1CQYA

Starch binding domain of bacillus cereus beta-amylase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
TPVMQTIVVKNVPTTIGDTVYITGNRAELGSWDTKQYPIQLYYDSHSNDWRGNVVLPAERNIEFKAFIKSKDGTVKSWQTIQQSWNPVPLKTTSHTSSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Separated Starch-Binding Domain of Bacillus cereus B-amylase
rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords BETA-AMYLASE
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00686 CBM_20 Starch binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cqyA00
3U1SH 1Y0LA 1H5BB 1I7TA 4YC2C 5F71A 1N7MH 2IMNA 3MRMB 3TA3A 4EOWL 4QY8B 4XPBL 3MRCB 5KVDH 5ERWB 5SWSE 2DF3A 3VFOB 4LCUB 1IFHH 1JMXA 5GS2D 4PJBA 3GSOA 2Y9RT 4CVUA 1JWMA 5K93A 3RI5F 4U3XA 3MLRL 2VITB 5HGBA 1MIML 4LPCA 4POZD 5CWSA 1IQWL 5BV7H 4X7CC 1WWBX 5I30H 1NUNB 2W1NA 3QUYC 5GGTH 4IRSC 1DN0A 2V2WA 1ONQA 2RJMA 5BVPH 2YUZA 5GS0D 2BZDA 5DDHA 4AK1A 1AKJB 2DDQL 2CXKA 2HTLC 3MREB 3HI1A 3FB8B 4CMMB 4Y4HC 3HC4L 3NCBB 2IAND 1VGKA 1S5HB 4GT7A 3H9YA 3WJLA 1I75A 4AM0A 1CK0L 1CE1H 4HD9A 4KROD 2NY3B 3GFUA 2P8LA 3AM8A 4XAWH 3ULUE 4M9PA 2VXSH 1PFCA 2FR4B 4LLWB 2JB6B 2NY0B 3PWUB 1NFDA 5C0AA 5F7DB 3U82B 4GO6B 5IJVA 4HWZB 1I1FB 3CUPA 4AIZA 3PUCA 1D9KC 4HLZH 2NQCA 3QA3B 4X8JB 4LVEA 1PZ5B 4HS8L 4WFGE 1DLHA 3O2DA 3NFNA 3RL1B 1J11A 1CDJA 3GMPA 4D0DB 3QIWB 4A2LA 4APQB 1ZS8B 1X5XA 2DQGL 4ZXBA 4TSAL 3GI8H 3G6AA 3GUTA 4FQQB 5DUPL 5E56A 3O41B 3UROR 3KWWB 1MH5B 1FG2B 2WLZA 2ATKA 5BS0E 2AJZA 4OGYH 5SX4H 4MQ7A 3HUJE 2BP3A 1KLFA 1ZVYA 3UZQA 3FN0L 3O6FA 1W72L 1XR8A 1XH3B 1AR1C 4G9FB 1KELH 5GRUL 4AQOA 4AJ0A 5IWLC 5D1XA 5DK2A 1F00I 3PQYB 5EUKB 1A0QH 1CXEA 4FQCL 1BF8A 4QXTA 5FM5O 2O93L 3C2SA 5L6YL 3NA4A 4PJ5A 5CEZE 4MVBD 1VPOH 4QRRB 4JFDB 4FNLH 2Z31B 2YWYA 3CH1B 4WUUE 5D2LE 3QUXD 4OZ4B 3T1WA 3MV7B 3BQUD 4WI4A 4TVPH 2GT9A 4P4KD 1QSZA 3UBXI 3DLQR 4QF1A 4UQ3B 2BOCA 4K7PY 4BSWA 4HMDA 3O6FD 4X4XA 2D31B 1SMAA 3D1MC 5ESVA 3TBWB 1A1OB 1EAJA 1FFNA 5CP7A 5DMIL 3MGAA 1D7FA 1JJUA 1PX4A 4ONGL 4U05A 4LEOB 4YWGL 1NC2D 3SO5A 3OR6A 5HVGB 4S1QL 2DI8A 1QFPA 5ICYA 1ORSA 3L3IB 3BKJH 1A7OL 1Q9OB 5EOQH 1DQDH 2RAMA 5F9OL 3W82A 3H0TA 3T3PE 3BIBX 2VXQL 2DWEA 1C7SA 4RISL 5FM5M 3FT2B 1JP5A 4K9EH 3MRRA 2ESVB 4CVWA 3MLXH 4L1DA 1D5XA 1MJ8L 5E8PA 2DBJA 3BUYA 2VXTH 1RZGA 3CFBA 4HH8A 3AGVA 3F62A 4BH8A 2COQA 5TH2A 3O3BA 2J8UB 5FB8B 2BVUA 4FP8L 3DUUA 1CVRA 1F4WH 5GGVY 3SO3C 4FXKB 4XX1E 1KCRH 3MLYH 3MLWH 1Y6KR 4JO3H 4IOFC 1F90L 4LAQH 5E8NB 2OJZL 3BKMH 2XN9B 2OTPA 3BHBA 4GG8A 3QEGH 3DV6A 4ZUVB 4Q9RH 5KS9F 3IFLH 4QRPD 1G7JB 1H3GA 1FVCB 4O02H 3LQAL 2AKRB 2P24B 2XZAL 3QQNA 3IS1X 1UZ6F 1DBMH 4LIQE 2VXQH 1IL1B 3V0VB 4EBQL 2LAGB 2VN4A 4G43A 3QP3A 1G7QA 2CDEA 3TBTB 4DKDC 3EOTH 3ARPA 1AD9A 4PJAB 4MA1C 2JCCF 3LH2L 4HPYL 1I1AB 4Y2OA 1WITA 4YWGH 4WCYH 1HHJB 5HVHC 5BCAA 5IB1B 3ZYZA 4MQXC 1C5DB 4PJDE 3K4ZA 3SKMB 4ZSOE 4L3AA 1IM9B 4B5EA 2NY5L 2WUBH 5AZ2H 4GRLB 5T3ZD 1P4LA 2BDNL 3LS5H 5C0GA 4YDKL 2AXGA 1N6QL 4UT6L 3PGCA 4OZFG 5TQ0H 2MQCA 5JDSB 3QIUA 4HV8B 4QOKA 4JJ5B 4Q6IB 5EC2A 4OF6A 3IETB 4P9ML 4NZJA 5TDNB 1AQKL 3FRPA 2VR5A 1YYMH 4X6FB 2D7MA 2H26A 4WO4C 3O3EA 4HULB 3H8NA 3RGHA 1JGLL 3F7VA 3EOAA 2UYLA 1JHKL 2WQ8A 3DPBA 2V9RA 1AE6L 4TRPH 1NJ9B 1C5CL 5JIKA 2NY1C 4LARH 4PGCB 1ED3B 1Z3GH 5IVXE 3T0AA 3NFPB 4DFIA 3EJYC 3MOBL 4P5MB 4APQC 4C83B 2IG2H 3QCTL 3JTTB 3K1KC 3MRNB 4JFEA 4KVNH 2HFGL 4QT5B 1UKTA 3ROLB 2I07B 4EQ2A 4WWID 3OZ9L 3BYYA 4NZTH 4PRAB 3G5YA 4OZIF 1JHKH 1YNLH 1I8KA 3HI5H 4XI5D 4JM2D 3QFJD 5J1AB 3BPCB 4PJDA 4XNYH 5EU5A 1BPVA 4P5TD 3SDXF 4NC1C 5ICXB 4W4OC 1U95A 5IHBA 3CXHK 4JZJB 3WIFB 3HFMH 4JPKL 3PGFH 2GK0B 3D3VE 1DUYB 4U1JB 2WBJD 5IEHB 3GK8L 4HUUB 3OJDA 4CVZA 2FZ3A 2XKNB 3TNMB 1YECL 2K7QA 4DW2L 2ZCKH 3IVKA 1XIWB 1GCFA 4P9HC 2BXZA 1KJVA 3RKDD 1JZ6A 5GSRB 1R3JB 1U8PB 5F9DC 1XT5A 3OXRA 3S96B 1I8IB 2Y6SC 3INUL 5DJ8A 5EC1B 4HKZB 3TT3L 5HPMB 3E8UH 3L3DA 4XCNB 4WUUD 4RGND 5A16A 1F6LL 2NYYC 4U6YB 4MD5A 1DSFH 1FLTX 3ZTJH 1E27B 4ZPVB 5I66B 1Z6JT 2QJDA 1A4JA 5IVOA 1JPST 3KPTA 4U1GB 1YQVH 5EDXA 3BOVA 1YMHA 5BZDA 1ZSDA 1KYOJ 3V5DB 3S5LA 2P45B 5E9DB 3GSXB 2A83B 5CHNA 5AAWA 3OHXA 3QWOA 3ZDXE 1BFVH 3NABL 1C16A 1IEBB 5JXED 5GGRY 4XCEB 3VMNA 5GGQL 3AVEA 3W5MA 5BS0D 3LKRB 1A4KB 4JE4B 1F90H 4PP2B 4N8VG 1J05B 3DUHA 5EPMA 3DGGB 4HIXL 2FEDC 4NUJA 2AK4B 5JW5A 1FAIL 1MFDH 5DRXA 2EO9A 3LKNA 1JZ4A 3IYLW 1QRND 2IALA 4DAGL 5D71H 3KPOB 2EYTA 1DQMH 4JFEE 4TQEH 2FLBT 3E3QC 4K3JH 3BH8A 5IVXA 3IJSA 3SGEH 1J0JA 1CDUA 4RISH 3IDMB 3H3BC 3TZVD 4KV5F 1QFOA 2WINA 3EO9L 5E00B 3B3IA 3TLRA 3Q5TA 2HYMA 4IJ3B 3QYCA 1FRGL 4PJFB 2VH5L 1YY9C 3WHXB 3T0EA 3GSUA 3H9HB 3MBED 4RIRB 5HVWA 5IKCA 4NQXB 3ABZA 1IJ9A 1MFBL 4WU5A 3OB0H 3QQ3A 4JCMA 3QIBD 1JNLH 5C0DA 1XCQA 3EGSB 4PIRF 4Z18A 2PYED 5I8KL 2W9DL 4RWYH 1NEZG 5BW7A 5KN5B 5CCKL 4B0MM 3ES6B 3V4PH 1ZHLB 4RQQB 4FNLL 2I27N 3QDMA 2F5AL 3BPNC 3SKOB 4Y4HB 5C0JB 4Y4KB 4P9HL 4AEHH 1LP9F 1E4KA 1OP5H 2DYPA 2IPTL 1CE6A 2D4DA 2J1KA 3ARFD 1VEMA 2EDRA 1INDL 1IKNC 3U4EA 1GJIA 4LKXB 1VACA 3V5HA 1SEBA 3A67H 4P99A 5DJ2A 1VERA 4KUCD 2ZUTA 1FE8L 4ZS7L 1T2QL 3QG7L 1OW0C 3U0TA 2FWOA 1LDSA 1AIFB 1JGDB 4GRMA 4PJIF 4GAGH 4I2XA 4HUVA 1NC4A 3TBVA 1CD8A 3BE1H 4YHIA 4XNYL 1D3CA 4PGJA 5ILTH 4G9DB 4K8RL 4MAYA 3FB6A 3WO3B 3WS3A 3QT2A 5IB5B 5I16A 3KLHD 4OJFH 4AG4L 2NX5E 3M17B 1NCDL 1FL5B 4PJHB 1GH7A 4H88L 3C5ZA 1NGPL 3FHQA 5FYJE 4YXLL 3DUSB 1CR9L 4Y4HD 3QB7C 3U83A 5IMMA 4L4VA 4XCFL 2PXYD 4HLZG 3I02A 2NY0D 2BNQE 2HFEA 3KPSE 2C3VA 4E41B 3FQNA 4L3ED 4K7FA 3G5XB 4F9PA 3BT2H 5FYKH 2QR0B 1FP5A 3U48A 4YDLB 1DEDA 1HHHB 3QIBC 3UYPA 5DVKA 3FONB 1TJHL 5AWNH 5I1CL 3MXWL 4MAYD 3W9EB 1UJTA 2R0KH 2YS4A 4PJ9A 5DYOB 3RIAF 2AV1B 5HYIA 4PJBB 5ALBH 5ACLA 2FJGA 5KW9L 5KANG 5CZVL 1J1OH 1JUFB 3GMNB 3DURA 3J8F7 1I8MB 3GGWB 3NIDF 4N1EA 4KAQH 1W8OA 3MMEB 2FX9L 5T1LD 3WKML 2BY0A 2VDNH 5FA3A 5LGJB 4KVNL 4LIQH 1JZ7A 1KCSH 3FT3B 3VXSB 1CDYA 5HVFB 1FDLH 2GJZB 4BZ2L 5GZOC 4KVCL 4JPVL 4WTZG 3VA2C 3AB0B 3OAUH 1YJDL 3IRZA 3D25A 3IU4H 5ID0B 1FORL 5IHLB 1OGTB 5D4QA 1VGKB 4AIOA 3THMH 4PREA 3O9WC 2IPUK 2OL3L 4LSDA 1OW0A 3WFHB 1IGMH 1PAMA 1MVUB 1S7TB 4ODTH 4YHLH 5C6TH 4X9HA 1A7NH 4MD4A 1ZLUK 1WFOA 3GSQB 3SY0B 1KGCE 3PNWB 3RY6C 5B4MC 1T5WA 4UT6H 2NY2D 4G8IA 5DVMA 5IR1B 4YH6A 3SDCD 5B3JE 4HHAA 1F6AA 2DKUA 1VKXB 3LOWA 2Q8AL 5FECA 5I8EA 5IB2B 1VFAA 1OWWA 4GAJH 4X8JA 4ODSL 3AS3A 2HA1A 3VFRB 1DLHB 4N8VB 4DZBA 2X7LA 3LAFA 1T80A 3HHRB 3TC9A 2A0LD 4XGZB 5I1DA 4Y5XC 5JO5A 4I0PC 5HI4C 3TYGL 3NGBC 3O41A 1M6OB 2MKLC 1FG2A 1K5NA 3K8LA 4FQHB 3P73B 2ATKB 4G8FA 4MB3A 1P6AB 3OKOA 2CLVB 4LRNL 3BP5B 2GITB 5EOQL 2P5EB 3AY4C 4XAKD 4WV1C 3PHQB 4OF0A 3F7PC 4UINL 5F9JA 3WFDH 1MQKH 1HH9B 4KUZL 5MI0B 1YUHA 4JEGB 5EUKA 3TVMA 3U7YH 3ARBD 5D2LB 3GMLA 4P2RB 3VGAB 5K9QG 5ISZA 3B2UC 3FO1A 5KJRH 3BO8A 4GAFB 4M3JA 3CH1A 4ELMA 3KPRA 5CUSL 5IQ7H 3MV7A 4OCWL 4X6BA 1TCRA 2VUYA 1MWAA 4HSQA 4P2RE 4UQ3A 4OI7A 4P5KB 3VGEA 3SQOH 4HIIB 1EHLL 4XXCA 3QR2A 3SDDC 5CP3H 1ZHNB 1BVLB 4R2GD 5GGVH 3C5SA 3RWHA 4D2NA 4JFXA 1BZ9B 4IIQB 3SKNA 1DQDL 2NZ9C 2QSQA 4Z7OF 3VH8B 4NQDE 5F88B 3WFBL 1XGYH 3EYVB 1MFCH 3RTQA 5HD8D 1Q9OA 1E4KC 3S4SB 3C6LB 1LNUA 1UVQB 5DJDB 1FDLL 4BFGA 4FQIH 2G2RB 3X14A 3DSFL 4CJ1A 4YHMH 4JFOA 4XX1G 3FQWB 3ULSA 1Q8MA 5J6GA 3ECBB 2VC2H 4XBGA 5M7QA 2NLJA 3ROOB 2GJ6D 5L2KD 1OAXH 2OR9L 3UO1H 3BFOA 5TH2B 4M61B 5F9AC 4JDZA 4JM2B 1CG9B 3HRPA 4JFHD 4U7SA 1O5DT 4XAKE 4NO0A 3MRKA 1Z0MA 1K8DA 1RU9H 1S9VA 3TBYA 1RJLB 1NBQA 2VABB 2YA0A 1MCRA 3MGTA 3KXFD 1HYSD 2WQRA 3BHBB 3NMEA 4GG8B 4LVOC 4OAWB 3UCRA 3DV6B 3F8UB 3EOBB 5L8JB 4I18A 5HHME 3FB7A 3ORJA 2CKNA 5EBMA 3BD5A 1KIPB 3CFDA 1FG9C 5CZXD 3D2UD 5KSUB 3DX7A 4XCFH 1KCSL 4DN3L 3ULVH 1IL1A 1PG7W 3Q48A 4EI5D 3MV11 2FX9H 5J8OA 4M6OL 3TESA 4NRXB 1S78D 1CQYA 5D1XC 3MRJB 1HHGA 4JRYE 3REWA 2A6KB 4OCXH 3T4AA 4OGAC 1FYTA 2QQNH 3ARBB 4M6NL 4YFDB 3MGOA 3PDGA 1RIVH 3ARRA 2CK0L 1MNUL 2HRLA 2XQBL 4FFVC 4XPGL 3GI9L 3HRZB 3UXFA 2F19L 1U8JB 3C08L 5DVLA 3I3EA 2IANB 4WHTB 4HV8A 2K9UA 4KQ3L 2H32B 3TH4T 4PUBL 4LCWB 5IVZA 4MDJA 4H0HB 3ZL4L 4NQCE 5TDNA 3WBDA 1ZWIB 2E7HA 5AZEH 2F5AH 1WBXA 4TTGA 5LVEA 4IIQC 5ETUB 2LU4A 5HHPA 4S1RL 4JG1H 2VE6A 5C92A 1QUNA 4OM1H 4F7EA 1FFPB 2DDQH 3GRWL 4DGVH 3OBAA 4N68A 5J9PA 5CEXA 3GJEB 6FABH 4B7LA 1ED3A 5BVPL 5DI8A 3B83A 3NFPA 1WQVT 5C0AD 4HG4J 2NW3A 4ETQA 4NNXB 3IU3B 3ROLA 4YBQD 4HX1A 4IHOB 4X7SL 1A6WH 2B1AL 3FRUB 1T1YB 1QYGH 4Z7WA 5DHYA 1FZOB 2DMBA 4PJDB 1QSEB 1P2CB 3FFDB 4KK5D 3ARFC 4YE4H 4ZAKD 4NHCL 4U2YA 1NAMB 3IXAA 2UZIL 2VIRB 1QR1B 5B22A 1GPOL 3UC0L 3WIFA 3MR9A 2D0FA 1HQRB 2GK0A 2HJKB 2BSTA 2PCPB 2WWKT 3T3ME 5CCKH 4U1JA 3BZ4A 5D7IF 1WV7T 2HJFA 5I19H 2PW1A 2AEQH 1CGSL 3L9RB 3TNMA 1T3FA 2VDLL 5I73B 5FUZL 4Z78B 3O45A 4IOIB 3B9KC 2GFBA 2EXWD 3DSNA 1DVFB 3WIHH 1E4JA 4NGHH 5JIHA 2XN9E 5DFWH 2YPLB 3BKYL 4HIEB 4CU7A 4UDTA 5IEKA 3L5WB 1I9RL 3BPLB 4ZUTB 4D3CH 3U79A 3I2CL 3GJFH 5A16B 3ARUA 3DRTA 5DJ6A 4PJIA 2FO1A 1KIRB 3CPLA 4M5ZH 3QCVH 1YJDC 3BQUA 3SPVB 2YUXA 4ODVH 1ROWA 3EYFA 3MV7E 4E0RA 1K4CB 3ULVF 3S5LB 3T08A 2DQFB 4KRLB 5EU4B 1U8QB 4EN3B 2HFTA 1ZAGA 2X40A 2XZCL 4N5ED 3WD5L 1RUKH 1H0DB 3UAJD 4FQ1L 2ICES 1QBLH 3LKRA 4PJDF 1JFQL 1WCBA 1H3PL 1J05A 3QNYB 3DGGA 1FGNL 4OZIA 1A14H 1QLFA 5D8JL 5C0RL 4J4PD 5DRXB 3BXNB 3TO2B 1T7ZA 1QEWA 3ME0A 3MOAL 1GC1L 1GGIH 4JKKA 1RZKH 3TN0C 2EYTB 1ZT4A 1OY3B 4Y19A 1L7IL 5T5NF 4H1LH 2BHYA 3FO9A 4W6XB 2V2TB 1TNMA 3P4LA 3QHFL 5MENA 3MBXL 3MNZA 3G04B 3OKDB 3CSGA 1QHPA 4KK9D 35C8L 2VWEE 3EW3B 3ZTNH 5SX5K 3Q2CA 4Y5XB 5BV7C 2VAJA 1X4YA 3PHSA 1ETZB 4JFFE 3B3IB 3TCLA 5C09A 4ZFOA 5LCVL 1U58A 3VFVB 4ZUUA 3CU7A 2DQEH 1WVZA 3DO3A 2IQAA 3MSPA 3WSQH 3VFGL 5E4EB 5I75B 3N1GC 1UB5B 3GSNA 2JTDA 1UWXH 1PGRB 2R4SH 3O8XC 4F58L 3KPPB 4XPHH 3MO1B 4X4ZA 3JUYA 1IKFH 1IGIL 3LKQB 2VL4A 1ODAA 1N4XL 3CK0H 4FZ8L 3HC0B 4X6EB 5GS1B 4D0CA 1MEXH 5H94B 1NMBL 1RUQL 1HI6A 5E2UL 4NCC1 3B5HA 3ES6A 5D2NC 2X05A 1A1MA 4WEBH 1T0NB 4MJIA 4UIKH 3C5ZC 4R7DA 3LHPH 4YZFF 5BZWA 1LEKA 1JPTL 3EYOB 7FABL 1BJ1H 1XGPA 4XMLL 1AXSA 3X3GH 1J9CT 4K55A 2PTVA 2R56H 1UZ8B 1U3HD 4PR5A 5IMOA 3K8KA 1CZ8L 3LEXA 3KXFB 2DI7A 1P7KB 2FIKB 1PY4A 4ODUB 1QD0A 4Q9QH 3F6LA 3ZKSD 5JW4M 4GBXB 3VFGH 4FQIL 3DVNB 3L95A 5F1NA 5F7YC 4H88H 5B8CC 3BN9C 1MCFA 1MRDH 1ZLWK 3U6RB 1SBBA 4R8WL 5DGRA 5BO1L 3FRPG 4MAYB 1JBJA 4WNQB 2CD0A 2BCKA 3BGMA 4PGDA 1EEZA 3FT4B 4GRWH 3EZ8A 1YYML 4IRJB 3LEYH 3O3AA 3QAZC 1I85C 4XXCC 4ZAKB 3ZHKA 3JVGC 1BJ1J 1CDHA 1HZHL 1RZ8A 3MRQA 4HBQA 5BRZB 3ZDZE 4AEIL 1NSNH 5DA4A 2P5WD 5EOCH 3P4NB 3SO3B 2BVOA 2R29L 1I7UB 1F02I 1QFWL 2N7AA 3T1FB 4Q9RL 2FJFB 5K9KA 3HZVA 1UKQA 4PB9L 5C2BH 3TNNA 3LS5L 4XVJH 3HNSL 4WWKB 5F96L 4XBPB 4H5SA 4BQBA 5DFVD 1BJ8A 4AQ1B 1BAFL 4XH2A 3WXVL 1JFQH 3QFJA 5EBGA 5KOVC 4MNHA 2QHRL 4U6VL 4BH7A 1OGAB 1MWAL 4UT9H 3RP1A 4JR9L 4RWYL 1A22B 2YD7A 1BFSA 3PJSB 1CU4L 1BQUA 4ZO9A 3DARA 1I8MA 2A9ML 4OFIA 3RX8A 3RDTB 4RMRA 4DVBA 2Q3ZA 2H2SD 5LGJA 4K3EL 1FL6A 5IM7B 1LO4L 5D7IB 3WE6B 2IPUG 3QIUD 1B2WH 3T09A 2FGWH 3V0WH 2B39A 3G6JA 4KQ4H 4N8CH 1IEHA 3VXUE 3ZDYE 2OLDA 4K7PH 3FAWA 2OXGA 3QEUB 3E2HC 4O51A 4WRLA 1IGJB 3BKYH 2W0KA 1KCVL 3TYFA 2WV3A 2A38A 3HE7B 5CFHA 2R1WA 3MLWL 4LBEA 4LLAA 4PRHB 3A6OA 2R0WL 1MVUA 4I48A 1S7TA 3S36L 3BZEB 4F7TA 1A6AB 4G6JH 2FHFA 3OKYA 3S9DB 4R7NB 4U1MA 4RFEB 1G6RB 4LKCA 5FO9B 4RBPK 4U6XA 1I9JL 2E9JA 1DVFC 4G8IB 2XKUA 2OR8A 4N1CA 1NPUA 3VXME 2IQ9L 1KB5H 3SJVB 2ZZUT 4HHAB 3CLFL 1A7NL 5JMRA 1M05B 1XGUB 2J8UE 5E4EC 5I75C 1WT5C 4HT1L 5H35A 1EV2E 3U0PB 5C0FB 1LP9E 3QUZB 2X5PA 4OFYA 4X4YA 5DC4B 5D7JB 1DEEB 1BQHG 3WN5B 2YD4A 5BJTA 2EKJA 4N8VA 5JPNA 1RIUH 2BY3A 2C3HA 1J8HD 5GS1C 1M71A 3KPLA 4WU7B 3EKCA 1X44A 4BYHA 5BO1H 3J7HA 5HI3C 1TVHA 3SGKC 4JPVH 1F3JA 4M7LH 3PXJA 2OXHA 4KWUA 3RY5A 3DXAD 1DLFH 3LPWA 1Q0XH 1K5NB 3WL9A 3U7WL 4G8FB 4BSJA 1A6VL 4YXHH 5FHAH 3CSBA 4K71C 4ZTPH 3ARBC 4V2CB 3EHBC 1YNTB 3VU2A 5HHQA 4FQPA 3WKMH 3VRLE 3QXTA 5JR1H 3VGGA 4G6MH 2BERA 3HMWL 1C12A 1PX3A 4Z8FL 3RVWD 3TT3H 2MQ3A 3MNVB 4OFKA 1QFUH 3SJVD 2DQCL 1KG0B 4LCYA 4YDIL 3TIDB 4FQXB 1BBJA 4RX4A 1PSKH 1J8HA 3EDDA 2W9LA 3OL2A 1CLYL 4QO1A 5C09E 3X17A 2UVFA 4LAJH 5AEAA 2MFNA 5KG9B 1N5AA 2DWDB 2EH8H 5DLML 4ELMB 5I6XB 3MBEA 2XV6B 3GK8H 4XWOC 4G5ZL 5TE4H 4OF8A 5CKGA 1B6UA 5T33H 1OTUD 3TT1L 1TCRB 5F6HJ 4AL8H 1R6VA 2BHZA 1RIHL 5HYSB 1MOEA 1OPGH 2Y7QA 4HIIA 5BV7B 1KACB 3PQYE 4RGOH 1KT2A 5C0CA 5HHOE 1NEZA 5EBLA 3VCLA 3RWHB 1JVKA 4P4KC 2VB5A 4PJBF 2AJYH 3VRIA 2ZCHL 2J8HA 3SCMC 1CIUA 1X5GA 3ZKQD 4G6ML 5HYFA 4MJ5B 1J0HA 3NCEB 3MFGB 4CN6A 2KBGA 2GW5A 3U30B 5C08E 3UTOA 4G6KL 1T89A 2Y25A 4K94H 5INCA 3M8OL 5FGCE 4DUXA 1M7XA 3KYKH 3UPAA 1S3KH 1ZGLB 4X9BA 3FQWA 1MFAL 5CEYB 5L0QB 5T3XE 4U33A 3GSNH 3ZE1E 3CFIC 5TE4L 3H42H 5F7HA 1YEIH 1QLEH 3VXUD 1D9KB 1QFHA 4PJHF 4NRYB 3VXRB 3CFKA 2FBOJ 4JHWL 4PPTA 3OF6A 1CLOL 5ACZB 4XNMA 1Q9LB 4NO0B 4QRQA 5DVNA 4NN7C 1RJLA 2HLFD 2NY4D 3V5KB 3OKEB 1KJ2L 4HUNB 2DJSA 1S5IL 4EVNA 2E27L 1YPZE 1KENL 5JHDB 4QNPF 1YA5A 4PJXF 4UOW0 3VXUA 1RURL 1YEDA 2ARJA 3A6BH 4XNUH 2VO5A 1CGVA 2I9LB 1E4XI 3MRJA 4BM7A 3C2AL 3RGVC 1FVDA 1WUNT 4MS8D 3QUXB 4Q2ZA 1FYTB 1U3HB 3EO0A 4H0IA 2GCYB 4IRJD 1X5FA 3BAEL 2VLLA 4P4KB 2V5TA 2IQ9H 1X5JA 5GIRA 5AD0B 4NJ9L 2CJUH 4OCWH 4WWKC 1RK0A 4ZSOA 1U8NA 1IC7H 1F5WA 4OCLC 3ZKND 3HZYB 5SWSB 4QRPE 2F53D 5D96B 4UZGA 3MRDB 2F58L 1L9NA 1R24A 3CFCL 4RAUB 1RK1A 4Z7UE 1WC7A 1T89C 5LBSH 1QO3A 4UBDC 3O2DH 1LE9A 5BMFL 2XOTA 2J4WH 4JDTL 4JFFA 5JOFA 1FIGH 4XRCA 2E9WA 1XEDA 4M1DL 4G7YH 5ETUA 4I3SH 2A74B 4KRMB 5GZNC 3GSRA 1OAUH 4JRXD 5J3HD 1HXYA 1J10A 3SOBL 3QUYD 1TTGA 4G8GE 4YDJA 2ADJB 5CEXB 5GQBA 3PWPB 4WW2A 3KYMB 4QRPB 4Q6YA 5EZJB 1XCTA 1LO4H 4GKZB 1JRHI 2OZ4H 2F53A 1KLGB 3S3PA 4LMQE 4Y4FA 4GOSA 3S37X 1NGXB 4LP4A 4HDIA 4YPJA 5DMKB 3DROB 4LCCB 1FZJA 3CXDL 1QLRB 2O5ZL 1JPGB 2OL3A 3EYSL 3LN5B 4U1SA 1QSEA 3JWDC 2YHGA 4AZ8A 1I1AD 4L9LA 1HDMB 5IFHH 5FA4B 5EOTB 1B0GB 4MDIA 1Y6MR 2EYRB 1HQRA 2AEIT 4OFDA 1U8LA 1LEIB 4LSVL 4XVTH 5D7LD 3GHEH 3H7BB 4MCYB 2LAAA 3VFSB 1IAKA 3BN3B 1OAKH 4TSBH 7FABH 3MLUH 2XQBH 4X7EC 4Z78A 5CGYD 2JIXB 5HYSG 2F8OA 3DTXA 3W9DB 4BQ9A 3N9GL 1IGML 2PO6D 3P0YH 3E6FA 4L9LC 1KNOA 1CFTA 2BFVH 2UVEA 2X4SA 2AQ3A 1V3KA 2ED9A 4N0YH 3C5JA 3NH7H 4JLRA 1C1EH 1HHKA 4LCCC 1RZIA 4MB4A 4UDTB 1E6OH 4ZS6D 3SDYH 5IEKB 1UQSB 2M1KA 4R8WH 1VGEH 2DTML 1FO0B 4NZTL 5DJ6B 2DAVA 1Y18B 1IKFL 3OX8A 3L3HB 1R3KA 3MUZ1 5JHLH 5LG1A 2NNAA 4L29A 3O4LE 5DUBB 25C8L 1IRAY 1HWGB 4FQLH 3VFTA 5IW1A 2MTPA 3CVHA 2IBGA 4KKCC 3WHE1 2NY6B 1EXUB 2Z0BA 4PJGA 1NCWH 4ZXBC 3KR3H 3DETD 3JUZA 5C08B 3QDGD 3MROA 4NHUA 1U8IA 2DM3A 4QRRD 3KLDA 4KJYB 2HTLD 3RWFB 5I71B 1UC6A 2APBA 4HFWA 1S7XA 3MV9B 5B39G 5D96C 3STLB 4OZIB 1A7QH 5ABDE 1I1AC 1F8TH 2NY2C 4KK8C 4A6YH 1RZKL 3P4OB 4DTGL 3WUWA 4U2ZA 4NKMB 5CBAB 4Y19B 4G6FB 3QUYB 4C56D 4QHMB 4L8SA 3O0RL 5FYLH 4BFIA 1MCEA 1CXLA 4OZHF 2IAMD 2DL9A 1V7NL 4PG9B 1N0XL 3G04A 3MC0A 4YXLH 3SDXE 3HC3H 2WIIA 2R2CA 3EYQD 3QH3B 5AUMB 1LP9B 2AXJA 2XNAA 2B8OT 2UWEF 4QEGA 3QEQA 4N0CD 1I4FB 3P4MA 4X83A 5FUOH 4MNQA 2XZCH 3L7FA 2DM7A 2IQAB 4PJ7E 5C3LD 4UUJA 1LO2L 4YIQB 3HNVL 1NFDE 1A6UH 2NY4B 3NFSL 3MV7D 3P77B 3C8HA 1WFNA 4L8DA 4OZFB 1AI1L 1UGNA 4UIMA 5MEQB 3KPPA 5D7SL 4F3FB 5EUOF 3LKQA 1WIPA 3IJHB 4XVUD 4GW1B 2DLHA 1SVZA 2WW8A 3ARGA 5GJTL 4E41D 3IAQA 2FNBA 2RHEA 4X6EA 1EMTH 5CEZH 1KLUB 3MRCA 4PJFF 3HKFA 3GIZH 3ARDC 2YEZA 3RU8H 5GGRA 4JO3L 1G6VK 4W81A 1IM3B 3A6CL 1N7ML 3S8WA 2PO6B 4L9DA 5IP4A 2JJSA 3RTQD 1NUDA 5D9SB 1QBLL 1XGPB 2ZPKL 3JVGA 1CF8H 1AXSB 1DN0B 2V2WB 2X4TA 3GJFA 3PGDB 4NM4L 4F2MA 5D1ZA 4Q9CA 3HLAB 3HI1B 4DZ8A 4PRBB 3SE8H 4JVUA 2I5YL 4JPWH 3K8MA 4NQCD 1A7BA 1XIWD 4C58B 2GJ6A 4ERSH 5L2KA 2ZUYA 3GMRA 3O8XB 1A2YB 4MJ6B 3SOBH 1MUJA 1U8KB 1W8NA 4RGMB 3U36A 3O6ML 3FOLA 3HE7D 5HYQA 3MRPB 2P8LB 2QSCH 3PP4L 4LLMA 4M4RA 1G7LA 2D4FA 5EA0H 2ZJSH 3LN9A 1CICB 4HK3N 4KPHL 3ARFB 1NGYB 2WANA 4NN5B 2A77L 3OKMA 1MY5A 3QRGH 5TDOB 3IDNA 2VDLH 3MRQB 3T65B 1IAOB 5BRZA 1FNLA 2DIJA 3D39B 4KY1H 2BVOB 1CLZL 4LCWE 4J6RL 4O2EB 4JRYD 4PB0H 4P46C 3HZVB 4J3OC 4TVPL 4WIQA 1JGUL 4NQCA 3EDEA 2QBWA 1BIIB 5EO1A 3D2UB 2IAMB 4GRWE 4ODTL 4TVPE 1KTDA 3L1OL 4LF3B 1YEJH 3QFJB 5L2KE 5F44A 4FQCH 4XC1L 1B0RB 3VWJB 4YC2B 2Q7NA 3QQ4A 4OI8A 1OGAE 3P30L 4R4BA 4RAHA 5TPWL 5HHVH 3RBGA 5L88H 2ADFH 2MWCA 3GHBH 2AJZB 2FX8H 2HLAB 4WJ5B 4URTB 2QTEA 1NBVH 4HPOH 3V6ZA 3V6FA 2R1YB 4OD1H 3S37H 3STBA 3CLEH 4JRYA 5D7IA 5E0QA 3WE6A 3WS6C 5AYQA 5DD1L 1KB9K 1OOAA 2DQTL 1UG9A 3G6JB 3KPSA 3IDYB 2XWTB 2FX7L 3HG1B 3TWCH 2FSEB 4CW1A 4QXGH 4PP1D 4O51B 5D7KE 4F7MB 1YPZB 3C6SA 3TYFB 2X89A 4H26A 3BPNB 1Q9KB 4Z0XA 2VXVH 1OT1A 2XWJA 2D03L 1TITA 4GRLD 2DB8A 1RUML 2L7JA 2UY6A 3VD5A 1QBML 4OZGE 2IADB 5J56B 1ZVSA 2UV3A 5KAQF 1ADQL 5A3IC 3AAZB 4QHKI 2VDQL 2OSLA 2CRIA 4X7TA 3CX5K 1F13A 5ICYB 1ORSB 1JN6B 5TE7L 3BP4A 3L3IA 4Z7UA 3HI6L 1WK0A 4NKOA 1WWCA 2Z92B 1NQBA 4YHYB 2X42A 4OD2B 3VFUB 5IB3A 1HOCA 2WM0A 5JA8B 5BOZG 3AS1A 4QRTB 3V8CA 3DI2B 3T0EC 3W0WA 5HSFA 4JM4L 3SBWC 5IFAL 4MNGB 5MEOA 3DMMC 3DSFH 4LPTA 2FRGP 4L3EB 5DD1H 1VESA 1Q0XL 4NWTL 1LE5B 4LARL 3VXOB 3WL9B 4OBRA 3LSOB 1P1ZA 1VADA 1FE8H 3BESR 4NQDA 3P9MB 2EICA 1IARB 3UTSB 3D48R 1DQQA 4TUJB 4RMQA 3QDJE 5T33L 4HJ0C 2O5XH 4XCYB 1C12B 1OAQL 4FFYL 4L5FL 4PLKD 4L4TA 4KMQA 5CSZB 1KPUB 1SJXA 2ZSVA 4RGNB 3C9NA 2JB5H 3ZDZF 1UM4H 4H20H 3FMGH 3K74B 1KV3A 2YN5A 3E1F1 3RX7A 4JQVA 1JGUH 5BVJB 3LEVH 4FZEL 2QV2A 2MHAA 2CIKB 2L7UA 1NLDL 4L8BA 5KS9B 5D7LB 4G6JL 2CDEB 1BREA 1AGFA 1O0VA 2PTTB 1D5ZA 4J3XA 1F58L 2ADIB 5CJQH 5HYJA 1HHJA 3WXWH 5DRNA 1MSPA 1MFCL 2YD5A 2Y4SA 3SKMA 1G9EA 1U91A 1TXKA 2WWMC 1UCTA 3JWOC 4PJ5D 4IS6A 1D5MA 2E6QA 2PW2A 3L3GA 4MJ5A 4KQ4L 4N8CL 4K9EC 4JFPA 1CS6A 3QJFA 5F3HB 1U3JA 3PL6B 3LB6C 2NW2B 5JDSA 2GTWA 5KSAA 1IT9L 4NBZB 5MERA 43C9B 4PGEB 2W60A 4F33B 4QOKB 1REIA 4K3JL 1GGUA 1SJVA 5GS3A 5HJ3B 5TF0A 1BEYL 5CUSH 1QSEE 1MLBA 2H6PB 3KAAA 4Y5VA 1YDPA 5ITFA 5FKAA 3TIEA 2Z93A 1KB5A 1G9NC 3C60B 5GJSL 3P40A 2VXUL 1QNZL 5C09D 4NNPH 1DBBH 3DGCR 1B4RA 4OUOA 1F3DH 2OYPA 3ILPB 4HUXB 5CLTA 2EEDA 3O6LH 4C83A 5JXAL 2AJVL 3MACH 3OKEA 2V5RA 1YMMB 4Y5YC 1G7IA 3MJGX 5DRWB 1NCCH 4KKCD 2QADB 4EVNB 1PKQA 2IBBA 3QUZD 5E2TL 3PWVA 3PWNA 4AH2A 1J87A 5A2FA 3T2QA 4BKLB 2UUDH 2IH3B 2FECL 3G5VA 4ZOCA 1A7OH 4MD0B 3KPMB 3ALPA 3HPJB 2E5EA 1UT9A 1MCOL 2X4OA 3B43A 3WDIA 4P4RB 1P9MC 2V2XA 2PNDA 4R90L 3MRGB 4HIJB 3ZMRA 3X3FL 1FNHA 5IHZB 2C4FT 2FCBA 3QO0B 4LFHG 4G3YH 2EIDA 4L8SC 1A9BA 1T04A 4ODWB 2UUDK 5J1TC 1U3HA 3GO1H 1OQOA 1CDIA 5FGBC 1FZKB 3WEXB 2VDNL 3VRLF 2IGFH 1L6XA 5EWIH 4M5YH 4NO3A 2AJXH 3PDOA 4NO5B 2IAMC 3AXLB 5IESL 1OCWH 2P8MA 2K7PA 4LMQI 5EOCL 2R8SL 1QVOA 4KKNA 4I18C 1S7SB 3GRWA 2LQRA 1GZQB 1CIDA 2IF7A 1I3GH 3Q1SH 3RPKA 3Q6FB 1E27A 3NIFE 3H42L 1I7RB 4GBXC 1A4JB 2Z31C 5MI0C 3HS0B 1MRFH 5DJYB 5EZOH 3M1BA 3P9LB 3RVXC 4OUUA 3SCMA 5E6IB 4MA8H 5JTWA 3TV3H 2D7TH 4NZUL 4G6KH 2CDFA 3PWPA 1YEGH 3IDIB 3QEHA 5FHBL 3VWKC 1JYXA 2IANE 2AXHA 5EZJA 5I18H 1ZEAL 3WYRA 3GI8L 1QG3A 4QOKD 3ZLQC 1RULL 4YHOL 1J1XH 1NDMA 1S9YB 5LCVH 4C4KO 5BXFB 4LCCA 1FZJB 2LTQC 3VA6A 1BQHA 1JPGA 1INEH 3ZT5A 4XXDA 1LILA 2MKWA 4J8RA 1RZKC 3P0YL 1AQKH 4KK5C 1G9MC 2D7NA 2L4OA 1TQCB 4R26L 2NR6C 3SGJA 3BH8B 4FG6D 4FMKA 5ACMA 2PO6C 3IJSB 2ZNXA 3PWPD 4MSWB 5EORL 3SBWA 3RVUC 4KROC 3E6HA 5D72H 1S7UB 4M5YL 5IBTH 2GEEA 2Z35A 1A6TB 3TA3C 2OM5A 3SKUD 3V6BR 4YJZL 3C5JB 4JLRB 2R69L 4HWBL 3MRHA 3T0EB 3WHXA 5IMLA 1WAAE 4P59L 4X7DC 3GMQB 2FX7H 5TGBA 8FABB 1UM5L 4Y89A 1FN4A 3RUGF 2ICWB 3WJJC 2DIBA 1NDGA 3REVB 3MRBB 7CGTA 4PRHD 2WBJA 5EZLA 4IRSA 1TCMA 3G9AB 5DUBA 5ADPH 3RWCA 4TSCL 3FOMA 3STZB 2WAHA 2CLZA 2HMID 2FX8L 3T0XA 1I3RA 2EDNA 1X5LA 3H9SA 3EDFA 1GGCL 1TJGL 5C0JA 2UY7A 4Y4KA 4LOUD 4PRPE 1AGBA 2ICEA 3RY6A 2HH0H 1XF4A 4HGKC 1Y0LB 1EJOH 1MCSA 1MY7A 3MRMA 1MVFA 1U8IB 4M03A 1J5OH 5E03A 1SY6A 3QIWD 1KCRL 3MLYL 2R1XB 5CINH 4LHJB 3PDDA 3GSOB 1CICD 1J1PH 3V7MA 4CN1A 3FQXA 4JKPL 4Q74A 1YEHH 4WI3A 4K07A 4J7RA 4PBVC 5HYJE 2AEQL 3RPIA 3VFWA 4WTXA 4YHKL 3D85A 3GBNH 1U8MA 3IT8D 1QRNE 3EAKA 2CO7B 4LDOB 1AKJD 3D0VA 2E9IA 4BFIB 3RIFF 1WEJL 4C4KT 3LD8B 1QSFB 5IK3A 4MX7A 4OCRL 3KVQA 1FL5A 5DO2C 2J5LB 3QNZB 4UNTA 1I9IH 3QH3A 4K8RC 4G42A 5DA0B 2OZ4A 5I2IB 3NN8A 4NKQB 3OF6D 2NY3D 3QEQB 4OF7A 3IJYB 3P4MB 4HC1H 5K9OA 2YOCA 3EYUH 1CFVL 3MODL 5HGHB 4GKSA 2EDWA 5CSGA 2QR0A 3NACL 1HEZA 1S7RA 5EUOB 5JZ7D 3QDJA 5FAAA 3JTSA 2P47B 1GOFA 3T77A 1D6VH 1HHHA 1J7VR 2LV4A 4RSVA 3IJHA 1EPFA 1NLBL 5F7DA 2BNUB 4KI5D 3PWLA 4OT1L 4P3DB 3WXVH 1J1PL 2BVPA 5GGRB 4LOUC 3A6CH 3HCVB 4W68A 43CAA 5KSVB 3GGWA 3MMEA 4NKIL 3C5ZD 3UJTL 1H3VA 1YECH 2EXYC 3S34L 3OR7A 3PWJA 4I0CC 5D72L 5EULV 3T0ED 3FT3A 1OAZL 1CICC 3G6AB 3VXSA 3GUTB 1MFAH 4FN0A 1FNGB 1KIQA 2GJZA 5DHVA 5IGXH 3RZCD 3IKCA 2OTUA 3B2UD 4F7CB 1AHWA 4K94L 4DZ8B 3H2WA 4OGYL 3ULUF 4Y2DD 3ZE0F 4EIZC 1U41A 3W39B 1U6AH 1MIEH 3O6FB 1A64A 2BY2A 4M62H 4CNIA 1XH3A 2GJ6B 5E1AA 1U2HA 4OM1L 1XMWA 4FQJH 4PBXA 5DK2B 3QDMD 4HEPG 4DN4L 4LSPH 5FCUL 2YSSA 4QHUA 4QXTB 3ARFA 1HHIB 3Q3GB 4I0PA 3EYQC 3MJ7A 2CIIB 3GSQA 2XN9D 4WTWA 1EBPA 4ZFGL 4JFDA 2Z31A 3RVVD 4PY7B 5C6PB 4UU9B 1IM9D 1J0KA 2WK2A 1IAIL 4JJHA 1VKXA 4AL8L 1I3UA 1MLCB 5I8EB 1VFAB 2A6DA 4X4XB 4DZBB 1JPTH 3LDBB 3LHPL 3RUGA 4ODXA 3TVMC 1BMGA 5HI3D 3UBXA 1JK8A 3VWJD 4XHQA 1BM3H 1KTDB 5T1MB 3RJDA 3BEVA 5I1DB 3FQRB 5IESH 4S1SL 4UDUB 3JWOL 4C57C 1YY8A 1CLCA 2GSGA 3HMWH 2HLAA 3RHWK 2BRRL 4MLIA 3IXTB 4KMLB 3LKPA 4OZHE 1ACYL 4GW5A 1A6VH 2P5EA 3PHQA 4JRYB 5FV1L 4WFED 5FHBH 5A43C 1NUGA 5F9JB 3MRRB 4YR6B 4QRUA 3SDCA 4ELMF 4ZPTB 1V3MA 1D5XB 1WZMA 3X3FH 1MCPH 4HPOL 4WDIB 4QTIH 2V9QA 4Y2DC 5D2LA 4BH8B 1WBYB 5DMGC 2VLRB 5TPWH 4PJ5E 3BO8B 3UTTB 1A02N 4XPAH 1KXTB 4FXKA 4ZNEA 1A3LL 1V3JA 2GTZA 4XT1C 4Y16B 8CGTA 1YEJL 4WGWB 4CUCA 1QA9B 1BD2E 5E8NA 1VEPA 2FLRT 3RNQA 5EO9A 1DDHB 3MRLA 4X7FC 2IADA 2P5ED 1R3HA 4JN1H 3O6LL 2AK1H 4YGVA 1FVCA 3LPGA 3SDAD 4H1LA 3U46B 3SKNB 2AJSL 5MP6H 1NAKL 1DVFD 4EQ3A 2DMKA 2AQ1A 4M7KL 2OSLB 1AC0A 4R97B 4MA7H 4X7TB 3V0VA 5F88A 3ARGC 5DD6B 5D7KD 4XP5L 5SWZE 3V0AC 2VDKL 3RTQB 1JN6A 3T4YA 4X6CE 3TBTA 3S4SA 4LQFH 1KN4L 2G5BA 1UVQA 1KCVH 3LH2H 2Z92A 4HPYH 2XWBB 4NKOB 1I1AA 1CL7L 1MCOH 3VFUA 4C55A 3WFEL 5ISZD 1M7DB 4K7PL 4K94C 1BLNB 5DK0B 2H8PA 4Y16C 4JFOB 4AMKL 5JNYA 5GGSB 4ZQKA 3WUWG 4AYFA 2LU7A 4OLWL 2P8PB 4U1IB 2AXGB 5F9OH 1X7QA 4P57B 5D1QC 1QPPA 1OF2A 4X99A 4NQDB 5C8JB 3ZKXC 2BNRA 4N0UE 1ZA6B 4PS4L 5KS9E 3AS0A 4BSVA 1FBIH 4ISVB 4M1DH 4Z7VB 4P2OC 4NFDA 2X1PA 4ELKA 3FQUB 5CSZA 2QHRH 1R3LA 1AFVH 2MSPA 1S9VB 3NBNA 4P2QB 1U8OA 1ZGLP 4RFNC 2H26B 4OAWA 5D93C 3MUGB 1NLDH 4LVHC 2BVQB 1YN6B 3DX8B 3WNPA 4PFEA 4EEEA 1BJMA 5BVJA 2I26N 1NJ9A 3DX7B 3RKDC 3ZDYF 1RVFH 2MHAB 4D9QD 1ZT7B 4YO0B 3JWDH 5FEBA 3FMGL 5C70A 3QXUA 5DQJB 3BDBA 4JKWA 3UTSE 2VR9A 3SHSA 3WIIH 2XTJC 3CVIH 4YHPB 2AXFB 5IBLC 3LS4L 3VD3A 4NSKB 5FYJH 5T1KB 4JY4A 1HQ4B 2VLJA 2Z91A 4OCSH 2A6JB 3G5YB 4YHNB 5IF0A 1EDQA 1UADC 3ARBA 3EFDH 1A6WL 2ZOKB 3KDMB 1OM3L 4J2XA 1W72H 4HK0A 2MCG1 4BZ2H 3LZFH 1KPVB 2L0DA 1B4JL 1U8JA 2E27H 2QQLL 2NW2A 2GTWB 1DUYA 1BOYA 4JO2H 1U9KA 5MERB 4OKVB 4HUUA 2X1OA 4KRPB 1Q9WA 4TYUA 1A8JH 4NM8L 5GISH 1ZWIA 1J0YA 4P2CG 1XIWA 4KTEL 1WBXB 2YD8A 2VLJD 5FDWA 5MHSE 4U6TA 5ITFB 1G0XA 4KROB 3TBSB 1OGAD 4N5EC 1KB5B 1FSKB 3OXRB 3S96A 4RGMC 5DJ8B 2P7TA 4XPAL 1QLEL 2P5WE 4K3DH 4XCNA 4L5FH 4GFTB 3RDTD 1FORH 5CGYC 1SJHA 4HUXA 4EUPB 4ZPVA 4Q58C 1BBDH 5IUSA 2RBLA 5K9QI 1YMMA 3ULUD 4HXBH 5EZIH 4GLRH 1ZSDB 4ZS6C 3TO4B 2QQNL 2WUCH 1FYHB 4PJ9C 1QR4A 2VLRE 3PWVB 2A73A 4PD4K 1GHFH 3P11L 1FO0L 4CMHB 4JKMA 3WLBB 5IB4A 3SDDD 1Q1JH 2H45A 3UPRA 4HK3J 4FQJL 5CZVH 2NZ9D 4HKJA 2DQHL 2HJKA 5EPMB 4WEUD 4I9WD 1HCVA 4JB9H 4NUJB 1F4XL 1A1NB 5JW5B 2PUQT 4C56E 3O81A 2PW1B 4AEEA 5F6HI 3LKNB 1J12A 1FL3A 2WZPD 3KPOA 1YMMD 1N64H 4PJBE 3PDOB 5DLMH 5T1DL 5I1EL 3ISWA 5FYLD 2AJUH 1XF2B 2DLTA 1CXIA 1II4E 4PJ8A 3ZKNC 4HMCA 1QVOB 2BNQD 4EI5A 5IIEA 3D39E 2IH1A 5DHVH 3K3QA 5F7FA 5LWYL 5DXWA 1ZKAA 1VFBB 3WUZA 4DN4H 1TTFA 4Z7VF 1YMME 1JNLL 3M1BB 4YHML 4LRIA 1G7HB 3O6KH 5E6IA 2GAZA 1MIEL 5J13B 1N5YL 3RVTD 4MJ2A 2DICA 2FHCA 5IKCB 2OZ4L 3IDIA 4NQSB 4PJHE 2AQ2A 1HSAA 3QQ3B 1BD2A 1UB6B 4ZFFA 1LO5A 1OM3H 1L4IA 3EYUL 3BMVA 4ZNEE 2OTWB 2NY6D 3LY6A 3Q5YA 3U9UB 3P30H 4UNVA 5GSVA 5EU6B 2ZUVA 3ZT7A 3FQTA 1Q0YH 3SKOA 2HVKB 5GGVL 5C9KA 2VLRD 3MA7B 4OCRH 3WIHL 1PG7H 2Y5TB 4LLYA 3IFOB 3KLAB 4AENB 1QHOA 3JWDL 3UYRH 3GKZA 5B38B 5HDOA 1BF2A 4PV9A 4PJXE 4MSWA 5DURD 4HCRH 1CF8L 1CTOA 2ZPKH 1FCGA 1S7UA 5E6YA 4Y5XA 2BJML 1EVTC 3KPQB 5M95B 1MAMH 5D1QA 1LWRA 1A6TA 4Q7DA 4ZD3L 1QQDA 5DR5H 3OAYH 1RJYA 5HY9A 4QYOB 4ZUUB 2VLJE 3R0NA 1HIML 3NCJL 5TF1H 4UINH 2NCMA 3FB6B 1YNKL 2YZ1A 2HH0L 2PF6A 4B41A 2XFXB 3WJLC 5F70A 1GYAA 1QFWM 2ICWA 3RWDB 5GZOD 2Y36H 4FQ2L 1SJEA 4PJGF 5H37G 3HC0A 2WBJB 4O2FB 1P84J 5GRWA 2P48B 2JK5B 5H94A 3KJ6H 1SMOA 4XB8A 3W5NA 1HI6B 1PQZB 3G5XA 4WI9A 4QOKE 3I50L 3GKWL 4NPYB 5MHSD 3GBNL 4NN6C 4MJIB 1K8IB 1GGBH 5KTEH 1YEFL 3SDXA 1XF4B 4DAGH 2GK2A 3GMMA 4U6VH 4RMVA 3KYNB 4QWWC 2C4FU 2HAZA 2CQVA 4MA7L 3CMOL 3B9EA 5AZEL 5DYOA 2HJLB 4LPXA 5CLWA 3LDBC 3LEXB 4JRXB 2FJGB 4KI1A 3FQXB 3H9ZA 4PB9H 5C2BL 1P7KA 4OLZL 4EDXB 4JZNB 3I6GA 4PLJC 4R9HA 1PW3A 3QULA 4PD4J 5HHOA 1DJSA 3I85A 4OLUH 4FFZL 4JY6A 1JWUB 2EDYA 4OTXL 5D5ME 4Q97A 3H9SE 3TZVB 2CK0H 4DVRH 2V7HA 3HNVH 1PD6A 4OQTL 1BZ7B 4YUEH 3QNZA 3TO4C 1YJDH 4MGXA 1C08B 3M45A 2NY7L 5EO0B 4ENEC 2H9GA 4TUKH 4W6WB 4KVCH 2VQ1A 3O4LA 1HH6B 2YKLH 5I1HH 3RGVA 1V7ML 3G5ZB 1HKLH 1ITBB 3OKNA 5HGHA 2DQJL 3QI9B 4JZOA 1BFTA 1I7ZA 2IG2L 1EFXD 2YZ8A 5DFTA 1HEZB 1S7RB 5EUOA 2M26A 4R96A 1JI2A 1OP3K 5ANMA 2EO1A 2GI7A 3NCFB 4R4NC 4WWKA 1IKNA 3JWOH 3EDJA 2D3VA 4D9LH 1AD0A 2XQYK 4L3CB 1BQSA 1FJ1A 1NBYB 4TULH 4K3DL 5AWNL 5I1CH 5EIQA 3PJSA 2BVPB 3EHBD 2V6HA 3X12B 2C1PB 5B3NA 5A40E 2YD1A 2XT1B 4Y16D 1LD9A 2ZCLH 4HUKB 4Q6IC 4XGZA 4NQVA 5IVNA 1KIUA 1W0VB 3QHZL 5EBWB 2EDEA 1T03L 3VWKB 3W11C 3L3OB 4F7CA 4ZFGH 1CD1A 3QEUA 2HVJB 4WO4B 4JREC 5JHLL 3EO1B 3RNKA 3IDJB 2VJXA 3IDYC 3U2SA 4MA8L 1UWEL 4LCIH 1WAAF 4K8RH 3Q0HA 1MREH 2ZUQB 4RNRA 1CFSB 1IBGL 4LLDA 4F7TB 1YUHB 3QQ9C 3K4DA 1U93A 3JBG7 4N0YL 3HR6A 1VENA 1URLA 3V4VL 4EJ1C 2YRPA 4JO1L 5I8OH 1W2KT 3FO1B 1TQCC 1QFWI 1WCQA 1F42A 1FC2D 5DZNA 1ES0B 4XCCL 1OAZH 1RHFA 5E08H 3OV6A 1WTGT 1MWAB 4GMTL 3QUZA 3ZKMC 1INDH 3BKML 4X4YB 5CIPB 5E70A 5T3ZE 4MA1B 2IJ0C 5AAMA 1P4BH 4ODXB 3ZKXB 5ICZA 3UJIL 3CFCH 2APXA 1E4WH 2J88H 3MCKA 1KF9B 3N06B 1FNEA 2Y06L 1UM6H 1ERNA 4HBCL 5DJCB 4UDUA 3PV6A 1BOGA 1N2RB 5DJDA 1LO0H 4K9EL 4JGMA 1IT9H 4GW5B 3T3PF 3D3VA 1NCBL 3HTLX 1K9TA 5JHDE 4KJWC 2CRZA 3DIFB 1NGZB 2VR4A 3MNVA 4ZPTA 1MCHA 3RL2A 5C0IA 2KPNA 1KCKA 5I1KH 5JOPE 2GIYA 3QI9C 4FQXA 1BBJB 2EH7H 1KBGL 3QDME 4AEFA 4XBGB 4G9FD 3BYTA 3LRSB 3VGDA 3HG1D 1WBYA 3OSKA 5BMFH 2DWDA 4POUB 1JHLH 3UTTA 4NNPL 4EI6B 4JHBA 2FL5A 5IROA 1KJ2B 1BAFH 1X4ZA 4X5WB 1PEWA 1QA9A 1F4WL 3RWEA 4KZDH 4P2YA 2O5YH 4LU5L 1RUPH 1W0YT 1NAKH 1R5WB 4XVJL 4TQEL 1DDHA 4YHKH 1T1XB 2EIZB 1BEYH 4BZ1L 3QUMH 4NJ9H 2YPVL 4PJ7B 2B2XL 1T1ZA 4XCCH 2JIXD 5DVOA 4Z0BL 3I6LD 5CBEA 3VRIB 3KGRA 1VPOL 3G9VA 1UZ6E 4DQOH 2OR7A 4OIBA 5DD6A 1A6ZA 5GGQH 4KI5E 4KRNA 4M1CD 2G75A 4DOHE 2N4IA 4HFUH 1EEUA 3HB3C 3QUZC 3VFNB 2NY1D 3N1QC 1MREL 3JV0A 3GM0A 5INCB 3DX6A 3T4AB 3MA9L 5I8CB 4X80L 1QRNA 2VSCA 1AH1A 1HSBA 1CD9B 1K2DA 1VDGA 3MLTB 1JPFB 1D5BB 3WDJA 1V8HA 3ZHDA 5IFAH 4U1IA 5FFLA 2HG5B 4PYHA 5C8JA 4XHJD 3OAZH 5E94A 4EN3D 3L6FA 3GB7A 4WHTA 1H3TA 1CGTA 3QXAA 4AIXA 3RX5A 4ISVA 2VDPH 2H32A 3BKCH 4HJ0D 4OLVH 5FO8B 1NC2B 5IVZB 1ZV5A 2W0PA 2JB5L 3CSYA 1R3LB 2VQUA 4M6AA 1EEQA 1ND0A 4LSTH 3L5XL 1OTSC 3V5KA 4KQ3H 5FOBA 4M43L 3OAZK 5I1EH 2D0HA 5HHPB 4DGYL 4XP6L 1P7QD 3DX8A 3SE9L 5EORH 3R1GL 4WW1A 1IGCL 5J12B 1RQ5A 1G84A 3WHE0 1W0WB 4NN5C 3LQMA 1T4KA 1VSCA 1FQ9C 2X4NB 3QWRD 5DT1L 3ZHLA 2R4SL 3CDGB 4ETQB 4OCXL 3O6FC 5CAYB 4PRIB 2FECI 4FHBD 1M4KA 3FO2A 4JY4B 1ZMYA 4TSAH 2YKLL 1FVDB 2W38A 1NCDH 4YHNA 3W0WE 2NZIA 2EE6A 1F97A 5EU3A 4P3CL 3KDMA 1P2CA 3TPKA 4O4YL 3OKKB 3FFDA 4OBSA 1EERB 4F80A 3LVEA 1GHFL 1R5VA 1XZ0B 4MCZA 1A5FH 4NYLA 5DRZB 2DOCA 2R23B 3UMTA 3VD4A 4J12A 2EZ0D 3EBAA 5GGTL 1RIHH 3RZCA 5J4MA 1UJ3A 3VXPB 1ADQH 1DL7L 2AERT 2Y07H 1Q9WB 2JJVA 2YA2A 3SE9H 1TENA 2BVEA 4GSDL 1NH6A 3MOAH 4CBPA 4KKBC 4Y1AB 1I85A 3F12A 3KNBB 2VDRH 1CFQA 4RDQF 4RDQG 1F4HA 2CGRH 3OB0K 3PIQB 4PTUA 1HXYB 4HIEA 2P7TB 1MRCH 2ADJA 3ARYA 1G9NH 3QPQD 1DTUA 3DRTB 2Q76B 3HC4H 3PWPE 4PJIB 4UV7L 3UP1A 1BVKB 2WBKA 4JFYA 3MTRA 4IRZH 4I0KA 3WD5H 3CC5B 1ZHBA 4G8GB 2F53B 2GQHA 3QXWA 4DKEH 2F5BH 3WMSA 1K4CA 5DSCB 2QQLH 2K1MA 5DMJB 1DLFL 2BOBB 3S37L 1DQLL 4XP9L 2KL6A 4TOYL 3EJZC 4LHUG 1A3RL 2DRUA 3QXDA 5D7IE 4KPHH 3B9KD 1IILE 4X6DB 5EA0L 3HZMB 5FGRA 1MI5B 5F7EL 4L4TE 3MLVL 3ZDXF 2VL5B 2BY1A 2HN7A 1CQKA 5DJZA 1TPXC 3VXNB 1C5BH 3V0WL 5FYJL 1KEGL 1LEIA 4WFGD 2DD8L 1EHLH 3H7BA 4MCYA 3ZYIA 1FSKC 1SM3H 4FXGB 1VHPA 5CP3A 2QADD 4I77L 5ANME 4KKLD 1JZ3A 5D71L 1CFTB 2X4SB 4XZUB 2LABA 1T1WA 2AEPH 5LGKA 4GAYB 4FABL 4PJ8B 5TFSL 1T0MB 5J1SC 5IIEB 4PLNC 2PYEE 1UQSA 4XVUC 2IH1B 1MFNA 4BK4A 5L2JA 4OB5H 3OX8B 1ETZA 4XVSL 3TCLB 1VFBA 4OCNC 4ZO8A 2V7NA 4WI6A 1EMTL 1KBGH 3IGAA 4PYGA 5I0ZA 3U4BH 3O6MH 1TJGH 2Z31D 2B1AH 1MHPL 3O3DA 4X7SH 4HJJH 2A9NH 4OQTA 5D7SH 3OAYK 5D5MA 1MF2L 1TQBB 5ELIA 3MO1A 2MJWA 5IW6B 3SE4C 3MROB 1EZVY 3TA3B 4MXVE 4J3TA 3IS0X 1EA9C 5GS1A 5FKPA 5HVHB 1DSFL 4KJYA 4ALAL 4Y1AE 5E2WH 3ARDB 1A1MB 1BX2A 2VNCA 4JAMA 2VITA 5DJXB 1LEKB 3CZJA 2OI9C 1N0XH 4JDVB 5F1SA 4NN7B 3IFOA 1MI5E 3QUYA 1IEAB 5T1LA 2R2BA 5FYLL 4PR5B 5IMOB 1J0ZA 5B38A 2AK1L 1AGCA 4IEFB 4GW4A 5HI5D 2FIKA 2ICCA 1M7IB 4XMLH 5E5MB 5L9DL 3K1DA 2HKFL 2XACC 4W70A 2BNRD 4LPVA 3KPQA 5IHUH 1S5HA 2YA1A 4JO4L 5D1QB 2Z8WC 1JF1B 1S7VB 1QQDB 4TNVF 4PRIE 2KQMA 1XGRA 2J8OA 5E5UB 4JZJC 5E8OB 5D7JD 3ULVC 2BCKB 1KYOK 5C0NC 4KHTH 4PGDB 1MCPL 4S1DD 3AU1A 3PV7A 2ED7A 3K2UL 1NFDB 3O3AB 5JQHC 4YZFE 4U1LB 5LXGH 5KVFH 4Q9QL 5IJVB 4YX2L 4FFWC 2FJFA 5K9KB 1S9WB 3MV8D 4NCC2 1I8LC 4P23A 3NIFF 5D70H 4KHTL 5I1LA 1MRFL 2PO6A 1I1RA 1LK3H 1WWAX 3ARTA 1A7QL 4H5SB 5D9SA 4J23A 5DWUL 3GMPB 3KYNA 1BM3L 1HXMB 5E99H 4D0DA 1I1YB 3MUY1 4XH2B 3QEQD 3RWGB 1BP3B 4Z7WE 5FYJU 5E99L 2DJUA 3RAJH 1D5IH 4OV6F 4PJEA 2A6IB 4TSBL 3QXVA 3HLAA 3IDUA 1OCWL 4EDXA 1R0AH 1BWWA 4KRPD 2QKIA 1QBMH 1P7QB 2Z8RA 4G6AC 4X0KA 3OJVC 4XNXL 1FCCA 3GMRB 5DHXB 1JNNL 4MA3A 4JO2L 3RRQA 3U36B 5IFHL 2EDFA 1B3JA 3V2AR 1NL0H 4POZC 5I1HL 1PYWA 3KPRE 3AY4A 4V1DA 2ADGB 3HAEH 4QRRA 4Z77B 1IGJA 4M93C 4NOFA 3OKMB 4KTDL 4O9HH 3EOTL 2VDML 5TDOA 3JXAA 3T65A 2VQ1B 4LBEB 4XPTH 2CLRB 2YXFA 2EIBA 2GT9B 4D94A 3OKNB 3D18B 1BQLL 1LVEA 3RVXD 5HGDB 2BOCB 2ESVD 4QGYA 4GXVH 3VGFA 1UACL 2APWA 1NBVL 2Q7YA 4NZRL 5I1IH 4J3WA 3O9WD 3TN0B 1G6RA 2IPKA 3QCVL 5DS8B 3VWKD 1A1OA 1BIIA 5EO1B 2RFXB 4U6XB 3D2UA 2IAMA 3VG0H 3GHEL 2EYSA 4O00A 1B88A 4IOFD 4GRLC 2EEBA 1M05A 2BHUA 4M6MH 4OB5L 1EHAA 1JPSL 4V1DD 4KI5C 1FGNH 4R4BB 4XPBH 1DBAH 4HKXB 3CMOH 5E5RB 1DEEA 5GJSH 1DUZA 5DQ9A 5GRVL 1NBZA 1F3RB 2CKBL 4Y88A 4RRPA 1M71B 1EHNA 3CXDH 5I19L 3LRGA 4FS0A 1EGJL 4WHYH 2ESVA 3BRFA 1MFBH 4UV4H 1ULVA 3O9WA 5E8PB 3VWKA 2A77H 4CW1B 4NHCH 4TVPD 3LRHA 4F7MA 2ZJSL 3DUUB 4O5LH 3MYZA 5K33A 1GIGL 4M7LT 2XWJB 4RNRB 5F7EH 4LCYB 3TIDA 2X4QB 4G7YL 4KHXH 2UWEB 1F2QA 2A1WL 2AK4D 2HRPL 2J8UF 4EKXA 4PJGE 1XGTA 2ZSWB 1J8HB 3BVNB 3BGAA 4WW2C 4S2SB 1DQLH 3DYPA 2IFFL 1G7MB 1ZVSB 2C4XA 2YWZA 5B39B 3OQ3B 3SGJC 5IQ9B 2Z4QB 2E7LC 1ES0A 4ZOEA 3VGHA 1MQ8A 4YPGA 3LEVL 3BDXA 3LB6D 4FZEH 2IBZY 4KK6D 2LE9A 2NY5C 2WMPA 1AD9B 1UM4L 1NEZB 3ZSTA 2B0SL 4OGZA 2XY2A 4PV8A 1D9KD 3S88H 3VW3L 1C5DA 5FYKE 1EJOL 1RPQA 3CXHJ 4LLUA 1H15A 4Z7OE 1QBBA 3P9WB 2M2DA 5DJCA 3MLVH 1GGCH 5EIIA 4GRLA 1HCFX 1LE5A 1TJIL 5C0GB 4QTIL 1X5IA 3FN0H 3LSOA 1P1ZB 1VADB 5D5MF 2B4CC 5CKAA 3UTSA 1ZK9A 1ZT1A 2G9HB 1AO7D 3MXVH 3RIFK 1ZGLA 3O6KL 5FUOL 4L4TB 4P48A 5T3XD 2VDMH 1U92A 1S78C 4IRZL 1KPUA 2JCCA 2ATPB 4X6DE 2BNQA 4S1RH 2X4RB 1IC5H 3CZFA 4D8PB 5T3ZL 2E6PA 3C9NB 2AVGA 4HKBB 3N85L 4UTAL 3HE6D 1D9KA 1HINH 4NRYA 4MJ4A 3P11H 5GGTA 4M7ZC 3VXRA 4EI6A 5TQ2L 2FL5B 4N8PA 5JIIA 1TJHH 2D7QA 4X5WA 4DW2H 3ZE0E 3BWAB 4KDVA 4GSDH 2Q8BL 1KB9J 2YC1B 3BP7B 3TT1H 2FO4A 5ID1A 5DTFA 2X9XA 2HT4D 1H3WM 1RU9L 2I07A 2ADIA 4KK9C 4MNQE 4PJ7A 1T1ZB 3MV8B 3RKPA 3O2VH 3FFCA 4M43H 1I8KB 3TEUA 1AQDB 4XWOD 1NGQL 1KCLA 5JHDA 4B53A 1AGDB 5DWUH 4IS6B 3NZHL 2CXGA 2MNUA 4DFHA 2AS5M 4PGBB 3ALXA 1YNLL 5D70L 3VFNA 2I9LA 3AS2A 5SWZA 3CSPA 2F54D 4XHJC 1CBVL 3QUXA 1ZEAH 2DLFL 3U7AA 1BGXL 2XKNA 5HJ3A 1WGOA 5GRVK 4RGOL 2ARJQ 1AHWC 2BSSA 3LV3A 4P4KA 5DEGB 5C07A 1KC5L 5SWQB 2YD6A 1MLBB 4TUOA 4WFEE 5FO7A 1KTLA 3MA9H 5HDLA 4MQXD 5DUMH 5GSRA 2Z93B 4JG0H 3L6FB 4MMXC 1WFUA 3EFDL 5EC1A 3MLRH 2CSPA 5DD3L 1C8PA 1OB1A 3DXAE 5K9JL 1WC7B 1NC2A 3F5WB 2RR3A 4ZNCD 4JFQA 4KTYA 1LQSR 3L1OH 2B5IB 4HGWB 1ND0B 2JLLA 4MLSA 4JFFB 1MCCA 4ZXBD 1OAKL 2YPLD 4P2QE 2A74A 3GIVA 5BQ7B 2E7MA 5DRWA 3V8OA 4XNZC 4QCIB 5JORB 5E9DA 2A83A 4WY7L 4TTDC 3DRQB 3VJ6A 5EB9A 4WV1B 4BKLA 1G7PB 2I25N 3OHXB 1T4KB 2IC2A 3DBXB 3QWOB 1D6VL 4GG6E 2X4NA 4N0UB 2R4RL 1QTYT 4XCEA 4H8WH 3QRGL 1DR9A 1A4KA 2JJSC 4WI7A 4PJCE 4Y4FB 3FTGA 3GEWB 4HUWB 4X80H 5IHZA 4L4TD 3QDGE 3FO2B 1MPAL 3LKSB 3K80A 3S3JA 4MJID 3VWJC 5CJOH 3VG9B 4JGUA 5JIPA 1GIGH 1IGTA 1OSZA 2XY1A 2FJHB 2R2HB 1HDMA 1RMFH 4PJXB 3N0PB 5E9DD 3QG6B 4JY5H 1LK2B 5C7XL 1MJJA 5EOTA 5AG8A 3TJEH 3GNML 2EYRA 1MCKA 2VZ1A 3MLSH 4QHLB 4Z0BH 1UWGL 1MCIA 2G60L 4MXWL 3SDCC 3T3MF 1LO3L 1EO7A 2LFGA 1OARH 3WLWD 2JELL 1AY1H 1F3DJ 1CL7H 3UTPE 4HIHA 4RZCB 4IOSD 1U42A 1UM6L 2Y06H 5E00A 1RUPL 2XI9A 3NTCL 3DTXB 3TGXA 5LBSL 4Y1AA 1FFOA 4N90E 1INQB 1X4XA 5GRXG 3HS0A 4H8WC 4PJFA 4M7KH 4PTUB 1SYSB 3DX9A 4X9IA 5F96H 3BQUC 5FV2A 3GSUB 3H9HA 3O4LD 4F7PB 5HHXL 4UMGA 3UTTE 3C8KB 2R0ZL 1FO0A 4PS4H 2ENYA 3P2TA 4K7PX 1RZJH 4JFZL 4UBDD 2MCPL 5I1KL 2P5WA 1RHHA 1UWGH 1XCQB 3EGSA 4AEIH 1B9ZA 5J11B 5J3HC 3C2AH 1ZHLA 4RQQA 3LN4B 3ULVE 1T66C 4PRDA 3QDMB 1EXUA 4MZ3A 5GHWH 3QXDB 1VA9A 3BEWB 2VKWA 2I60L 3AC0A 2F8XC 5CJXA 1CE6B 3IB4A 3U4EB 1E6JL 4LCUA 4LKXA 4OZHA 2H32H 4KZEL 1VACB 1S7XB 3MV9A 2ZUSA 3U4AA 4G6AD 4I3RH 4C56B 3U0TB 4BUHA 4OV5A 1RZJC 4GMTH 3KPNB 1UYWL 2R56L 4YHIB 2DQIL 1JTPA 2P44B 2H2PC 3BZDA 3GM8A 1F8TL 1EFQA 5DDHB 1F45A 3AROA 2NMSA 3NAAL 4MAYC 4R3SB 3MRHB 5IB5A 1ZXQA 3S35L 3DYOA 3M17A 1K6QH 2I9TA 3IFNH 2GHWB 2UZXB 2XXMB 3JV6A 1LP9A 4Q0XL 1ZLUH 1H3UA 3WS6A 1E0OB 1S9KC 5IMMB 4ODHH 1WISA 3IU4L 3I02B 4JG0L 5K59E 3T2OA 2ZG3A 2C3VB 1UWEH 3FOMB 3OZ9H 4PRPD 3STZA 1HNFA 2Z9TA 3BW9B 4K8RD 2FH6A 3MUJA 1I3RB 1MHCB 2XA8L 4L8DB 3L5JA 4OZFA 4LLWA 2JB6A 1ACYH 1NMAH 5D2NA 1UFUA 1HKLL 4OCYL 3WIHA 5C0AB 5IW6A 4GW1A 3ARGB 5GS0C 1KN2L 5CS7A 4E5XA 4KAQL 3F7RA 4X98B 3W9EA 4PJ9B 4LP5A 4YBQC 2MMXA 1F4YH 1TVBA 32C2A 4ODHL 4PLJD 4JAMB 1MCWM 1WJ3A 4GAGL 3MXWH 4NKDB 3C8DA 1O7VA 4U6HA 3Q1SL 1U8MB 1FNAA 4APQA 3KLHC 5IGXL 3AREA 1PVHA 2X4TB 3UTPD 3GJFB 3PGDA 3S5LG 3I9GL 4PJ7F 1MH5A 5DQDL 3DECA 4MAUH 4TNWF 5HHNA 1JI1A 4JFED 4CL7A 4OM0L 2IPTH 5CSBA 4PRBA 2BDNH 4S10A 3NN8B 4Y4KD 1PSKL 4XTRD 3FO0H 3MJ9L 1MJUL 4G9FA 3WNMA 3I75B 3O8XA 5K9OB 3RWIB 4OT1H 4G3YL 5DEFB 1XGRB 5HYQB 5I6XC 5DEZA 4TUKL 4QXGL 3UTTD 5C71A 4PJFE 1CICA 2HKHH 1W72A 2I60H 4I9WE 3SY0A 1CDBA 3SN6N 4ZOAA 5CILH 3KJ6L 2XTJE 1AJ7L 3IDNB 4FA8A 2APTA 3QG7H 1U36A 2BSED 3D39A 1BIHA 4Z7NE 1IQDB 1QSFE 5FECB 1ZGLM 5LAXB 4FFZH 4HJJL 4O02L 3ARQA 3HCVA 4WFHD 5C0CD 5KSVA 4X9GA 3U30C 1CTNA 3GBMH 3UAJC 5ESVB 3TBWA 3R06A 2HT2C 1HXMA 3O2DL 2WWKO 1I1YA 1FVEA 2P5EE 4LEOA 1SY6L 3FHAA 1FNGA 5B8CA 1M6OA 4GXUN 1OD7A 2AEPL 5DHVB 2A6IA 4FQHA 4R2GC 3L3JB 3QUML 4HCRL 3VGAC 3SKJL 4PB0L 2QKIB 2HFFB 3SGKA 1Z2KA 3OPZH 5KVMC 2DWEB 4PRPB 2R2EB 3RA7H 4CNIB 1CI5A 3I84A 2OP4L 2X2YA 3DHJA 3OXSB 4NQEB 1JHLL 2XPGA 1AXTH 3G08B 2F74B 5CD3B 3BIAX 4QHUB 3PQYD 4LSUH 1RZGB 1MAJA 2F54E 3GMLB 3MJ7B 2QSCL 1G9MH 3DMMD 3O3BB 5ISZB 3MX0A 5CJOL 2DYPD 4KH2A 5GPRA 4H26B 4ERSL 4PY7A 4U3HA 5F72S 5KBNC 5C6WH 3WXWL 1FAKT 5CJQL 1T83C 1ZTXL 4Q9BA 1F2XK 3VXSD 1YQVL 1JWSB 1N5YH 4Z95L 4MXVF 1PG7X 5JXEC 4J3SA 4Y2DA 1Y6NR 3UBXB 2EC8A 3WKNA 3E8UL 1G9NL 2EE3A 4NRZB 2J7LA 5I76A 3QUXC 4ZTOH 2W65A 1VFMA 3EYVA 4Y5YA 4G43B 1DBAL 5B4MD 4HKXA 4ZDHB 3ZL4H 2GSGB 3F7YB 3GMOB 1DUZB 4PJAA 2X44D 5DQ9B 1AGEA 3VXSE 3AUVA 1L0YA 2G2RA 5DD3H 2IMMA 5T1DH 1GGYA 2Y07L 4QRTA 4O2CB 4DKFL 3GI9H 1IM9A 3ULSB 4MNGA 4L3EA 3O9WB 4MQTB 4JPKH 2X9YA 2KDGA 4KKAD 3VXOA 4GQ9H 4IDLA 5CILL 1LO2H 4OZGF 3QIUB 3P9MA 4JM4H 5F7KC 4LHUD 4DGIL 3NZ8B 2X41A 2D9CA 3JWNC 4YNYA 2GTZB 4JJ5A 4Q6IA 5EC2B 3WDHA 5J06A 4P2OB 2DQGH 3MYJA 3MRKB 2X4QA 1YQ2A 2Q1EA 5FGSA 1I3VA 3TBYB 4RA0C 2VABA 4Y7MA 3MRLB 3NZHH 4EXKA 3EOBA 1G7MA 1R3HB 4NFCA 2EDJA 1S7QA 5CJ8A 3U46A 4MAUL 3O2VL 5IQ9A 4HG4K 3CFDB 2Z4QA 1AE6H 4TRPL 5JMOC 5EZOL 2EDDA 5JOEA 2CIKA 2ARWA 5INDA 4YPGB 4G5ZH 5KS9A 3ARWA 1D5IL 4WTZA 1AGFB 1RIVL 4QT5A 2XWBA 4YHZL 3L5XH 4CJ0A 1HHGB 3ZT6A 1BLNA 5DK0A 4QWWD 4JN2B 1U91B 5J1AA 2V17H 1H15B 2DQIH 3D6GA 4R6UA 2VC2L 4D9LL 5D93B 5JNYB 4UTAH 5IBLD 4JFHE 5GRJL 5GGSY 4JFPB 2IGFL 3HRZA 4XPHL 1U95B 1X7QB 4ZTPL 3VI4E 3F58L 4KXZI 5B38G 5KVFL 4GG6A 1ZA6A 1ZT1B 4KMTH 4DCQB 2XA8H 4PGEA 3MNWA 1ZANH 3NA9L 4HXBL 1LDPH 3BPOB 4LCWA 1E6JH 4MDJB 4F15B 1U92B 5EG6C 3ULUH 2BNQB 4P2QA 2X9WA 1JF6A 2ZOLA 1DFBL 3ZE1F 1YDPB 4HKBA 4MHHI 1KJVB 5FKAB 1EO8L 3MUGA 2BVQA 1R3JA 1U8PA 2VE6B 1I3GL 1K6QL 1U3HC 5SV3A 4EOWH 2HKFH 1KPRA 3GJEA 2R8SH 2QADC 2OR9H 4KXZH 5DI8B 1KB5L 3IFLL 5DQJA 4LLVB 5I66A 5JXAH 4WFFD 1CDCA 4TNWK 1ZLVK 2NW3B 2VLKD 3WNKA 5BZDB 5IMKB 3IDGA 1OD9A 5T1KA 4Y8AA 4LRIC 4LCWD 3MV8A 2A6JA 3T0BA 3FRUA 3I3DA 3PWNB 1AQDA 5CHNB 4D9RD 5A2KH 5AG9A 1JTTA 2FYYA 4MD0A 1YPZF 3U7YL 2DMCA 5GZND 5KSBA 4CU8A 1RD6A 2XZQH 2SEBB 3BGFC 3TVMD 1RY7B 4PGBA 4R90H 1UXWA 1FBIL 4BQCA 3MR9B 1N59A 1NGWA 1OSPL 3PL6D 5GS0L 3QO0A 1CN4A 3R8QA 5JPMB 1T04B 4ODWA 5C9JB 2E8ZA 5FK9A 2FGWL 2Y6SD 1DBML 2I5YH 4JPWL 3DO7A 4FTVA 2IALB 3L9RA 2Y36L 4FQ2H 4LVNC 4F37K 4OIIH 4YXKL 1FZKA 4PJCB 5SWQA 1DBJH 5T1KD 4U1KB 3EUUA 4WW2F 1RZJL 1DVFA 2YUWA 3VDAA 2F15A 3TBSA 5GS0H 4ONHB 2XRAL 4ZUSB 5F21B 3TFKD 3L5WA 2XZQL 4JR9H 1MCLA 5D2NE 1MWAH 2OJEA 4UT9L 1CCZA 1OB1B 2J88L 1BHGA 4WUUB 2WINB 1MAML 4Z7UF 4DWHA 4EUPA 1VEOA 1Q94A 2ITDA 3N50A 4JFDE 2NXYB 3O4OB 2J3SA 2AJSH 5E9DE 3EYFB 3GIVB 1N3NB 1P6FA 4I77H 2XRAH 4QCIA 5F93C 4M48L 4OUUB 3SCMB 4MQSB 3L3KB 5CEZL 5FXCH 5F1IB 4RIRA 4WV1A 1QFWH 1G7PA 4AT6B 3DBXA 2X4PA 1FLRL 2UZIH 2DQDH 3WLBA 1KUMA 4NZRH 1HZHH 2NYYD 1KEGH 3TYGH 5E8EB 1NDMB 3QNYA 4KJQD 3AREC 3LKSA 1BQHB 1MI5D 4U1GC 5CMAB 1A3RH 2FJHA 1S8DA 4UILL 2IBZX 4J8RB 5FYJD 2PR4H 3NA9H 1KJ3L 1ZT4B 4PJXA 2D0GA 1YY9D 3QG6A 4U3CA 1MJJB 2Q8AH 4QHLA 1X5KA 1KJ2H 5D1ZD 3V5HB 3X11B 1T20A 5HBBA 1XF2A 5MEPB 3O0RH 5DJ2B 3OKDA 3WV0A 3PABA 4JANB 4XB7A 3BUTA 1CZ8H 4JN1L 4Y4KC 1DQJB 3BSZH 4NDMB 2VN7A 4X4ME 5JZ7C 4OLXH 4I2XB 4HUVB 2FEEL 5KZCD 5J6HA 4ZFOB 4XI5C 5LJYH 1INQA 3QUKB 4JHZA 5C0AE 3DVFA 4J1UA 5I16B 4F7PA 3THML 3GMQA 5TGBB 1FYTD 8FABA 4RA3A 1KEML 3C5ZB 3C8KA 3BN9D 3S7GA 3JSSA 3B5GA 1BD2B 1UB6A 4ZFFB 2CK2A 3MRBA 1LO5B 2WBJC 1LDPL 1RHHB 1ZLWH 3OKLB 5D7JC 4JHAH 1E28A 4E41A 3S6CA 1F4XH 3MCG1 4Z7QF 3X13B 5FGBA 3GDBA 4PRDB 4HXAH 4NP4L 1T0NA 4P3CH 3E0GA 5DC9B 2APFA 2CMRH 3TA3D 1SBSL 2VISB 3NPSB 2ZUXA 5T3ZH 1Q1JL 4LSPL 4WHDA 5KSBF 1DE4A 4WI8A 3FONA 2GSIA 3CCHB 5FM8A 3RJQB 3HB3D 2AV1A 4OZHB 5I73C 3ZTNL 4PV9B 3KXFA 3N9GH 4JO4H 5E6ID 4ONFH 3FCTB 4GBXA 1UCBH 3RUGE 4OV5B 5I1AB 1G1CA 4UQ2A 3S34H 2Q87A 1DQTA 3U6RA 4LSTL 5IK3B 3U0WH 4MX7B 1FHGA 2B0SH 4P9HH 4AEHL 4S1DC 2I9TB 2XFXA 3DV4B 1T0PB 3HE6A 4XNQA 1EAPA 1OTTD 4ZUWA 5D2LF 3VXRD 1HYSC 3RWDA 3BJ91 3IFPB 1OGTA 4RBPH 4HZLB 3N85H 4ZAKA 4NM8H 5GISL 1Z5LB 3QIWC 1XF5A 5CD5D 3IJYA 1GGBL 5KTEL 1OQXA 3RHWF 4TPRL 1I7UA 5F97E 4GKSB 4GG6F 4WHYG 2BK8A 2J6EL 4MD4B 4OD3H 1NFDF 4UB0L 4ACPA 3JTSB 1K8IA 5ALCL 3PNWA 1JZ5A 4PLKC 2AAVA 1JZ8A 5IR1A 1MCNA 5C3TA 4HWEL 2VUOA 4WUKL 4X98A 3PP4H 1F6AB 4XC3H 2GJ6E 1T21A 3H3KA 3PP3H 3UZVB 4MMZC 4P3DA 4X4MA 5ESAB 2V5MA 2ED8A 4O5LL 1FIGL 4J3UA 1WZ1L 3BJLA 2B7DT 5DR5L 1P53A 5FUZH 1QKZL 3W0WD 2B2XH 1JWUA 4M7JH 2F58H 5JO5B 5L8KB 4J4PC 4BZYA 1OWRM 3LKOA 4G7VH 5C07D 3C60C 1KTRL 2BC4A 3IKCB 3B5TA 3P73A 2D9QB 1YEHL 4NQDD 2OK0H 1UENA 4U0QB 1WZKA 1BFOA 3S36H 5T3XL 1A21A 1PKOA 2AGJL 2DD8H 3QDGB 2H9GB 5JQ6H 2R1WB 4XPFL 3I75A 3RWIA 1HH6A 2E6JA 3GIZL 1FRGH 1C5BL 3QI9A 3V6OE 4F9PC 2EH7L 2YSSB 3A6BL 3SGDI 1IC4H 4R7NA 1W72B 5DFVC 4J4PA 4P2RA 2CIIA 3LPFA 1UACH 1AC6A 3KPRB 4UU9A 4ZYKB 2K3TA 3H3PL 4R4FL 1LO0L 4OD3L 2J6EH 1IQDA 2UZYB 5ISZE 5H35B 1MLCA 3GRWH 4DGVL 3FFCD 3QPXL 4LQ1A 4I5BA 4CMHC 4A6YB 4R4ND 1KXVC 3HN3A 3T2NL 4UV7H 1KN4H 1Z9SA 5I9QB 3C5SB 2X09A 3JV5A 1T7XA 1FAIH 1MFDL 1MRCL 1TETL 4JHWH 3MZGB 3FN9A 5MP6L 1JPSH 1W0VA 3QSKB 3HUJB 1FNSL 3MV9E 4U1NA 4P2RD 3IF1A 1NAML 5LQBL 4Y0GA 3L3JA 3BZFB 3IDXL 3VG0L 3UJJH 5EH1A 4KU1A 2AK4E 1WSST 1B6DA 1UCBL 3RNKB 3U2SB 3UTQA 5I1IL 5ADPL 3I6LE 4LHUB 3NFSH 2NTFB 4NQEA 1KG0A 4LLDB 1EO8H 3ECBA 1WIUA 2B4CH 3LQAC 1U93B 2NLJB 3ROOA 3ULUL 4M61A 5KG9A 1HKFA 3MLZH 3FZUC 3B9AA 5EFIB 1RULH 4JDZB 4YHOH 3VFMB 3MBEB 1ZANL 3JV4A 4Y16A 1O7SA 2XTJB 1WAAA 1GAFH 5TDPB 1IE5A 2YD3A 4GLRI 4ODBD 4UTBL 1JWSA 1UEYA 2VLKB 3RNQB 4QTHB 3SEPA 3QFDB 2ZCKL 3RY4A 4I1NB 3VXTA 5CIPA 1CXFA 4I18B 3T0EE 3HNTL 1WF5A 1JZ2A 3I9GH 3VCLB 4YGAB 1RZFL 4ZMAT 1J1OL 1JGLH 5EBMB 4H1LB 4A6YL 4M8QB 3V4UL 5HGGS 4YAQA 1KIPA </