A 1NLYA 1SD1A 3I5MA 4RU1A 3ER8A 1M2OB 4K3VA 2WG1A 3DKIA 1QPBA 3ZI4A 3HU3A 3PF9A 4ZCMA 4BWGA 3NYRA 5CMLA 3WGKA 4HYEA 1DRKA 1U7HA 4ASUA 4B6FA 4HFNA 4AJLA 3RQSA 4DBZA 2ORIA 1VJ0A 3V9AA 4NQZA 2DXIA 1QIKA 3TMKA 1TYDE 2SCUA 5K4HA 1E69A 3EEQA 5J4LA 2ZE6A 1TUBB 1AUQA 1WSAA 4LXXA 1PT9A 4AFNA 1OH7A 1U7TA 4FC6A 4YAGA 3IO3A 2F67A 4WD3A 1C1XA 3B1FA 2FEOA 3GDFA 1XMSA 5LIPA 1F12A 1FS6A 3UAYA 1MOSA 1DOAA 1SVSA 1WE2A 4FMPA 2ZREA 2ZW9A 4NBVA 4RM2A 2JCSA 3DM9B 3S8YA 4ILKA 5EXDA 1H5NA 3GUVA 4D56A 5F52A 2BELA 4UD2A 1EBUA 1R27A 5K6AA 3NWBA 3DD5A 5EYPA 5IKOA 3A36A 5EIHA 2VR1A 2IKSA 3HZOA 4GKVA 2R2AA 3ZKAA 1N2ZA 1COWA 1NBMD 1RW4A 2A9OA 1DC4A 3IH5A 2PLFA 3QP9A 4YQYA 1T3TA 1QFZA 2OCPA 4NZOA 4D82A 4L7QA 2OBMA 4A0SA 1XIVA 2I4TA 1NP6A 1X94A 1AS2A 1G3QA 4ZYXA 4XA8A 1Z5NA 4AQYB 2J45A 2O0KA 2AFVA 4OVKA 1BMDA 5JSUA 2VTEA 3O1IC 3E22A 4R4JA 1W44A 3IE2A 2IH5A 2Z2YA 5TIIA 2AYXA 5FD8A 2PMWB 2B4TO 1V8BA 1XXHB 2NU6A 4RELA 4LFCB 1GZUA 2CLIB 2DR3A 4EY6A 5LSAA 3VZPA 3PT9A 4MJXA 3TZLA 5NULA 4EA6A 2XF8A 5CB4B 3MN1A 5LXTF 2KX7A 3WL7A 5JISA 1CE8B 3RLFA 1FZQA 1P6UA 1QLJA 1RXCA 2BMVA 2PZGA 2QYTA 4ER0A 2PUFA 4X94A 3JS5A 2RGNC 3W77A 4Z54A 4BO3A 3TTSA 2VAMA 4MLPA 3U7RA 4C04A 4ER3A 2JH9A 3F97A 5LU9A 4MHTA 1WNTA 1HG1A 1I1OA 3NG1A 1F51E 1C4WA 1QB7A 2PSJA 3C3XA 3CZCA 1J90A 1PR2A 3KCNA 2DQKA 2HMTA 1KAMA 4FIDA 4J9UE 1QCCA 4QOFA 4FB4A 1Q2XA 2W0MA 3AY3A 2PT9A 3EXHB 3PDCA 4OHRA 3G6WA 4KEAA 3T3HA 4A1OA 5EJ7A 1BQEA 1PF7E 2BJWA 2IE8A 3ABIA 3L5KA 4Z8XA 3N0RA 3TGPA 1CHNA 1P3Y1 1NONA 1ND5A 1DZ3A 1VDMA 2WF5A 1LDNA 1T4GA 4OFWA 3ZE6A 6GPBA 4ENTA 1H9AA 1O1YA 1WB5A 4L4ZA 1YIAA 4UM9B 3KEOA 3C14C 5J5AA 2WT9A 1B0UA 2APJA 2F3UA 2C95A 4QYSA 2QZ9A 3OO1A 4UBOA 4BGDA 1XROA 1O9GA 1JECA 2JW5A 4O8ZA 1ISFA 1NI5A 3A9TA 5H8WA 3R7BA 3O0TA 5ULLA 3G23A 3L8CA 3MWLA 4GRIA 1VHTA 3INYA 3TRKA 3A10A 5IBCA 1B93A 1HLDA 3OIFA 4C78A 1YS7A 1AUVA 1D6JA 1WXDA 2GNOA 2OO5C 5AK0A 4UVIA 3QH4A 3NV7A 4ND5A 2O3UA 5JQGF 1A8IA 2ZCJA 1QAOA 2FSSA 1CS4C 2NZXA 3RVMA 4J6FA 1FRFS 4YACA 2OV8A 2XUJA 4H77A 5CJPA 3RJTA 4J4BA 4IAOA 4LIPD 4E03A 2R0QC 2XQGA 4AUEA 4F84A 4M54A 3ZPXA 3L0ZA 2VZEA 5CYPA 1XLVA 1ZNQO 5SY4A 2HJ9A 2YMMA 4LXQA 2VDWB 3R7WA 1GDHA 3F8WA 1ZN2A 1C9YA 3ESRA 4MWCA 4O4HF 4WLFA 1ZK2A 2I4IA 5EE0A 3OPNA 5FA8A 1UBMS 1P0PA 2J7PD 3F4LA 4KTVE 1YIOA 1B8OA 1DRWA 4IIGA 4TX1A 1KVQA 5F23A 3WV5A 1NKVA 2OENG 2O8NA 2H2FA 4J8PA 4J1TC 1JDNA 5A4AA 2E48A 1KI8A 4KLRA 2YY7A 2YFHA 4X1IB 1PEYA 4BPBA 2HADA 2JPDA 3SLKA 3DOOA 2PAAA 2J3IA 4L0MA 1K8ZB 1Z07A 4N0DA 1QK4A 2W37A 4GSYA 4MV1A 1RVV1 4Y8VA 2JJ2A 3RU2A 3ZC3A 2WHQA 3JVDA 4CM1A 3TLGA 5K8LA 2IUFA 1T2VA 4L50A 1RE0A 3AVTA 2D0DA 1E99A 3FPSA 5C31A 3C6XA 1IONA 1HWYA 2ZR0A 4QHTA 4OFXA 4PN3A 3RUHA 2HU5A 2QTVA 4W1QA 1FSSA 1O6ZA 2AH5A 4GPTA 2ZATA 2AS0A 4J2HA 3SZLA 4OX9Y 5EEHA 3ZXYA 3B6IA 3QLTA 2VSFA 3KSZO 4K0RA 5A5GA 1NUHA 4ZI7A 1QU2A 4OOFA 4MIEA 1K5PA 3WYNA 5JQWA 4Q7KA 2GXQA 2QN6A 3GZNA 4R68A 5D84A 3B36A 2X8JA 3HVIA 3WB1A 3X3HA 2FWAA 4JU8A 1YE5A 4JQOA 5G0SA 1D2GA 3UV7A 3SR0A 4CMAA 2Q29A 3ORFA 4K8OA 5KYYB 3H2GA 3NHMA 1RZVA 3NC0C 3CPEA 2P75A 2MJLA 4KXLA 4Y6SA 4HGNA 3W7VA 2WJ4A 4LJ9A 5K7SA 1F7UA 2BI7A 1NTOA 4LYDA 2ID7A 4UE2A 5CLIA 2BE9A 4FHZA 3RVPA 4OHBA 2FMIA 5T8KC 1U0RA 2YXDA 4OQZA 4YRBA 5CBPB 1XMVA 2C9OA 3MWYW 3R3ZA 2JFVA 2REQA 4LQ4A 3TJZA 2OB1A 3JAWB 3M6IA 4I08A 5FYDA 1WD5A 4J7XA 4TLCA 1Q0TA 1ABEA 4P3YA 3P52A 4LRQA 1VPEA 2DSNA 2OC4A 1L5YA 4FGLA 2HR1A 2GN0A 2FHSA 2Q2VA 4OU5A 3ETDA 2PIDA 5KMGB 4AW9A 4C76A 1E7RA 1FLDA 4PLFA 4ACAA 5K51A 1GYPA 4KGVA 1CUYA 2RGUA 2OXIA 3O84A 1CJKC 3LHDA 3QI2A 2B4KA 1OPRA 1C9MA 3WKBA 2OCLA 3ETCA 2BTQA 2Q8PA 1S4MA 3AINA 3ETHA 3JD4A 3OF2A 3HDTA 4OXYA 4XASA 3T8YA 3EPLA 1E1YA 5K4AA 3RIXA 2RI1A 3RI3A 3KKLA 4BVAA 4EVIA 2HJVA 4QUEA 1S0UA 1YUNA 2P41A 2IOQA 1BXGB 2VHVA 1R6UA 4UREA 4HJRA 4FFWA 3LVQE 1UF9A 3TG8A 1K8XB 5CX1A 4ZAWA 3SS9X 3BT7A 3H3XA 2R60A 2K4MA 2Q2WA 3FUXA 3RS4A 3SM9A 1F38A 3V4VB 4LV6A 5IFKA 1TYCA 1P2VA 2AX4A 3QYAA 5K5EA 1WCIA 3U09A 1BXGA 3IBCA 3QPUA 3WBBA 3E1GA 5K0LA 5FOQA 4NG5A 4WOPA 4NATA 3ZIAA 4YRAA 3U16A 1JMYA 1E6KA 1YKGA 3HJGA 3UH0A 3WQQA 4QYWA 5HKKA 2P4HX 5LOVF 4KGXA 4TUYF 2OV2A 2XUHA 2R87A 3JQ8B 1YRBA 4I4CA 3DP7A 2Q1TA 4LZOA 2ZZKA 4O8CA 1UADA 1ZOOA 2ZT5A 4MYDA 2HU7A 5LYJA 1P2DA 4DA7A 4MWOA 1RAGA 1RC8A 3KJHA 4KE7A 3PDIB 2PWYA 4C7OA 4OJMX 5I9IA 3M4NA 3TE7A 1ZLYA 2ZTSA 3I2YX 1B3RA 1YTLA 3Q72A 4IF4A 4JSRA 4CL0A 5CFLA 2C8VA 3FCXA 4LXGA 4F72A 3A2KA 2V9CA 4C6SA 2Y1XA 2VUUA 5EESA 2B9VA 2CMKA 4V0NA 3IPLA 3HCNA 4M0KA 1HT0A 4F12A 4RK5A 1A8UA 1SA0A 2X6TA 2AJLI 3MVEA 4XM2A 1BE6A 3EEOA 1NC1A 5HJ2A 3LA8A 1EFHA 1X1EA 1UMKA 2NO0A 4DQKA 5E7MA 4JB0A 2P69A 2BEWB 4HMOA 4B7UA 4X8LA 1GRNA 1AX9A 1EE2A 3OTIA 5A02A 1EINA 4YRCA 3RQIA 1PS0A 5C2JB 3WRYA 1NJ2A 3LXMA 5BOSA 3TOVA 3G82C 1PW7A 1TM3E 1XQXA 1YRQA 2AN9A 3A4MA 5IJWA 2CEKA 3N2EA 2D3WA 4YRRA 2AQKA 3OFND 3D3JA 3HL0A 4P98A 5FNVA 2QJOA 5BQFA 2RHJA 1RI4A 1U6IA 2JGIA 1H1TA 3BMNA 4HEA1 4R0VA 4XD7D 1QRTA 1P19A 1Q7RA 1QV6A 1UQTA 5FOTA 4DDKA 1S2DA 2MINB 2ZKIA 3HV0A 1RLMA 3RYIB 2WTMA 3ZN2A 2NTEA 4EG7A 4G6ZA 4CIDA 4LPKA 3S7ZA 4WFJA 3WFIA 1UKZA 2QRMA 4OIMA 2HD4A 4RKWA 4EX7A 1XCJA 1YRLA 4U2BA 5CJ2A 2G83A 1T8RA 5DX0A 4PZUA 5F2OA 2CNDA 2OCKA 4KAAA 1Y8CA 4CM3A 2WJPA 2GILA 4DLUA 4FE4A 4JVNA 3ZHTA 4WBNB 1F3OA 3O26A 3ASYA 3BXZA 5J4VA 1MGOA 3HVKA 4J1NA 4IUBS 4TQ9A 1FSGA 4JL6A 1OI3A 4JUIA 3GJ5A 5CBPA 4E15A 3VR3A 3R7SA 1EGAA 1T6NA 2N75A 3HBAA 4I55F 5BSHA 1MZPA 4KYUA 1MJ5A 1J5PA 1QQ6A 5TQ0B 1MFZA 1WVGA 3AFIA 1KPIA 1H8HD 2C5EA 3C70A 4XAQA 4B3BA 1U0NA 2CEAA 2AFHB 3IL2A 4R51A 1W49A 2ZSIA 3GFTA 1HOTA 3JTEA 2X8JB 5I8WA 3IIEA 4XQGA 2J9XB 1FX0A 3BXOA 3A7DA 3CRZA 3E4DA 3PQ6A 4FHEA 4KQ2A 4N0EA 3S8MA 3JQFC 4P7JA 5K0CA 4BN5A 3OLCX 4Y9UA 1DT5A 5BVHB 2H8GA 3ZV7A 2QB5A 4B32A 1ISIA 3R3XA 4LHSA 3IJ5A 1JEQA 1ISGA 5LZ9A 3L0PA 3DLTA 5D85A 4DCJA 4YASA 4K8RB 4EJSB 4GDMA 4DDHA 3PDUA 4PZ0A 1J2YA 1WDLA 1E5VA 2PL9A 2H5JA 1I9CA 4JLDA 4MINA 4O4IF 4EG3A 1YZUA 1KVRA 2P1RA 3NHSA 4MWZA 2ZUSA 3T94A 3MUOA 3OIGA 3JAWA 1PDWA 1QYCA 3KS9A 3QOXA 3GCWA 4C3UA 4O1HA 1QR2A 3MMXA 3BH0A 4WZBB 3UMCA 3VC1A 1WU8A 3KOMA 2QUIA 2ZI4A 3DDUA 3EC1A 4NH0A 4EAAA 3HMQA 3W9UA 1NDQA 2A5LA 1JB1A 2PMDA 2QZ4A 3ESBA 3HJHA 3QA3E 2NSLA 4UPVA 4ZPXA 4KXVA 2H1SA 5IC5A 4DT1A 1LTKA 2NT4A 3MNFA 3FOEC 5HQTA 2HQSA 2QLBA 3DLAA 1IN1A 1OFUA 1JE0A 2X9QA 2PJUA 1CVRA 5CA0F 1USGA 1VG1A 4G86A 2VJCA 5JSFA 1BOOA 1C7IA 1SC6A 1GL6A 5BQPA 2CLHB 1ICEA 1XDZA 4TWZA 4HYYA 1G18A 2I9KA 4ZP1A 1V6AA 5A7HA 1P61B 3DS8A 3RTGA 3ZHCA 1GKLA 3U3ZA 3AYZB 4HVTA 4PLHA 3KQWA 4YAFA 5CIYA 2VF4X 3QF4A 4V0QA 3OE1A 4BLUA 4CZ2A 5JAUA 2CVPA 5CX1B 1CSEE 3R3VA 3OQOA 5DYYA 5EJ6A 1G9XA 3G8AA 1U28A 2G9NA 1XDBA 4FZVA 3Q8WA 4AG6A 4AZTA 4F71A 1NF2A 5IANA 5J1TB 2ZU6A 3L18A 4RIHA 4YAJA 2E9SA 5IT0A 2GCNA 3O1HB 1J9ZA 4UULA 3PUVA 2VDVE 2PHZA 5L7TA 1V2HE 3TBFA 1FJXA 4AX4A 3SDBA 1AGPA 3F6BX 2BGRA 2H3EA 1A4XA 4TLMB 2IT1A 1XZJA 2BFOA 3GT3A 1E79A 3C74A 4RADA 4GNRA 5EJEA 5JMOA 2IEDA 1Z4JA 3IPCA 4ZYUA 4XX1A 3TCNA 2NXNA 1F2TA 2XCIA 5KJCA 4R2LA 5AQ1A 4XUEA 2ZIAA 1P7WA 2HLPA 2YRWA 4UOZA 5IH7A 2RK3A 2PJZA 5JVDA 1NVAA 2FPMA 1BD4A 3H1TA 3WGLA 1IJBA 2CL7X 3BJMA 1LJLA 4EYKA 4OJQA 3MWKA 4A8JA 2BFCB 3IUMA 4M87A 1A9XB 5CVEA 4C4AA 3A4TA 2B37A 5BSMA 2OHXA 3GLHB 3BCUA 5M34A 3UBTA 1ZYUA 3U4QB 1BH2A 1ADYA 3DF7A 4TMWA 3AT1A 2VZ0A 2JD2A 4NOMA 3TS1A 3C24A 5BWMA 3K31A 1YOVB 3RIHA 4XYLA 3IDZA 1NC3A 1Y5NA 3FAZA 3GJSA 3NIFB 4B84A 1SCIA 2ZB2A 1P45A 3U61B 2GBCA 5AQEA 5HKBA 4YYEA 1GQRA 1A8PA 1AF7A 3C3PA 4DQ0A 1QPGA 4G8CA 3VDXA 1JKJA 3DE0X 3H83A 1C3OB 1GO2A 3HWWA 3ONEA 4P8RA 4YRLA 5KVVA 1PE0A 1FMTA 3BTOA 3BMNB 3GJ4A 3U4AA 2ESRA 1SWWA 5SV2A 2ODPA 5A0TA 1QFSA 1QOQB 1ZC4A 2WJVA 1QGZA 3FZQA 4UBMA 3SIWA 4XUGB 1RWWA 2HHLA 1QIDA 5I7FA 3AHIA 2WFMA 2J0UB 3KR1A 4E13A 4QE3A 3RBZA 3GX1A 3MTDA 4JLBA 4UU1A 3VAZA 2W6ID 3NBZC 1G9TA 3QUQA 4K2AA 1U3VA 1IPFA 3JYQA 4W5HA 5J5VA 1XEXB 1OKKD 5EJ8A 1W0JA 1LC3A 4ZVQA 3OLVA 4QIHA 2IZ0A 3EZXA 1SXGA 2LIPA 4L2IA 5BW5A 1NG9A 3KPJA 3M4XA 4YJGB 1F0NA 2FAXA 4O4HB 1I0IA 1S8NA 4WY5A 4XVHA 3UMJA 4AROA 4DQUA 1YTUA 2BFAA 3RSFA 1TA0A 3TOZA 1J1UA 1TCCA 3Q3CA 4PLPA 2XIJA 4F9GA 2PQ0A 3L3BA 3BREA 1WVIA 2ST1A 5EWJB 3CNNA 1N6IA 4JEMA 5HZGA 1SD2A 2E7ZA 2W9XA 1NF3A 1Z83A 2C9ZA 2HREA 1IZZA 2H7VA 2VJYA 4D9MA 2Y3IA 4MV7A 1MABB 1RJWA 2GQ0A 3G8YA 2QPOA 4CYMA 2ZQYA 4Z1MA 3B2NA 4EB6B 3PCXA 4YCCA 1NZDA 2W42A 2Q21A 3GDHA 2W7TA 1KO5A 2QTRA 2QVYX 2KLBA 3KQVA 3RUEA 1CTQA 2OBNA 2OWEA 5FH9A 5KTRA 3W4IA 5GJWC 5B55A 1Q1NA 5KYUB 2O0JA 3GPBA 4F4CA 2RARA 4KSBA 3IVAA 1EFRA 5FBZA 2GMWA 4LDPA 1I7PA 2PGLA 1NR1A 3K9BA 3WIBA 4O02B 1A2QA 3ZUPA 3F6EX 3QTLA 4Q9AA 5CIQA 1RWQA 5EIWA 4KWTA 1M2VA 2BM0A 5K3SA 4OBEA 3RVJA 3UKJA 2WUGA 3E81A 1AZSC 5BN4A 2VTBB 1Z6YA 3IAFA 1O5OA 4I1OA 5MN4A 4YMUA 3U13A 3PFHA 1FCJA 3SXUB 1OLSB 4DRYA 2NPFA 3L93A 4CIBA 1DIRA 1VHJA 4LZAA 1LVHA 4YFVA 1NFQA 2B4YA 3AIMA 4P92A 3HUDA 1DTWA 6REQB 3F5DA 4P5PA 1YB2A 1WHSA 1RABA 2A9PA 1KJ9A 2IYFA 3DV0A 3K4PA 3ANMA 2A7XA 1C7QA 1TM7E 1WUTA 4DLWA 1ZLXA 2JIDA 2BISA 4L22A 1P4JA 5PNTA 3ROQA 1E1RA 1K9SA 1CLUA 2X7JA 2W6JA 2XAUA 2JGNA 3H86A 1TC2A 1ZUHA 2O2IA 2W4QA 3DZGA 3G3EA 4JELA 3STXA 1LWNA 2V5AA 2E4WA 3U31A 1R6XA 1P9OA 4BMXA 4Z6KA 3AF4A 4H0CA 3UGTA 3Q3GE 3OIWA 3AUYA 1XWFA 3PFIA 1VJCA 4TTIA 4DUGD 4WASA 3DKPA 5G1OA 3WJ2A 5BSFA 1WXFA 1CF9A 2Y76A 2ORVA 2WZBA 5FUWA 4BNYA 2HFKA 3C3JA 2QN3A 2F8SA 1EHYA 3H9QA 3W1VA 1V8ZA 5LLDA 2QGZA 4AU1A 1DBIA 4IP0A 4BNTA 1RI3A 2O7SA 1I3MA 5FHRA 3MAJA 4RE5A 3P9XA 1JWLA 3VKVA 2JB9A 4POAA 1QQTA 4MR9A 1DAFA 1RS0A 1AC5A 1N9KA 2DFPA 2QY9A 4RVNA 2FFQA 1UC9A 3NJ8A 4HQ6A 3V7YA 3VR5H 1KY2A 4ZO4A 3ZDQA 1EJ2A 2A0YA 3NKFA 2XB2A 2ILVA 4EMUA 1FXUA 1OXXK 1B3BA 5FWXB 2IYEA 3O3NB 4GX1A 1DBRA 1Z4NA 1GQOA 1YVEI 3NBYC 1AS3A 2BTOA 2FPUA 1RKQA 2GEDA 2OMEA 3LWBA 2HF9A 3MCZA 4QQRA 3CE6A 4H1TA 4RHTA 5CW2A 1P91A 2AZXA 2O50A 3AKEA 3H0KA 4NCAA 2Q6KA 1NQXA 1ECGA 3WLPA 1I7DA 4R01A 3G0DA 4JVSB 5ARCA 1F17A 1MPTA 3NM5A 3A4LA 3ZZTA 1TEVA 1Z12A 4MW0A 4KQ9A 4IFIA 1YOVA 2CMHA 2DE0X 4PCAA 1U4SA 2D54A 4ZJPA 1QHHA 3C97A 4ZVKA 4C2TA 1O8BA 1DUSA 1FIUA 3L6EA 3VTZA 3FWPA 2CJXA 1Y5MA 1PYDA 2J9FA 1VRCA 1SBYA 3EY9A 3KUKA 3LT2A 5EHIA 5H68A 3WL5A 4EKNB 2D5CA 3LWNA 4KZPA 5IYZA 4NP6A 1UP7A 3F9CA 3T1HB 3L0SA 1UDXA 1J2JA 1RBMA 4RKRA 1LTHR 5IJZA 1JJVA 1NJ1A 5CH8A 5IPFA 1JQ5A 2G6BA 1E7MA 2J7PA 1OZ0A 5H4HA 1E1QA 1WOMA 3LXRA 2I8CA 2COUA 3VJLA 1E3IA 3IVMA 1C3LA 1TLTA 1UKYA 2ECOA 1T9CA 2J1LA 3AF0A 2H9YA 3DNPA 3H4IA 4DIMA 1SVUA 3G0HA 1PJQA 2XLBA 2A9JA 1YBAA 3IERA 3LCVB 4QXQA 2WJHA 2BBWA 2Z5FA 4IFEA 4HLNA 4Q19A 4PX9A 2VPPA 4ROSA 5FUBA 4PZLA 1IXYA 1SRQA 2YZ2A 3DDHA 1NXXA 3LUKA 1GGKA 4JLNA 1A2KC 3ORHA 4OGKA 2FOIA 1XRQA 1E6CA 4L78A 3UBMA 4DWWA 4V38A 4P0PB 4OXRA 1E9AA 2XUGA 3OTWA 4G9EA 5C8YF 1RYDA 3Q0EA 3O8CA 4E22A 1QH9A 1VKOA 2VT7A 4LZNA 1Y1PA 4UTRA 1FTYA 3JARA 3EGDA 1VL6A 4Q9KA 3VKUA 3H3FA 4P5EA 2JIOA 2YYAA 5L45A 2O8FB 4PANA 1H93A 1IHPA 4JLOA 4QNRA 4TKMA 1IE3A 4G81A 4N12A 3SJAA 4D4GA 4PRYA 1DG9A 3IXMA 4YMGA 3DBHB 1F5SA 2CWWA 1ZKDA 2E6UX 2BZ1A 1BKYA 1TVKA 4ZREA 3VZQA 2H5LA 1IJFA 1WTAA 2BN4A 2JGJA 3G88A 5FORA 4Q48A 3ZTTA 4E3WA 3DQZA 5C80A 8ATCA 2PQ2A 2YDYA 1DAPA 4IS3A 2J4CA 3JYHA 3KT6A 2GBLA 2BI8A 1IWPB 3KL2A 3QXJA 2QUJA 4RGVA 1SQ6A 1DO2A 4JGIA 2BPOA 3JASA 5E2IA 2KSQA 5D1NA 1JLHA 5GWXA 5H3LA 4HAXA 5JWHA 4MDYA 3VNRA 4CLOB 1MQ9A 4US2R 1D2CA 3C3DA 1P5FA 2OV3A 3T9BA 4HNUA 3FVTA 2AOWA 3NOOA 3WL3A 2R8YA 3F71A 5DYGA 3SYNA 1BS2A 2I1LA 3RSHA 1BXRA 1Z2NX 5CVDA 3DQPA 3IR5A 4Y3UA 4WXRA 5A5DA 3S2YA 5IJ0A 2ZS9A 2WP0A 2I80A 5FWAA 2IRWA 2BM1A 4Z1OA 2CHFA 4Z49A 5JADA 3Q8LA 2FDCA 1U8UA 1QB8A 2YC4C 1CR6A 4EHAA 2OKCA 2WRZA 2H2DA 3PEUA 4GX0A 4R2JA 4CKBB 1FA9A 1VC2A 4RIGA 1ISJA 5LQKA 1GPYA 3CLRD 4NXMB 4RF5A 4LNUB 3D6AA 2F1IA 1N5OX 2PUTA 1SCDA 3H5TA 4XQEA 1PDVA 4EO7A 2NO9A 3TLEA 3O8LA 1V5FA 2JLRA 3DMFA 3MMZA 1ISMA 4E30A 2ASVA 1G60A 3HVJA 4Q4JA 3BRWD 1O8CA 3DVAA 3H1AA 5EUQB 3OT4A 3ZLBA 3H4VA 1S3FA 3B9RA 4IG4A 1BHSA 2VQDA 3DEAA 5GGXA 1WDMA 4L0CA 2P7IA 2CVHA 1KEEB 3FMFA 4GVLA 4HD8A 3ZXUB 1RM0A 3CVUA 1B23P 2P27A 2F9MA 5FBLB 3PTAA 5F64A 2EGGA 4MR8B 4TTPA 5JH7A 2VP4A 3IAXA 4RVSA 3AF5A 4M89A 5IAKA 3TM5A 1WIWA 5C8VA 1X70A 2V59A 2PX5A 2AQIA 3RM3A 4LVCA 3DB1A 2FX5A 3E3MA 4R3NA 1WO8A 3GQVA 4AJJA 5HG0A 2EWWA 2C88A 2QW8A 1PFVA 4EHDA 1O94C 1W88A 3BVPA 3I01M 5BNZA 1YRWA 3MT7A 5JR3A 5BVGA 1C1HA 2CJWB 3KYCB 2BBTA 4RESA 1MO4A 1QDLB 1H94A 3EPJA 4DA0A 1KBOA 3FLBA 3W7BA 5AVQA 3U6BA 3WK4A 4OUKX 4HO1X 3INNA 3EMBA 3LYLA 5KX5B 5F1YA 1EZ4A 3HHEA 1CJUC 3KUCA 3A3PA 3QELB 3N8GA 5B2FA 4HCJA 2CFIA 4FBLA 2J4FA 4RHEA 1WQ1R 2AFHE 2D59A 3W34A 5L6LB 2D13A 2EFYA 2O06A 2ROQA 2WM9B 3GGOA 1SXJA 4LG1A 4PZYA 2CUNA 2WSMA 3KUUA 5CFOA 4S3MA 1W52X 2ZROA 1R8JA 5EHNA 4MYHA 5AKJA 1H85A 4F04A 1C80A 2WOOA 3UHFA 1YFZA 4R5MA 3A6JA 4L85A 1SMKA 2QAGA 4H6PA 1Y4UA 1VIYA 2CFOA 2VT6A 3BERA 3BMOA 4NG4A 1D2HA 2GVZC 1YA4A 2V5VA 2Y6VA 2IIQA 4MS1B 3RRZA 2I4LA 3QUTA 4KE8A 1L1RA 1P7CA 2G9QA 2NU7A 2WNSA 2XI4A 4D1YA 5KOJA 3D0OA 1MG5A 1Y9JA 3I34X 3UK2A 1XJ5A 4QUDA 3EDCA 3R3HA 3STVA 1F2UA 1EVEA 2HMYB 2ZIFA 3QEKA 5LXTA 1TF5A 2GPSA 1KI1A 4QAJA 1MQ8B 2PGJA 1SVLA 2I0FA 2CZQA 4L6IA 3VHRA 3SZRA 3DTYA 3ZR4B 3TOCA 5AVRA 2VRNA 5JSQA 2BFEA 2C7GA 3LOQA 4YWJA 1EX9A 3LXUX 3PEFA 3WLAA 1V9SA 1CY2A 3I9MA 5ISMA 3AW8A 3PI6A 4NEQA 2DOKA 4C30A 1YDHA 2ZYAA 3FSEA 1GQYA 2GZ2A 1KOJA 2O3QA 3ND5A 3R0QA 4EW2A 2H11A 2G09A 1PSDA 1T9ZA 1LDBA 4BCDA 3DVQX 1DU4A 2X2OA 3I5XA 5ALTA 2H4HA 1K3TA 2BGNA 1UANA 1AQUA 4ZICA 1U0BB 1RAHA 3IQFA 5HF6A 1E6EA 2OHOA 3M1LA 4Z9BA 1L4EA 2EL9A 1MQAA 4MV9A 4KG7A 4PZPA 5ERGB 3OH8A 4BVLA 4BUJA 2ZIGA 4FGUA 4QC2A 3O2NA 3BHIA 4P4TA 1NI4B 3UICA 1RWMA 1DFIA 3FVWA 1AUPA 1G20B 3P45A 4YJHA 4A4DA 4RY2A 3RYHA 4MZXA 1KQPA 2YS7A 2V7BA 3RB8A 4KMRA 2Y8EA 1D2RA 3KXLA 4C5BA 5JEEA 1E6LA 2B0JA 3ENZA 2BSAA 2PO7A 4FMCB 4CGZA 5F3WB 4ZTBA 1K7SN 2QNIA 5FTWA 4CKCA 2FWPA 3P9YA 5BMOA 3QXGA 4ZAZA 1HK7A 3D4LA 4UUBA 5JJ5A 2ZJ6A 5ALGA 1FU7A 3BXHA 5IKXA 2IOFA 3CTMA 3FPFA 3CIFA 2FZVA 4NNOA 1XRRA 2I2DA 2QTZA 4GLOA 4Y6QA 4ED9A 2B7CA 1M8PA 2CDCA 1CK4A 2XA9A 3Q8MA 2JRLA 1E64A 1VBNA 3DCIA 4ENVA 1KF0A 3IP5A 3W6UA 3WDLA 4EYSA 5EIEA 2Q62A 4XD2A 3ERCA 2JEYA 1J8VA 3HPQA 3CW8X 5GM2A 2G80A 4IIHA 1C30A 1XRMA 4JYCA 4IUCS 2WJZB 1CR2A 4RK7A 1VG9B 3IULA 4OM8A 1WKVA 5JYBA 1PZFA 1D07A 4LYHA 2R6ZA 3GMSA 1O6BA 3X2FA 4E5MA 4XJSA 4PPQA 4TS9A 1TZCA 4QODA 4B79A 3OOSA 1T9KA 1H66A 2PKXA 1IWOA 1LKZA 1YS4A 4IMJB 4B40A 1NMSA 4P86A 4XX0B 1R0WA 4QM7A 2HL6A 3MS7A 3P26A 1GOTA 2C7VA 3FDZA 4JBLA 4E6PA 5BORA 4DPMA 4F6CA 4RCZA 2DUMA 5AVVA 1VMAA 1AKYA 4U7TB 3FDJA 2JFQA 4D43A 3SBOA 3RT7A 1RQGA 3UO8B 2JIMA 5MGNA 4O4JA 1MAAA 2OKGA 2EW1A 2Z5GA 5ABPA 2VH2A 4RTNA 2B82A 3DDSA 4URWR 1BA3A 1HLPA 2X5NA 1DI0A 2XGGA 2YZGA 4HKTA 2WJAA 2ZYIA 3UJ9A 4A6XA 1VJ1A 2F1JA 1K7XB 2Y1FA 1Q84A 1VLLA 3LQ4A 4KIFA 4QRDA 1Q1AA 5B2ZA 1TEXA 2PKWA 3W5VA 4AUKA 4OYYA 1ETHA 5AHKA 1MB3A 4DLBA 5AVXA 1Y1RA 1K8QA 3LECA 5D7BA 2EGHA 4Z9XA 2C9MA 4HB3A 5D3MB 5HRAA 2P78A 3DOCA 5HJ7A 4R8VA 4JX8A 2Q6TA 1GPWB 4KK4A 3ZWNA 1LK5A 2V97A 2BGWA 1G8YA 1WHTA 2HI0A 5CH3A 4L3VA 3P0RA 3P32A 3CN9A 1UBJS 1JIKA 1SOWA 1D7AA 2BFDB 3ANNA 4TXLA 1TZ2A 3BF8A 3V4LA 3AY0A 1GDTA 4KYTA 2D6FA 2BFPA 4RYDA 3CLUD 3LQ2A 1O77A 1QJ4A 2B1GA 1K3FA 2HA2A 3GXOA 3HEAA 4ZO8A 4GM1A 1WP9A 2QSYA 4HLUC 4JC4A 3HJUA 2H3HA 1GP2A 4FSHA 4LA4A 5ANRB 3T7TA 2VNKA 2F17A 2VK4A 4D99A 3OLXA 3KKNA 5LJLA 1SELA 1U1IA 3RUAA 2PGAA 5JZBA 3ER9A 4OJYA 2ZSUA 1IY1A 4D74A 4CU5A 3AJ8A 1I5OA 5EP1A 1OGJA 2W6JD 5JAQA 1QVAA 1RHUA 3HCDA 3D3NA 5KX5A 4J76A 2IDMA 3G6KA 4I81A 3ROFA 3BJIC 1UZLA 1XRJA 4UU0A 2HIAA 1YRAA 1U9YA 2PKQO 3G89A 3AMVA 2EAUA 2PU5A 1C1DB 2O8EA 2VEOA 1SCQA 2A33A 4JI3B 1LPAB 1DBSA 1M34B 1PWXA 2VHXA 4TL6A 4UCXA 3ZZUA 3GPLA 2QTHA 4K5QA 1NJFA 3S5JA 1K6EA 4MLZA 4I4NA 2WT8A 4R0MA 1IMOA 2GRAA 5FUXA 3P2MA 1MHTA 2O8EB 1XQ1A 1N57A 3PB3A 1QYDA 2WABA 3C5VA 3JZFA 4US0R 1E96A 2AVNA 2FG7C 2HSDA 4U5XA 2ODQA 3UG6A 3ZNPA 4BRUA 5CFZA 2ZI3A 4BB0A 1U2GA 2R4TA 1LH0A 1N6RA 1YB1A 3N05A 5AJWA 1PGNA 5ILOA 3EXHA 3H04A 4FZJA 3OJWA 1K7FB 4BMOB 1YQTA 3F6CA 4PO9A 3ENNA 2NU8A 4ZVNA 2DUNA 2Y0PA 3QIAA 5BN1A 1A9PA 1HG0A 3DUFB 1QZTA 3ICWA 1J2RA 2VG8A 3DE4X 4UU8A 4WHMA 1T9DA 2P9BA 1K63A 3GEEA 3I5AA 3EZNA 4NYIR 4RQTA 4KKXB 2GYYA 5LLSA 3WKAA 2FMHA 2PWBA 5ALEA 5U4QA 5LQNA 2JDID 1G8KA 9ABPA 1X1CA 2O5CA 1BMFA 1B43A 1EEXB 1WUHS 5DK4A 2HBQA 5E9WA 1L5VA 1AJEA 1BE1A 3DBVO 4Y9DA 2YJ5A 5IJAA 3SYTA 1IOLA 2EFHB 5DX1A 1KFCB 4DJJA 4J7AA 3GRYA 5CNIA 3ELWA 2CMDA 1QLHA 1O95A 2EW2A 3PC2A 3TN7A 4FMDB 3C1AA 4XSVA 3TTTA 4P80A 2X5OA 1QWSA 1KJYA 1P4HA 2GZ3A 2Q5IA 4L5YA 1V71A 2HKIA 2PA3A 2IYSA 3U5ZB 1HE8B 5FUQA 5ALSA 3A70A 1JR3E 4P3NA 4RZHA 4IIDA 4Z3OA 2CD9A 2ZRJA 5EC8A 1WSWA 4S1OA 4YJHB 1C7RA 2GK3A 1Q0LA 3M0EA 2UVPA 3RUDA 3HXOA 1UKVY 4RD3A 4HUQB 2H29A 2VNHA 1F1JA 4WIAA 1ML4A 4C0XA 4HOYA 4B9EA 1YQ9A 1L5LA 1EIZA 3HXKA 3MOSA 2BC9A 2NWQA 3AR4A 3HP4A 3IDFA 3NBUA 1AO3A 2I7DA 2EDCA 1PI3A 1S2LA 2ZS8A 1YMQA 5JBNA 1BNCA 1R88A 2H1HA 3KZOA 5TJHA 4CIAA 3NXKA 2ZI6A 3W6NA 3HRHA 3ZNQA 5ED4A 1MC1A 2QN1A 3RVQA 2RG1A 5A4KA 1PNQA 1CHDA 3LNCA 3MT9A 4MARA 4MWTA 4RL6A 1G8AA 3TTWA 4MTCA 1G2PA 3NKLA 3BE8A 1XL0A 3UPUA 4OLAA 3EYWA 2MIIA 2NP7A 5LMCA 4LOHA 4HAWA 4LF9B 3EZFA 4RLFA 1XTTA 4PLYA 5HS6A 4B46A 2OCIA 2XITA 1DQPA 3WRWA 4ZZIA 4E21A 1K66A 3DE7X 4IXTA 4EKYA 3KM0A 3B6EA 3DLHA 2X0KA 3PX3A 1TADA 1X1BA 4LRSB 1K0UA 2SCUB 3J7TA 1II9A 3NKVA 2AUTA 1SZJG 3HKDB 4M9UA 1QIFA 4PS1A 2ZSHA 1FU4A 1QE0A 1AB5A 1VL5A 3CEHA 5JD3A 3U44B 4KGDA 1LY1A 2LRHA 4HNGA 4ESVA 4KBGA 3OHMA 5IKPA 2W8BA 1LTQA 1ZBQA 7ADHA 4AT1A 2I2XB 1D5CA 3HFSA 3V42A 3WGHA 2VLIA 2HHJA 3UFXB 5LP1A 2DFNA 4UJ5A 2W2KB 5KNCH 2UUCB 2HRQA 5KJ1A 5HSGA 3SKYA 4DG8A 3K2IA 3E7FA 5HYVA 4IO0A 3HO1A 2XYRA 2Q3FA 4C6TA 5IM5A 1EQ2A 4Q34A 3RRFA 1BAPA 1XG5A 5M7EA 1KS2A 5LYJF 2C04A 4QXRA 4YEDA 3WAGA 2PGXA 3KG2A 3HP1A 3RTAA 1B6GA 1PLLA 1N5IA 2LCIA 3BB1A 2CJFA 1FEZA 3ONWA 4HZUB 1F48A 2I7CA 5DM0A 4OQEA 2QR3A 4XB2A 5B1SA 5HGXA 3I76A 2I91A 4RMNA 1KAHA 4BNJA 4ZN6A 3N70A 3QGMA 2B2NA 2GESA 4OPMA 4F1WA 1E2UA 4IDHA 1MRNA 1XCOA 4P9NA 5EJGA 1T1EA 1F4PA 1TE2A 3Q9UA 2Y05A 3O3OB 3KVNA 3LUAA 3FGNA 4HDRB 1JDVA 4KO3S 4NEGA 5E9QA 3O38A 4JHXA 3TXXA 1O9HA 4PAQA 3G5MA 4A5SA 5BWOA 3C6QA 2VEDA 4KYVA 4Z7OB 1Z8FA 4UHHA 4WY2A 2GHQA 3WLHA 5IK2D 5IZ4A 5J2UF 4DYVA 2JKZA 3QPVA 1Y80A 2PSFA 4KU4A 5D2CA 3CLTC 1RRPA 3E7WA 4WLEA 1E3EA 5DN6A 4DR1B 3A8TA 4LGMA 3MJVA 3CNLA 4RH0A 1JFRA 3IAS1 2C00A 3OM1A 4MQ4A 3ZU3A 2VBIA 5CT5A 3DUWA 2N42A 3W05A 3UXMA 1JZQA 3F47A 1LW6E 4KQEA 3R9KA 1CVIA 1O5TA 4RKFA 3LGAA 5LKAA 2ZBVA 3OT1A 5GJBA 1N8TA 4L15A 2QI9C 3DNFA 2GCEA 1PJTA 1T10A 2WD7A 2DKOA 4N39A 2XSZA 1AK9A 1KRHA 2H06A 3R6TA 3RTBA 4EX6A 5LM3A 4ZTUB 4HFJA 5C7YA 3QMPA 4E2WA 5ALXA 1H8EA 2AOTB 3EGVA 3QUSA 2R66A 1F8FA 4PVCA 2JD0A 4Y2JA 3RBXA 2IHVA 3TFQA 4B85A 2FJUA 3ZJTA 1TIBA 3RRNA 2HTFA 3VOAA 2XGSA 3SF0A 1OYVA 4YPVA 3MQFA 1S2OA 3OBIA 4ZYVA 1UZNA 3A4VA 2YQZA 1W75A 4JCCA 4OQMA 3TEJA 2EX1A 1SPBS 1ZD4A 2VHTA 1ECLA 2ZULA 3JR3A 4XEUA 2ENUA 3M6VA 4E5KA 1B6TA 1E77A 3KR2A 2MU1A 3EH2A 1QBKC 2UVPB 2VAVA 3HCPA 1U81A 3V3KA 2REOA 3JW8A 2WTBA 3IC5A 4LY0A 5JD4A 3EOAI 4S1TA 3UM9A 1DJQA 3W3ZB 5SY6A 4Z3KA 5B36A 5CB8A 2FR8C 1ULAA 2V7XA 2FG5A 4G8DA 3OQ1A 5FPTA 5EE9A 2HJRA 4DA8A 2ID9A 5TXGA 4A2PA 1Z63A 4MCHA 5BYBA 2JGFA 5I7HA 4HXGA 1W8IA 4M55A 1CDDA 3PKJA 2M6KA 1B7GO 3RC9A 2DPGA 1WVMA 3TPFA 3VRHA 3ZBTA 1G8FA 4P93A 1W46A 4QLOA 2PD6A 2YXPX 2D2FA 4B33A 3C3MA 4ZT6A 2QRHA 3OBBA 2YWEA 1YFJA 4G84A 4H1UA 4XVUA 3TYXA 1F14A 2B25A 2O2SA 3LYUA 3R5SA 1X8JA 4QPZA 1KMHA 1UT5A 3ANLA 4QUGA 5FBRB 3H5LA 2IHUA 4HGQA 3W5IA 2H4JA 1XCPA 1Z0DA 4TKVA 1IN7A 1PLKA 3S2FA 4Z4FA 1SIBE 2PGDA 1CQWA 2GF2A 2VBCA 5C53B 1JA1A 1MO6A 1R9MA 2G76A 4N76A 3NHAA 1XZ8A 4YCJA 4AG5A 1U94A 1NNUA 2XECA 2XXAB 1H9BA 1SVNA 5HFNA 1NNSA 4DQLA 1TJ5A 5CM9C 1P0QA 3NO4A 2YRFA 3BG5A 5CGQB 5AOCA 4CBVA 3NT5A 1TO2E 4GHWA 4QEZA 1FSZA 2WB4A 5KNDH 3SJ7A 3QHAA 3GLGB 3AJEA 4MW1A 1FOEB 5B1YA 3H2IA 5LKRA 3FRHA 1RAEA 3C3AA 3OTHA 4R1NA 4AKTA 4IDDA 3K9QO 4MJLA 1T5OA 1ZSNA 4I66A 3TUJC 2BV3A 1V5WA 3BILA 1Z0ZA 3I9JA 3NDPA 1DAIA 1E2MA 1JI0A 4I9GA 3JQFA 2RHOA 3BF7A 2G77B 1CEXA 4KHZA 4X1OA 3SS8A 3TLKA 3U81A 3V7FA 4BRSA 1G19A 2IY9A 4ZZ0A 1I6KA 5CVJA 4RZ2A 4D0LB