1CQYA

Starch binding domain of bacillus cereus beta-amylase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
TPVMQTIVVKNVPTTIGDTVYITGNRAELGSWDTKQYPIQLYYDSHSNDWRGNVVLPAERNIEFKAFIKSKDGTVKSWQTIQQSWNPVPLKTTSHTSSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BETA-AMYLASE
publication title Structure of Separated Starch-Binding Domain of Bacillus cereus B-amylase
rcsb
source organism Bacillus cereus
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00686 CBM_20 Starch binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cqyA00
5DGQA 4BUGA 4YZFE 3EIFA 3TN0A 1YEGH 1WC7B 3MGTA 1WZ1L 3P0GB 1T0NB 4YDJB 2ORBL 3D0LB 2F74B 3UTSD 4R4NC 4EDWH 4D0DA 2ESVB 4PG2C 1ADQA 4DVRH 5EPMB 3CPLB 4OF8A 4QY8B 2DBJA 4TUKH 4YC2B 1OQOA 1VEPA 1I1CA 5F6IC 1QSEA 3WFDH 3H9SA 1A6AA 1JTPA 3BQUB 3CD4A 3BZFA 3PXJA 2PCPA 3CFBA 4QXGL 2MMXA 4K3EL 1PAMA 4U31A 4X9HA 3UTQB 5JXEA 4JFDB 2A6KB 4UTBH 4DTGL 4JFHE 5GS0L 1D5IL 3WMSA 4EI5D 3NMEA 5KJRL 1G1CA 1K4DA 4Z5RA 1HH6A 4TVPD 1ZTXL 1IAOA 4Z0XB 1YEDB 2CIIB 2BOBA 1IM3B 1LP9E 2AK4A 4P5MA 5D96B 3BPOB 3VFVA 4YDIH 4XNUH 1HOCB 3SGDH 5C71A 2A77H 4N1CA 3G6DH 3WS6A 4QHUA 4NZUH 4RDQG 1UQSB 4LRNH 3QDJE 1F4WL 5KN5B 3IETA 1PKOA 2EDKA 3VXUA 1DQDL 3ZDXE 1NGWA 2Q76B 4P2OB 3FL7A 3CLFH 2KQNA 1HHKB 4O00A 4J6RL 2A83B 1NL0H 5L2KD 3HZVB 3F12B 5J12B 2WP3O 1NGYA 4RAVB 4YWGH 4BQBA 2DQGH 4HFWA 5CZXD 3RPIA 2AP2A 3G5XB 3DYMA 3PQYB 4AM0A 3BN9C 4Q2ZB 5C07E 1KJMA 1I9IH 3V6OA 3RTQA 2WINA 4FMKA 4ZUWA 5SV3A 5D1ZB 3TZVD 5EUOE 3VXSE 2WANA 4D8PA 2OP4L 1FC2D 4MMZC 5DVKA 2Y1VA 1CTNA 4PJ8A 4CU8A 5MP6H 1YDPA 5IVXE 4P9HC 3TN0C 43C9B 3PUCA 4I13B 1UENA 3O2WL 4MA1C 5EU5A 3V7MA 1EGJA 1MI5E 3G08B 2DICA 5E03A 1ZANH 2XQBH 4JJ5A 4X99A 4GOSA 2G9HA 3O3DA 4PJIE 5JR1H 3P4NA 5I66A 1CGTA 4PJXF 1A7OH 5IBTL 4ZODA 3RVUD 4D0BA 4FQXD 4NKIH 4YR6B 2FD6L 2PYEB 4N0YL 5IGXL 2WWMD 3KPRD 1P84J 3GMQA 5BVJB 2VABA 4HLZG 3T8XA 5FUZH 4UAOC 4I77L 2QADC 2YEZA 4X6FA 4IIQA 4XCNA 3CSBA 4DW2L 1JGEB 2XACC 1A7PH 2EDJA 1RU9H 3K3QA 3VI4F 1BD2E 1J0KA 1WTGT 2BSRB 2CXGA 3GMMA 3RGVA 3U4EB 5K9KA 3EYUH 5D7IE 2H9GB 2P24A 4CN4A 1JGLL 3I02A 3NPZB 1E4XH 1C5CH 1TETH 2DQIH 4M43H 1CYGA 2EYTB 3V5DA 3QB7C 1HHJA 5EOTA 3G5YA 3N1FC 1MFAL 1YJDL 3GKZA 1EUTA 4RQQB 1SYVA 4CKVX 2CKNA 5D2NB 1KCUH 1Q8MA 1OD7A 3BD3A 4YXKL 1OP9A 2EEDA 3MOBL 4R2GC 4NO0D 3AREA 3ZTJH 1T83C 3KVQA 1XZ0B 4WFFE 2X09A 4K9EL 4Z7VE 2XN9E 3QIUA 3GIZL 3RBGA 1RMFH 2G5BA 2YOCA 3F6IA 4HKJA 1T22A 3ZYOA 3BDYL 3RTQC 1E28A 1D5ZB 2HKFH 1NUFA 4KQ3L 4OIIH 4XB8A 2V9TA 5BW7A 4Q97A 2MCG1 4LOUD 4NBZB 2GAZB 1MCWM 3OGCA 3HCVA 1XF3A 4PYHA 4YX2H 1LEGA 4PJ8C 1MSPA 1MWAL 2RQ8A 4XTRD 5D71H 1FIGL 3T0EE 4J4PC 4LGPB 2VXQL 1QNZL 3O8XB 1FG2B 4OFVA 1G9ML 2DQEL 1T7ZA 1D5MB 4FQ1L 1FE8H 3MJ8B 4JN2B 3NFNA 3BGMA 4Z78A 3STLB 1C1EL 2CGRH 3L1OH 5GRZA 1TLKA 3DXAE 3HI6H 1B6DA 5EBMA 2A6JB 5DZOA 1JWSA 2OCFD 5DA0B 3H3BC 3AY4C 2IAMC 5FYKU 1T7VA 2BNQE 3FB5A 1P7QD 1UB5B 5CEZE 5ENWB 1ZLUK 3VWJD 4LSRH 3MV01 3GK8H 1NAMB 2E7MA 2VLLB 5I2IB 4AL8L 5HHMD 3KR3L 4KGLA 4ZG1A 1N59A 2BY1A 2NY3D 3K4AA 2ZCHH 3VXPB 3QCUH 4NOFA 1KB9J 3VMNA 5FV2A 3RGVC 1YYLH 3LZFH 2PXYC 3PXHA 4ZXBD 4KMQA 4V1DE 4YDVA 4PV9B 4O4YL 4OFKA 2GFBA 5DURB 1ZLSH 2HLAA 4I2XA 4QEGA 3TWCL 3I9GH 2IH3A 3GSXB 3N1QC 3NAAH 4NO3A 4MD4A 4P57B 1REIA 1KEMH 3G5VB 1AIFB 2YBRA 4OAWB 4G42B 5D2LE 5A16B 5L6YH 4J7RA 1ZGLP 5F6HI 3VGEA 1EJOL 2W0KA 3ZKQD 25C8H 3U0PB 1DP0A 2XXCB 2VITB 3SKOB 5F7KC 2YMXL 2EXYC 1YA5A 4Y2DC 5IQ9B 2DI9A 4M3JA 3ULSB 3SJVA 4OZIB 1L7TH 4AEIH 2C4FT 1MHHA 1FJ1B 3P4MB 5DJ6B 3ZSSA 5HHPA 3QULB 4LDOB 3PL6C 2IPKA 1NJ9B 4KJPC 3BPLC 1UB6B 3OKLB 1DVFA 4BZ1H 4U1JB 2RR3A 3MA7B 2H41A 5ELIA 3P0YL 3RZCB 4WI8A 4OIBA 3QUKB 3IKCA 1HINH 4UDUB 3SQOL 2QV2A 1K85A 3LKOA 4Y16C 5IV2A 2XQYK 1CI5A 2ZG1A 2I9LB 4I0KA 5FEBA 3JTTA 3MACH 2A1WH 3PWJA 4JFZL 4LKXA 2NY2B 2QR0B 3WIIH 3A6BH 2C1PB 1AGDA 1PW3A 1B4JH 1QBLL 3BGFC 3N0PB 2VLJD 5IFAH 3HI5H 3BH9B 1M71A 3OJDA 5DJXB 3HA0A 3MOAH 4OFPA 4JKMA 1INEH 4X6BA 5E8PB 1QSFE 3IXTA 5FHBH 3HNTL 4WU7B 5C0CD 2EO1A 4D9LL 2XA8H 1BGXH 3AM8A 4JY4A 4QNPF 5I9QC 2JLLA 3HZYB 3FFDB 2GUOA 5DRZA 2PTTB 5F1IB 2W07A 5I1IH 2ZUQB 1NUGA 2FSEB 5C0GA 3QQ9C 3FCTA 5FYLE 4IMLB 3G6AA 3NPSC 3N85L 1WTLA 1YPZF 1OTSD 3P4OB 4XVTH 1PSKL 3U0TB 1NDGA 5DHYA 1MQ8A 1ZA3B 2FIKB 4PJBB 4R7DB 3ROLB 1P4LB 1ERNA 4EQ2A 1MRCH 1HWHB 4MSWB 5CJQH 4YQXL 3LKQB 2DQTL 4KTYA 3HRZA 4XX1E 1QLFB 3HC4H 1KIPB 1IT9H 3ULVL 8FABB 3AS3A 5F7HA 1M7DB 1JHTA 3REWB 3IGAA 4ETQB 4NQEE 3MRFA 1P1ZA 3IAQA 3B9KB 1H5BA 1WIPA 4GRWF 1AHWA 2Y07L 1QHPA 2BVYA 4OGAC 4OZHB 1F90H 1CFQA 5DEGB 3TBSA 2AJSL 1OL0A 2ZUTA 4CMHC 1OAZL 3WXWL 2XZAL 1MI5D 4XXCC 1MPAH 5IEKA 1CF8H 5JOFB 4XZUA 4OLYL 2A9MH 5IMKB 4G6AC 4P23B 4J1UA 4LL9A 2YXMA 4JRXE 5DJAB 5BCAA 1FO0L 5C0RL 3QXVA 1NCDL 2HN7A 3KPMA 1JCKA 1GPOH 1QEWA 1Q9WA 3V5HA 1XCTB 2O61B 2ITDA 4LAQL 4N8VG 2EDBA 1BP3B 3MJGX 3RY4A 2CO7B 3RRQA 4NJAH 4LEXL 5FYKD 4KI5D 12E8L 1JGDB 2KKQA 4ZSOA 3SDDD 2IH1A 1HKLH 5IK3A 3TP4A 4APQB 5EU3A 3MRRB 3NFSH 2HJFB 3LQMA 5DFWH 2N4IA 4ENED 2EDFA 3ARDB 1T2JA 3QCVH 1GGBL 3V2AR 4I0PD 3CMOH 5E99H 4Q9BA 4N1HB 1LO3L 4GMSH 3FFCB 4JRYA 3AM8C 2BRQA 3RWCB 3THMH 2FEEI 1JRHH 5FIEA 4GQ9L 4I3SH 2X4TA 4XBGB 3BI9X 3NCCB 4NC0B 4PJDE 3LAFA 3NOIA 3NACH 1MLCB 1A6VH 3BEVB 3QA3B 1CFNB 5CBAB 1U8IA 3I6KB 4QRUB 3SGJA 1J86A 3FN0H 3RDTC 5DD6A 3FONA 5JA8B 3P73A 3U4BH 4KU1A 4WHTA 1OARL 3MODL 1KJVB 1CQYA 4QTIL 3SDXB 1GC1L 3RVTC 1W8NA 4WFFD 4Y7MA 4U6VL 4W68A 1G6RA 3W9EB 2ARJQ 3QUZC 1UWGL 3AXLA 5JQ6L 4LFHD 1MHEA 3PP3H 5E9DD 3IS0X 4UOJA 1JZ4A 1A1MA 1X4YA 4GKZA 1UWXK 1A3LL 2VQ1A 4YDKH 4LCWE 5E8OA 2WK2A 2BCKA 2D9CA 1I9JL 4OFYD 4L8SA 4KKAD 2BXYA 1BVLA 3KG5A 2AKRB 5DRWA 1IAKB 3PJSB 3DTXB 3PDOA 1T7WA 5J13B 4X83A 2A73B 4U05A 3JV4A 1T2XA 3DXAD 1K5NB 1IM9A 2NY1D 1V7NL 4LGSB 3FZUD 4TRPL 3L5IA 1DQMH 2LTQB 1ZHKA 2F8VA 3R1GH 1DQLH 5TF1L 1AP2A 1JF5A 3ES6A 3WLWC 1QR1B 1L7IL 4N8CL 1MNUH 1QKZH 1YUHB 3SOBH 1XF5A 1YNKL 2AGJL 1KNOA 1HNGA 1IEHA 5DD0H 5E6YA 1FP5A 4F7CB 1NC2A 3KYOA 5F9JA 5C6WH 4AK1A 1BM3H 3EKCA 4PJCA 4GAFB 3ARYA 4YHPB 4R90H 5DD5L 4FXKB 3ZKXC 2VE6A 1NCTA 1N5AA 2R9HD 1C5DA 4K7PL 4MA7L 3U0WL 1NCWH 4JFYB 4PJEF 4WWKA 5T3ZH 3O2DH 3M17A 3WSQL 3SKUD 2OTWB 4XGZB 3WIFA 1CK0L 3TVMB 3L5WB 3RWFB 3HE7B 4C56A 5E6IB 4OQTA 1IC1A 2WWKT 4JDVA 1NCAL 2EICA 4G9DA 3IJSA 5KTEH 1OWWA 3GMOB 5FO9A 5FGSA 5GSRA 3NCJH 1YEGL 3KPOB 7CGTA 4PRIE 1AXSB 4X98B 1JGUH 4S1DC 3GIVB 5H2BA 4OCMC 1U8QA 4WV1A 1CXEA 1Z5LA 4H25A 5HYJB 1WC7A 4EDWL 3LPWA 3RUGB 1JNJA 5CS7A 5E4EB 4D9QE 1HQ4A 2XWTA 4F8TA 2PYFA 4MZ2A 4JZOB 4PIRF 1HILA 4NM4H 1N6QH 2ESVA 1EZVY 2XY2A 4QHMA 3BUTA 5EPMA 3WFDL 3HNVH 5BZDA 1ONQA 1LO0H 3BKJL 4JO2H 2NTFB 5I1DA 4FP8L 3BQUA 4OM0H 2X05A 4JR9H 5DC0A 2AAVA 4UTAH 1YC8A 3NABH 3HS0A 4EJ1C 4IOFC 4KK9D 1ZHNA 1MJUH 4KKBD 5AZEL 2ZSWA 3JTSA 5FCUL 5CBEA 4OI7A 5MENA 1JYNA 4FTVB 3LKPA 2VISB 2JF1A 3V4VH 3D25B 1Z9MA 3IFLL 4RWHA 4XC1H 3BRFA 4XNUL 3MRHA 2CIIA 2A77L 1KN4H 3G6DL 3MV9A 3OR7A 5GRJH 2AEPH 3P0VH 4NZUL 3ARQA 1YEIH 4LRNL 5DA4A 5KZCD 2YRPA 1DR9A 2QKIB 1MCDA 2YZ1A 4XAWH 3UYRL 1MH5B 5BV7B 2AJVH 3CLFL 3QNZA 3NCYP 3ABZA 2G5RA 1GZPB 2YS4A 2Q76A 2FGWL 4YWGL 2DQGL 4K8RC 4GAYB 4LASH 5ISZA 3F12A 3DYPA 3QQ4B 2J3SA 4PJGA 4RAVA 1I9IL 3BJLA 5E1HB 1C7SA 3G5XA 3WEXA 3PQYA 5C09E 3RWGA 5INDB 4KKNA 4PRPE 4OI8A 1MCOL 3GMNA 4QKXB 5FYLD 2CLRB 2GHWB 3K81A 5TDOB 4C83B 5C8JA 5EZOL 2B0SH 3UX9B 2W91A 4XNXH 1CDHA 3NH7H 3CDYA 4H1LG 3VA6A 3VW3H 5T3XH 1FFRA 1HH9A 5JR1L 4FG6C 4ONHB 1NLBL 4HWEL 4LPTA 4F9PA 3HNSH 5DS8B 1TJHH 4WW2B 4ZFFA 1FNHA 2PTVA 1LEIA 1FFNA 3MSPA 2Z4QA 1OAQH 1RZKH 1AKJB 4GS7B 4YC2C 1VESA 4YR6A 2LAAA 3QO1B 4MNGB 3LN4B 4P5TB 4QRPD 1I9EA 1Y18B 3BQUC 3MBXH 2EZ0C 5FUZL 5ABDE 1IGJA 4JVPA 1WT5A 2X2YA 5CJ5A 4X5WB 4NIKB 2PKDA 2R4RH 4YAQB 4NWUH 4RBPH 3WJLA 4NWTL 1RU9L 3EO1B 1INQB 1E4JA 3NCEB 2HMID 3IU3A 5JDJA 3FO0H 2BSRA 4QOKB 4HKXB 1AY1H 3U4EA 1BECA 5AD0B 2G2RB 4M5ZH 1E4XL 3KGRA 3BPOC 1HDMB 5B39G 4JM2D 3ET9F 4UDTA 1ZLVK 1TQCB 4X6CF 3IAPA 4UV4H 1YY9D 1P9MA 4R9HA 1CE1H 3I50H 3UTZA 2DYPA 4Z95L 2NX5B 5GS3A 2DMCA 5DJDA 5E2TH 3DETC 2P48B 4P2OC 4KKLC 4HPOH 3PWPB 5IMMB 3L6FB 3X13B 4RMTA 4XPBL 1IQWL 4B7LA 4EI6A 5JUEH 5J12C 4OV5B 2HTLD 1R0AH 3DBXA 4KHTH 1J11A 4Y4HB 3QEGH 3KYNB 2HKFL 1NGPL 3WNMA 2XXMB 1RZFH 4OIIL 4H0GA 1QLEL 5EORH 4YX2L 5K59F 1D5ZA 5D1ZC 5D7JD 1JZ6A 4Y4FB 1XGTA 5D71L 3RX5A 3P9LB 5H35A 1LO2H 3EZ8A 1NCBH 3MBEA 4BFIB 3FQUB 3LQZB 3PE9A 1FE8L 5TFSH 2JTDA 3VFSB 5ADOL 4ISVB 1PY9A 3L1OL 2Y5TA 3WFBH 4DJMA 4H5SA 2I26N 3HI6L 5F8RC 5FKPB 2CDGB 1FLRH 4L3EA 3SQBA 4M00A 3MJ8A 3STLA 3RX7A 1S8DA 4ORGA 4W6WB 4LARH 4NQDE 4LFHG 2R39A 2A6JA 5B21A 3KPSE 3LB6C 4HMDA 3N50A 5HHVL 3RI5F 3IJHB 1EFXB 3GK8L 1WT5C 3FRPA 5SWZD 4JPVL 2CRMA 1UB5A 2UY7A 1MCWW 4KTEH 4ONFH 2GTZB 5F7FA 1NAMA 2WQRA 2VUYA 2ZCHL 5I2IA 3UPRB 5JHDE 3QCUL 1OT2A 4KTDH 5GSVB 3BWAB 3LZFL 4RGNE 4JM4H 5IROA 4LSQH 4EN3D 9CGTA 4TPRH 1YZZA 3CFJB 3DMMD 3V6ZB 3DHJA 4EKXA 3I3EA 2B4CC 4M8VA 2AJ3B 2BJML 1ZLSL 2D31B 5IEHB 1OOAA 1J1XH 5IB5B 1FGVH 4ZDHA 4MJIE 3GB7A 5SWSE 3KPPB 4ODWB 4U6YB 4R26H 3O6FD 1KEML 4DWHA 2NY6B 2FEEL 5F3BB 1EVTC 3GSXA 3X12B 2X4QB 1IE5A 1LMKA 1YQ2A 3QUXA 3G5VA 2X9WA 5D2NC 25C8L 4R3SB 5IHZB 1MCPL 2H6PA 4KHXH 2Q1EA 4ELMF 3HR6A 3MR9A 4WI3A 5T5NG 3U82B 3MNWB 1KXQE 4L4JA 4ZNEA 1L7TL 3EOAB 4AEIL 4P4RB 5CEXB 15C8H 4WO4C 1T5WB 1FNAA 1HYSD 3O9WD 4OZIA 3STBA 3C9NA 5D1QD 1MEXL 1NBVH 1QD0A 2JIXD 4CMMB 3P4MA 5DJ6A 3MCG1 3AAZB 1P2CB 3WDJA 4N1EA 3TA3B 1NJ9A 2HH0L 2VL5B 3KXFD 1UB6A 1UVQB 2IALB 1OGAE 2ZPKL 4P9HL 4OCSH 4L8CB 4S0TD 1HINL 3O8XC 5FYJU 3U48A 2K9UA 4UT7H 2X4OB 3RZCA 3WNPA 5ERWB 1OW0A 3B3IB 2VLMD 2FX7L 1R5VB 1FDLL 1W72L 5CJ8A 2MSPA 4JZJB 3DYOA 4MAYD 3O3AA 4HIXH 1EX0A 3QDAA 5DI8A 4ZAKA 3A6BL 2OS7A 3LS5H 4GMTH 4XXDB 4NPYB 2GJJA 1CTOA 3TC9A 1X5YA 1JPSH 2XT1B 4HS3B 2NNAA 2J2ZA 2C1PA 3CIQA 3ZHDA 1INEL 4XVSH 5SX5H 3BH9A 1T20A 3E0GA 1T21B 5FHBL 3KPNB 4XAKE 2BERA 5E8PA 1NAKL 5C6TH 1IGIL 5JXAH 5JORA 2Q7NA 5BOZG 4WU7A 5IHLB 3C6LC 4LNRA 7FABL 1N2RA 5I1IL 1D6VL 3FO9B 3VG9B 4Z7OE 2HTKC 4KDVA 2ICES 1WZLA 4BUHA 2PTTA 5F1IA 2NMSA 2FSEA 1DL7H 4PJ7E 1B88A 4NFDA 5C0NC 1FN4A 4NZJA 1BREA 2VZVA 3MRGB 4PR5B 5D7KE 1MRCL 3U0TA 1U95A 4TVPH 3H6JA 4OLUH 1DEDA 2XZZA 1F6AA 5D6DC 1ZA3A 3SGEI 1P4LA 1BFTA 1T0PB 5C0IB 1T04A 3BEWB 4K23H 4D3CH 2X4UA 1K4CA 1DTUA 3ARZA 4ODBD 1QFUH 4POUB 4XBPA 4OT1H 5C09D 2Z93B 4PRPD 3PABB 2R2HA 4XNQA 3EYSL 4ETQA 4F2MB 3IDJB 3JUZA 1KC5L 2DOCA 2ERJC 5EOCH 5TE6L 5MEPB 3BD5A 2NTSP 4ZFZB 4OZHA 1MPAL 4NUGH 1FYTE 32C2B 1CF8L 5I76A 3PP4L 2A9ML 4UT6H 1U8LA 2UYLA 3MJ6A 3RZCC 5HD8D 5F6HJ 4K7FB 1HWGB 4LDEB 3RVVD 3ZKNC 4F7PB 4XX1G 1P6FA 4OGXH 4P23A 1MCBA 1BAFL 4S11A 1GPOL 5DJAA 5GRUL 3TNNB 2W59A 1S7RA 3IDIA 5GZNC 2WBKA 2O61A 5E8EB 3O3UN 4O51B 3LPGA 4Q0XH 4NJAL 3G6JB 1IJ9A 4U1LB 2PO6D 2ARWA 1FZOB 4MNQA 1QSED 5CKGA 1RIUH 3C5SB 3H9SD 1INDH 2H1PL 3NFSL 2ADGB 2BNUB 3BH8B 1JGDA 4F9LA 1U8KB 5JXED 3QCVL 2ZOKA 5E99L 3MRRA 3QJHA 5LXGH 2VXVH 3P9MB 4F58H 4GMSL 1OVZA 4POZC 4D2NA 3R8BB 1JRHL 3ZKSD 1P7KB 1KULA 4HWUA 3FFCA 3UPAA 2EDLA 3EBAA 3CUPA 3NACL 2CK0H 2YD5A 3MV8E 2ZUQC 4GBXB 1FV1B 4HDIA 3DV4A 3FN0L 5SWQB 1MLCA 3BEVA 3QA3A 4YPGA 5GPRA 2QHRH 3U4BL 3UBXG 4KMLB 1ES0B 1GSMA 3TYFB 2DLTA 5HI3C 3L3OB 4IRSA 1NFDA 4PJFA 2YA1A 4HIJB 4LVHB 3SDXA 1R3HA 1KPVA 1T6WA 3K8MA 5AG8A 1P4IL 2DS4A 5HY9B 5CFHA 2R1YA 4YDKL 1F5WA 1RD6A 4JY6A 1AQKL 5K33A 5EC2B 3QUYA 1BX2B 4FNLL 3PGDA 3B9KC 4PY7B 3LEYH 2F53A 5IOPB 2NR6C 4BZ2H 1V5JA 3GJFB 4BQ8A 1OB1B 4TQEH 1JPST 4YJZL 4I9WD 3SGKC 5CD5C 1IAKA 4DCQA 4TTDD 2BNRA 2F54E 3DTXA 5HHQA 1XCQB 5FYJD 3DURA 2VZOA 4P23C 4EI5B 1RHHA 2DI8A 1OP3K 4X6EB 1U8PB 1N64H 1EEYA 3OMZA 3I3BA 1EO8H 4KI1A 3R1GL 4ONGH 4FA8A 5KAQG 4HJ0D 3MRQB 2EXWD 4X8JB 1MNUL 3SOBL 1OT1A 3B5GA 5MEOA 2H32H 2M1KA 2EDOA 4XMPH 2NY5C 4OF0A 1QR1A 1MCSA 2EC8A 4NSKB 4YUEH 5I75B 5A1AA 3L95B 4APQC 5JHDD 3CDCA 1I9RL 4JHWH 3ARDC 4LPXA 2J4WL 4RGND 4YHPA 4W70A 2W65B 5DR5L 4PP1C 1I85C 4Y19E 5T3ZL 1PEZA 2HT3C 3O2DL 2OTUB 5J3HD 1ZV5A 3BXNB 5DFTA 3O0RL 4ESKA 4JFYA 2Y6SD 3LQAH 3QDMB 5SWSD 4YDLB 4PLKC 1DUZA 1X5AA 2BC4B 3TVMA 3L5WA 1TVBB 5BJTB 3OAZH 2IG2H 3UO1H 3TZVB 3K46A 4NQCE 3HRPA 3MLZH 4LLMB 1KCKA 4LPWA 1JGUL 2EDDA 1G0YR 4Y8DC 5J8OA 4OKDA 2YSSB 3MRPB 2JB5L 4X98A 1LDSA 4P46A 3GIVA 3ARED 2FJGB 1RUMH 4NM4L 1N6QL 1AXIB 3MPCA 4DKFH 1C12A 1S78D 2AXGA 3HNVL 3SE3A 4FQXB 4JZOA 5DUMH 3QWRA 1ZS8A 1E4KA 1UA6L 2NLJA 4M6OL 5GS0D 1RURH 2EE3A 3KPRB 4V2BA 3S96B 4KKCC 4HH8A 3IFNH 3TO4A 2A74B 3FOLA 4OM0L 4XWOC 5GGQH 1I7ZB 4G8GD 1OGAD 2WZPD 2NXZB 3NABL 4FXGB 2QSQA 1AGFB 1HE7A 3BP6A 5EO0A 4BFGA 5J13C 4Q9QL 2DLEA 4G43A 1I3GL 3CSPA 4LPUA 4NUJA 1EMTH 5HDBE 2EDHA 1K8IB 2Z31B 4XC1L 1QVOB 1UYWL 4X6DB 1KN4L 3QZWG 3L7EB 2LTQC 2APXA 4HEME 1YN6B 1EUUA 5HHOE 3P0VL 5CJXA 4OV6F 4U4BA 3ZL4H 1JN6B 1YEIL 4NM8H 2NZ9D 3UEZA 5I30H 1KCSH 1EHAA 2Y72A 4MX7A 4ALAH 4Y88A 5C7XL 3LRSA 2D7PA 2BMKA 1UACH 2AJVL 2E8YA 3ARGA 4N0UE 3FKUS 4YXLH 5D5ME 4HX1B 2H26A 2EH7L 1KJ3H 4L8BB 1JNHB 3D18A 4D9RE 4P2QD 2UVEA 2CRZA 5CZVH 3D85B 2OK0H 2VR4A 4K2UL 4N90E 4G3YH 2D4DA 2CIKB 2YC1A 4GW4B 4R97B 3LKNB 1WAAE 4AEEA 2IANA 1AFVL 3TVMC 3BZ4B 3LHPL 1B0RA 3E3QE 2P49B 3HE7C 2VUOA 1CN4A 1JGVL 5E6IC 4S2SA 3WO3B 1B0GA 2CLRA 4PUBH 1KPRB 3D2UD 5IB3A 1CXLA 3BPNC 2CKBL 3LKRB 5T3XL 1ETZA 2BXZA 2UWEB 3FMGH 4R4BA 4AEHL 1G7PA 3GRWL 2OLDA 5DO2D 1FZJB 3HNSL 1TJHL 1G7QA 1MFCH 2OL3H 3MXWH 4LKCB 3AMKA 5DZNA 3P4LA 3FO1B 3W0WE 5I8KH 3GSNB 5E4EC 1KB5H 1T89A 2XKSA 5DS8A 3HN3A 1RZKL 1ZWIA 1A4KA 4HUKB 4RFNB 3SE3C 4HC1H 1QBMH 4WI2A 4HPYH 5L0QB 3HAEB 4QHNB 3LMJH 2FLRT 5EU6B 1FZKB 4KK5D 1FYTD 1P7QB 3LN4A 3BIBX 3SDAD 3VWJB 1S9YB 2VXUH 1Y18A 3BE1H 4NWUL 4XNYL 3VXOB 2P42B 5HHMB 3VD5A 5M95B 4GUPA 4HWBL 1MCCA 2NY3B 5CD3A 4IHOB 4JCLA 4WNQB 1NFIA 1KBGH 3VFGH 5DYOB 1AY1L 4U6XB 4ZXBB 1JTOA 1G7LB 5CMAB 43CAA 2P5WA 4H88L 5JDSB 3RWEB 4L29A 5KVGL 4HKXA 3F7VB 2G2RA 1J87A 4UV4L 1A7RL 4QRSA 3RNKB 4DUXA 5J1AA 1CE1L 4GO6B 5C0DB 3I50L 4X4MA 2D7QA 2NY0B 1JWMB 3AU1B 5E2VH 5E6ZA 3QEHA 1CXIA 1T1XB 4HPOL 5BV7C 1AO7B 1UG9A 3IF1A 2NW2A 1R0AL 3PWPA 3GI8H 4P59L 4QYOA 5C1MB 5GS1B 3QEGL 1RZFL 1A3RL 2HFEB 4HW6A 1DZBA 4PJBF 3HMWL 4Y4HA 5EORL 5LVEA 4MD5B 3RBSA 3DX8A 4JFEE 5DWUH 4Z7WA 4LSDA 1FL6B 3ZDZF 5F7MC 4M6ML 2JJSA 5TFSL 3P9LA 1UT9A 2W38A 1R5WB 4CW1A 2D7OA 4P3DA 3QO0B 5F7UA 4X9GA 5DJZB 3LQZA 3VFTA 4PLJD 2O5YL 1FLRL 3VFSA 1T89C 4OZHF 5J11B 3SPVB 4WW2C 3EO9H 4ISVA 3BKCL 4E9LA 3UYPA 5EIQA 3F7YA 5FKPA 2IADA 3FB8B 3VXMD 2FO4B 3UYOD 2P8LB 4XBEH 4V2CB 4KDTA 1KENH 1K2DB 3VE0B 4GS7C 2LE9A 3ZLQC 2VKXA 5ITBL 1DQJA 5JNYB 4P5TC 1HNFA 2J1KA 4KTEL 4HUVA 2VLJB 3IJHA 1EFXA 4ONFL 4GXUM 4GW5B 1DLFH 3K4DA 3LEXA 2VSCA 5A43C 2J8UB 2X40A 5FA4B 3BP5B 3V52H 3JZ7A 4LSQL 4KPHL 4PJ9B 4PJAA 4H20H 1I3RA 1HN1A 1WBXB 4TPRL 5I1EH 4DGVL 2WQ8A 2X70A 2IMMA 4NCDA 4ZUVA 5C0CB 5IIEA 4S1QH 3WV0A 1J1XL 4WUKH 3QG7L 3CFJA 1ZHBB 1M05A 5KW9H 3TBVB 4F57H 3V6ZA 1AR1C 4TVSa 4R26L 2VLRE 4I3RH 4U1MA 1QBBA 5IB5A 3BIKB 3GSOA 1S9VB 1TQCC 3IXAB 4ODWA 4NNXA 4DAGH 3O3BB 1UKQA 1WICA 5E24E 1EZVX 1IMHC 1MELA 4O58H 5T1MB 4H1LB 4JDZA 2ITCA 4QT5B 5E8DH 5LGJB 4Y19D 3U7YL 3ZKMC 5FHAL 4YHZH 2PTUA 2C26A 1RK0B 3EJYC 4PJ5B 5CEZH 1JPGB 1BF2A 4HKZA 15C8L 4K3DL 4U3CA 4Y4HC 1KEGH 2FX8H 4LLUB 4X5XA 5CEYB 3MNWA 4L4TA 4PJXE 5F9WB 1NBVL 3ARVA 3BW9A 4PTUA 1ZA6B 3CFIC 5CUSH 2X4SA 2EE6A 4Y4FC 2VIRA 4KY1H 1PBYA 4OCSL 3VRIB 2X41A 4ODVH 1Z3GL 1Y6NR 2NY4D 3TA3A 4O2EB 4UT7L 3E6FA 2QSVA 4P4KA 3MJ7B 2X44D 3T4AB 5AWNH 1WWAX 3MRLB 4LBEB 4RNRB 3QEQE 3RZWA 5C0BE 3ISWA 1R5VA 2FRGP 2X4RB 3VI4E 3HMXA 1EAPA 3MXVH 4DVBA 4GMTL 4PB0H 4HWZB 4M62L 5B39B 5J57B 1KELL 1JPSL 3BHBA 3BP4B 2GI7A 3QDGE 4NPYA 1SMOA 2KQMA 3ME0A 1MJ8H 3GI9H 4PRDA 5GJTL 2D2OA 5C08E 3K4ZA 2FJFA 1YN7B 3WJJC 1QRNE 1UXWA 2PW1A 3I84A 1A1NB 2UV3A 5L7XH 3OV6A 4QXUH 2G60H 1LO4H 4RBPK 4I0PB 5F1NA 6FABH 5C6TL 5JXAL 4WJ5B 3VCLB 1A6UH 5D1XB 3QI9B 3S34L 4E41E 1IM9D 4BSJA 5HHOD 5EFIA 3RI5K 4ELKB 1S9KC 2FEDD 1UC6A 1KCRL 1HXYA 2AJYH 1EERB 1A4JB 1CVRA 2X4NB 4JFFE 3QFDB 2VLKD 3ULVD 1CIDA 1SJXA 4OLUL 1S7TB 1RZ7H 1LK2B 5BV7H 5K9QG 2XFXB 4PGCB 3PWUB 1FIEA 4K23L 4LPVA 4GKNA 3D3VE 4NHUB 1QFUL 2I25N 2DJUA 4WUUE 2K3TA 3RKDD 1U8HA 2DWDB 1QFWI 1UZ8A 5HVHB 5E9DB 3D0VB 1PKQE 5MHSE 2W60B 4J8RB 3ARPA 3PABA 4JAMA 5EOCL 4LIQL 5HSFA 3RUGF 3WHE0 5IMLB 1TQBB 4NUGL 1CD1B 3DO7A 1F02I 4UT6L 2WP3T 4NZRL 1JHLH 4QHKJ 5D2LF 1I8IB 3WFEH 4L4VB 3L3IB 5KSAB 32C2A 2I60L 3CVHH 3RVXD 3W0WD 4OGXL 2XTJD 4Z7UA 3WUZA 2YZ8A 3HI1A 3R06A 3PG2A 4HULB 2VDOH 1QZ1A 2OQJB 2BFVH 2RAMA 4QRRE 4OTXH 4JZJC 1N4XL 1XGYL 2KZ1B 1GCFA 1ROWA 3R4DA 3WFCH 5FM4A 4Q0XL 2DIBA 4HBQA 5IBLD 2P7TB 2FR4B 1L0QA 3OL2A 3HPLB 5I1LA 4O51A 1RIUL 1INDL 3G6JA 4EUPG 1QPPA 4U1LA 3CDGA 2FECI 2CDEB 5IWLC 2NYYC 2OZ4H 3C5SA 5LXGL 2VXVL 1J88A 3BH8A 1FCGA 3Q48A 4OCRH 4F58L 2R8SL 4M5YH 4PRHA 4FQJL 3QIWA 2H2PC 1FBIH 1ACYH 3U83A 3ARBA 1QO3A 2DF3A 2B4CL 2C5DC 3GUTA 1I3UA 2CK0L 3OX8A 5I73B 1CLCA 3MRNA 4JQVC 3VG9C 5ITFB 3EYOB 3QCTH 4Q6IA 5C86A 1MCNA 1N5YL 2QHRL 3V79C 1CICA 1TXKA 4G9FD 1FV1A 3FQNA 2C4FU 5J89A 2W9LA 2NXYB 3DIFB 4NYLA 1HHIA 4U1IB 4LNVA 5ACMA 3DVNB 1ES0A 2WBWB 3L3OA 1IC5H 4AIXA 3QXWA 1CXKA 1MCLA 2AEIT 5JIHA 1G1YA 1I3VA 4PGEA 3OAUH 4DZBA 1II4E 1MVUB 4Y89A 3UTSA 3B2UC 2SEBA 1AD9B 3H7LA 4BZ2L 3QH3B 1X7QB 4YHNB 1BX2A 3V6FA 5BXFB 2ATPA 4Y1AE 4R6UA 4WW2F 4TQEL 5HTSA 4PY7A 1XGPA 5DJ8A 2JE8A 3BVNB 3KYMB 4Z18A 3GJFA 2R0KH 3DHMA 3P2TA 4ETYA 2EC9T 4PRNB 5CSGA 3AS0A 5HJ3A 4XHJD 1XGQA 4IRJA 1N64L 2IQAA 3TCLB 1BQLH 1XCQA 4JQXC 2V7NA 3OR6B 1OP5K 3C2SA 1MFDL 3LS4H 1R3LA 3B43A 1A14H 2EDWA 4KJWD 1SEQH 3DRTB 2F58L 1A3QA 4XMPL 3T65B 5IB4A 4QNPE 5ICYB 1I7UB 3BDXA 3CFKA 2DKUA 4Y4KB 5DHVB 3PWNB 3V0VB 5KZCB 3ELAT 3VFNA 1G7IB 2HG5B 4JQIL 3INUH 3PNWB 3QNYA 4HKBB 5AYUH 3L3JB 1HZHH 1YPZE 2P5EB 5SX5K 4X4XB 4YHLH 3FO2B 5L2KA 4X7TB 4CDGC 4G8EA 4AQ1B 4S1SH 4O2CB 3RWIA 3TT3H 1FL5A 3JWDH 1HHHA 4PFEA 1A9BB 3TCXA 4QO1A 4GBXC 5CSBA 2BC4A 1TVBA 4PGDA 3S3SA 4XP9H 3TZVA 4GRWE 2JKXA 2LU4A 1U3HB 4TUJA 5KSBB 4HCRH 2P4AB 5GISL 3M1BB 4LCUA 5E5MB 4LVHC 2YSSA 4LQFH 4NJ9H 1A0QH 2GCYA 3C8HA 4CJ1A 1CDBA 5DUML 1G7HB 3FQRA 3ZMRA 4BSWB 3SY0A 4R0LA 2GQHA 4CVXB 2B5IB 1FH5L 4N8VA 4FQXA 2ARJB 1VFOA 1LWRA 2WUBL 3IFNL 5GGQL 1T0MA 1R24B 4QRPB 2AQ2A 4UILH 3KPRA 5FO7A 3JV6A 4PBVC 1VGEH 4EBQH 1RZIA 2QQLH 3A67H 3QXDB 2AK4E 4W4OA 1AGFA 1VGKB 4W6YB 5IVZA 4RDQF 4EI5C 4UI2A 5E0QA 4U3XA 1JMZA 2E7LA 3WDHA 1EV2E 1CCZA 3D69B 2ICWJ 3BGAA 5T1DH 2E27H 4L3ED 4YFLF 5JZ7D 5AZ2H 4NM8L 5I30L 2PETA 4X6DA 1VENA 1EH9A 3L7EA 4LAJH 4XP1L 4JM2B 2IFFH 5C08D 1MLBA 1UACL 3UBXB 1X5GA 5DK2B 1IGYA 4YXLL 4AIZA 5I75C 1BVZA 3U1SH 1KJ3L 2WM0A 3TV3H 1Z9SA 1WCBA 4HH9B 4HX1A 3CC5B 4XPGH 2VYRE 3ARXA 4L8BA 4E41D 2OK0L 4MJ5B 1UJ3A 4NO0A 2DJSA 1MJJA 3JXAA 2E3VA 3MO1B 4JVUA 4OM1H 3RIFF 3QRGH 1S7UA 1PDKA 3KLSA 1PZ5B 3HUJB 3WN5B 4KDWA 2DDQH 4LLWB 4GW4A 4YDLC 3LKNA 1H0DA 3IVKB 3ZE2F 3RX8A 1B9ZA 4PUBL 1IFHH 4I18A 3HG1D 4Y5XB 5D7JB 3BAEH 3TZVC 5EU4B 2DQDH 5F7EL 1YEFH 3QIBD 3S35X 3FMGL 2Z8WC 4LHQB 1KPRA 4DK6A 5BRZE 3LKRA 2OL3L 3MXWL 2HFFB 1BIHA 3TYGH 4ZS6D 2C9AA 1FZJA 1WF5A 2VJXA 2DIAA 4N0FB 4HC1L 1QBML 1RZ8B 3GSNA 1Q9OB 4NKDB 1YMMD 3RVUC 3SEPA 4OF7A 3TT1L 3HB3D 3ZT6A 1S7VB 3LMJL 3O6LH 1ED3B 5BZWB 4E42B 1YEHH 2WWMC 4JFQB 4R8WH 4NZTH 3LCYA 3HC0B 4UNTA 4QHNA 3D87B 3BE1L 3GO1L 3VRJB 5F7DA 5SWZB 1FZKA 1RZJH 2NXZC 1AGEB 3IS1X 3OWEA 1P7QA 4HJJH 2V7HA 3VWJA 5GGUB 1S9YA 3CXHK 1LK3L 3MUGA 2WBJD 3HC3L 3VXOA 4U6TA 1KBGL 3VFGL 4NOBA 4ODUA 4QRRD 2E7LC 3IDMA 3DVGA 5EOCJ 5FGBC 5D7LB 3VFOB 3WD5L 4EN3B 4WNQA 5A40E 2Z31C 3MRDB 1W0WB 2JJVA 4TSAL 3TH4T 4U6XA 2FBOJ 4NDMA 4M61B 4ZXBA 1IZKA 1G7LA 4YFLI 5JDSA 5H37H 1IKFH 4PJEE 5DJCB 4DKEL 3F7VA 3O6FB 1SBSH 4LCCB 5TGBB 1IC4L 3QR2A 4GXVH 3ARFD 5C0DA 1JWMA 2X1OA 5EBWB 2FHBA 5GS2D 3VGHA 1T1XA 3WBDA 3GI8L 4JZNA 5F96H 2CLVB 4AH2A 1EAJA 5F7WC 1VACB 4AZ8A 3M8OH 3V5KB 1BFVH 1VFAB 1YNLH 4R97C 3C5ZB 1UM6H 4HIIB 2YPLB 3L3GB 4BZYA 1Q0YL 4OZFH 4YHKL 4FQCH 4OZGA 5D1QB 4M7LH 4YHMH 3L3KB 4MD5A 2AV7A 4RA3A 5TE7L 4OZ4A 2DTMH 4MHHG 5MI0B 1MFEH 1LDPH 3KXFB 3LDBB 4XTRC 5HGAB 1XIWA 4JO1H 2ZOLA 5D9SB 1RULH 4NQXB 3WFHB 4BKLB 2VDRL 4B41A 1KPUA 3EO9L 1W0YT 4FXLA 4XBEL 3SPVA 4RFNC 1KENL 4MAYB 4G80A 5IFHL 2M2DA 4GG6B 3QPXH 3OXSA 5EZLA 2W0FB 4UNVA 2P8LA 4I5BB 5L0QC 3VE0A 3VGAB 5DSCB 3UROR 1TZHB 4H8WC 1DLFL 3RA7L 4FHBD 3RU8L 3VWJC 3Q3GA 3T77B 1MIMH 2GT9B 4A6YH 4M8QA 2VLJA 5T1KD 3V52L 3BZEB 1VKXA 2VXTH 4XCEA 4H20L 4OLXL 3RWHB 2AI0H 5I1EL 5FA4A 3G6JF 2NY3C 3BP5A 2HRLA 3MRIB 5M7QA 4I2XE 2FECL 5DK3A 5T1LA 3MLTB 2N56A 3QXUA 1NGQH 1QRKA 1WBXA 4WUKL 5ALCL 4ZXBC 1RUAH 1N7MH 5C0CA 3CK0L 3EDJA 3B9EA 4B5EA 4G5ZL 3LN9A 3QWOB 3KLAA 4GRMB 2F5BL 4DAGL 1KB5A 3U9UB 4O58L 3IU4H 4MNQD 3AB0B 3IXAA 1X5HA 5E8DL 2NY0C 3QDJA 3EOTH 3GSQA 1U8JA 1A6WH 1CT8B 3MUY1 3BN9D 5CINH 4PJHB 4QT5A 2KDGA 3SJVE 2AJZB 3S8WA 5LGJA 4ZFOB 4PTTA 5CEZL 4P2RE 4HZLB 4NN7C 1KEGL 3S36X 2FX8L 5GS1C 2QJDA 3E1F1 4UU9B 3VD4A 3SE8L 4AMKH 4DGIH 2IPTH 3Q5OA 5BVPH 2DL9A 3U6RA 5I74C 2J88L 1LNUA 2DJ4A 1I1AB 4KY1L 5ESVB 5EUOA 1TTFA 5LGKA 1T7XA 2LABA 1ZA6A 3VA2C 3REVB 3SKMA 5I15H 4NBYB 1JPFB 5AWNL 4KVNL 1Q1JL 3NCFB 2VERN 1MI5A 4O2EA 1KN2L 4OB5H 3GSVA 4OD3H 3B2VL 3MGTB 4PJIA 1CFVH 1F3DJ 3RWJA 2ATKA 3MXVL 1E6JH 4KWUA 4PB0L 4D0DB 4HXBH 5J1SC 2D03H 3DWTA 4LVOB 4E5XA 2QSTA 1CE6A 1G7JA 2ORBH 4HWZA 1MJ8L 3GI9L 5B39A 3QUYD 2PO6B 2DKSA 2ZUUA 4LSTH 3BP4A 1QSEB 3H9SB 1A6AB 1FQ9C 3JV5A 4NFCA 2BVOB 2KH2B 1ZLUH 2PCPB 3SDDA 2G75A 3CFBB 4X6CE 4BK4A 2G60L 1YN7A 1AE6L 6FABL 1KLFA 2BNRD 4PJ9C 1A6UL 1RJYA 3BZDA 1BD2A 4I0PA 5FUOL 4DTGH 5GS0H 1K4DB 1SM3H 4Z5RB 1C7TA 1HH6B 1LEKB 3CU1A 3MRCA 1JL8A 1IAOB 2QTEA 2GTWA 5KJRH 4ELKA 2BOBB 2AJYL 1NKRA 4L1HA 4P5MB 2ADIB 2AJUH 2V5MA 5T3XE 2X7LA 3QG6B 3RIAF 1AI1L 1FVDB 5EU7C 2YHGA 3R0NA 5JW4R 4QHUB 4MXWH 3OKDA 1H8NA 1GVIA 1WWBX 3OPZH 4M7LT 4U33A 5CIPB 3QFDA 3RAJL 4KXZH 5BV7L 4FRWA 1CIUA 1DSFH 3IETB 3VXUB 5HGBB 3Q2CA 4GKOA 1CZ8L 1LK2A 4LDLB 2X1XR 3PWUA 4OUOA 1J8HD 2Z91A 1VFUA 5LBSL 4NHUA 4Z7VA 2XN9A 3DGCR 1NGYB 2A9NH 5DQDH 3RPIB 1IAII 5FCSH 4J4PD 5C9JA 5IT2H 1KJMB 4XH2A 4J8RA 2WMPA 1JHLL 5IM7B 2WINB 4ZUWB 3WFEL 4XVUD 5IMLA 1FVCB 4D8PB 4OFYA 1ZVSB 4E0RA 3CVHL 2N1KA 1HEZA 3HLAA 4X7FC 2ZSVA 1NUDA 1YDPB 3L3IA 1CBVH 1T1YB 5EU5B 2HJKA 3QWQB 5C0AE 1KLUA 4OTXL 4JJ5B 2G9HB 2JJTA 3O3DB 3EUUA 5IB1A 3WFCL 3DXAA 3O2WH 5I66B 4MLIA 3W81A 1CL7I 1U8MA 2R0LL 2MQ0A 4OCLC 3VXTB 1YMHA 4UB0H 2DBLL 2OZ4L 3QFJD 3C60D 4KI5C 2FD6H 4N0YH 3TO4D 3SCMA 5DLMH 3TFKD 4JRYE 2VABB 3T8XB 3ALWA 1WWWX 5H94A 3ZTNL 4M5YL 2M26A 4NRXA 4ENEC 3MC0A 1FBIL 2YEZB 1ACYL 4IIQB 4I0PC 4X7CC 1F4XL 4B50A 4PP2B 5D1XC 5BS0D 3QI9C 3ILPA 4EUPH 4ELME 2E9IA 1DQTA 4V1DA 4DW2H 3QCTL 5K9KB 1XR8A 5FM5O 4P9MH 2P24B 5ID0A 3W9DA 1X6LA 3MLRL 1HSBA 1I8KA 5DF0A 3I02B 3ZTJG 3V5DB 4BELD 3G5YB 5HVFB 1I7RB 1JZ5A 2YD4A 4NKQB 4NT6B 3ARGD 1IC5L 1SYVB 2APTA 3RJDA 1MFAH 1ZEAL 4GXUN 1OTUD 3AREB 1OAUH 3PL6D 2GKIA 2Z35A 2MQ3A 3FOMA 2UWEF 2Y5EA 5HVHC 2FH8A 1MVUA 3GDBA 2G5BB 3NIFF 4QCIB 4HKJB 1T22B 5C3LD 2MNUA 4CUCA 1AD9A 4K9EH 4MXQD 4NQTA 2R0KL 1TQBC 2XNAA 3GMLA 1YECH 4KKAC 4G8GB 4Y16D 3OGCB 1R5IA 3HCVB 1XF3B 3BVNA 1LEGB 5HVGB 5KSAC 1U2HA 4YIQA 1KJ2H 4PRNA 3PHSA 4JFOA 2NW3A 4HGWB 5DDHA 3D39D 4GW1B 1F3JA 1QNZH 3BGMB 3NFNB 4Z78B 3FZUC 1G9MH 5DUBA 4GAGL 4LRIA 5FO8A 2AEWA 1CFTB 1C1EH 1T4KA 4BH8B 1JWSB 2DLIA 1KXVC 5ICYA 1TZIA 2IPUK 1GJIA 3G9AB 3FB5B 4QLRA 5T3ZD 5DHVA 1TDQA 1DBKH 4FQ2L 1X5ZA 2HG5A 5EIIA 1FPTH 3EZJB 3FTGB 3L3JA 1N59B 1QSFA 2R9HC 2EKSB 1CR9H 4P2QB 4S1SL 1G9EA 2A6IA 3JWDL 4M6AA 3RHWF 5I73C 1J0HA 4YDVB 4F15B 3BP7B 3GMRA 2GFBB 2X9XA 5I8EA 2C4XA 1A9BA 4YHYB 4XP9L 3IDXL 4YHIA 2IH3B 4WGVB 3N06B 4HCRL 3D2UB 2NXYC 3TH3T 5FFLA 2YBRB 1Q9LA 2ESVE 1MIEL 1FGNH 1V3KA 2VOTA 5KSBA 4LQFL 2PN5A 1YEEH 3F7RA 4HK3J 3OHXB 1A0QL 1DEEB 2A6DA 3I75A 3AS2A 2OR8A 3K80A 2BVPB 2X9YA 4MB5A 3PHOA 4Y5VC 1EJOH 3N9GL 3IRZA 4XPAL 1P7HL 3VMOA 3QYCA 4BSWA 3UTTD 4YLQT 1UWXH 4UILL 1MHHB 4JFDE 4G6AD 4K3GA 5BMFH 5HHPB 1VGEL 3B8SA 2IPKB 3FHQA 3S36H 4QRPA 2QQLL 4YNYB 1DVFB 2X10A 3ZSTA 3QXDA 4KK9C 1GOGA 4GLRH 4KQ4L 3IKCB 4KRPD 4W4NA 5T1DL 1VGKA 2E27L 3LKOB 1OAKH 5AZ2L 1CVSC 2J8UF 3D69A 3SQOH 3JTTB 4O9HL 3CFDB 2GJ6D 3PWJB 5E1AA 1M1SA 4Y4KC 1AGDB 3U1SL 3FN9A 4M1DH 4JFZH 3HHRB 1TFHA 3TV3L 5HGGS 5DK2A 2FJHA 3AUVA 4J12A 3FQWA 5I1CL 2DAVA 1M71B 4XPGL 3OJDB 1LD9B 2IMNA 1JYWA 1QBLH 2VDLH 1RIHL 3EO0A 3PQYE 4OM1L 4BQCA 4NQVA 4HH9A 3QRGL 3SKNB 4X6BB 3CC5A 3RGHA 5F72S 3IXTB 4X4ZA 1W0VA 5FUCC 2YPKB 4MJ5A 4TNVF 4LIQE 5FECB 4HWNA 5GGVY 2QSCL 4FFVC 1MWAB 5T3XD 3DX6B 4JY4B 5GHWL 3PV7A 3WN5A 4PJDA 4N5EC 3BAEL 1UWEH 5F9OL 1YEFL 2GUOB 4D9LH 1T5XA 2VL4A 5C0GB 5C2UB 1PG7H 4YH6A 4C58B 3FCTB 3QUZD 4M3KB 3G6AB 1U3HC 3M45A 3U36B 1A6TA 3TYGL 3ULUC 1CLOH 5DHYB 3T1WA 4I48A 5FM8A 2PYEE 2B20A 5D4QA 1OM3L 1U2CA 4WFGE 3TJEL 3VXMB 3MYJA 3NIDF 5HXMA 1RZ8A 4YQXH 1JHTB 3WE6A 2B5IC 4R8WL 4L4TD 4NZTL 5DK0A 3GSWA 3MRFB 1P1ZB 4TUOB 4NO5A 1H5BB 1RZJL 1AHWB 3WIHH 4HJJL 5CP7A 1DDHA 3OGOE 3TBSB 4ZMAT 2Y07H 5C0AD 4U7SA 4XZUB 1AQDB 3MCLH 4P4KD 4BQ6A 1I1FA 2AJSH 4ORZC 4G6MH 4TOYH 1OAZH 4KI5F 4J1UB 4WEBH 1NSNL 2XZAH 2ZNWA 3O4LD 1F4YH 3WXWH 4M9OA 5K93A 1W2KT 4EN3A 5IG7A 5TQ0L 3MRDA 2HN7B 3KPMB 1W0WA 3DMMA 1QEWB 1Q9WB 3UP1A 4O5LL 1H3GA 1FO0H 5C0RH 2QEJA 1NCDH 1OSPH 5D2NE 4JM2C 4AYFA 5JMRA 2CR3A 5IHUL 4JO4L 4GXVL 1YY9C 3O6FA 1FFOA 1TJIH 5TGBA 4ZSOB 2IH1B 4MXVF 4DFIA 1NFKA 5IK3B 5EU3B 4K7PY 4LEXH 1HK6A 5F96L 4JY5L 3ARUA 3M8OL 5D72H 1BFVL 1TPXB 3W11D 5CSZA 3NFPA 3AS1A 5IJKC 2HTLC 1UM6L 1GGBH 2EO9A 4XWGH 1VFAA 1LO3H 2X4TB 4FQCL 1QLRA 3MRKA 4HIIA 3KWWA 1RJLB 2DTML 3PGFL 3O9WA 4Y5XC 5D7JC 3SBWA 5D1QA 3ZDYF 1U8IB 2JIXA 1A22B 3S88L 1CG9A 1UCTA 5DQ9A 1R3IL 1IAIL 5T33L 1RULL 3DVIA 2NY4B 5DD6B 3RIFK 4PRIA 3KXFA 3P73B 5I1HL 1S5IL 3WNKA 2J6EH 1MHCB 4NKMB 1KIRA 5D9SA 2DTSA 4OCWH 1O7VA 4A2MA 5F9AC 4JREC 3JWOC 3W2DH 5JPMA 3NBNA 5L8KB 1G6RB 1OARH 3MODH 3MV7D 1EK3A 3QPXL 4QTIH 3BO8A 3AXLB 3QZWA 3VD7A 1NC4A 1WJ3A 1MHEB 2HT2D 4U6VH 2XKUA 1NDMB 4GKZB 1F45A 1FFQA 2VQ1B 2W0FA 4IOFD 4I5BA 2X89D 5E8OB 4PPTA 3BWUC 1TZHA 4L8SB 2EYSA 3OKYA 5FGCB 4I4WB 2MQCA 1IGTA 5IFJA 5D70L 2GT9A 1I9JH 2MTPA 1N3NB 3SKJH 3BZEA 1JZ3A 4MWFA 3DI2B 1NGQL 2R2EA 3DV6B 4RGMB 3MRIA 5DZLA 4EN3C 1N7ML 1EJ6A 5EZJA 4RMVA 5HPMA 1IM9B 2OM5A 1FNGA 4LMQI 3IB4A 5FA3A 3CSYB 4MLSA 5JW5B 3C8KA 1V7NH 5F3HA 1KGCE 3ES6B 3IU4L 3ZT5A 4TRPH 1OTTD 3O6FC 1XF5B 4GRMA 4LCCC 4WFHE 1ZLVH 3IJYA 1SMAA 4ACPA 2VZSA 2VLKB 5F89B 1KLGB 2BHUA 1NC2B 5LGHH 4YE4H 4UQ2A 5F9JB 2Y36H 4PJCB 4F37F 1D6EA 2VE6B 1K3IA 4PRHD 4OZIE 3QIWD 1N5AB 2VMFA 3JVGC 3LPFA 1C5DB 4WHCA 1GH7A 3IDNB 4AMKL 4DGIL 3U46A 2IPTL 2Q3ZA 3SO3B 5BVPL 4WWKB 3C5ZC 4LSSL 1BBJA 5C09A 3WIFB 4PRPA 4FG6D 1MRFH 2KBGA 4C56B 3WSQH 3IDGA 3VH8A 1XF1A 1CICD 4JDVB 4DN3H 4HK0B 4G9DB 1V8HA 3IJSB 3S37X 5MI0C 1NGZB 3LDBC 5FO9B 4R96A 5GSRB 4QRTA 1H9VA 4N8PA 3ULUH 2XTJB 3B5TA 5H2BB 1U8QB 1E6JL 1HQRB 1Z5LB 4WV1B 4H25B 2ENSA 2VB5A 4HXBL 2D03L 5J6HA 4MAYC 1HQ4B 1OAYH 2XWTB 3CX2A 3K0WA 2PYFB 4F7TB 3V7AG 4NN6B 1HILB 1NANI 1FNEA 1FNLA 4JFDD 4LSTL 1JJUA 1M7IA 2CSPA 2RGSA 4QHMB 2X42A 5JO5A 1X6NA 3GHBL 5BZDB 3VGAC 2X1PA 2PO6A 3ALPA 1ONQB 3L5XH 5B4MC 5I1DB 5KG9B 3PGCA 4WVRA 2BVOA 2GK2A 1Q72L 3BKJH 2YWYA 3MOQA 1EEQA 2RFXB 3HS0B 4W81A 1VADA 4FP8H 2F15A 4IRJD 1ZHNB 5I19L 3ILQD 1SM3L 2ZSWB 3JTSB 5CBEB 4OLWH 1GIGH 4M7ZB 5MENB 1FORH 4U1NA 3LKPB 4KUCD 4DKAA 4YO0A 5DUPH 5AZEH 5FCUH 2AJUL 3CJJA 3LSOA 1LEKA 3V4PL 4L8DB 3MRHB 2JJUA 4P2OD 4KKLD 3MV9B 3OR7B 4PJBE 2ADIA 3IFLH 4MXWL 3QG6A 3OPZL 4G9FB 3AB0C 3DPBA 2H2SD 3HKFA 1FVDA 2DD8L 3O11A 4K94H 1DBJL 4ZO7A 1DSFL 1U3YA 4X7SH 5CIPA 1DLHA 1JV5B 2VDKL 1OQXA 3QNZB 3ZDZE 1OCWH 5HGBA 3UYRH 2O5ZH 4A6YA 2A9NL 5DQDL 4CNIB 2VN4A 2OR9H 3OKKA 5ISZB 3QEUB 5JW3L 4MCYA 4OZHE 3ULUF 2FGWH 4ZO6A 4PJGB 5IT2L 4JFPB 5D6CA 3WEXB 3VFWA 3PF2A 2C1OA 3RWGB 1DBBH 1I1AC 3KHOA 3GMNB 4PREA 5IM7A 2Q86B 5C8JB 1X5XA 1XR9A 1H3PL 1MCOH 3J7HA 1FVCA 1CBVL 1ZVSA 4MA3A 5TH2A 1I8LA 3VGFA 2EEAA 3VMPA 4N0CC 5EZOH 3LB6D 2VTFA 4R7NA 1TITA 1HH9B 3S35L 5B8CA 4WFGD 5IMOA 1T1YA 3UTPE 2MKWA 3V0WH 4XMKH 4ZFFB 3MV11 4NRYB 1LEIB 2I5YL 1FFNB 2XOTA 4NQDA 1FZMA 1NLBH 4HWEH 2Z4QB 4LVOC 4Z9KB 4J3WA 1X4XA 1C16B 3KPSA 4UB0L 2F9BT 3MMEA 3VFRB 1BBDH 1JZ8A 3KAAA 4JEGB 1U6AH 2PO6C 3VXTA 2B2XH 5DLML 3U7AA 4WCYL 1G7MA 2ZUSA 3DSFH 1IGJB 1LO5B 2OYPA 3GJFK 1BWWA 5HDQH 3K7UA 3VXNA 5JXEC 3FFCE 5JHDA 4UOW0 3LD8B 1D5XB 4DK3A 4JM2F 1GGUA 1NEUA 3CXDH 4HUXA 4QRQA 1S5HA 3NVQA 4BFBD 3IU3B 4FN0A 4PP2A 4NWTH 4P9ML 3FT4A 4EDXA 1T66D 5A2FA 5SWSA 1KYOK 3SDXE 4UDTB 3WHXB 2AQ3A 3WS6C 4N9OB 4N9GB 3HUJF 4U6HA 2QQNL 1I7RA 1SEBB 2PNDA 3Q0HA 4NT6A 3UTZB 2DYPB 3WYRA 4WO4D 4MMXC 4LLVB 5DJDB 1OAUL 4BFEA 1FC1A 2FIRT 3C8DA 4EI6B 4Z95H 4L3CA 4LGRB 3RIAK 3DBXB 2B1HH 2JK5B 4XPBH 4CU7A 1IQWH 5HYQB 4NNYA 3O8XD 4ZD3L 3DGGA 3V6OC 4HUNB 4QCIA 1YECL 4UZGA 3CCHA 5GS2H 1CD9B 1WBYA 5KAQF 2HT4C 1NGPH 1XGTB 3UJIL 1YQVL 1MAJA 1QLEH 1I8LC 4LLQB 4G8GA 1OGAA 1KJ2L 5GJSL 3RKPA 4WTZG 5H35B 1CGVA 3U2SA 4BSVA 4TTDC 3MBEB 2VWEC 1XF4B 5IJVA 3DRQA 3UDWA 2Y5TB 4HGWA 4H5SB 1AD0A 1QUNA 3V4UH 4L3EB 4GW1A 1D5BA 5ADOH 4HJ0C 1S8DB 1W8OA 4GFTB 4ORGB 1UEMA 4DZ8B 3VFUA 1CFTA 2VDMH 1MCFA 4BH8A 5B38A 1XEDA 5DQJB 4AEFA 3QPQD 1DBKL 5FK9A 1TVDA 4JPWH 1FRGL 1ULVA 2OJEA 4XPFH 3VFMB 2ZUVA 1VPOH 2XTLA 1FPTL 1MY5A 3C6LD 5HHVH 3TH2T 1BJ1J 2BVQA 4O02L 4IIQC 1CR9L 1A6ZA 1T1ZB 4JPVH 2HTKD 3FTGA 5JMOC 1BVKB 4BQ9A 3GMPA 4HMCA 2V5YA 2EKSA 1WBZA 1RUQH 3UBXI 2VZ3A 1JFQL 4LLAA 5J3HC 4P2QA 4XVJH 3ARRA 2AXHA 5EA0H 1WIUA 3VWKD 3NIGF 2Y6SC 4ERSH 3VDCA 4WI5A 4ZDHB 4QF1A 3MGOB 3GB7B 3HG1B 3BP7A 3I3DA 2BJMH 1HIMH 2F8OA 3DNKA 1CU4L 4X5LA 5HYJE 3DECA 4P3CH 1FGNL 3RUGE 3D2UA 5I1JH 1YEEL 1RK1A 3QUXB 1KYOJ 4RMQA 1TMCB 3QXTA 1P69B 1Y0LB 1NMAH 2H6PB 3OHXA 1DEEA 3AREC 3D48R 1RIVH 3MR9B 3HZMA 2BVPA 1YMMB 1MCPH 1S78C 4FQIL 3QIUC 5JTWA 3EDDA 1SVZA 4OKVA 5HHNB 4IDLA 2Y9RT 5BMFL 4HS6A 2OMNA 3CX5K 1IILE 3S36L 3C9NB 3ZKND 4EUPA 5BW7C 2IWGA 1LE5A 1FYTA 4KROB 4B0MM 3SDAA 4GG6F 5GZND 1MEXH 4FTVE 4P5KB 4D0CB 1BMGA 3VXRD 2WBJB 4OGZA 4YNYA 5IP4A 4ZUTA 3DX9B 1XIWD 4JPIA 4LHUA 3SDCA 2FB4L 2HH0H 3UDWC 2KZWA 4XMLL 1ZT1A 3DUUA 1OAKL 1KACB 2IF7A 2ZPKH 4P9HH 1OP3H 1WGOA 3CSGA 4GRWH 2XIDA 1JPTH 1JNLL 3O3AB 2FX7H 3QJFB 1FDLH 1W72H 5DI8B 4ZAKB 3CFDA 4M1DL 3H7BA 1ZMYA 5I1AB 4POZD 3WNNA 2NNAB 3VG0H 5KANI 4UQ3A 3QXAA 3ARFB 5IVOA 2VDLL 3OXRA 4Q9RH 4OD1H 3R8QA 1FLTX 4X7EC 4JFHD 4OUUA 1KV3A 1T20B 1LD9A 2W92A 5T1LD 3SKNA 4WI4A 1FNSH 5JORB 1HI6A 2WNGA 2MFNA 2YPKA 4LNRB 5FECA 1UWEL 4F15C 1N2RB 1NAKH 2EDXA 4PJHF 1IGIH 1MWAA 3MV8A 3DX6A 3MLSL 4X0KA 1PG7L 4YHYC 5F7LB 1M6OA 1UCBH 7FABH 3MROA 1D6VH 4P2YA 4F33A 2HRPL 1FN4B 1CLOL 2Q6WA 3QDJD 2XZQL 3QUMH 3G5ZA 5E5RB 3U36A 5ESQA 4G8FB 1U95B 3RHWK 1F6AB 3N1MC 2EC9U 1N0LA 1ITCA 1T04B 2X4UB 4MNGE 1K4CB 5FXCH 1J9CT 2VR9A 3VXMA 2D9QB 4XBPB 3CAFA 5C07D 2R2HB 5ICXB 2EIZB 1V05A 4XNQB 3WIHL 2HFGH 4HZAA 1MREH 5JOPE 4PV8A 4TUOA 1KIQB 3VXSD 4YPJA 3EYSH 5T1KB 1DVFC 1C8PA 5I76B 1U41A 3MCLL 1KC5H 1U8LB 2UYLB 4QOKE 4G6ML 5TE6H 3CX5J 3IDYB 4TOYL 4WEBL 4OBRA 1T2QL 1F4YL 2O93L 3PP4H 1AQDA 4BYHA 4OGYH 1IAMA 4MA8H 5A2KH 5A2IH 5FOBB 1RHFA 2EIEA 2MHAB 3WO4B 5J7CC 5M94B 1S7RB 3IDIB 3RY6A 3TLRA 5SV4A 1YJDC 1OSPL 1BAFH 3GSRA 5GRUH 3SHSA 1EFQA 4KUZH 1EHNA 2NX5E 5I1GH 4PP1D 1TJIL 4MNQB 3PWPE 5DC4B 1MCHA 2HT3D 1CGSH 4JHAH 4KK8C 3ARTA 4K3HA 4RWYL 1AGCA 2DI7A 3MRMA 5D72L 2ZOKB 2H1PH 3QJHB 3BKMH 3MRJA 4Y19A 1N26A 3PHQA 1BD2D 2DM3A 4XWGL 4HLJA 4KZDH 4Z6AT 3KLDA 4HUUA 3KS0H 3CUPB 5AUMB 3TBWA 1BQHA 1RJLA 2HWZL 4HDIB 5E94B 3DV4B 4ZOEA 4YPGB 1XGUA 1BOYA 3DROA 2BX5A 4DOHB 2FNBA 2J6EL 5DD3H 4TNVK 4OCWL 1AC6A 1DUYA 4RX4A 4MDJA 4IRSB 1NFDB 1MHCA 4PLJC 4NKMA 3W2DL 3T0BA 4NQSB 4PJFB 2QHLA 1R3HB 3T1FB 1KPVB 5I1KH 5E5UB 1ZSDA 2C7UA 2R1YB 2XN9D 1BOGA 1WITA 1IEBA 4JY6B 3BRGC 1P4IH 3QUYB 1NDMA 3F8UB 3PGDB 1H5BC 1AHWC 4Z7QF 4KZEH 2F53B 3I6GA 2LV4A 2YK1L 1AQKH 1N8ZA 5IW1A 4FNLH 3SKJL 4XP4L 4JFXA 4I4WA 1RUKH 3T0ED 4DCQB 2BNRB 1N3NA 2AJXL 5HHQB 3DURB 3DV6A 1RY7B 1RHHB 3IDUA 3RY6C 1EEYB 3MFGB 4ZPTA 5HHOA 4PD4K 3KJ4C 3CSYA 5JW5A 5MEOB 1BEYL 3ZE2E 2BNQD 5LGHL 4YE4L 5CEZD 2HKHL 1G84A 1GOHA 2Y36L 3F5WA 4N0UA 1RJCA 1WVZA 4MQSB 3SCMD 4DKDC 5F89A 2VLKA 1J5OH 1KLGA 1P5UA 5DMKB 5E00A 1IEAA 1L0XA 1TPXC 3HE7D 2OSLB 1CDGA 3OBAA 1A64A 1I9RH 2IBZY 1J8HB 2Q7YA 3IRPX 2J4WH 4FQQA 1WAAA 3IDNA 4MD0A 1XAUA 4MB4A 5KVEH 5DR5H 3S9DB 4V1DD 1DN0A 5I17A 1MRFL 3BRDA 2VNCA 1DUZB 1LGVA 3SN6N 4DN3L 2YUVA 3O0RH 5EOQH 3Q5TA 4M1CC 5D7SL 3PIQA 4XP5L 3SGJC 1N6UA 5HPOA 4HK0A 3H9HB 3ULUL 2NY4C 1J0IA 4RRPG 1FO0A 1NGZA 5ETUB 1EBPA 1UXSB 2JB6A 2JCCB 3W0WA 4XB7A 4P46B 1HQRA 1OAYL 2VZUA 3W39A 3GBNH 3X14A 2JB5H 4F8QA 3GBLA 1C12B 2AXGB 4F7TA 1QFOA 1ZS8B 5C70A 2NLJB 3L5XL 1J7VR 3UMTA 2NQCA 3QFJB 3C60B 3CVIL 1WWCA 1VA9A 3TO4B 3FOLB 4L8SC 4P99A 2CLZB 2FL5A 1UA6H 4M6OH 5GRXG 5KG9A 3MA9L 3MLXH 3BP6B 5EO0B 2YKLL 4OLWL 4G43B 1GIGL 2RFXA 4RGMC 1PLGL 1FORL 4NUJB 4JANA 4TSBH 5BS0B 4Q9QH 1GZQB 5DUPL 3CDFA 1I3GH 4YBHA 3O3EA 1HSAA 2FEDC 1U3ZA 4LCYA 3C5JA 5FF6A 5SX4I 5C6PB 4PGBA 4WRLA 4B53A 2KL6A 4L8DA 2A0LC 1UYWH 3PDDA 4K94L 3CH1A 4MX7B 2ZJSH 4X7SL 4ODHH 4S10A 3ULVC 4G9FA 3LRSB 1OLZA 5DTFA 2BMKB 3ARGB 5IHBA 1OCWL 1JF1A 1B2WH 5C7XH 2H26B 2CQVA 2O5ZL 1JV5A 1QSFD 1TIUA 2OR9L 3D18B 2AXFB 2E6QA 2EH7H 1U8NB 3SO3C 4CNIA 4WWKC 2YC1B 3QEUA 3EFFA 3P30L 1DBBL 2IANB 1GGCL 2HP4A 1PZUB 1EHXA 3WXVH 4JFPA 4K2UH 4XI5C 1B0RB 4JFEA 3KDMA 4G7YH 5L8JB 2FO1A 3OKOA 4F37K 4S2SB 1AFVH 1EIBA 5I8CA 4YBLB 4K3JH 2D7NA 1B0GB 4QWWD 3LHPH 3NZHL 2OTPA 4KVCH 5IB3B 3H3KA 2Q86A 1JGVH 5DMIL 1ETZB 2K7PA 4R4BB 4OJFH 1G7PB 3RVXC 2D4FA 1KFAL 3CFCL 3V0WL 2XTJC 4XMKL 2CKBH 2AK1L 1AJ7L 1G7QB 4WV1C 4LP5A 4AEHH 4P5TD 4HV8B 3D39B 3G6JE 3GRWH 4K7PX 2YXFA 1ZWIB 1A4KB 1BBDL 4NRYA 1U6AL 3S5LA 4NQED 5JOPD 2B2XL 1C16A 2ICEA 4ODSL 5DEZA 4MS8D 3VFRA 4LU5H 3UZEA 3DSFL 5ID1A 1Q94A 4LSPL 2L4OA 5HDQL 4QOKD 1EXUB 2GSIA 1LO5A 2GITA 1AR1D 3CXDL 4PLOB 3S3PA 4GUPB 3LY6A 4XNYH 1NPUA 1D5XA 3HE6A 5DJYA 5KOVC 5CD3B 4CL7A 4JRXD 3VDBA 1NFIB 2P8PA 5CWSA 4HWBH 3MJ9L 5FM5M 4RFOL 4JE4B 5GGTL 1J1OL 43CAB 3L7FA 2P5WB 2AVGA 4L29B 3QBTB 1ZVYA 2V2WA 1GC1C 4H88H 5D96C 3ZKMD 4QRSB 4EQ3A 2R0ZH 5KVGH 5DMJB 5J1AB 3WHXA 1GOFA 2HLFC 5E7BA 4N9GA 1A7RH 3NZ8A 3QEHB 4LLYA 1SEBA 4BH7B 2CDFA 2J7LA 5EZIH 5KS9B 5ANMB 4LLVA 3IF1B 2XWBA 2NW2B 4Y4FD 2B1HL 4QYOB 1YEJL 2AERT 1ZE3C 4Y8AA 3EW3B 4OFIA 1IGCL 2W9EL 4PS4H 2JK5A 1X9QA 3UTTB 2R0WH 2X1WL 4P59H 5HYQA 4KRNA 2CMRL 1JUFA 4PLNC 1V3LA 3EYQD 1A3RH 3DX8B 4UINL 3HMWH 4JKPH 3SGEH 4Z7WB 3BSZL 1MCRA 4LLQA 1A02N 4XHJC 4CW1B 2LVCA 4P3DB 3EDFA 5ILTL 1XF4A 2Z8VC 4M6MH 3VFTB 4KRPB 3V4UL 2WIIA 4F9PC 5C0BA 3G04A 5JHLH 3F7YB 2IADB 3SE4A 2O5YH 2VDML 2GJ6B 1TVHB 3BKCH 4UT9L 3H3PL 3QDGA 4DZ8A 2V5TA 3U9PH 4JPWL 4LCWD 4XPFL 1DQJB 3MQIA 1VPOL 5C08A 1TJGL 5I71B 2H8PB 5DQJA 1I8MA 4Y5YA 1H3VA 4HUVB 1QRNA 2B1AL 5ITBH 2R2CA 3VFMA 3LEXB 3LD8C 4MQTB 2CPCA 3WJLC 3QDME 5IF0A 5CGYC 1RUQL 1U36A 4PJAB 1T1ZA 1I3RB 4XVJL 5EA0L 1BVKA 3GGWA 4E41A 3CFEA 2X70B 5TPWH 4ERSL 4ZUVB 5IIEB 3PWVB 4KPHH 1BFOB 1QQDA 4DGVH 1M05B 1BQSA 4XNMA 1ZT7B 1HIML 4U1MB 2ED7A 3QG7H 1T1WB 3GSOB 4MQ7B 3MGOA 3HG1A 4JFFA 4P3CL 1F6LL 4RZCB 5INCA 5I1JL 4NNXB 4EIGB 3QIBA 1P9MC 4U1HA 3TBTB 4JDZB 3C6SA 2Q8AL 2ITCB 1NMAL 4ZFOL 1XF2B 5F97E 1RIVL 2EH8H 2J8HA 2VAAA 1R3JB 4WUUA 1Y0LA 5L2JA 4IJ3B 4HIEA 3KPRE 1GHFH 3F7QA 3U7YH 2DN7A 1PKQA 4HKZB 5FHAH 4K8RH 2VQTA 1YMMA 4X5XB 3F65A 4L4TB 4GG8A 1XT5A 5HHNA 1E27A 4K3DH 4U1SA 3BW9B 5DEFA 4PTUB 2X4SB 4OQTH 2VIRB 1CDJA 3EJZC 3PV6A 2WLZA 4HQQL 4OLEA 3MBEC 1A9EA 3E6FB 4P5KA 4PRID 4X6DE 2BVEA 2OX5A 2WBJA 4P4KB 4D0CA 3DX9A 1Z3GH 2NZIA 2IPUG 3O4LB 1I7TA 3UJTH 1OP5H 4QRRA 2YN3A 1JPTL 5DMGD 4ZQKA 3U79A 4D9QD 1VEMA 2D0HA 5DFVC 5JZ7C 1RZGB 1EAPB 4DVBB 1MAKA 1NC4D 4U1GB 3RL1A 2K7QA 5AAMA 4GJTB 3QJFA 3BHBB 3KJ6H 3VG0L 2P44B 4M62H 4PRDB 5I1AA 4Q9RL 1KELH 3BMVA 4NNPL 3OAYK 3DOSA 4OD1L 3A6OA 2FJFB 2VDPH 3ARFA 1UXWB 2PW1B 5GJTH 3BJ91 5CAYB 2ZNXA 5F1NB 1FNSL 5CGTA 4MQXC 3BFOA 5IROC 3CGTA 1I4FA 3ULVF 3SDYL 1ODAA 5A3IC 5JPNA 2F19H 3ZYIA 1G0DA 2YA2A 4QXWA 5EFIB 2YD2A 4PJCF 4CU6A 5A2JH 1UCBL 3S34H 2UWEE 1Z0MA 1HXYB 1DE4A 3NIFE 2RIKA 2FATH 3TNMA 1KCRH 3QUML 1AC0A 3BUYA 2CK2A 2FZ3B 3QUXC 4ZS6C 4J3UA 4G8FA 4UIMB 3ETBF 5F7YC 1H3UA 4GKNB 3MV7B 4RIRA 2C3XA 5EU6E 4X9FA 1U8HB 1JF6A 4CGTA 5J6GA 2YUWA 4XP6L 1UZ8B 2HFGL 4NBXB 4F7EA 1OSZA 3RNQA 4GSDH 3LEVH 1MREL 5BQ7A 2QQKH 5HHME 3VXQB 3OG4B 4JAMB 4Y1AA 5ICXA 1T3FB 2EIZA 2P47B 1MVFA 3DUSA 3TO2A 3QHTC 5ALBH 2YPVL 4JKKA 1KIQA 3EAKA 3DO7B 4KROC 2YUXA 4LIQH 5T1KA 4WWID 1JVKA 4OGYL 4MA8L 1EGJL 4NZRH 4UOW1 2UVFA 4TYUA 1E6OL 4Z7UB 1IBGH 1OW0C 3HI1B 3R06B 2I60H 5FOBA 1J0JA 1NLDH 2MHAA 2FDBP 4KUZL 3JBG7 3OKEA 5I1GL 4ZAKC 3QHZL 3NGBB 5J56B 1N4XH 3T2OA 1OAXL 1Q9KB 1XGYH 5I1LB 1CGSL 1JI1A 4JHAL 1AO7E 2NY2C 3X3FH 3OJ2C 3CDGB 5MERA 4ZTOH 1PQZA 1WEJH 2DM4A 3BKML 2F5AL 1DN2A 4PRHB 4P48A 3CMGA 4GBXD 3QIWB 1JP5A 3VU2A 1NMBL 2K1MA 4HG4K 4KZDL 2ICWB 2R8SH 3X11A 1UH4A 3H42H 3ARBB 1QO3B 1SYSA 1NBYA 4QTHB 4WTXA 4FQJH 3U4AA 4UV7H 3GUTB 3SE9H 3OX8B 2VH5H 3MRNB 2B4CH 4JG1H 5AUMA 1MCQA 4Q6IB 5E4IA 2EEBA 1C08A 2GSGA 1CICB 1P84K 3FQNB 5DD3L 5E94A 3STZA 3OF6D 4PJGF 2XPGA 1W72A 1N5YH 4NYLB 1HHIB 5TQ2H 5DJ2A 3HPJA 1SJHB 4JHBA 5I1KL 4UBDD 1PEWA 1IQDA 4ZYKA 4NQSA 4PGEB 3T1FA 4DZBB 5CILL 5GZOD 3T09A 3UTSB 2VLJE 2SEBB 4GRLD 2J8UE 1FL3B 4KZEL 4J3SA 1WIOA 3V6FB 2ATPB 3B5HA 5CGMA 1XGPB 5DJ8B 3WLBA 5T5FL 1RUKL 1JMXA 1UADC 3O6KH 5C0CE 1BFSA 3IDYC 5HJ3B 5AYQA 2HJLA 1XGQB 2BOCA 3TBYA 4IRJB 2IQAB 3TJHD 5JW4M 2V7NB 2YD7A 1KCVH 3WO4C 4X9IA 2IQ9H 3QUMA 5EU7E 5DT1L 1R3LB 2MCPH 3FT3B 2ENYA 4JDTH 4NQDD 4KJQD 2NCMA 1BJMA 1PFCA 3T0VA 5EO1B 1MFDH 3KPSD 4RGOL 5IB4B 1ACZA 3NA4A 3WS3A 3CFKB 2F58H 3D6GA 1X4ZA 1J5OL 3CZFA 3VFNB 1F6FB 1T83A 4F9LC 5E8NB 3QDMD 4PJ5E 3QNYB 5ACZA 1B4RA 3QISA 4LQ1A 3Q6FA 2I9TA 1NAMH 5DMKA 4AY0A 4JQIH 2OSLA 4MHHI 5KVEL 1A1OB 5HGDA 1J8HA 1XMWA 5L2KB 1X3DA 3JUYA 4G8EB 4EVNA 3RWIB 1FL5B 4HF5H 1HHHB 5EOQL 3EHBC 3NIDE 4MJID 4J4PA 5IQ7H 3UTOA 4HG4J 1CS6A 3H0TB 3LH2L 5K9JH 2DQFA 4XNZB 3DO3A 3RL2B 4PGDB 2F8XC 2EE9A 1F3DH 2BRRH 4MDIB 5HYSG 1PGRB 5BRZA 2AABL 4TUJB 3H9HA 4IOIA 5ETUA 1KTDB 2FCBA 5J0BA 4Z8FL 4IRSC 1UXSA 4LCUB 2JCCA 1H15B 3GBNL 3AY4A 2IAMA 3TPUB 5GISH 1KB9K 2GCYB 2NXZD 2Y7QB 4HT1L 5FYKE 4KI5E 3FQRB 1CLYL 5DGRA 3T0XA 2Y25A 3SY0B 1QTYT 4LMQE 1X44A 4R0LB 3MRBB 4N8VB 4BM7A 3QUYC 2QBWA 5GGRA 5FGRA 1T0MB 1FH5H 3QFJA 2Z9TA 2Z31D 1JNNH 3C60A 3O2VL 5FO7B 5HDOA 4FOMA 3JV6B 2WUBH 3MLXL 2PXYA 4YFDB 2CLZA 3FQTA 1RZIB 4JLRB 4NKOA 2DIJA 2FX9L 4TSBL 4MXVE 5DVNA 4EEEA 3L9RA 4BA8A 5IVZB 4IRZL 1KTLB 2DWEB 5IR1A 2Z8SA 4WY7H 1MRDH 5BS0A 1T03L 2OR7A 3NCYS 1GZQA 1MCIA 1T7YA 1J05A 1S9WB 2BHYA 4PJEA 2LAGB 1QFWM 2ZJSL 4UIKH 4ODHL 4RA0C 2W0LA 1MLBB 2RCSL 4ZOBA 1U58A 3D85D 1IGYB 2XKNB 4XP1H 1B2WL 4AIZB 3ZDYE 4Y2DA 2YD6A 1WCBB 2XZCH 4WO4B 3GNML 5E9DE 5CCKL 4YBQD 4XAKD 1KG0B 1UJ3B 4NO0B 1MJJB 1Q0XH 3S97C 2AXFA 3PL6A 3K74B 1S7UB 4M02A 1U8NA 3WXVL 4G7YL 3O45B 1H0DB 1BZ7B 4L4VE 1YNTA 4K3JL 2X4PB 4I18B 4DN4L 4FQHA 4KVCL 1C5BL 4XVUC 2DMKA 5EO9B 3RWDB 1S7XA 2Z8RA 5JLZA 4OJFL 4Y16A 5D7KD 2E7CA 2HVKA 5F7EH 4GKSA 2H32B 1CFBA 3DSNA 2V9RA 4OZIF 4HHAA 4P46C 5EU6D 4M7JH 4HV8A 3D39A 5TDNB 4P2CG 3FB6A 2R1XB 1J1PH 1UH3A 5HGHA 5I6XB 4LU5L 2ADJA 4WGWB 1E4KC 3SGDI 1UZ6F 2C3VA 4Z77A 4YEFA 2V2XA 2D3VA 5F21B 3C60C 3TT1H 3RP1A 4MCZA 5FDWB 3TO4C 5GIRA 5F7DB 4GAJH 1L6XA 3TFKC 4B7IA 5E08H 5KSVB 3VH8G 3O2DA 1K8DA 4X4YB 2V7HB 3C6LB 5FOJA 3MUGB 1EXUA 3RQ3A 3GO1H 3ZO0A 1H8OA 5H37G 1ZGLM 3ROOB 4LHUD 3SDCD 4M1GL 2OJZL 5C2BH 1LK3H 4ODUB 3IDMB 5IKCA 3HC3H 3EYVA 2ZZUT 3DVGB 4XC3H 2NY0D 3VWKB 3LKSA 3CLEH 4NDMB 3O4OB 3WD5H 5CJXC 4XCYB 3DI3B 1PJ9A 1AO7D 2R0ZL 1GAFH 4TSAH 5BOPA 1BIIB 1AXTL 1F2QA 5J9PA 4WDIB 1OHQA 4DKEH 2NY5H 3ARGC 4WI6A 5EZIL 4M48H 1AGBA 1IC4H 1E4WH 4JZNB 4BH7A 4OZFG 1OTUC 4P2RA 1IKNA 4AH2B 5KS9A 2ERJB 5ANMA 2DLGA 3MLUL 4PS4L 4KJYA 2R0WL 4IOSD 5CJOL 2FHFA 5IW3A 1NMCB 4XXCA 4RFEA 2DQUL 3MV8D 3UTTA 1B3JA 4JKPL 4MXQC 2D7MA 4OZGB 4YBLC 2AV7B 4OZ4B 4G6KH 1MCKA 2YD9A 4CADA 1Q0YH 4LEOA 4YHKH 4LPCA 2R2BA 4ZUUA 3V9FA 1TCRA 1F8TL 3WUWG 3VXRB 1J0ZA 3KS0J 1XIWB 5TE7H 2ZOLB 1B6UA 1QFWH 3RY5A 1KCLA 2QLVB 4HUWA 1KPUB 2W9DH 5KVFL 1G6RL 5JHLL 1QBAA 2GY7B 2VDRH 3NN8A 1DANT 3DJ9A 4G80B 1RUPH 3U9PL 5ADPH 4LF3A 3OXSB 1N0XH 1S9XB 5EZLB 2IBZX 2GJ6A 1X5LA 3S7GA 4PJ9D 1TVHA 2R56L 1E4XI 2D0FA 5IFHH 3QHFL 2P5EE 4HD9A 1MFBL 4JKWA 2H8PA 3Q3GB 4X6CA 4M8QB 5FUCE 1VKXB 2GK0A 3RA7H 4XCEB 1OPGH 3RU8H 1ZT4B 2F54D 5HI5D 5TPWL 2WUCL 5T1LB 4OLXH 4U0QB 4U0RB 4PYGA 4FFWD 3PWVA 3RDTA 1I1YA 1LP9B 1BFOA 3W82A 1ND0B 2CKBA 4ZTPH 5ALCH 2OL3B 5KSBE 3ULUE 1U8OA 3S4SA 1F58L 5FKAA 1ZT7A 3KLAB 3GRWA 3I2CH 3CK0H 3JV0A 1KB5B 2KUTA 4HAGA 1T1WA 4MQ7A 1YYMH 3ESUF 4RZCA 4G5ZH 4PJ5D 1NQBA 2WV3A 3WL9B 3QUZA 3QDJB 2F5BH 5DMYA 3GSQB 1U8JB 3TBTA 1U91B 1SJEA 2VC2H 2EH8L 1IKNC 4KRLB 3QSKB 1BZQK 1MHPL 4ODXA 1GHFL 1XF2A 4PTTB 4K8RL 1R3JA 4XRCA 4QRPE 5HHXH 3T4YA 2RHEA 1MQKH 3T04D 5C07B 3U6RB 1NFDF 4PJFF 1LNUB 3SDXF 3SE8H 1A7QH 1TNNA 4OQTL 4HWBA 2YUZA 3VXSB 4NQCD 5EUOB 4HIHB 3T3MF 1QPXA 2R23A 2J88H 5KVDH 1R3KB 4Q7DA 3SKMB 1FVEA 1S7QA 2JJSC 3KLHD 5IVXB 3DVFA 4FS0A 1MI5B 5C0AA 3UJTL 1EEZA 1P4BL 4KRPC 4RX4D 5LQBL 3GSVB 1P5VA 4PJIB