1CQYA

Starch binding domain of bacillus cereus beta-amylase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
TPVMQTIVVKNVPTTIGDTVYITGNRAELGSWDTKQYPIQLYYDSHSNDWRGNVVLPAERNIEFKAFIKSKDGTVKSWQTIQQSWNPVPLKTTSHTSSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-AMYLASE
publication title Structure of Separated Starch-Binding Domain of Bacillus cereus B-amylase
rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00686 CBM_20 Starch binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cqyA00
1FNFA 4GRMA 1JWUB 5F88A 1XGTA 2O5XH 3C9NA 4TNVF 5D8JL 2P5EA 1DEEB 5FECB 1A0QH 5JZ7D 4NHCL 4MYWB 1KTKE 2BNRD 1YNKL 4NUGL 4JG1H 1S7WB 1TZGH 3F7YA 3MLUH 1LP9B 2FLRT 3ESUF 3AS1A 1WBXA 2WANA 3NN8B 4JFDA 2LTQB 3MLWL 1WZKA 3QUXD 4ISVB 4Z78B 2XZQL 5EUOA 4CRPA 3OSKA 1R3LA 3VXQA 5F1KC 1IGIL 3DIFA 4CW1A 1TITA 1OSPL 3CFEB 3FN0L 4TSCH 4A6YA 4WFHE 3RKDC 4AIXA 1NMBL 1VFBA 3NCYP 1BIIA 1QKZL 2F9BT 4YUEL 4U3CA 2ZSWB 3L3HB 2ZCLL 1EUUA 2HN7B 4XPGL 3QEQB 4PGBA 4QRPE 4C4KO 3T8XA 3KPSB 4O4YH 1FO0H 4ODSH 1J0JA 4G6JH 4Z5RA 3BQUB 2QADD 4ELMA 3G9AB 1ZSDA 4GLRI 3V7MA 1QRND 1AE6L 5D7SH 4L3ED 5CIPA 4DZ8A 2XA8H 4N8VG 5JW4M 4YZFE 2VXTH 2R15A 1YN6A 5CD3B 3QH3B 4GRWE 4XT1C 3D2UA 5D5MF 4ORGB 4Y2DB 2NX5E 4ONOA 3W5NA 3O4LA 2YD7A 1MVUA 2VH5H 3S9DB 1IM9A 5GGSA 4X80H 5IHZA 3CFDA 2W92A 5E70A 5CSZA 1L7IH 5IQ9B 4OCNC 3VFGL 4JO1H 1FNEB 1MI5B 5L7XH 3LKSA 3BYTA 2ZUTA 2XG4A 3GJFB 3V4UL 3BHBB 4PS4H 4MXQC 1IT9L 4U1NA 1I3RA 1QG3A 5ID0A 4HKXB 1MIEH 1CDUA 2DKSA 4KROC 4OZIA 4FTVB 1F42A 5I1HL 4P23A 3E8UL 4JFXA 1JGVH 5J6HB 2AQ2A 1GXEA 1YMMA 3RWFA 4P3WA 3LN9A 3EOBA 2DQJH 4X98A 4S1QH 1T20B 1SQ2N 4YK4C 3CFKB 2F5AH 3LIZL 1QEWB 2OSLA 1WV7T 5EU6A 3U0WH 4P9HC 2IH3B 5IQ7L 5KSAA 2HFEB 3V5KA 3W5MA 4X6BB 4ZXBC 4K9EL 5GGVL 3UYRH 5HYJB 4AM0A 2D0GA 3QEGH 1LK3L 4HC1A 1VB9A 5C3LD 1CG9A 1P9MA 3PG2A 1U6AH 4MJIB 4WI4A 1S7SB 3KYKL 1YUHA 1EGJL 4IS6B 2RJMA 4WHYH 1DP0A 4PTUA 1ZMYA 4F58L 5C09B 3VFVA 3LQMA 2V9QA 1E4WL 4H20H 1GHFL 3TO4D 5EPMA 1TDQA 2XN9D 4NWUH 4U6XB 2WUBL 3DX6A 4X7SL 2DRUA 2Y5EA 4N0FA 3KYNB 5HTSA 1D6EA 5T3ZD 4MSWB 1GGBH 4K3DH 1FRGH 2VR5A 5L6YH 1A3LL 5DUPL 3GKZA 5SX4H 2VJXA 1I1AD 5EO1B 1D3CA 4YEFA 1J1XL 4MCZB 3MFFB 4K8RD 1PBYA 3F65A 3N9GH 4HDIB 2CR3A 3FQTB 3QIWC 3WIFB 5KAQG 1BD2A 1SEQH 2X1QA 3ZKSD 2FD6L 5FO7B 1FH5L 5CZVL 3WXWL 2X4SA 3KJ6L 1LILA 4HWNA 3SDXA 5C0JA 3CH1B 4NNYB 1IKNC 5C2UB 1XAUA 1V05A 5CFHA 3QUYC 1YY9D 2IJ0C 3MRPA 4BFEA 1CR9L 4QNPE 1YMHA 4JFQA 1A6VH 2PW2A 4IJ3B 3DX8B 4WY7H 3O4OC 4XGZB 1TVBA 4PLOB 4Y89A 1AGFB 3PP3H 4O02L 4UTBH 4X6EB 3I02A 3NIDF 5J11C 3C5ZB 1IL1A 3L7FB 1LO3H 5FV2A 5KVDH 3OBAA 1RURH 2AV1A 4L4VD 4KJWD 2Z31A 2XPGB 5C0CD 1IGTB 3BO8B 2ZUXA 2VDOL 2C3WA 3K2UL 3RI5F 4O2CA 2VLRB 4F57H 4P2RB 4EI5A 4EOWL 2EH7H 3PL6B 4F7PA 2YKLL 4HGMA 1NDMB 4UQ3A 1OTTD 5D7IE 4MA3B 3V0WL 2VLKB 3GUTB 4G7YH 5GGQH 1IAKB 1C5BH 4NDMB 1R0AH 2B1AH 2IAMB 3GJFK 1BHGA 2YPLB 2AEPH 5JW5A 5A2IH 5C0BD 2VSDA 3V4PH 1SVCP 4LSRH 5ID1B 1CZ8H 1VEMA 1WK0A 4OQTH 3VRIA 2DM3A 5JPMA 1OW0C 5GHWH 5DRNB 4NGHL 5F3BA 5JHDA 1QFWM 3E6HA 3I9GH 1WICA 4C56A 4QF1B 1RUAL 1H3TA 2IPUK 4MA1B 3MV9D 1D9KC 4PGEB 4NKIL 2X4QA 1P4BL 5LGHH 5IT2H 1RJZA 2DM4A 3VGHA 5CEZD 3KS0J 3DMMC 2H8PB 4OGYL 1MRDL 1XCQB 2GTWA 1NFDB 4EDWL 3HB3C 4PJ8A 1LEGB 1VERA 4JY4B 3RIFK 5DEFA 4MQ7B 1CF8L 5E2UL 5D7JA 1T1XA 3P0GB 4GAJL 1OGAB 5ITBL 1WWAX 2VDLL 3W9EB 2CLVA 3O45B 1HHGB 4PRPA 4WI3A 5EUKA 4KTEH 1KEMH 4KQ3H 1P4IH 3OJ2C 4FZEL 2B2XL 3ARED 1NSNL 4YIQB 4IRJA 2DM7A 1OQXA 5FUZH 1IEBA 3B9KB 2FHBA 3AB0C 1IAIM 4PRIB 1ZHNB 3CSGA 3UPCA 5E2JA 3L5IA 4ZFOL 4YPGB 1FO0A 3X14A 2GJ6E 4S1DC 1NGZA 5I75C 2UUDK 5BVJB 5DA4A 5E9DA 4LGSB 3UEZA 4UNTA 4PTTB 1C16A 1FFNA 2VZ1A 4J8RA 3ARUA 3QG6B 2EKJA 4L5FH 1P7QD 1N7MH 2FZ3B 2Z4QA 1GC1H 4B53A 2IANB 2VMFA 1CFTA 1S7VA 4AT6A 2ICCA 2HKFH 4AENB 3FB7B 4OD2B 5D96B 2HJLA 3M1BA 4OF5A 4Y19D 1A0QL 4MS8D 2Y6SC 1T1WA 3X13B 4XP1H 1DQJA 2ESVA 3OPZH 4HUUB 3DURA 3VXME 4DVRH 3ROOA 4BZ2H 3FQXB 4MNHB 2R4SL 5CBEA 4D8PB 4G8GA 1L9NA 3GK8L 1MCSA 2DBLH 1CGXA 2YD4A 3TO2B 3B3IA 3VI4E 4QOKE 4UDTB 3UTTB 3FZUC 1LE5B 5E6ID 3NH7H 3BPOB 4XI5C 3U1SH 4NRYB 1MREH 3EJJX 4NO0A 43CAB 2FJFB 3NTCH 4NZTH 1YEFL 3O0RL 1UM4L 5BVPH 1XCTB 2GUOA 3TV3L 3JUYA 3HAEH 4HH8A 5JXED 1QYGH 4ERSH 4PY7B 4ZFFB 4I48A 2UWEA 4K9EC 4TN9A 4O4YL 4JFOB 1BBDH 1X5LA 2L7JA 4BQCA 1AR1C 3VXPA 1SY6L 4G6JL 3DYOA 5IMMB 2D9CA 5CJBA 1CD8A 1J1OL 4LLDB 2BY1A 1BQLH 1QBMH 2QL1A 4PJAB 4Q6YA 4LFHG 2X40A 2J8UF 4XX1G 2ERJB 5J0BA 1FN4B 2EDLA 2GW5A 2D7NA 5MENA 4M8QA 2VXTL 2YD9A 1SYSB 1FVDA 4PJCB 1FFQA 1CL7I 3LN5B 5IHUH 3JXAA 3BI9X 5LCVH 2VLJD 2FGWL 1KPUB 2I5YH 1Q8MA 3VXSE 1Q9KA 4JRXE 3U36B 2CJUL 3SDCB 2F74A 4J3XA 4CU7A 5IFHL 3QUMA 4DTGL 5GSVA 5EU5B 3BPCA 4X80L 3U30B 3X12A 4YZFF 4OGZA 5T5FH 1L7IL 4M00A 1DVFD 4JO1L 2LABA 5EOQL 4GRWF 1TCRA 3C6LB 5FGCE 4PS4L 3T65B 4ZAKB 4AMKL 3MO1A 1KC5H 3DX9A 3I6GB 3VXUE 3K1DA 4WUUE 3C8KA 2X4PA 4L9DA 3WSQH 4LLYA 3FL7A 5DJXB 2VXSL 4H8WL 3RQ3A 1T66C 1B3JA 2BCKB 3C60C 1C5DA 2DQJL 2AS5M 4LLAA 3L3KB 5TPWH 5FYKD 3QDJB 4D0DB 3N1MC 4HG4K 3QNXB 5ITFB 7FABH 1D5BB 4MXWH 1JHLL 3SGDI 2QR0A 3UYRL 1DQMH 4CDGC 3QEGL 5DJ6A 1XZ0B 4OCLC 5DJAA 1U6AL 5B8CA 2NY6D 1QSFE 3U2SA 4HV8A 3U4EA 3DTXA 2DDQL 5I9QC 2QSTA 4PJHE 4XMLH 3EO0B 4W4OA 2X4OA 3MUGA 3AY4C 1MCBA 3FB5B 1IAOA 4RGNB 4ZOCA 2JJTA 4HIIA 5BCAA 1S9YB 2IF7A 2OJZL 2VDNH 3IKCB 5INCA 4BKLA 1UB6B 5BV7B 4U1SA 5C0GB 4M6OH 1LE9A 1T0PB 1FRGL 2W0FA 5DJ2B 4JFHD 5L6YL 2LE9A 1D5MB 3ZKMC 2ZSVA 5E4IA 1RJLA 2QQLL 3CMGA 2I9TA 1NMCC 1P1ZB 1RIUH 1K6QH 2Y07H 3N9GL 3CSYB 3FT2B 4PJ5B 4JPKH 1SEQL 2V2WB 2QHLA 3MOAL 3W11C 3PP4H 3FONB 1QR4A 2A77H 2NQCA 2O26U 2V2XA 2W65A 4OQTA 4G9DA 1I85C 2F54B 4G8FB 4HS6B 1AQKH 2FGZA 1G6RH 5MEQB 1ND0A 3QWRA 3D85D 3UJTH 1CGYA 4JZJA 1KB9J 1CFNB 4K94H 3BRFA 4GXUM 1JPGA 1CICB 1CXKA 4DN3H 1IGJA 2AJ3A 4UTBL 4MNGE 3FO0H 4OZGB 1I7TB 3WNLA 1ULVA 4WTZA 1IAIH 3RNKA 4MQXD 5J8OA 1MFNA 5JLZA 4HCRH 3DUSB 5HPMB 3PABB 5IFJA 4PJ9C 1HOCA 2J4WH 1VCAA 2ARJQ 1LO3L 3WS3A 5I2IA 3RWIB 1ZT1B 4FQXD 1S5HB 3RVTC 1G6VK 3M17B 2EC8A 4XPTH 4NKMB 1KB5H 3OG4B 1NGWB 4F57L 1U8NA 1B90A 2OI9C 2CLZA 4G42B 4PLJD 2F8VA 4KHTH 3FCTA 3CU7A 4QHMA 3QJFA 3EYFB 1SJEA 3MOQA 5GGQL 1C5BL 5CD5D 2B1AL 5EOCJ 3QEHA 1YY8A 4PRHE 3V4PL 4N90E 2R0LH 4LSRL 4LKXB 2WV3A 4P5KB 5IROA 3V0VA 1NBQA 1NCAH 5TDPB 4KUCD 5D7IF 3L3JB 1JJUA 2VDKL 4NJAH 3FHQA 5IWLC 3MRMB 5KOVC 4LGRB 3EUUA 4Z7VF 4X5XA 5H2BB 5T3XH 1DBBL 3MRGB 1MCLA 2H2PD 4DVBB 3NCBB 4GRLD 3NABH 5C3TA 4LLMB 3BP4A 3MSPA 4ZFGL 5LGHL 5EOTA 3VFTB 5IT2L 1H3WM 1KCRL 5J13C 4IDLA 3H2WA 2LAGB 4XNYH 4PREA 4CGTA 5BMFL 3BUTA 1T3FA 4NPYA 3VFMB 3MRKA 1PLGL 2X1XR 4WI5A 1KJ2H 2HTLC 4L8CB 1QQDA 3D3VE 3LH2L 4Y4KA 3QRGH 3LOWA 3ABZA 1CXFA 3TN0D 2LV4A 5EIIA 1VHPA 4M7LL 1W0VA 3KYMA 1WC7A 1IBGH 5F7EL 5DXWA 4KQ3L 4LVEA 1RK1B 4D0CB 1ORQB 4EUPA 3L9RB 1Z5LA 2F5BL 1FC2D 4IRJC 1UKSA 1UQSA 4HXBL 5D1ZD 1NJ9B 5FUZL 3HAEA 4JAMA 4BQ6A 3OXSB 5HDLA 3QNYB 3O9WB 1DUZA 3PV6A 1Q0XH 3BN3B 1AO7A 4Q0XH 4JKPH 4Y5VA 1F4YH 5D7KD 1J0KA 1GPOH 1U8QB 3EDDA 4YQXH 3ULUD 3PQYE 4M7ZC 5BRZA 2YWYA 5GRYA 2EYSB 4L5FL 2ZOKA 3RL1A 4L1HA 5DO2D 3VWKA 3W82A 1OHQA 5KSBF 3S3JA 3LEYH 1JF1B 4YHYC 3FQNA 3H9SA 2HKFL 5D9SA 1HXYB 4P2OB 1DL7L 5A43C 5KS9E 1MFAH 2CIKA 4R6UA 4ODBD 1FZJA 4RRPA 4UOW0 3DROB 3GJEB 3OPZL 4PJFA 4K07A 1AGDB 2P5WD 1W72B 3MQIA 1IE5A 2FECL 1QOKA 1A7NL 3O2VH 5F7KC 5BOZG 2DBLL 5DRZA 3ARFD 1MH5A 5HGDA 3V7AG 2LU7A 2WIIB 1P2CB 4WWKD 1KIRA 3U1SL 3QIUB 3WJJA 1INQA 1T80A 1YJDL 3P11L 4HSQA 3NTCL 4NZTL 1KOAA 4WEMB 3DBXA 4L8SA 2D31B 4E0RA 4Y1AD 2DQDH 3V4VH 5E5MA 1MCKA 3GSOA 5T33L 1QYGL 4ERSL 4JM2A 5DHXB 5C1MB 3NCJL 3ZDYF 3F12A 1FBIH 4JHWH 4QRTB 1JWSB 2ARWA 2AJSH 3NFPB 5F3HB 5MI0C 3SCMD 5IB5A 2VKWA 2ZKHH 2A74B 1A4KA 3GSUB 3KDMA 4IRSC 3FO9A 4PGDB 5D1QC 2VYRE 4NQDE 5D2LB 1YEJH 1QACA 1ZGLA 1Z3GL 4OZHE 1S7XA 2Q20A 2HTKC 3ARXA 3MV8E 3D25A 3ELAT 1WUNT 2AVGA 2BY3A 1KG0B 3BSZH 3VXRB 4NQUA 4WO4C 4EXKA 5IHUL 5E8OA 3HNSL 3KPOB 2I5YL 2OBGA 1QBLL 4HK3N 4FQHB 4LVNC 4G6MH 1TETL 3UJJL 2OL3A 5I74C 4Z95H 2YK1H 3LKPA 4WIQA 3EOYG 2OJEB 4FQPA 4MD0A 2DLEA 2PTUA 3O41A 4KK8C 3BKMH 5FKAA 1NCNA 3FQUA 3KWWB 8FABA 1MFDL 3MBEB 5IGXH 3MA7B 5DVMA 1I7RA 2FO1A 1KC5L 2CIIB 3IU4L 3PWJA 3HI6L 3MODH 3QWOA 4JZOB 4Z7WB 3WSQL 2WBJA 3ZKNC 2EC9T 2FWOA 1G6RA 1KULA 1U91B 3OXRA 3E2HB 2ITDA 4JY5L 4M62H 4NQVB 4Y16B 1TQCC 4KFZC 4LP4A 3RY5A 1B4RA 4OKVB 1H5BA 2X42A 3NFSH 4WUKL 3DO7B 1KJMB 4G6FB 4HUVB 1IM3A 2MQCA 1HQ4A 1IMHC 5TPWL 1G0XA 2E7MA 4HJGA 3UTZA 5HHNA 7FABL 4EBQL 1MJJB 1CE6A 4KK9C 1F3DH 3GSXB 3HUJB 3BWUC 1P84J 4LNRB 2JIXA 1DQML 1YQVH 4JRYA 3FT4A 5ISZB 4BQBA 4RCAA 3KPNA 2NNAA 3RKDD 1X3DA 3R06B 2MWCA 1E27B 4U1JB 4HQQL 1HH9A 4XMLL 4X9BA 4M5YL 3WN5A 3H0TB 3VGBA 5K9QI 3SDYH 4J2XA 2VDNL 4WW1B 1KB5A 3QDGB 5D70L 4ZG1A 1N59B 4I0CC 3IVKA 4M6OL 2E6QA 5E8DH 5F96H 3TBVA 2C1OA 1DDHB 3RUGF 1FVCA 4YHZL 5JHLH 2AJXL 2P1YA 3P4OB 2DQGH 1GZQA 5E1HB 1ES0B 3LEXA 4P4KC 4QTHB 1QA9B 4H5SA 1RMFH 3LRGA 1BLNA 5KZCB 2COQA 3RPKA 2A77L 4X4XB 1J87A 1OVZA 5GGRA 2P24B 2EXWC 1AQKL 3MNWB 3WEXA 1HYSC 3QYCA 2B1HH 3T09A 3UJTL 4RFOH 1HI6A 4NQEA 1HHKB 2NR6C 4LU5H 4OFVA 3ROLA 1JPFB 1E4XH 4XZUA 4U1GC 2BVOA 1FLTX 1FSKB 2Q1EA 5IJVA 4MXQD 4KROD 2XTJC 3MLVH 1AIFA 2JB5H 4LVOC 2V7NA 3O81A 4J3SA 5FHAL 1IAIL 3DRQA 2XY1A 3MRHB 1JFQH 5HHVL 4EIGB 1F13A 3BD4A 4HCRL 5FA4B 4X9HA 1KJ2A 4UT9H 1MEXH 2J4WL 4N9OB 3N0PB 5FHBH 1IC7H 4HWEH 2L7UA 2W9EL 1A9EB 3U9UB 2G9HB 4KDWA 3O6KH 4NC1C 1EAPA 3P4NA 3T0EB 1IZKA 2PR4L 4ZXBD 4FXGB 1KB5L 4ZDHB 3MXWL 5GRUH 4NZRH 3V6OE 5DJ0B 2Z91A 2E7HA 5FO9B 3GHEH 5DC0A 3FRUA 1FHGA 3AGVA 3QT2A 4M6NH 2BSRB 1BVLB 3G04A 2WK2A 3MNZA 1NC4D 5FUCC 3S96A 2JELH 5HGAB 3WO3B 1WBYA 3F58H 4GQ9H 1RVFL 2DWEA 1KXQE 4RISH 4NZUH 1L9MA 4OLWH 2R0LL 2Y4SA 5IROC 1KLFA 2J2ZA 1BJ8A 3V5HA 1IC4L 1FYTB 4Q9CA 4NJAL 1OWWA 2FJGB 5BZWB 5SX5K 2EEDA 5HHQB 5T3XL 2Y06H 1AC6A 3MACH 1QPXA 4MCYB 2GJZB 4QHNA 5HGHB 5BXFB 3QIWD 1JGEB 3TBSA 4O00A 3P9LA 1AD9A 5DMGC 5BJTA 4ODWB 4TPRH 2GTZA 2IBBA 3T0BA 1U8MB 4UMGA 3VFNA 3D6GA 3T4YB 3GSRB 1P7KA 1NAMB 3G5VB 2CPCA 5F7MC 4ZFZA 4XNYL 5I8KH 3KR3L 1EJ6A 3QUYD 1INEL 3CXDH 3RIAK 2Q86A 3TPUA 5AAWA 5ILTH 1HDMB 1U8LB 3NGBC 2H2SC 5F71A 4KK5C 5BW7C 4QOKB 2IFGA 2YEZA 5FK9A 1TENA 5F6HI 2JJWA 5B21A 3SOBH 1MPAH 5EO9B 3CFJB 4J23A 4Y4KC 1CE1H 3EOAA 4XPFL 3ZYOA 2Q7YA 3DUUA 1X6LA 1IGYB 4U6VL 3GMRB 4PV9A 1I1FB 1YJDC 2AV7A 3UROR 5BZDA 1ACYH 3TJEL 2NY4B 4PRDB 2HJFA 2DF3A 5IJKA 1JWUA 5DD1L 4JM4H 3FFCB 1DN0B 5IVOA 1AHWC 5CILL 3ZT6A 3ZDZE 5FECA 1S7UB 2W0KA 1NGYB 2ED8A 3DSFH 4JANA 2G5BA 1S7WA 2OCFD 1Q0XL 2AJZB 1LP9A 3D39B 1FCGA 1OSZB 4PJGF 5I1JH 3MFGB 4Q0XL 4JKPL 4MJ4A 4XNZC 5JOFB 3LHPH 1F4YL 1V3JA 1GPOL 4HJ0C 5T1DL 3MLRH 1MFBH 4ISVA 4KRPC 3O3EB 1T04B 4Z78A 3CU1A 4NYLB 3VH8G 2YPKA 3SDDC 4ZPTB 2O5ZL 3DRTB 4P57B 3CFEA 5TE7L 3S88H 3PDGA 5GGUB 5IESL 3VXSB 5I1EH 4LPWA 2CK0H 4DEPB 3I50H 4G5ZH 4O2FB 2APBA 1TQBC 5FV1L 1CLOH 1MFAL 2ZSWA 3L3HA 2HN7A 2VKXA 3QEQA 5C86A 5DUBB 1KIPB 4ODVH 1VKXB 5F9WC 2EH8L 3KPSA 1A47A 3OKEB 4KKLC 1ZLVH 3BQUA 4L1DA 1D9KD 2KDGA 1DBKH 1QBAA 4K3GA 2C1PB 5EUOE 2G60H 4G9FD 3TA3B 2YPVL 3DMMD 4MQSB 3O2WH 5D7LA 4GLRH 5DT1H 2X89D 4L9LC 5IB1B 1T6WA 3QH3A 3HB3D 5E03A 1SM3H 1J0IA 4ORGA 3IRZA 4Y2DA 4X6CB 3AS2A 2LU4A 4X4YB 5EBWB 2ATPA 4JM2C 4OM1H 4WGVB 5IQ9A 5T3ZE 1BX2B 1IGMH 4JHWL 4ONGH 3RP1A 1MI5A 1HSAB 3GJFA 2ICWA 2V5YA 4JO2H 4QRRD 2ZKHL 3BHBA 2MCPH 4PJHB 1JGUH 3IS0X 2CRIA 4HKXA 4OCRL 4IEFB 4FTVA 3BEWB 4XNQB 4PUBH 5K9JL 4U2YA 3D69B 3X3GH 1KENH 2GEEA 4GKOA 1WTGT 5DI8B 1T20A 4S1DD 5EU3A 4U7KA 5TH2B 4UT7H 4X6BA 4Z95L 5F8RC 2PF6A 5HYJA 3RDTC 4HW6A 2CKBL 1Q9WB 3NCMA 4MJIA 4M93C 1IFHL 1S7SA 1E6JH 1AI1L 3MLXH 3KPQA 4OJFL 3GMLA 3EJYC 3FAXA 4UBDC 4OZIE 2Y25A 4IS6A 2EECA 2VO5A 3RPIB 5IGXL 5DVLA 2ICEB 2P5ED 1G7LB 1YMME 5C09A 4PR5B 3MODL 1RULL 2Y6SD 4U6XA 5CWSB 4JG0H 5GS0L 1DBML 4OLYL 4DKFL 5DD5L 3KYNA 3MRIB 3PGCB 4MSWA 2G5RA 2F53A 5EU6E 3NFSL 2BXZA 2DLGA 2C4FT 4XVTL 2RQ8A 1CFVH 5IVNA 2X09A 4DKEH 5EO1A 5CEYB 2PYEA 3JTTB 4MCZA 3MFFA 3FZUD 5FM5O 3TVMC 3GMMB 3HPJA 4HDIA 3SBWC 3WIFA 3FQTA 4XI5D 3NOIA 5IBUB 5T1KD 5FO7A 2N56A 3QXDB 4WI8A 5JIPA 4NNYA 1XGQB 3D0LA 3S4SG 3MC0A 3WN5C 2NW2B 3DX8A 4ACPA 3LS4H 2VAAB 1JUFB 1R24B 4DKAA 4XGZA 2UVEA 3TIEB 4RMRA 3KPRB 5E8DL 5SWQB 3NCCB 1AGFA 4X7CC 4W70A 3FAWA 1BD2E 4X6EA 5E56A 3DETC 4IOFC 5JHLL 2NY5H 1SEBB 3MV9E 3K1KC 3PJSB 3QUKB 4HUXB 2A9NH 4P3DB 2R2HB 3SDXE 3KPPB 3QWQB 4XP9H 3L7FA 3R4DA 4FQLH 5LKNA 3O4LD 2XPGA 3WIHL 2YA2A 3BO8A 1KXTB 5E95B 1RUKH 1XIWB 4B7IA 2VLRA 2B1HL 4P2RA 5BV7H 1UA6H 3JWDL 3PL6A 4RFOL 4ENEC 1NDMA 2PXYC 3N50A 4PPTA 1N6UA 5F21B 1DN2A 4GW1B 2VLKA 4FP8H 3SY0B 1TFHA 1IAKA 4LEOB 4NDMA 1KCSL 3WE6B 2IAMA 2QQNH 2YPLA 5CGTA 3MLVL 1XGPB 4J4PA 1QHOA 2EO9A 3BWAA 5ID1A 4F7MB 3O6LL 1C5CH 2AGJH 2CXKA 4K23H 4KZEH 1JFQL 1T66D 1YN7B 4UT6H 1SBSH 3PWPD 3C60D 2SEBA 2NXZB 3TFKC 2YA0A 43C9B 4E5XB 4M03A 1MEXL 3QISA 1UWXH 4UT9L 5IF0B 4BA8A 5FHBL 5B38B 4HWEL 2D7MA 2NMSA 5DRNA 1J8KA 5I76B 2A6KB 3V6ZB 3BGAA 4HKJB 4D9RE 1URLA 4IMLB 3T04D 5LQBH 3E3QE 3BZ4A 1S7QB 2EXYC 5TFSH 4PGEA 3X3FH 1EEZA 3OGOE 5C0AB 1ADQH 2H8PA 4LCWB 4M6NL 3GM0A 3ULVL 3VD3A 1XCQA 1NFDA 3B83A 4PLKC 4RISL 2EIZB 4HFUL 4JY4A 4OLWL 3O2DH 3RKPA 4MQ7A 4AIOA 2MCG1 1TJGL 4R2GB 2V17H 5JHDE 3QO0B 3ZKMD 3UPAA 2GY7B 1OGAA 4CN6A 3RWDA 2JK5B 3MLTB 3W9EA 5DVKA 2Y06L 1HHGA 3O45A 3MACL 3ILQC 4CAGA 1FDLH 2V7HB 4HPYH 2XWTB 3CJJA 3W11D 3NPSC 2DI8A 1J8HA 1WF5A 15C8L 1CD0A 4YIQA 4LLUB 5F6IB 2X9XA 3B9KA 5M94B 4PRIA 1ZHNA 4KGJA 2OM5A 3CXDL 5ACLA 3QP3A 4YPGA 2BVPA 3B2UC 3HR5B 1NEZG 2R2EB 3VGAB 4K2UH 1G9EA 5BVJA 2YHGA 4F37F 4B7LA 3SOBL 4PTTA 4LDOB 4PRPE 4OKDA 2YN5A 3B9EA 3QG6A 1GGCH 1ZHBB 2J8HA 5EBLA 2IANA 1ACYL 3I3BA 5DURB 4PJ9D 1BP3B 4UINL 4LSPH 4AENA 4JM4L 3FB7A 5DTFB 3RVTD 3RGVB 4HUUA 4Y5XB 3G08B 5D1XB 2VLJE 2B4CH 4MNHA 3U4AA 4AQOA 3FQWB 4PG9B 3O8XC 3TO2A 4V1DB 4N8CL 1EHXA 2YD1A 4Y4FC 4NQDB 3LHPL 3UTTA 1OAYL 1FORL 1NANI 2IC2A 1LE5A 3F7PC 4OZHB 4NQXB 4N0UE 3MLRL 1MFBL 4OTXH 2J7LA 5C08B 43CAA 3LRSB 2FJFA 3CXHJ 3DHJA 3ARGC 1RZFH 1ZWIB 3F6LA 4J3OC 2XICA 1H8SA 4PRBB 1XCTA 3TT3H 5D6DA 3ARBC 1OTSC 2PTVA 3DARA 2CK0L 2F8OA 3F7RA 3I50L 4FRWA 2Q8BL 4OLZH 2ESVE 2HFFB 2XQBH 5DJZB 4Z77B 3UTSD 1CLOL 3MLSH 4ZFFA 1OP5H 5C07D 4L3CB 4G8GE 3HZMB 4JFOA 4YBLB 4NFDA 1YNLH 4D9QE 5LBSH 4DGYH 3HN3A 1QFPA 2O93L 2R2BA 5IMMA 1BOYA 2VN7A 4LLDA 1KFAH 4Y7MA 4PJAA 3VDCA 2G60L 4P9MH 5DWUH 1O0VA 1TJIH 1FLRH 4GRWH 3GIZH 5GS0C 5DT1L 3CLFH 2ADIB 4O5LL 1SYSA 2FBOJ 2P4AB 4PJCA 3T1FB 3LN5A 4P2YA 1WFUA 1SM3L 2YN3A 1EFXB 2HTLD 5JR1L 1GIGH 2GK0A 3U36A 3T2NH 5EUOF 2VITA 1CL7H 2E7BA 3HE6C 5DMIL 4OM1L 3DXAD 1PFCA 4TNVK 4YWGH 1T7WA 1W72H 4ONGL 4JFHE 4EXPX 35C8H 3C6LA 3CCHB 4XBGB 2BOCB 4IRJD 4ZOEA 1DLHB 4ZAKA 5HJ3B 5GS1B 3I6GA 4QHLB 3OKKB 4XPAH 2ATKA 5DJXA 3BE1L 3PHQB 4PUBL 4ELMF 4FQJH 3X3GL 3EYUH 3PDOB 2BCKA 3S8WA 4X83A 1KENL 3FMGL 4FMFA 3MV7D 1QFUH 3OGCB 3L3KA 3MROB 1DJSA 2VTFA 2BY2A 5HHXL 4D0DA 5E9DD 4IOIB 1UT9A 4QGTA 4YHOL 2XZAH 3QNXA 5ITFA 4OZFB 1HHIB 1JPSH 3VCLB 2R0WL 1G7MB 1N6QL 5TQ2L 1WEJL 4UT7L 4OCMC 4RIRB 3HFMH 1KIUA 2V6HA 1XZ0A 4AH2B 3D9AH 4TNWK 5C0RH 3OHXA 1J05B 1TNMA 3MLXL 3SGDH 4HEPG 1UYWH 3SE3C 4L4JA 4RGMC 5F9AC 3EO0A 1JIBA 2NYYC 4ZOAA 1UWGH 1MJ8H 3S36H 3UJIL 4GOSA 1S9YA 3IKCA 5I30H 5IB2B 4XPHL 4RMUA 3MZGB 3JWDC 1UB6A 4JG0L 5C0GA 4N9GB 1FL6B 5DJ2A 1D5MA 4NKOB 3WFCH 1QO3B 3N1PC 1BZ9A 4OZIF 1CFVL 4JFED 2GIYA 5TF1H 2NY3C 2Z92B 1P1ZA 3UP1A 5HHMB 3CSYA 4PJ5A 3WUWB 2I24N 5JOPD 1U3ZA 4JCLA 1D5IL 4S10A 2VXUH 3FONA 4OLXH 4XP6H 5IK3B 2W9DL 4OI8A 3THMH 2F54A 2YMXL 4G8FA 1OOAA 4HS6A 2YXFA 4F9PA 5HYSG 4OI9A 5MEQA 2IG2L 5IM7B 1X5ZA 1RIVL 1CFNA 3LS4L 1SVZA 4U3XA 5JUEH 4LHJB 2MPAH 3VA6A 1CICA 2P47B 4JB9L 1RZJL 1UXSB 4YAQB 4IRSD 4NZDA 3ALPA 4GMTL 5D1QD 4I18C 1ADQA 4OZGA 1EHLL 3DOSA 1RU9H 2NY5L 2HTKD 3MJ6A 3DUSA 4J7RA 2A9NL 3PABA 2YZ1A 2R1WB 4XP9L 4NCC2 4WO4D 3LMJL 5D93B 4FQLL 2BNRB 1A3RH 1ZT1A 4Q9BA 2C9AA 3WS6A 2JLLA 5HDOA 3BXNA 1RUKL 3FQRB 4NKMA 4M1CC 1NGWA 2KBGA 1CFQB 4XH2B 1UA6L 2EE9A 2VWEE 4KK8D 2PUQT 3SDXF 2VN4A 4G42A 2DMBA 3QUXB 3QCTH 4FP8L 3EYFA 2N4IA 1U8PB 2XY2A 2HT4C 3RZCC 4LSVH 4YFEA 2IAMC 5C9KA 3U0TB 3OX8B 2QQNL 1R6VA 1T89C 3ZKND 1R3KB 3WJLC 2F15A 2XKNB 1C5CL 2AGJL 4LKXA 4K23L 4Q58C 4XP5H 4UT6L 4P5KA 1WTLA 1KN2H 1RK0B 5TDPA 3L3JA 3SJVD 4GXUN 1CFSB 1KCLA 3MRMA 5H2BA 1OAXL 4Z7OE 4H0GA 3MRGA 3B9AA 2QADB 4KK9D 4DVBA 1PX4A 1U3JA 1QRNB 4FFYL 1BF8A 1TVHA 5LQBL 4L3EB 1P7HL 3VFTA 1FG2B 3ULUE 5FFLA 3MPCA 1ZLWH 1JTPA 4ETQB 1NMAL 2A6DB 4OFKA 3KPMB 3HZYB 3VFMA 3AS0A 2BSTB 4Q2ZB 4NQTA 3JBG7 4QT5B 1NL0L 3O2DL 4L8CA 2O5YL 1F58H 1G7HB 3BAEH 3RA7H 2V17L 4P99A 1XF3B 1DE4B 5AG8A 5L0QB 4KPHL 5FIEA 2P5WE 4BZ1L 2YUWA 5JDSB 2AJVH 4P4KD 1FDLL 4HPYL 4PJXE 5KSUB 1RK1A 4XCYB 1ORQA 4D0CA 3L9RA 4LP5A 3RI5K 2VSCA 3UAJC 3H3BC 3K0WA 4KV5F 1MOEA 1NJ9A 1R3HB 3AMKA 1HCVA 3OXSA 4D94A 2EXWD 1FE8L 3IDJA 3QNYA 3O9WA 1HYSD 2Q3ZA 4TUKH 5A1AA 1AKJD 1A4JB 3BD3A 1HEZB 3Q48A 3FRPA 3BJ91 4IDJH 2NR6D 2P49B 1ITBB 1BFVL 1NCDH 3JWOL 5GRZA 2OP4L 1U8QA 5KN5B 3N1FC 4H25B 4ZUSB 5IB4B 4YGVB 1GGCL 2AQ3A 2EYSA 4LF3B 1OP3H 4OT1H 2XTJD 1KT2B 1T5XA 1X5HA 3MUZ1 2F58L 1ED3B 1ZEAL 1JF1A 1ODAA 5C0DB 1NAMH 1HXYA 4LSPL 3VFUB 4P2OA 4P48A 1Q0YH 2XN9B 3MUJA 2J8UB 3QBTB 5EB9A 5MEOB 2E5EA 3DROA 1AGDA 5TE4H 5ELIA 5JMRA 4G7VH 1W72A 2B4CL 5DJDB 1I1AB 2CLRB 2V5RA 1D6VH 4DFHA 2XRAH 5E6ZA 5BRZE 3OAUH 3QUZC 4P4RB 2WIIA 1P2CA 4JFFD 4OTXL 3MRNB 2ZG2A 3QIUA 2C7UB 3BPNB 5KBNC 3QCUH 5FYJE 1UG9A 2JJUA 5FCUH 1EA9C 1LO0L 4P2QD 2D31A 1OPGL 4W6XB 5LAXB 4X7FC 4NZJA 4PJFE 4CU6A 3GBLA 4UAOC 2RBLA 3S35H 2V5SA 2HT2C 3B4NA 1JWSA 1V7ML 4QRTA 1A1OB 3NFPA 5F3HA 5LBSL 1Q9LB 2N7AA 3SKUD 4DGYL 2A74A 1F11B 1C1EL 4XNUH 4UV7H 1FJ1B 1KFAL 5ESAB 5D2LA 3VRLE 1BFOB 3LN4B 3NACH 4NIKB 1QD0A 1AFVH 3GIZL 3TBTB 3FHAA 2X4NB 5CINH 5J12B 3C09C 1KG0A 1I1YB 3CLFL 4L4VB 3VXRA 5IVXB 2DYPD 2H2SD 5C0CB 4KK5D 3KPOA 5DHYB 1GIGL 4FQHA 5FYLH 1K9TA 2ADJA 5T1LD 2OJEA 1CL7L 1G0DA 3H9ZA 5ADPL 4RX4A 3VWJC 4YWGL 1CDHA 4GAYB 1AJ7H 2GT9B 2V9TA 4LAQH 3PGFH 4L4TD 2HT3C 4H0IA 1LGVA 3KWWA 1QFOA 5I1DB 3BH9B 3MBEA 3MA7A 1CBVH 5C0BB 2UWEF 3FT3B 3BPLC 5JA9A 3CLEL 4BSVB 4JZOA 4Z7WA 1KIQB 1U91A 4NQVA 4K7PX 4Y16A 4N68A 4FQJL 1ZLUH 4OKVA 4R4BB 1F97A 3DO7A 1KJMA 4HUVA 4LFHD 4OCXH 4Y4HC 4S1SH 4HJ0D 1JPSL 1MJJA 3MV9B 4KRPD 3EBAA 3GSXA 2OYPA 3HUJA 4LNRA 2NY5C 3SDDD 1FG9C 3NCFB 3HFML 5ISZA 3H42H 1FGVL 3D9AL 2Z35B 1UYWL 1E27A 4IIQC 4U1JA 5A2LH 1NC2A 3WMSA 4AG4H 1MJ8L 3H0TA 1EX0A 4NQCD 3QDGA 3KXFD 1N59A 3P4MA 12E8H 4KKLD 4BFGA 5ESVA 1WBZB 1KGCE 5FKPB 1A6PA 3WFCL 4XCFL 1DDHA 3C2AH 3UMTA 4KHXL 4YXHH 5TF1L 4JRYE 3OB0H 2JF1A 2XZCH 3AREB 5TF0A 1ES0A 3KJ4B 4P59H 4P46C 4QTHA 1QA9A 5E8NB 3CH8A 3MXVH 3EFFB 4OD1H 3OKOB 4X4XA 5CCKH 1RUPL 2VZOA 4W6YB 1JZ8A 1CGWA 3G5XB 1CQKA 3MLYH 2PO6C 1P84K 3MGOB 5ANMB 4JM2D 5DD3H 2K9UA 1QSED 4NO3B 4XWGH 4IHOB 1IGCL 1HHKA 4WTWA 3L95B 2QSVA 1JPFA 4B0MM 4FMKA 2OMBA 2MPAL 2CRMA 2X5PA 5J1SC 1P7QB 4OCWL 4RFNB 3TC9A 2CD0A 1BECA 1II4E 2R69H 4Q6IA 4X0KB 3O3AB 4NUJB 1RU9L 3CSBA 3U7YH 3VMPA 3VDBA 3MRHA 4BJLA 1GRWA 5FA4A 3SHSA 2FX7L 4Y19B 1MCNA 4HWBA 3U4BL 1VADB 1A9EA 3U9UA 4K71B 2G9HA 4DK3A 5I19H 4NQEE 3QEUB 4U0RB 3T0EA 4FQ1L 4FXGA 3FB6A 5JXAH 3ESVF 4ZDHA 3RDTD 1T83C 3K7UA 3TCLB 5DJ0A 5JQ6H 1MCOL 5E6IB 2ZUQC 3EJYD 4UBDD 2BXYA 5E8PB 2BSRA 4Q97A 3GBMH 4LSVL 3GMPB 2AEIT 2QBWA 4CBPA 5HVHB 3SKJH 3V95A 2DLHA 4XP5L 1KN2L 1FYTA 3JWOC 5DGQA 4GG6B 1E6OL 3W0WE 3QSKB 4M7LT 3WO4B 4X9IA 5H37G 1XEDA 5BZWA 1A1NB 3VRJB 4NC0B 4F15B 4MCYA 2GJZA 4K7PY 3TVMD 5HGHA 5BXFA 1JGEA 1A6AB 2YR3A 5I18L 4X6DE 5E99L 3WHXA 3BVNB 1BM3H 1U8MA 1A6UH 3T4YA 4LSQH 3GSRA 4QRUB 1NAMA 3LDBB 3OR7B 2GFBA 4MVBC 3BMVA 5L9DH 3VXMA 4Z7OF 3S97C 2NXYC 2VLJB 4ZSOB 1PZ5B 4R97B 1PG7H 1U8LA 2B4CC 1MHCB 4Q7DA 3CNKA 1Z9MA 4QOKA 3HNTH 4HBCL 1MCRA 5FYKU 3BAEL 5EO9A 3CFJA 4N0UB 4JVPA 2DI9A 1DVFB 2J8OA 1EO7A 3DETD 4KI5F 1IGYA 3U9PH 3GMRA 1GGUA 5DUMH 3K4AA 1I1FA 4LEXH 4QXTB 4LHUG 4HK3J 4PRDA 1TZHB 4G9FE 5ALBH 3MRRB 2IALB 2EZ0C 3Q6FB 3FFCA 1DN0A 3AM8A 4JREB 2YSSB 5HHOE 3R1GH 2XWBB 3BZDA 3RY6C 1NGYA 3HE7C 5T3XD 5HI5C 5E5RB 4TUKL 2AJZA 2FIKB 3D39A 1OSZA 3QHFH 4ENED 2PXYD 4IDJL 1PKQB 1BZQK 2X4UB 5JOFA 1NLDH 1NCDL 1KPVB 4Y5YC 3WNMA 2D7PA 1GOGA 1T04A 2YRZA 3O3EA 4XAWH 4NYLA 2NY6B 2FL5B 3LPGA 4ZPTA 3WNPA 2M1KA 3DRTA 4P57A 4QRRE 3UX9B 1DR9A 3GSNH 1S7RA 5GGUA 3VXSA 4JRXA 4PV8B 3TFKD 5CSGA 1PX3A 4O2FA 3MCLH 4K7FB 4YX2L 4NFBA 1WFTA 5DJYA 4Q74A 5F1SA 5DUBA 1KIPA 1A7OH 4U7SA 2OTWB 4JHBA 5TE4L 3QPXH 3MV11 3OKEA 4JKWA 3OKDB 4AK1A 3ZL4H 2EXYD 2C1PA 1LO5A 2XRAL 4HIJA 3TA3A 3OAUL 1X9QA 4PJEF 4W68A 1TPXB 4F7EB 1MLCB 1WSST 1PZUB 4WJ5B 5TGBB 4U3HA 4PLKD 5IB1A 1PY4A 5IHBA 1HWGB 5C8JB 3NVQA 2JE8A 3SE4A 2EC9U 4ZODA 4AEFA 3IDYB 4GAGL 2CR6A 3D85B 4X4YA 5EBWA 2RFXB 2XXMB 4LOUC 3WNKA 1R5VA 4FFVC 4HHAA 1BX2A 1F2QA 1DBJH 3ILQD 4XRCB 4K7PL 5JIIA 4GUPB 4Z7QF 1CGTA 1HSAA 3QDMD 4FABL 3P30H 1MIML 4PJHA 3NBNA 4UV7L 1RUML 3BP7B 3GGWB 1VGEL 4PJFF 1I9RH 2GCYB 2NCMA 3P2TA 4M6AA 5C0EB 5I1KH 3BEWA 1UJ3C 4XNQA 1A7QH 5DJCB 3NACL 1MCPH 4MMZC 3D69A 1AFVL 3KYOB 4YO0B 3IFLH 5KOMC 5CINL 1CXEA 2F19L 4FQXB 4MA7H 1ETZB 3B2UD 1DBAH 1WVZA 2EE6A 1BQHG 1GAFH 3ARRA 2EDEA 4FQCH 5TH2A 3WNNA 1G7QA 1MI5E 3CUPA 3VRLF 5KW9H 4OF3A 4RMTA 3MJGX 2F8XC 1G9NL 5D2NE 1F6AB 5DHVB 4R26H 2PCPB 5FUOL 5BQ7A 2V9RA 4H1LB 4XC3H 2DQFB 3V8OA 4JJ5B 1A7BA 1YC8A 4TSAH 1NAKL 3RPIA 4JM2F 2ICEA 1G7LA 4MAYA 3LEVH 5DMJB 3GDBA 1EEYB 1AGBB 3LZFL 1ZLSH 4S1RH 1NDGB 5CWSA 1U8KB 3GNMH 4WV1C 3MRIA 3PGCA 4OB5H 1ZVSB 1JZ6A 4IRZL 3O8XD 1ZT4A 4MNGA 5HYJE 4Y4FD 4GRLB 5CEYA 3JTTA 4TTDC 2CMRL 1GYAA 4POUB 4PRNB 2I9LB 3INUH 3GMMA 4MJIE 4RWYL 3QJHB 4HMCA 3ARGD 1CXLA 3QXDA 3H42L 2N7BA 4OF7A 3HC0B 1T2QH 5C09E 3MJ9A 3ARBD 1OTSD 1I8LA 3HC4H 4UIMB 4LGPB 1XGQA 3RHWK 1UZ6F 3TESA 4RZCA 4AG4L 3JV4B 2Q8AH 3HKFA 4JFYB 1JHTB 2NW2A 4OIBA 5K59F 2VAAA 1JUFA 3HS0B 12E8L 3TIEA 3HPLA 3Q5YA 5E2TH 3KPRA 4I9WD 4TTGA 4OZFH 3TN0B 3C2AL 4XP4L 1Y0LB 4YXHL 4ONHB 3WXVH 1OM3H 5HY9B 4PRHA 3PJSA 3ZDXE 2XZCL 5D7LD 3QUKA 5LWYH 4HUXA 1MAML 2FIRT 2JTDA 2ILLA 4P3DA 3KPPA 4P59L 5D1ZB 5GS0D 3MXVL 1OAZH 2Y5TA 4JQXC 1I3GH 4CMMB 1V5JA 5CCKL 4YXLL 3O6FC 4JJHA 1GZPB 3IJHA 1XIWA 3HE6D 1N8ZB 3O3UN 4JQIH 2P45B 3FOMB 4XWGL 1T03H 4R90L 3HHRB 1IKFH 4LPYA 2VRAA 3TZVA 4LEOA 1C08B 4KTYA 3WE6A 2AK1L 4BFIB 4UI2A 4KZDH 4Q6IC 2VLME 2R69L 1XGPA 3STBA 4F7MA 3U7YL 3L5WB 1A1MB 1YN7A 1JWMB 2VL5B 3D3VA 43C9A 4E5XA 1UWEH 1A14H 1T7YA 4E41D 5B38A 2R0KH 1RZGA 1I9IH 2YA1A 2PW1A 4P2RE 2P5WB 1TJHL 5I76A 2A6KA 4HKJA 5MERB 4IMLA 4TVPL 3ARFB 1S7QA 2IWGA 4KKCC 2EDWA 1H3PH 4WWKB 4XMPH 5C0AA 2YS4A 4LCWA 1T21B 1CIUA 3GBML 2NYYD 2Q3AA 3WHE1 4MDIB 5ICXB 3KNBB 2EIZA 2FRGP 4JVWA 4Y1AB 5GRJH 2G75B 3F7VB 2F53D 4I0PC 5IHLB 3M07A 4JO4H 2DQHL 2MTPA 1L6XA 2E6PA 3PQYA 2BVQA 2DQEL 2PYED 3FB8B 2JK5A 3MLTA 2NY3D 4KKAC 4E9LA 4M5ZH 1MWAB 3SCMB 1JK8B 3VDAA 2V7HA 2XWTA 5IW1A 4DQOH 1J5OH 3GSQB 2OXGA 1CD9B 4LLUA 3LPWA 5KS9A 1A6UL 1NFDE 2W07A 1YC7A 3QULA 1HIML 3GKWL 1D5ZB 4OD3H 4DW2H 3L6FB 1ZT7B 4FZ8H 3MCKB 1HNGA 2HAZA 1PG7L 4XNXH 1PYWB 3HR6A 3RL2B 1CDIA 3HCVB 1OGAE 3HNTL 4Z0XA 3UTSE 4X8JB 5C07E 1NBYB 1MWAL 4Z7UE 5I8CB 1K3ZA 1T4KB 1ZHBA 3GB7B 3ULVD 2HFGH 2R23B 3SO3B 1X5XA 5DUML 1MCIA 3V79C 5L88L 4LEXL 5CUSL 4XAKD 4HIHB 3MV01 4KTDH 3WFZA 1NCCH 2IQ9L 1J86A 5ALBL 2CDEB 5DTFA 1EMTL 3SPVB 5M7QA 1S5IH 5I1CL 3RGVA 4HT1L 2ADGB 4Y5XA 3G08A 5D1XA 4HKBB 4M1CD 4OLUH 4QWWC 5ADOL 3HMXH 2DL9A 4G6AC 3FQWA 2ADFL 2X44D 3EO9H 4PG9A 3QHFL 3U79A 5EN2B 2XV6B 3CX5K 4V1DA 3O6MH 4NQDA 2YWZA 2FR4B 2OLDA 4DN4H 1V7NL 2HT4D 4OZHA 2IANE 1KN4H 4NQXA 3RZCD 1CVSC 2IAMD 1KTDB 5C08A 3LRSA 1YPZF 4U33A 2OR8A 1ZWIA 1CGUA 4J6RH 1HZHL 1NANH 4PRBA 1OWRM 1JZ2A 3GSNL 3LQZB 1AXSA 4F7CB 1CVRA 1I3UA 2HFFA 4F9LA 4Z77A 3ZTNL 1M1SA 3N85H 3AROA 5F1OB 4L3CA 4ZOBA 1NBVL 4MXVF 3HZMA 1G9NC 4WU5B 1A5FH 4HLJA 5JORB 1B6UA 4MWFB 2KH2B 3QPXL 3ES6B 2P44B 1OLZA 3UTTE 5C92A 3K3QA 2D7QA 5DQ9B 2D9QB 3CFBB 4M43L 1IVLA 5TE6H 3LKRB 2OMNA 3CIQA 4AL8H 3MYJB 3QZWB 4NQSB 1EBAA 4N1EA 1LP9F 5LGKA 4R3SB 5BOPA 2ADIA 4F33B 3GI9H 3T1FA 3PNWB 4ZUTB 5CS7A 1RI8A 5DC4B 1PJ9A 4OSUH 4ZO6A 3GO1H 4ZD3H 1BAFL 5T3ZH 3M8OH 1UCTA 1XR9B 2YUVA 1OAQL 4X5LA 1VFAB 4LSTH 1A7RH 3T0VA 1WAAF 4PGCB 1BZ7B 1O7VA 2WWKT 3BIAX 4PJAE 1AXTH 1T7VA 3VXTB 1J8HD 4GW5A 3CX2A 4JFEE 4KROB 3CCHA 4XBGA 2BOCA 3UAJD 1WITA 1DLHA 5HJ3A 5GS1A 5DS8B 4NM8H 4U1MB 4QHLA 3OKKA 1VSCA 5AG9A 4MLSA 1ZXQA 5JOPE 1FL3B 4PJCE 3PHQA 1A7QL 1MCPL 1OARH 4YK4B 3PDOA 1DUYA 1KCVH 1Q1JH 3QR2A 5DMKB 2FX8H 2D03H 4MA7L 3IETB 3MROA 2RCSH 1GAFL 3A6BH 4IOIA 4R4FH 4ZXBB 4LSUH 2H9GB 4OZFA 3CVHB 3L3IB 4X5WB 1G7MA 3MRFB 3AUVA 1JGDB 5KW9L 2FBJH 4RIRA 4WW2A 1CI5A 2C26A 4AH2A 4R26L 4FXKB 1MQKH 4GXVL 3WFBL 4XC3L 3ZE2E 3MRQB 1BVKB 1J05A 4YHKH 1NC4B 4GBXC 3QI9C 3VFWB 3WD5H 3QFJD 4MAYC 3D48R 1L7TH 3WFDH 3BFOA 1JPTL 5FDWA 4S1RL 5IB2A 1I7UB 4TOYH 3IAGC 3QDJE 4N9GA 1FL6A 2E7LA 4NKOA 3T0WA 1QO3A 2E27H 2NY7H 4APQD 4HKZB 4HC1H 3CVHL 5CJQH 1QBBA 3RTQC 1JTOA 1CDGA 2NY1C 3QIWB 3QUZD 2Z92A 1K5NB 5B39B 1HCFX 5GGTA 1ZHLA 3WUWA 1FL5B 3VFSA 3OKLB 4QEGA 1AC0A 5MEPB 5DR5H 1E4XI 3ZSSA 3OQ3B 3QUYB 4B41A 1LK2B 4LPCA 4RGNE 3BKCL 2EDRA 1LVEA 1QSZA 3TT1H 1UENA 3O4OB 2BNQD 2YRPA 5GSRA 5IM7A 4XVJL 2HT2D 3GI8H 1E4KC 1LD9B 2AI0H 2K7QA 1JYVA 1DFBH 2BMKB 2ZCHH 1BOGB 3RIFF 5E2TL 1UXSA 3QA3B 4YAQA 1JHKH 4PP1C 5SWSD 4L8BB 2DQUL 2L4OA 3QQ9C 4DJMA 1XT5A 1F3JA 3MREB 5LWYL 5F9OH 3UO1L 2VR9A 1CDCA 3ARWA 5ICYB 2R1WA 2F54E 3SGKC 4N0RA 1LO4H 2BNRA 4HJJL 3PWLB 4CADB 1BBJA 2BP3A 3L5JA 2CUMA 3BOVA 25C8L 2Z8RA 1F5WA 1QLRB 1Y6NR 2BSED 1VESA 3EDKA 3FQRA 4M48H 3BN9C 4JFZL 3RWHB 3B5HA 4X6DB 3VWJD 4XH2A 4I13B 3S34H 4LLQB 4ORZC 3QUXA 2HT3D 3IGAB 4OZGE 4OIIH 3TZVC 4PIRF 1U8PA 3AMLA 5KTEH 1AY1L 3H3PL 3OX8A 1C12B 2Q7NA 3CK0L 4KZDL 3LQAH 2XKNA 1CS6A 2XTLA 3ET9F 4XBEH 1DSFL 1P5VA 1YEDB 1QRKA 3P40A 1OB1B 1RK0A 4XVSH 1UWEL 4KMTL 1EVUA 1ZVYA 1CFSA 2J12B 4KVCH 1B0WA 2R0KL 2LQRA 1UACL 3RWEB 4Y4HD 2FSEB 4XB7A 5A2KH 1QZ1A 3UTPD 4OCYL 4U1LB 4UILL 4C59B 2NY2C 1D9KB 2AK4D 1JBJA 4JPIB 1QRNA 4KWUA 2YXMA 4G9FB 4L3EA 2H3NB 5L2JB 3UBXI 3DMMB 1FZKA 4Q9RH 1FZOB 4URTB 3RJDA 3CD4A 4ETQA 4RMQA 4M7JL 2WZPD 2A6DA 3C2SA 3GSVB 2OTUB 3KPMA 3VFPB 2XKUA 3HZYA 5D6CB 2BSTA 4Q2ZA 1IEAB 3HMXA 3PWUB 1H15B 4QT5A 3UTQA 5J7CC 4JO4L 1G7HA 1HK6A 4FXLA 5DYOB 3ARTA 4NN6B 4X7DC 4I3RL 1CD1B 1NH6A 4M5ZL 4FQIL 4QRRB 3I6LE 1X44A 5A40E 5JDSA 3VGGA 1UFUA 4P46D 5KSUA 4XCYA 3HRZB 5GRWA 4DQOL 4P0DA 2DM2A 1J5OL 3AB0B 5C6PB 4EN3C 4C55A 1OT1A 2IQAB 3KYAA 5I73B 5FB8B 5E00B 2PO6D 5CJOL 3I3EA 4OD3L 2R4RH 5EC1B 4DW2L 5KVEL 3D18B 1IAMA 5I75B 5LXGL 3CPLB 2VQ1B 1A4JA 4JQVA 1HEZA 4OFPA 4P2QE 5GGSY 3WDIA 1XF2A 2R8SH 4QHKJ 3SKMB 3G5YB 3ZT5A 1WIOA 3QO1B 3WBDA 5IEKB 1NFDF 5KN5A 5J9PB 4H25A 4ZUSA 5IB4A 4YGVA 5JO5A 4CDHA 4LF3A 5TQ0H 3QIBA 1KT2A 5IMOB 4X9GA 1KJVB 1K4CB 1ED3A 2P5EB 2WINB 4KTDL 5C0DA 1NCCL 4HXAH 4AJ0A 1RIHL 3LAFA 1ZAGA 2J8UA 5C6WH 1FAKT 1NCBH 2KUTA 2E9JA 2IFFH 1VFUA 3GRWH 5DJDA 4OLUL 3SGEI 1I1AA 1WBXB 4KXZI 3FJTA 2P8PA 1RZ8A 4EZMA 3EYSH 5FO8A 1A7PL 2CLRA 2EDNA 2IBZX 3SGJA 3UC0H 3T1WA 3VXQB 1MHPH 4P4RA 2A73B 3HG1D 5I71C 4HUMB 5T1KB 3WLWC 4DN4L 3DIFB 1M6OB 5T1MB 2P7TB 1KN4L 4LRIA 3MRNA 2C7UA 3KLAB 4L4TE 3E0GA 1ZANH 1I8IB 2VISB 4G43A 2R29H 1MVFA 3HZKB 1T0MB 4GT7A 5LAXA 4MNQD 4F9LC 5CJXC 1J1PH 1JYWA 1IEHA 3N85L 2AABH 3C5SB 5D2NB 4CNIB 4ELMB 5FYKH 3QDHA 1H8OA 1WIPA 5IOPA 4DAGL 1F11A 1PEWA 1N4XL 2QSCH 3ARDC 5JNYB 1FJ1A 2DTSA 5ESAA 4CU8A 3DYMA 4MVBD 1OD9A 4A6YL 1BFOA 4AL8L 2C3VB 2FEDC 2EDOA 5F1NB 2VIRB 2NXYD 3TBTA 4QTIL 2AW2A 1I1YA 4L4VA 3GI9L 2CO6B 5IVXA 3O4LB 1IQWH 1TNNA 3KPTA 2ORBH 5GGSB 3LY6A 5DRWB 4OSUL 4JE4B 3RRQA 3GO1L 1VACB 5HSFA 1MNUH 1NFIB 2YBRB 1U3HD 3LKSB 4G8EB 1YQ2A 2APXA 2XXCB 1ZK9A 4GAYA 2GT9A 4UTAH 5DEGB 5CAYB 5ID0B 4WFHD 5D2LE 4YHML 3BH9A 4OUOA 2BRRL 1M7DB 2EZ0D 1CQYA 4WHYG 3FT3A 4PJBB 4JFXB 5K93A 3FO1B 5HYEA 2OTPA 4BSVA 1X5JA 1KYOJ 4QRPD 1UADC 3PWPB 3VXRE 3C60B 1B9ZA 3OAZK 4J3UA 1KIQA 3HE7D 5HI5D 4PY8I 3QUMH 4ALAH 4R4BA 4RBPK 2HLFD 4PJAF 2D03L 5E2WH 1EH9A 3A6BL 1ZA6B 4R4FL 5ETUB 4WFGE 1XR8B 1S3KH 3MV9A 1CG9B 3NZHH 1WFOA 4PJCF 2FBJL 1EDQA 2M2DA 4WW2C 2LVCA 1CLYL 1T0NB 3MOBL 4WI7A 2J6EH 3H8NA 3K2MC 5I9QB 5DK0B 2Z35A 2NX5D 4KI1A 3K8KA 4YHKL 3TYGH 4Z7WE 5I17B 5ERWB 3WD5L 5EPMB 3IAPA 4WNQB 3EYQC 3BZFB 1RZ7H 1MAKA 4I0KA 3WFDL 3EO1B 4LVHC 2ED7A 4TOYL 3EGSB 1NUDA 1EPFA 4X6FB 3ZE2F 1WBZA 5FKPA 2JJSA 5AD0B 4HC1L 1NMCB 3TCXA 2DQIH 3HUJE 4HF5H 3C8HA 2UZIH 4X7TA 4KY1H 1F4HA 4WVRA 5ISZE 5F7NC 3AREA 1O7SA 3IDMB 2WW8A 3DUHA 2IEPA 3RVXC 3RWGB 5E8NA 2YD8A 5J56B 1F3RB 1F4XH 2IBZY 3C5JB 1DQLH 3OKOA 5DR5L 4NM4L 1FIGH 2ZPKL 2BY0A 2XG5A 5DF0A 1YMHB 3G5XA 2NY0C 4NN7C 3MGOA 3QDGE 2ICWJ 3TT1L 4OAWB 4KVNH 4FFVD 4NO3A 1YZZA 4IHOA 3LKQB 3MRJB 3L3GB 3V6OC 3L95A 1RHHB 2BK8A 5B3JF 4OI7A 4K3JH 1KBGL 1HKLH 4YFLI 1P7QA 4GFTB 2HYMA 1HYRC 4MAUH 5DLML 1ZGLM 2UZXB 1I4FB 3O3AA 4NUJA 4X0KA 4PJ9B 3UBXB 5F9OL 5HVGB 2YD5A 2CRZA 4Y19A 1WT5C 5GQBA 5IR1A 3P73B 3TIDB 1LO4L 1VADA 3NMEA 1KEGH 3VGDA 1N0LA 4QXWA 3QG7H 2X7LB 2OI9B 2Q6WB 2GITB 4RX4D 1V8HA 4UDUB 3UPRA 3TCLA 3S34L 4P3CL 3IJSB 2GSIB 1U8IB 5E6IA 4YFLF 2OZ4A 5IMKB 4FNLH 2CDGB 5E8PA 3TGXA 3EFDH 1OGTB 3HI5H 4A2MA 3GMPA 1MELA 1W0YT 4ZFOB 4WTZG 3LQAL 3DGGB 3VRIB 4M61B 5JXEA 5JPMB 3UTSB 1OLLA 2ZUVA 4YHIA 5C07B 3QNZB 4XVSL 4GG6A 3OKNB 4OZGF 4Z7UB 3T0EE 4N1CA 4P5TC 3BZEB 5CGYC 4CMHC 4LHQB 2VC2H 1A1NA 4TTDD 3VRJA 2Z0BA 4OUUB 1U3YA 5D71H 4HS8L 2VZUA 1A6AA 1RJZB 3ULUH 2VLLB 5J13B 4OIAA 3BVNA 4GMSH 4Q9RL 5A16B 4QRUA 3B6SB 3OR7A 1ZOXA 1NGPH 1NC2D 4DOHB 2VLJA 4ZSOA 4AQ1B 2WUCH 1FYTE 4MB4A 3GRWA 3D0VB 1A8JH 2A9ML 1OF2B 5MP6H 1JVKA 4QHUB 5IKCA 3DXAB 1TIUA 5E7FA 4N0UA 2KPNA 1C7SA 4YC2C 3S7GA 5EUKB 4KRMB 3VI3F 2Z93B 3MUHL 2DMCA 2O5XL 3B5TA 4QXTA 3Q5OA 4IRJB 2DLFH 1TZHA 5DZLA 4U2ZA 1A3QA 3MRRA 2IALA 3Q6FA 4UB0H 5HXMA 5LVEA 2YSSA 5KJRH 4JG1L 3UZEA 2XWBA 1TZGL 1DCLA 3MLUL 3O6FD 5C2BH 2R4RL 4MJ6B 3MV7B 1ZS8B 2DLIA 3PHOB 3RVVC 3DV4B 2FIKA 5E9DB 4N8VB 3RWCA 1PKQA 2X4UA 1X5KA 4M7ZB 1KPVA 4XB8A 1OAKH 1R5IA 1BMGA 1SJXA 4EUPH 4TSCL 5JIKA 2FL5A 3QIBC 5TQ0L 5GZNC 4YHYB 1JF6A 4JFPB 3FFCE 4EUPG 1EERB 4ZS6C 5A2JH 4PV8A 5IMLA 3HAEG 4WTXA 2E7CA 1J18A 1ONQB 4HXAL 4K7FA 5AAMA 3ZO0A 4FA8A 2XT1B 1FO0L 3G5ZB 4ODSL 2HLAA 5F7FA 3D39E 2AXGB 2OTWA 1B88A 3DX7B 2IFFL 5F1IA 3IFOA 5J1TC 5D7SL 3V7AE 4JFEB 1KELH 2XA8L 3EYSL 5L2KD 3SGJC 3H6JA 4R8WH 2FH6A 4F7EA 2MHAB 1MLCA 1YEHH 5FYJH 4LRIC 3SEPA 4WJ5A 2HP4A 1I8MB 4OFYD 1ZANL 2VXVH 2GJ6D 5FGBA 4HMEA 3A0OA 5FYLE 2VH5L 4I0PD 4UOJA 4C57C 1E28B 2UWEB 5I1GH 3D85A 1YYMH 3G9VA 3Q1SH 2RFXA 1DEDA 3QXWA 3M45A 4RRPG 5L7XL 3CZFB 5MI0B 2AABL 4KKAD 3GIVB 4LCCB 4XRCA 4HLZH 1KTRL 1CYGA 3V5DB 4IRSB 1MIEL 5D1QB 1NGQH 2J6EA 4P23C 4HLZG 2QSCL 1JGVL 1L4IA 3IKKA 2NLJA 3BP7A 3GGWA 4JLRB 2GCYA 5I1AA 2EEBA 4K3HA 3KHOA 5DJCA 4S1QL 3VXMD 1YNTB 3ARVA 4WO4B 1PDKA 2F5AL 3KYOA 5E08H 3DVGA 3U0WL 5KSAC 3OF6D 4X6CE 4Z7NE 4X4MA 4FQXA 4LVNB 1JPST 4O9HH 5EA0H 5JMOC 2FATH 4WFFD 5I74B 3BPCB 4L29B 2GY5A 4D9LH 1P9MC 4PG2A 4FOMA 4ZTPH 1CDBA 4NRXB 4KDTA 4ELKB 1F6AA 1YECH 5DHVA 2PCPA 4H1LA 2DQFA 3VXOB 4UTAL 2XQYG 4HZLB 3B9DA 3BKYH 4H20L 2X4PB 4NWUL 3QXVA 4ZTOH 5I6XC 5EZLB 4G6KH 3U0PA 3ZYIA 1EEYA 3DYPA 3RX8A 1AGBA 1AGCB 1GGBL 4K3DL 1REIA 1JZ5A 3ALXA 1NDGA 3L5XH 1U8KA 3SJVB 1JMXA 3LVEA 3OB8A 1DQTA 2OL3H 4QWWD 5I16A 3QUML 4ALAL 4G6AD 1ZVSA 5D2LF 5SWZD 4GRLA 5IW3A 1I8KB 1UXWB 1JNNH 4PRNA 2I9LA 5DJAB 3NZHL 3QJHA 1FP5A 3PF2A 2VE6B 4S11A 1H0DB 4Y8AA 2QSQA 3OR6B 1MFCH 2ZG3A 3HC0A 3ZHLA 1QFWI 4JRXD 4UIMA 3G6JB 4LSSH 2VDRH 1A6VL 4NP4H 4WY7L 4NJ9H 3BIKB 4NO5A 3EYVB 4LARH 1RZ7L 3JV4A 2X1PA 4JFYA 1JHTA 2GKIA 3VW3H 4Y0GA 2DKUA 2VXQH 5CKAA 4LDLB 1WCQA 4QCIA 3H7LA 2JJSC 4QNPF 2I9TB 4Z7WF 1N6VA 3TN0A 3TF7C 3VXUD 4WUUD 4HF5L 1Y0LA 4P4KB 1XH3B 4POZC 4GJTB 1EO5A 2H32H 4M1GH 5KVDL 1RURL 3LQAC 3UXFA 5D1ZA 2W65B 2Z31C 3PV7A 4CUCA 4CMMA 1IQDB 3E6FA 1FIGL 3F5WB 1OTUC 2OR9H 4PP2A 4EI5C 1AKJB 1GZPA 2EH7L 4GKNA 3OAYH 2EDHA 1N8ZA 2B39A 4G7YL 3E3QC 3FOMA 3HRPA 4U1GB 1JPGB 1QVOB 3KPRE 3HNVH 4DUXA 1IGJB 1QSFD 1R0AL 1ZHKB 2AEPL 2XYCA 1UB5B 1HKLL 2XTJB 3BH8B 1C08A 4LVOB 1CZ8L 3C87A 5FM5M 4BFIA 1U2HA 5JLZB 3KPLB 3JV5A 4MAUL 1FNHA 4OQTL 3REWB 2XWJB 3L5WA 1A1MA 1JWMA 4PJIB 2VL5A 1M4KA 3D1MC 1N0XH 5GHWL 3S5LA 1SJHB 4J3TA 3SDAA 3I9GL 1FYHB 2P5WA 3LCYA 3CDYA 2XFXB 1PGRB 5MERA 4PJXA 1YEEH 1YYLH 3ARFA 5ESQB 5KANI 3QJFB 1SJEB 4FFZH 1QTYT 3QXTA 5E6IC 4EI6B 4JFFB 4GBXD 4WWKA 3QI9D 3EAKA 1ERNA 3ULVE 4PJ8C 2ZZUT 1EHNA 3HI5L 1T21A 4MAYD 4JDTH 5IV2B 4IBLT 4PJDE 4MDIA 3V0VB 5ICXA 4P2QB 1MSPA 3KNBA 4Y1AA 5D7JC 5HVHC 1UVQB 1U58B 1B2WH 2G75A 2PYFB 3F7VA 4HGWB 4X5XB 3WFHB 3RTQD 2NY1D 4KTEL 2VC2L 3FB8A 3OWEA 1KEML 3BD5A 4ETYA 1P4IL 2HG5B 1JK8A 3BP4B 3PP3K 4Z0BH 3S37H 5D71L 3VGEA 5C0AE 1HHJA 3GSQA 4DZBB 2YD3A 5EIVA 4LCWE 4EVNB 4GMSL 2FH8A 4N0CC 2ZCKH 1WFNA 1KJ3H 4RGOH 4WHTB 5CP3H 1D5ZA 3P4LA 3TNNB 3NGBB 2DYPB 3L6FA 1ZT7A 4ZNEA 3IXAB 4GKSB 4OLVH 5DFVC 2WUCL 5EBMB 1CFBA 3OTTA 1PYWA 4TVPD 3B9VA 4JGMA 3RL2A 5E5UB 4UIKH 5T1LB 2ENYA 4BH8B 4BYHA 5MP6L 1N7ML 4PYHA 1GC1L 3BEVB 1NBYA 5I8CA 4PP1D 1T4KA 3MGTB 1WC7B 4F3FB 3GB7A 3QQ9D 2R23A 4L4TB 4YHLH 4PRHD 3PWVA 4HIHA 4AEHH 1AHWB 3HAEB 2EKSB 1YDPB 1R5WA 4XP1L 2EYRB 2CDEA 2FNBA 4DVRL 4PJEB 4BZ2L 3BGFC 1YNKH 3SPVA 5KJRL 1XGYH 1MCCA 1D5XB 2DL2A 2KQNA 5EFIB 2ADGA 4HKBA 5BO1H 3JV6B 4XNZB 3LV3A 5J6GB 5EN2A 2D7OA 3NH7L 4X8XA 4KRPB 4N0YH 1MREL 5L8JB 2FR4A 1OAKL 3ORJA 3TZVD 3SDDB 3ZKQD 1U42A 1OSPH 3L1OH 1KTDA 5BVPL 5CSBA 3VI4F 1GH7A 1IGFH 1EHAA 1TQBB 4YUEH 3D3VD 1DTUA 4XPGH 5LJYH 3LQZA 4NQCB 4F7CA 4R7DB 5F9WB 1I7ZA 1BBDL 1NBZB 3KXFB 4LHUD 2NY2D 1YEGH 4WU5A 4MB5A 5JORA 4V1DE 3IU3B 3ES6A 1BQLL 1QBML 4EKXA 1MH5B 3F7QA 4XHJC 1WCBB 5DQ9A 4DUWA 3CFBA 5C08E 1LMKA 3LKRA 1K4DB 1HE7A 5DGRA 3MYJA 1Z9SA 1T2JA 4L9LB 5LCVL 4NQSA 5FYJL 4MJ5B 4R3SA 2BVEA 4F33A 2MNUA 3PNWA 4ZUTA 2M8XA 4OCSH 4YNYB 5E5MB 3QFJE 1WWWX 2CUIA 4JM2B 3BIBX 5I1GL 1QSEB 1F00I 1YYML 5T5FL 3HZVA 3PQYD 5JPNB 4X4ZA 1XR9A 1UEMA 4J1UA 4KAQH 1VFAA 2DOCA 4PGCA 2ZUSA 1BZ7A 1NUNB 3H7BB 5J06A 3VXTA 3LB6C 1BEYH 3PE9A 3TBWB 1PKOA 3IDUA 1ZGLB 4LCUB 5DS8A 1S7XB 4EN3D 1J0YA 4MQXC 4MD4B 3RU8H 2PN5A 4BK4A 1FL3A 3LKNA 1FC1A 1G7JB 5GGRY 5EZJA 4F7TB 1W0WB 4U49A 3LIZH 3S98A 2DJ4A 4ZS7H 4S0SD 4U4BA 4R9HA 2FX9H 5DMKA 5CJ8A 1LEKB 3IETA 4MXWL 5EA0L 2FATL 4UU9B 3I85A 4K9EH 4XCEB 5GGVH 4ZXBA 2H9GA 3O3BA 3RDTB 3L3IA 3GJFH 4PG2C 3O41B 4X5WA 5B8CC 3WFEH 3MRFA 4ZTPL 1JGDA 3MJ8B 4M93B 2FJHB 2H32A 3KYKH 4GS7C 4RMVA 1YECL 4CVZB 3V9FA 4FXKA 3UZQA 2HMIC 2VR4A 4W4OC 3MRQA 1BVKA 1I7RB 1NC4A 4AEIH 2JJTC 3EZ8A 2WBKA 5IBLC 3VFWA 4LPUA 3EIFA 1RHFA 5BS0D 2EDJA 5CGMA 5DD6B 1I7UA 3L5XL 3N06B 5DUPH 3HI1B 5EBGA 3GFUA 2OL3L 4PJHF 2IPUG 4HKZA 1RIUL 5B4MC 1K6QL 2Y07L 3TVMB 3QIWA 3IDNB 4JPKL 3PHSA 1K5NA 1JNNL 3WLWD 5B39A 5CZVH 3PP4L 3MV8D 3FKUS 1F8TH 1FL5A 1I3VA 3OKLA 3PUCA 3FFDB 3VFOA 1RJCA 5MEPA 2ZNXA 1HH9B 3NIDE 1NKOA 3GMOB 3QUYA 4LBEA 1G6RL 1CR9H 1LK2A 1PEZA 2YOCA 4JZJC 4LSSL 2VDRL 1AGEB 4EQ2A 2R9HC 1KB5B 4NJ9L 4K94L 2B5IC 2VWEC 3EDEA 3RGHA 8CGTA 4DN3L 2ZJSH 1LD9A 3MJ7B 2CRYA 1LWRA 2C1OB 2BMKA 1BOGA 4ESKA 3FO0L 3ARPA 3QA3A 3ARDD 5HHME 4L8BA 2YUXA 5DZNA 1XMWA 4JN2B 1LEIB 1K8IB 2FEDD 3MREA 1MCQA 2CO7B 5ICYA 3CFIC 3MBXH 3W0WA 2WSKA 4ODTH 2X05A 3K2UH 2VDOH 4MGXA 4XPTL 4CADA 3PWLA 4DGVH 3IB4A 4N5EC 1QLRA 3R8BB 1HH6A 2PXYB 3RWHA 3ROLB 2KQMA 4KHTL 4X6DA 4XZUB 5DFWH 4POYA 4LLQA 2BVOB 2HVKB 4WI2A 3SQOH 3B8SA 1FVEB 4KI5C 1T1ZB 4PJ7B 4C54A 2XQYK 3QAZC 2V7NB 4NN5C 5CP3A 4Q9QH 1NCAL 3L5HA 3OKMB 1AR2A 1YEDA 2BNRE 1OB1A 3AFLA 3VG9C 4WGWB 3FTGB 3SDAC 4NGHH 4LASH 3L3DB 3RWEA 1GC1C 3NABL 2AQ1A 4N8PA 1RUAH 5F9JA 1MJUH 4U1LA 1GOHA 3T3ME 2AJYH 1D9KA 4WEUD 4JEGB 5F93C 4JPIA 1NQBA 2PTTB 4OBRA 2E6JA 3N1QC 4D3CH 4G9FA 1YYLL 2H3NA 3K81A 5L2JA 3DMMA 1MRDH 5HHOA 2RAMA 1FZMB 2X89A 2KZ1B 3LKOB 4EDWH 1U93A 1KNOB 3ME0A 1QPPA 4OGAC 4OF6A 2QQQA 3EYQD 1G9MH 3GSVA 1KJ2L 2OTUA 3VFPA 4TUJB 4JDTL 3T4AB 4OBSA 5D6CA 1CF8H 4HS3B 5E2UH 1IEAA 4NBZB 5CHNB 1TZIB 3QRGL 3PWUA 1H15A 1NCWH 5EU4B 4GAJH 2E8ZA 5I1LA 5ITBH 3S6CA 4MD5B 2VDLH 1A22B 2KL6A 5FOBB 5DYOA 1IBGL 1RZIB 1QRNE 1P4LA 3QDMB 4L3EE 1LHZA 4MA8H 3NPSB 4QRRA 2DI7A 4Z0BL 3S37L 1OP9A 3D5OF 3RVXD 1DEEA 2W0PA 1MUJB 3HRZA 4YEEA 3EDFA 2ZCKL 5FB8A 2Q86B 3NPZB 2NY0D 5IG7B 3W2DH 1YPZB 3D18A 4Y5VC 1RSFA 3CPLA 3NN8A 5FK9B 2Z9TA 1I9JH 3W39B 4YQXL 1T22B 3EOAB 4MNQE 3SKMA 3U48A 3DECA 3G5YA 4RAUB 1VGKB 4UIKL 3QO1A 5IEKA 1JCKA 3BDBA 3VWKC 1E0OB 2GSGB 5J9PA 1VFMA 3LEYL 2LFGA 1BJ1J 2HJFB 1VENA 5IMOA 1HKFA 1KJVA 1K4CA 2WINA 2VDMH 4AEHL 1AP2B 5E7BA 1PSKH 3H9HB 2VABB 4JANB 2A6IB 1XGYL 1QHPA 2G5BB 2R4SH 3O2VL 3GK8H 4BQ8A 5A2FA 1DZBA 5BO1L 3O8XB 3GSWB 2YC1B 4I77H 4Y4FB 2M26A 5KS9F 3PDDA 4EDXB 1INDH 4N0YL 3WJJC 2YPKB 4BUHA 5CD3A 2A73A 5T1KA 3SGEH 1IC5H 1YEFH 1M6OA 2JCCB 2P7TA 3ARGB 4KXZH 3O0RH 4M3JA 1UM4H 5T1MA 3L1OL 3WKMH 4L8SC 3EYOB 3P0YH 4N1HB 5I8EB 4G80B 3KLAA 3BRGC 2XACC 3TV3H 2RGSA 3ARBB 2DQDL 3V4VL 3ZMRA 1I8IA 1KSRA 4ZYKB 3RAJH 2VISA 1IGFL 2XN9E 3JSSA 4PFEA 3ARSA 2J8UE 4TNWF 3HZKA 1T0MA 1FBIL 2DJSA 1FNEA 4P5TD 2AJSL 5CGYD 5E4EC 3C5SA 2CKBB 2WLZA 4CVXB 5D2NA 1SY6H 4CNIA 1ZA3B 3SN6N 1DANT 1YEGL 3VU2A 1J1OH 1U8HB 3U46B 3ZZ1A 1EGJA 4R4NC 2ENSA 1YEJL 3ECBB 5JNYA 5J6HA 5D7LB 3B5GA 2V2TB 3BSZL 2C3VA 5GRXG 4I5BB 3CFKA 5F1NA 2VIRA 1QEWA 2FGWH 2NW3B 2IH3A 2ID5A 2HFEA 4KK6C 4G6ML 2CJUH 6FABH 3HMWH 1KV3A 4OCSL 5IFHH 2J5LC 2YK1L 4DTGH 1KCUH 2ATPB 1VEOA 4OZHF 3HE6B 1FNGB 5DRWA 4UZGA 3MLZH 1VACA 1U95B 3BKML 1NFIA 4ZUVB 2YBRA 4U31A 3ZKXB 5EOQH 4G8EA 5HYIA 4KAQL 2ICWB 3IFNH 1MHEB 4AMKH 5DVNA 5DEGA 2WBJC 1BEYL 1M7DA 2VXSH 1XGUB 4PJBA 2IPTH 3FO1A 4H8WH 4U1HB 4M62L 3RU8L 1H5BC 4L4VE 3PWPA 1S9WB 4K94C 3C60A 4ZUUB 5IVXE 2C3GA 1G1CA 5C0CE 5EU3B 4E41B 4JFDD 4ZS7L 3RVVD 4PRAB 2FX9L 2GQHA 4MJ2A 1Z9OA 1HSBB 5F7WC 1JHLH 5GS2H 1ZA6A 1YQVL 5ETUA 2BFVH 1XR8A 1Z6JT 3WFEL 1FGNH 3QIBD 2Q87A 1KPRB 4MDJB 3CH1A 4M3KB 3KPQB 4NNXB 5GZND 3GMLB 1T0NA 3ETBF 2DDQH 5C0BE 1EFQA 2MKWA 3MYZA 4RGMB 1JYXA 5DK0A 4ZS6D 4NSKB 4OZ4B 4AEIL 5I17A 3AY4A 5ERWA 1JZ7A 1I1CA 3SDYL 2OJZH 4WNQA 3BZFA 3MX0A 4Y2OA 2OQJB 2W9LA 4I2XB 5J3HC 1AR1D 3EJZC 3EO1A 2F53B 4F8QA 1O5DT 5F96L 5F7LB 3KLHC 3EGSA 3JWNC 4X6FA 2QQLH 2PYEB 2X10A 3C5ZA 3NZ8B 2NY3B 5AD0A 2DQGL 1VPOH 1KYOK 2XKSA 3HPJB 3MOAH 1RMFL 5CEZE 4JKMA 3D2UD 4PLNC 3IDMA 1F8TL 4OFIA 3RWGA 3VMOA 3BP5B 3D0LB 1IGTA 3C5JA 1B0RB 1I85A 2DMKA 2WIMA 1IM9D 1HHHB 2Z8WC 1N3NB 2C3XA 4WW2F 2YD6A 4LU5L 4OAWA 4MA3A 1E4XL 3GUTA 3C6SB 5AYQA 3LKQA 3MRJA 3L3GA 2ZJSL 1RHHA 4JPVH 2EE2A 4I18B 1Z0MA 2Y36H 3JZ7A 4P23D 2HKHH 2JB5L 1YMMD 5DC9B 4PJDB 3IF1B 3ZYJA 5I66B 1CCZA 4XCNB 5JA8B 1I4FA 1CGSH 3UBXA 4PJ9A 2WBWB 4V2CB 3TH2T 4FN0A 2J1KA 1IC7L 1G7PB 4PBXA 5EU6D 4TVSa 5EU7C 5KSAD 3ZTJH 3O6KL 3MBXL 5ANME 3J7HA 4YJZL 2WNGA 3P73A 4ODTL 3TIDA 4DGVL 3OJDB 4DWHA 4QF1A 3ZTJG 3G6AB 3LD8C 5GRUL 1FIEA 4NZRL 5C7XH 2X7LA 2OX5A 2Q6WA 1MHHB 2GITA 4X9FA 2IMMA 1H3UA 3GHEL 1MCWM 5CLWA 1NCUA 4UDUA 2DQTH 3SQOL 3IJSA 2GSIA 1U8IA 3RZCB 2JELL 4Z7VE 5IMKA 3VA2C 3F58L 2CDGA 4GQ9L 4NZUL 1OGTA 1EO8H 1LEGA 2DICA 4HFWB 3BWAB 4ZFOA 2G2RB 2L0DA 4Q9QL 2YUZA 2SEBB 2BSSB 4Y19E 3DGGA 4BSWB 4M61A 2VDKH 3UTSA 5IWLA 3NCYS 5C07A 3QNZA 5EZOH 1DBBH 3OKNA 4LASL 4Z7UA 2Y23A 3BZEA 4NC2B 1BD2D 3WNOA 2IADB 4TPRL 2APTA 1MJUL 2AJYL 2VDPH 4OUUA 3BZ4B 1CTOA 1XFPA 3IFPB 4HUNB 4YDLC 4ZFGH 1Y18B 1OCWH 2D2OA 1KCRH 1EEZB 3CX5J 2VLLA 3V6FB 4D3CL 5I8KL 5A16A 5BMFH 1BPVA 3B6SA 1FV1B 1A6ZB 2DIAA 5ILTL 4CJ0A 1PLGH 3RBGA 1G9ML 3T3MF 1QFHA 2O61B 4RAVB 5C70A 3JV0A 2AJUH 3LH2H 4GG6E 1MPAL 3VH8B 3BGMB 1CE1L 3D0VA 2B0SH 4ZPVB 1NCWL 1WZLA 1OF2A 4WEBH 4QYOB 3RWDB 3C08H 2FZ3A 4FG6C 4QHUA 3DXAA 4NN6C 4M7LH 4EIZC 2Z93A 5F7EH 2FEEI 5IJKC 4POZD 5I8OH 4YDIH 1J8HB 4MA8L 5DZOA 2F5BH 4NKQB 3BKJH 1LO2H 1JNHB 4OD2A 4HXBH 5L2KE 2Z31D 4P5MB 3X13A 5DMYA 3DI3B 3FQXA 2WP3O 4R7NB 4C58B 3DSFL 4ZSOE 5I73C 4EI5D 1OTUD 4D8PA 3IAQA 2E9IA 5D5MB 4KQ4H 5KSBE 2E9BA 1BGXH 3W2DL 4C4KT 4MJ6A 3E1F1 3MV7A 1ZS8A 2BVPB 4D9RD 5I1JL 1N5AB 1KLUB 1SY6A 2VNCA 4UDTA 3PHOA 3ULSB 2D3VA 3DV4A 2LTQC 1I9JL 4N8VA 4QXUH 4XVUC 4LRNH 3ZDZF 2DTMH 4NRYA 1F45A 5HD8C 1X4ZA 3MA9H 5EBLB 4S0TD 4UV4H 2FYYB 3S88L 4BUGA 5I1EL 1HNFA 4G5ZL 4JFPA 2QTEA 2Y1VA 3QFJB 1DL7H 4PY7A 3BW9B 2VDML 1I9EA 5JHDD 4LKCB 2WM0A 4DCQB 4ODVL 5F6HJ 1ONQA 5CJ5A 1PSKL 3AXLB 4C56D 3G5ZA 3BQUC 3ZSTA 3MR9B 5FYKE 4CJ1A 1A7NH 1DBKL 2AXGA 2AXHA 5CEXB 1PKQE 3DX7A 3FRPG 4APQB 4WFFE 2Y72A 3OKYA 4JFEA 1RFDH 3QUZB 3BRDA 5DD0H 4I77L 1FN4A 4JZNB 3O2WL 4HX1B 4FS0A 1INDL 3ZDYE 5CLTA 5F72S 3P11H 1YJDH 4PJ8D 2X4TB 2MHAA 4WHCA 1IC5L 1N2RB 3WKML 1KPUA 4Y2DC 1I8MA 5M95B 3P0YL 3TJHC 4NOFA 3JUZA 3SDCA 2GI7A 5D7JD 3RAJL 2H26B 5T33H 5EU5A 4UAOB 1E28A 2XIDA 3GBNH 3NCJH 2BNQB 1IGML 4PRPD 3BISA 2EDTA 3BDXA 5I0DA 3CZFA 3EKCA 1V3KA 5D2NC 3GIVA 6CGTA 4JO2L 4NHUB 1ITCA 4LCCA 5ECJE 2MCPL 2R2BB 3T65A 1JGUL 5IBTH 4IRSA 3V5DA 1IJ9A 5D1QA 1UH3A 3QHZH 5SWSB 5SWZE 1Z3GH 3IYLW 4N0CD 5FAAA 5IIEB 5EC2B 4JLRA 3CVIH 3C09B 1YNTA 5HI3C 4WO4A 3HNSH 3QDJA 1QBLH 5DFVD 4TQEH 2GK0B 6FABL 3HMWL 1D5BA 1TETH 1ORSB 2VITB 3UJJH 1KCUL 1JP5A 4L29A 4WU7B 2BC4B 3VWJB 1KLGB 3MLZL 1E6JL 4KKNA 4NRXA 4ELKA 1RJYB 3S4SB 1MFDH 1NCTA 2DJUA 2MKLC 2K1MA 3V6B