1CR0A

Crystal structure of the helicase domain of the gene4 protein of bacteriophage t7
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
277
structure length
241
Chain Sequence
MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKDLRALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the helicase domain from the replicative helicase-primase of bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase
molecule keywords DNA PRIMASE/HELICASE
total genus 77
structure length 241
sequence length 277
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cr0A00
2ZS9A 1YZNA 5TVKA 3EIHA 4UNRA 1MH1A 4CF7A 4P4SB 4TMKA 2GEDA 5EP4A 3WMFA 2XAUA 4B32A 1E9BA 2MSEB 3Q7PA 1QBKC 5BXQC 1II9A 2QRNA 2B21A 4FMCF 3O8CA 2NO6A 3UMSA 1ZVQA 3T35A 4V0LA 4JBYA 4MRVA 1QHSA 4HZUB 3OAAA 4LHWA 2J87A 3RSLA 3QG1A 2ZM5A 1H8ED 3CUEF 4BEJA 1ZAKA 2AXPA 2VSXA 1YKSA 2AWNA 1HUQA 1UEIA 4F93B 2IUSA 4D4JA 1A7JA 2JCSA 3N5CA 2WBLC 2GRJA 5KPJA 3A6PC 3AVOA 4ZDWA 2EFHB 4BFXA 4M9ZA 5EJEA 1S0UA 2J45A 5DLQC 1HURA 2PCJA 1W0KA 4HDOB 4DLTA 5EE9A 4BRUA 2IS4A 1KKLA 4AKGA 4F4IA 2JLYA 2UZIR 2J1LA 5TB5A 1RYFA 5FTNA 3ADDA 4U00A 1YHNA 2CHQA 2G1JA 4E09A 4Q03A 4FCVA 1G7CA 4TLBA 4M53A 4LHXA 1UKYA 3GLGB 1G3QA 5KNCA 2C98A 2ZRMA 1V43A 5J47A 2GK7A 5KSZA 3OAAD 3U3MA 3IO5A 2GBLA 4M1OA 4A1FA 4GFDA 3TUJC 1XB2A 4W5HA 4DLSA 2FZLA 2HF9A 4OHYA 5TXGA 2JLSA 1N6LA 4HB3A 2YINC 1SHZA 1AKEA 4TMTA 3AB3A 2WMOB 1A4RA 1G8HA 3B13B 1QVRA 4D25A 2IL1A 5CB8A 4YMTA 1TMKA 4Q9KA 2PMKA 1N0UA 1RVDA 2ZETA 2ATVA 1SKYB 3BERA 5TY0A 1YR7A 4BRWA 5GJVC 3PEWA 1Q22A 1KHTA 3KUDA 1E2PA 4Q7MB 1XNJA 1OB5A 4EQ6B 4TQUS 1GKYA 2WJHA 2QPOA 4XJXA 1OKKA 4RKFA 1NLFA 2PT7A 2ASEA 4Z1MD 1KO7A 3AF4A 4OHXA 4TTRA 4A2WA 3KQKA 5JHHB 3NH6A 4B76A 4JMPA 1KI2A 2GA8A 1WQ1R 3T1QA 1TNDA 1BYUA 4M9QA 4KYUA 2JLWA 4CZ2A 1Z29A 3K0AA 3QF4A 1T8TA 2W58A 1B0UA 3ASZA 1E9DA 4LUCA 4DDWA 2CBZA 4DUGA 1XEXA 4HZIA 2EU8A 3H1TA 4ABYA 3PUWA 1E2FA 1AN0A 4HLCA 4QM6A 2GBLC 1VG8A 2VSFA 4TLCA 4QOSA 4WA7A 1UKEA 4DSOA 3WP0A 4C9BA 3CX7A 4PHFA 4KSCA 2WJVA 2ZVQX 4Z1MA 5M04A 2QENA 3KUCA 3Q8XB 4TQAA 3RDPA 1LF0A 5C2JB 2WOJA 2V4ZA 1US8A 3SJAA 2GWHA 2JATA 3C14C 4A6PA 3V4RA 1E9AA 1Q3HA 4BFYA 1F2UA 4LBZA 1SVMA 5H1YA 1SQ5A 1G19A 5L3QB 1S3SA 3DOFA 2H8KA 4ESHA 2JLUA 4FINA 2OSBA 1QHXA 3SNHA 4DLVA 3QKRA 3TMKA 1Q20A 3RS2A 1ODFA 4RD1A 1P62B 2Q3HA 1KJWA 1M7BA 2R6DA 2XTZA 1ZD9A 1HT1E 1ETUA 1QDEA 4OQMA 2GETA 1NY5A 1TF5A 4B3XA 4OYHA 4EUNA 1JEDA 2WAYA 4P32A 1G41A 2YC4C 3N2EA 1L2TA 1NNEA 5AUPB 2EYQA 1W4RA 5BW8A 1FNMA 2DFTA 1P72A 2CE7A 2F43B 3BH7A 5FBRB 3H0KA 3NBXX 4HAUA 5KUTA 1KJZA 2ZRKA 2HLDA 3TSOA 4LPKA 5FPSA 4ZDJA 1G7TA 4C2TA 5DI3A 5JS8A 2F9LA 1YZGA 2CMKA 1S3GA 4E07A 5KHOC 4JKIA 5DGXA 2VYFA 1G7RA 1GIAA 2QMUA 5FPHA 5GJWC 4JS0A 1G5PA 3W3AA 2Q3FA 5JS7A 1OH6A 4DRZA 4KAXA 1E2IA 2O8CB 3CWQA 2HT6A 4BASA 3ZD7A 2JLQA 2OILA 1R0YA 1AJEA 1CF4A 2ODBA 3TW8B 5KO2A 4B44A 1YZQA 1W2GA 4IKEA 2XXAB 2QAGA 5KSYA 1IN6A 3VHXA 2C77A 4G5GA 2FFQA 1D6JA 1UEJA 3B60A 1ZM4A 1G3IA 1YJ5A 3PUYA 1E4YA 1T3SA 4GZLA 4R98A 4NU0A 4DCVA 2FSHA 4V02A 2JDID 1G5TA 2IYSA 1G291 2BEJA 2WJJA 3X1XA 3VKGA 4HLUC 2ORWA 5L3QA 4RCZA 4QBIA 5JEEA 2ERXA 4ZIRA 1DAMA 3C41J 2LCFA 2V54A 1SKQA 1ZNYA 3MG9A 3L82B 1YZUA 8OHMA 5LPNA 2EFCB 5EE3A 2OT3B 3A36A 4D80A 1KJYA 2QSZA 5J4KA 4UNPA 2KB0A 2QE7A 5B30A 3GLHB 1AQUA 2WKQA 4FMCB 4FI3C 3VX4A 4IHQA 4Q21A 1ZC3A 4M1SA 4QBGB 1W4CA 2ZE7A 4IDQA 3WBJA 2EVWX 1GWNA 1ZINA 4KXFB 2XITA 4JYCA 5AJVB 2G3YA 4LHVA 5IT5A 3C7KA 3K9LA 4W5JA 1GKUB 3CF6R 4P4SA 1E2KA 4ACAA 4HEJA 3WYFA 2VIIA 1KI7A 2J59A 4A9AA 5FI0B 1IY2A 2J0UB 5JI3E 3VNUA 4C0BA 1KI9A 2CNWD 3KKOA 4CGZA 1Z0AA 2IEYA 3K09C 4LJ9A 1N3BA 4LZZA 3W8NA 2V6IA 3K70C 2RHMA 4G1UC 4OQFA 1AGRA 2FGKA 3VU9B 4A0RA 1UDXA 5FFMA 3IQWA 2AX4A 3HJNA 1Z08A 5KDDA 4RD2A 3U61B 2WWFA 3THOA 2A5JA 4XVQA 5K8UA 2XSZD 1NSFA 3N2IA 4M8NE 4NBSA 3I4LA 2O8DB 5P21A 2R6FA 1NVUQ 3AH8A 1FL9A 1IN4A 3IDQA 3ZZTA 5FR1A 2FDCA 1IY0A 4GRAA 1FTSA 2A9KA 3OIYA 5F9HA 2ZSDA 2FPKA 2CEAA 4XSGA 2HUPA 4B75A 4A2PA 3GJ3A 2AL7A 3OESA 2FE4A 5FTMA 3NXSA 2C8VA 2OXCA 1KO1A 1TUIA 1R0XA 4ITRC 1ZW6A 4RZXA 2ONKA 4B2IA 2QP9X 3GJ0A 4B3DA 2FN4A 2JDIA 4LBVA 4P4TA 1E2QA 3BC1A 2ZI4A 3LXXA 3I61A 1YZKA 4NE2A 4V0MA 3ZZUA 3ECCA 4TLEA 5FTLA 1PLKA 2J7KA 1GM5A 1Y3AA 1SVSA 1PLLA 5JCPA 3CZQA 2VLIA 3IHLA 1NMYA 4O0MA 5LB2A 2AHOA 2H1LA 2ZRGA 2ZUBA 3REFA 5FPTA 3QQ5A 2Z4SA 3K0EA 3K0SA 1JAIA 1HQCA 4QM7A 1ZD8A 2BCJQ 1A1VA 2JA1A 4NCHA 4CIDA 1XEWX 5KDOA 4IJMA 2RGGA 3PIRA 1HE8B 3T5DA 1OT3A 4MUBA 3SJCA 3FFAA 4HAYA 2A5YB 1HA3A 1AZSC 4TYQA 4TMXA 4HSEA 5FH9A 1KSGA 4LHZA 2OBNA 1Q1EA 1UKZA 1OE0A 3NKVA 1Q57A 1G17A 5CLQA 1OH8A 4M1KA 2FF7A 3KJIA 2O0JA 4PC6A 4A6XA 2B7BA 1A5TA 1I4DD 1W2HA 4ESVA 1FMJA 4C0SA 3CF2A 4DCUA 2BVNA 2E1RA 3MMPA 5SZHB 1XTRA 4MYCA 1XU4A 3SBEA 1U2RA 3IIJA 4OQXA 1W36D 4ACBA 2BIFA 3OF5A 5KPDA 1W5TA 1XEXB 2XZPA 2ZPTX 3I62A 1E3MA 4RJLA 3SQWA 4IDNA 5AJYA 5IK2A 1NG9A 4FW9A 3B7GA 2GCNA 1NN0A 2ZSAA 1N5LA 3ADBA 2DWQA 2J7PA 5L3RA 3HYTA 2QZ4A 2CCKA 1E2DA 4A8JC 4NCJA 2O8FA 4U5XA 2MSDB 1Y63A 1UBEA 2X2EA 2P2LA 4OI1A 2NZ8A 1MO4A 2H5EA 2QN6A 4RCYA 2P3SA 3THWA 3I73A 2DHRA 2IUUA 1MV5A 3GLFE 1AS2A 1XDBA 2XOKD 4OI2A 4LWZA 3HR7A 5JJIA 4C0KA 4US0R 1OF1A 2F3TA 2WKPA 3PEYA 1AA9A 2NTYC 1M7HA 5GJBA 2R6AA 1P4SA 4KHZA 3FWYA 2YOGA 2ZJ2A 2QSYA 2OBLA 5JJKA 1FUUA 2KBEA 2FFAA 4IEEA 1TX4B 2C9YA 2QBYA 2XTMA 2BM1A 1VHTA 1DAEA 3E1SA 4JLBA 2QMHA 1M6NA 3R9WA 1G3UA 1CRQA 4AG6A 3JVUA 5GADl 3BB4A 1FQKA 4TYYA 2V6JA 3RRZA 5EUMA 4JT2A 2VQSA 5CJ2A 3T34A 4LYHA 4XD7D 3TLXA 1KI3A 3K0CC 1AQYA 3IILA 4OHVA 2D2EA 3BH0A 2WSMA 1P9RA 2GJAA 2H7VA 3HU1A 3QVVA 4C0LA 3KQHA 3U44B 4Q1CA 5F98A 1ESNA 3VU9A 3RSOA 4E5UA 4YQFA 2BMEA 2W00A 4ZDKA 3AF0A 2A5FA 3DO6A 3U5ZB 5HKKD 1SVOA 4FN5A 4L8GA 4NMMA 1GDDA 1ZCAA 4US2R 5BYKA 2I1VB 5K8TA 1DAIA 4NHOA 1S1MA 3L8YA 4NYJQ 5FPYA 4A36A 5CYOA 4M9SA 5CIQA 4NYMR 3IPXA 2QEQA 3P27A 5BYJA 3UMFA 4Q5IA 2OCBA 2Z43A 4IOJA 2NQ2C 2IF0A 3G5UA 1XZPA 1E96A 1CJMA 2XXAA 3CIOA 2OFOA 4NCKA 2REXB 1EFHA 1AS3A 4LYFA 4LY6A 3MLEA 5HR5A 3FMPB 1XJCA 2RMKA 3TNFA 3LQQA 1G4AE 1UPTA 2VP2A 4JVLA 3THWB 3QVUA 1XJ0A 3P32A 1DAKA 3BB3A 3OHMA 1TU3A 4QBFA 4UJ5A 4DWJA 3NH9A 1C9KA 4JT4A 4UXHA 4JL5A 3U60B 2JJ2D 1LY1A 4QFMA 2N1BA 2NMVA 3QJYA 3SYLA 1LTQA 2CL0X 3GJ6A 1E1QA 1GG2A 4KVAA 5IF9A 3BXZA 1HE1C 1HTWA 2YWGA 1KI6B 1X6VA 2ZQ5A 1P2TA 4LJYA 3I5XA 1CXZA 4DLXA 5FPKA 3RC8A 2IK8A 3CH4B 2B6HA 4JLNA 4L9WA 1ZM3A 1X8KA 121PA 1Z83A 2IXFA 2PZEA 2E9SA 1T0HB 2OLJA 4GP6A 4RFSB 4TMWA 5AJZA 4F4JA 2GVZC 3QKTA 2JJ8A 1GNRA 2D7DA 3AF3A 2J0QA 5AK0A 1RRGA 4CEIB 2F55A 1AZTA 1X3SA 1OFTA 3QIAA 1W49A 1VHLA 2P5TB 1QRAA 1B23P 5CDFE 2F43A 1K5GA 2G1KA 2IS2A 1U8ZA 2IEZA 3Q5DA 1VYUA 4IW3B 4C3ZA 3AVQA 1NY6A 4QGHA 2LKCA 4JLPA 4P33A 3B9QA 3IBGA 2CLDX 1J99A 1P75A 2OESA 4IXMA 4BLQA 2NPFA 2VHJA 3KB1A 1XXHE 1GOTA 4YMSA 3ZIAA 4QKQA 1N5KA 2CDNA 4B2PA 4BWYA 1VIYA 3X1ZA 3FGNA 1Z2CA 4C0AC 3AVPA 1Z0FA 2X2FA 2YV5A 4GNKA 5EQTA 1VCNA 2GJ8A 2JLXA 4AYXA 4LDJA 1NLYA 1QG2A 2Z5FA 2PZGA 4D4KA 3GEHA 3AEZA 3DOEA 4HATA 4JVSB 5JZVA 1Z07A 5B57C 1RPZA 4Q4AB 1YVDA 5CK4A 4DKXA 3SYKA 4OK5A 4TYWA 3V9PA 1BKDR 5L3VA 2IBMA 2W83A 4YLGA 3HP1A 2XNSA 2NG1A 3HU3A 5FOSA 4QXAA 4PANA 3OEHD 2ERYA 4TL8A 3ICEA 3UANA 3RS4A 1GL7A 2R65A 4JLJA 3W6OA 5AUQA 1CR2A 2DWPA 4ZIRB 1GTVA 4CT4B 4HLQB 3Q3JB 5C1BA 4YC7A 4IOLA 4YDHB 3O8RA 2X8AA 1NP6A 1IQPA 1S9DA 1OHHD 2WPDA 4V0OA 4XWAA 1XD8A 5K8LA 3TKLA 2GDJA 4Q1FA 1JXOA 1U8YA 4G0NA 1ZYUA 1BO6A 2XOKA 5FOXA 1GKIA 2MMCA 2ORIA 4YDSA 2C96A 4G5OA 1OXXK 1NBMA 3CBQA 4PPFA 1DTSA 5AJXA 4D82A 3ZVLA 4MYUA 4TT3D 5JWRA 4LK2A 1CEEA 4HYYA 3DMNA 4PSKA 2ZRBA 2CJWB 1NIPA 2G77B 4KSBA 4Q7JB 2P67A 3KX2A 4MKGA 4YMWA 4AY2A 1QHGA 4PO1A 4NYIQ 1XCPA 2GTPA 2GXSA 3U3KA 1TQDA 1F60A 5L8VA 3VMFA 1ESMA 3F5FA 1VECA 4IVPA 1Q1BA 3RWMB 3KKNA 4Q4HB 5FI1B 3BFKA 3REGA 3GFPA 5CITA 1II8B 2QI9C 4HAVA 2ZRNA 4IDOA 2GJKA 3H84A 5FTKA 5DN6D 2WSSA 1XX6A 3Q9LA 2ODWA 3QUSA 2FV8A 1KGDA 1Q1ZA 1X8LA 4DLZA 4JLOA 2ZRFA 3WHLA 4WW0A 1KYIA 2GXAA 5J4VA 3QPUA 5HCNA 2IWRA 2FEMA 4PC1A 4RY2A 5G41A 4JJKA 1NG1A 3QKSB 4FMDF 2ZI9A 4EPTA 1TQ2A 5CB6A 5EP1A 2QM8A 2VEDA 3UPUA 2QP4A 2GJSA 2XZOA 1XF9A 2CHGA 1G9XA 3GJ4A 2ZRCA 4PO8A 4IFEA 4MUAA 3QXXA 4I1SA 2F7SA 2XX3A 3A1TA 3EAQA 4YMUA 2JEOA 4PAMA 2F1IA 2RKOA 1XTSA 4TSFD 2IF2A 1E32A 1P60A 4F7WA 2FH5B 5FBQB 4GOKA 4AKIA 1U0HC 1W0KD 4GI7A 4LSGA 3J81k 2ZRJA 4ZCIA 1AS0A 2A5DA 4DUGD 3W90A 4F92B 3Q7QA 4TZ0A 1YU9A 2Q0HA 4URWR 4G3XA 2V7QD 3OE7A 3TE6A 4MA4A 2UKDA 3ZVMA 4GT1A 2JIZD 3M0EA 4B74A 2FFBA 3MD0A 2QBYB 2C2HA 5B2ZA 1G21E 4RFSA 2VHCA 1J8MF 3GLHE 3ZLJA 4DCTA 1FOEB 1T5IA 2ATXA 1NIJA 3KQNA 3LX8A 3DZ8A 2R6GA 5HE8A 1TU4A 421PA 2WWIA 3ZS9A 4CYMA 3AGQA 1G4UR 3RVBA 4BUJA 5TV2A 3FHOA 1M1YE 2WZQA 2IYWA 4CEIA 1DADA 2NPIA 5EE1A 3T12A 4NP6A 3BE4A 3OIVA 3OEEA 2OHFA 4B33A 2Q21A 4QJ4A 2MMGA 4K46A 3DKVA 5DHFA 5HE9A 3KFVA 4C0QC 4PTLA 4I1VA 4EJSB 2AK2A 2A7QA 5EUQB 3EIQA 4TYNA 1GUAA 1UAAA 2IXEA 1W48A 3VKWA 5HZKA 2J0VA 1E79A 4EFLA 1F2TA 2IYXA 2QE7D 4LV6A 1I4TD 1N6HA 3TSZA 1KK3A 3OFNA 1M8PA 3MWLA 4R7ZA 1A82A 4KODA 2AXNA 5EP2A 1KZGB 5FUWA 621PA 3FMIA 1G7SA 3PEVA 3W34A 1FUKA 3GMTA 1MKYA 3KKQA 5DH9A 5FOUA 1WA5A 4IDPA 3EIEA 3I1FA 3Q72A 1BMFD 4B48A 4DXAA 5AUOB 1KDPA 2FPLA 3BIFA 1U94A 3C5CA 1XCMA 1EX7A 2IWHA 4G5SA 2ZUCA 1XTQA 2K5UA 5H70A 5KYKA 1OJLA 1WE2A 4ILEA 3LX5A 1W7AA 3MJHA 5LD2B 1KY2A 3UK6A 2Q9BA 4RD4A 2IXGA 3WP1B 5EZ6B 2OLKA 3PG5A 3VHLB 3B6EA 4KU4A 1JPJA 2QT0A 3VAAA 1NMXA 1CRPA 3QBTA 2FNAA 3I3SR 4QL3A 2RGEA 1K5DA 1XFAA 5JHGB 3AVXA 4ERNA 2B7CA 3GP8A 4Y0AA 2XTNA 4Q1AA 1N6OA 1NN1A 1UM8A 2AFIE 1JBKA 2PZFA 3LAWA 1IXRC 3H4MA 4Q4LA 4Z54A 4JVMA 3VX3A 1F2UB 4DLUA 2W2TA 2ZRDA 3A4MA 1OXUA 3KB2A 4GZMA 1XPUA 5E7JA 3K9GA 4URYR 4A4DA 1N6RA 1P9WA 4JKYA 1CJVC 1OLOA 1T3LA 1G8YA 1Z3IX 4CEJB 2O52A 5L3SA 2ZUDA 4NPHA 5LBIA 6Q21A 1CKEA 5ELXA 2GEVA 1SGWA 5DYGA 4W7SA 1ZIPA 3IQXA 1G64A 1DPFA 2NO7A 2IYRA 2WICA 3GJ7A 3UKDA 3VR1A 5JI2E 3U7GA 2ZJYA 4V0ME 1NSTA 1GL6A 2HYIC 4A8JB 1R5OA 3AKYA 1RYHA 4BZQA 5KOYA 4LYAA 3RLFA 1KZ7B 2Q9AA 4Y0VA 3SQXA 4OI4A 3X1YA 1MT0A 1TQ4A 3GPLA 2WSSD 1UKVY 2ZRAA 4I1UA 3BBPA 2BBWA 2V3CC 4LI0A 3EZ6A 3RS0A 4JLVA 4GDFA 3CNOA 1F48A 1G16A 3D31A 4A0HA 4IVQA 1DVRA 4RZ3A 4TMZA 2HXSA 4HAZA 2DBYA 3QG5A 2BC9A 1ELOA 4LRWA 1DS6A 1XBTA 2KE5A 2O0HA 4BPBA 3EPHA 3I8SA 4L9SA 1RRPA 1R5BA 1UBGA 3PXGA 1E9CA 1GNQA 1JQJC 3OFND 2PLRA 3TH5A 2JLRA 2JGNA 4P3YA 1CU1A 4JYBA 2VH5R 4Q9LA 1BH2A 3ZD6A 4ZKEA 1SXJD 3RAPR 1SVLA 1E2EA 4L5BA 4U02A 1JI0A 3IGFA 4QJ3A 4IRUB 1QHYA 5FOVA 2E87A 4DHEA 1S4QA 3E2IA 4C7OB 3GJ5A 3PV0A 2EWVA 3O8DA 3PR1A 2PJZA 4DBLC 3AKEA 3KL4A 2P6RA 2YNMA 1TPZA 2ZS7A 5F2EA 4EPVA 2H57A 2YOHA 3ZZ0A 2ZRPA 1XTIA 4OK6A 1XD2B 1XMSA 1R8QA 1OFUX 1K6MA 1BIFA 2REOA 3PUZA 3CX6A 1IN8A 1OPXA 2BBTA 4L16A 1Z47A 5EXXA 3WY9A 1ZU5A 2Q3MA 2VSOA 3WNDA 1YR9A 4BECA 3HU2A 3GJXC 3GLFB 4EIWA 2ZR0A 3A4NA 4OJKA 3B1YA 1E69A 1M74A 3RS5A 2QQEA 4URZR 1GP2A 4ZO4A 3T06B 2XJ4A 4R71A 2OO7A 1C4OA 5JRZA 1CJUC 1WF3A 3FHCB 1SULA 3X1WA 4BFTA 4OQNA 5J4HA 3U2QA 3VR5A 5G3ZA 4Q18A 1E1RD 4CEHB 1WMSA 5J4LA 4Q7KA 2CLSA 4HB2A 2ZRHA 1EFCA 2GHIA 3I92A 4OJQA 4ZI2A 3QXJA 1DARA 2NGRA 3SDZA 1IOZA 4KLZA 2ZJZA 2G0TA 1Z6XA 2EFEB 1MO3A 2ZYVX 3L0PA 4JLDA 1SXJC 4WIAA 3VR4A 4YONB 5E4FA 4OQLA 4Q19A 4Q47A 1ZMXA 2PCLA 1IY1A 1DAFA 1N6PA 3RRNA 1CP2A 1OXVA 2HYDA 4IOMA 4JLMA 3BK7A 3C5HA 5GJCA 1O3YA 1Z0KA 3AKDA 1Q3TA 5DE3A 4BLTA 1HV8A 2FPMA 2RGAA 3I32A 4NCIA 3AP3A 2P0EA 1NVVQ 4PR0A 1RRFA 1N2CE 2BMDA 3ZVRA 1R4AA 3KXKA 2HLDD 1EFUA 3N70A 3TRFA 5DIFA 1RIFA 1AM4D 2J3EA 2BKUA 2OG2A 3LBNA 3R7WA 3TUZC 4KCGA 4DCSA 1MR3F 2PMDA 3BGWA 2OFXA 4Q9HA 3A1UA 3BFXA 4AIIA 3L0IB 1D9ZA 4GMDA 1E1RA 1JPNA 3ZH9B 2ZYTX 3L0SA 3AUYA 3KXIA 2VF7A 4N0EA 5FUXA 3DVLA 1PZNA 1N5IA 3BRWD 2J41A 4A2QA 1G3RA 3AVWA 4OHWA 1JAHA 3NG1A 1HYQA 1VIAA 1ZM2A 2AN9A 1MO5A 1NL3A 4B73A 4PAOA 2ZSFA 4P4UA 3B1XA 3VFDA 3RABA 4PSVA 3P1JA 1N25A 4LJ5A 3PITA 2BWJA 2R2AA 4KFSA 5E7IA 2VTKA 1ZCBA 1XTKA 5ANRB 5SZKB 2IS1A 5KSOA 3CPJB 2HV8A 3QNUA 4EQ6A 1W36C 5G53C 4O3MA 4KVGA 1U81A 2A30A 821PA 1UDWA 3LRPA 1Z5ZA 5KU1A 5SZJA 5LD2C 2V9PA 1X8JA 4MYHA 3DPUA 3X2SA 3QKRB 2PH1A 5CIWA 2YJTD 3LW8A 2AWOA 4M0LA 1D9XA 1J90A 3CLVA 4ASUD 4XWKA 2VHUA 4FWIB 3TR5A 4C2UA 4MRNA 4X8LA 3W3ZB 1ZU4A 4QBHA 4CT5A 2O8BA 1S1CA 1R0ZA 2DYKA 1XMJA 4Q4JA 2ZU6A 2ZE6A 2YVUA 5TDHA 2Z0MA 1YE8A 3EXAA 4MH0R 4WZ6A 5J40A 3AKCA 3E70C 3T15A 4BFUA 4CDGA 4J0QA 1VCMA 3NIBA 3P20A 3LY5A 2CVFA 3F3YA 2FA9A 2NOAA 1S96A 4Z8YA 1P2SA 1R8SA 1US8B 1P5ZB 3IKJA 1Q0UA 2F6RA 4Q02A 5DI3B 3T1OA 4E22A 3THYA 3EZ2A 5JBQA 2C95A 4TL9A 3WMEA 4TYPA 2DFNA 4Q9IA 4F91B 4UQOA 3MCAA 3U6KA 4AI6A 2VF8A 4H1UA 1Z28A 2J5XA 2AK3A 2ZR9A 2W0SA 2O8CA 2IC5A 4ARZB 1VG0B 4FWTA 1KSJA 2GXQA 4LGMA 1Z06A 4WOPA 2ANBA 3FFBA 3ND8A 1IM2A 1TADA 3DHWC 3LFUA 2WJIA 4M1YA 4UXIA 2WAXA 1LB1B 2CCJA 5FL7D 2QUZA 2KBFA 3LLMA 4RSGA 3R8CA 5B58C 3THXB 5EZ5A 2GCOA 2XNDA 4PHHA 4URXR 1E2MA 2HEIA 3ETLA 4AURA 2QTVB 4NH0A 2OCAA 2RGDA 4PXAA 2FSFA 4UNNA 4TL7A 4AD8A 1J70A 2QGZA 4B3FX 5IRCD 3UWKA 1KY3A 2D7CA 5JJLA 2AD5A 5HTKA 1PUIA 3CZPA 2B8TA 1SHKA 4WZAE 3EPLA 3MFYA 1F5NA 4GSYA 4Q4HA 1VCIA 1KK1A 1M34E 3LV8A 3NBFA 3B5JA 3L0OA 1R7RA 1Z6TA 2H92A 1XD9A 2GK6A 3EC2A 1EWQA 2A5GA 3KKPA 2XNDD 4HZUA 2FZ4A 4S2EA 3KZ1E 2WJGA 4KBGA 1GRNA 1LS1A 5A0FA 3C15C 3UWOA 3R9XA 1C1YA 4HB0A 4IDHA 4BLPA 2IX3A 3AV0B 2HT1A 3TBKA 1PUJA 5JFGA 2IYUA 3L43A 4MITA 1GRQA 3OEED 1NMZA 4PPNA 3B2EA 3K0FB 1PV4A 1Q1QA 4OL0A 3PUVA 3SS8A 5CJPA 2BOVA 3TVTA 3BJIC 4JBWA 3K70D 2FSGA 2QROA 1E94E 1LFDB 1IXZA 2CK3D 1S8FA 1U90A 2IA5A 4XTRA 3RS7A 3AVYA 3MWYW 5JECA 4AKEA 4L4UA 2O0KA 2VL7A 2ZANA 1P7CA 1WBBA 4Q7LA 1EGAA 3W9YA 2D2FA 4D4MA 1N6IA 2P6NA 3WNCA 2WWWA 4PZYA 2FSIA 4EFMA 1P6XA 4AC9A 3PUXA 1M7GA 5AR1A 2O8DA 3DKPA 1ZIOA 2JLZA 3GLHA 2P6UA 3TVDA 3THXA 5FOTA 2VP4A 3LQRA 5GVSA 1G6HA 3D8BA 2ZIAA 1KSFX 2A2ZA 2LWIA 2WWYA 4CEJA 1E2NA 1OXTA 2V1UA 3EPJA 2TMKA 3CRRA 4MDFA 2OAP1 3CO5A 5CK5A 4JJZA 2X77A 3LXRA 1GRRA 4QJ5A 5DYIA 3I8XA 1LVGA 4D0LB 1E9SA 4A0GA 1JB1A 1TEXA 3L2OB 5CDFA 721PA 1SVIA 5K8IA 3EARA 2RB4A 4BFSA 3ZS8A 3AM1A 2QPAA 3TIFA 5C46F 1OB2A 1HEIA 4PZZA 3NHAA 3U3RA 4UXJA 1W1WA 1QZXA 4EJSA 3ZDQA 3LBIA 3WMGA 3QE0A 5BWMA 1DAHA 3LBHA 2BJVA 3QBVA 1U9IC 1JR6A 1NKSA 3UG7A 4XOIA 2CNWA 3E5HA 4PC3A 4BLOA 3A1WA 2IYVA 2QMOA 3RNLA 3FB4A 4LOAA 4UJ3A 2BEKA 2I3BA 4G5RA 2D74A 1Z0DA 3K0FA 1E4VA 3BB1A 1YZTA 1RRCA 1NVVR 3Q5EA 5BN5A 1KKMA 4Q9JA 2HF8A 5DHAA 3QXSA 2GZDA 1UFQA 2X19A 2IT1A 1G8GA 2GF9A 2HCBA 1HT2E 4QC2A 1KAGA 1JR3A 3D6TB 1KOFA 3RWOA 4JSTA 4WXPA 1R5NA 3QY0A 2WV9A 1U0JA 2ZITA 1KMHB 4TZ6A 1DO2A 2QM7A 1VYVA 1DO0A 3WYGA 4B6FA 2V55B 2ZRIA 1FTNA 5TARA 3U7EB 5EXTA 3R8FA 5H68A 3GEIA 1P2UA 4I81A 2FG5A 2BDTA 3IO3A 4DEYA 2H17A 1BS1A 1EFRA 2XB4A 1OXSC 2ECKA 5HCIA 4DVGA 1Z2AA 1T8UA 2F9MA 2OZEA 4NTZA 2BKEA 1COWD 2X1VA 2PL3A 2RGNA 1J8YF 4B3GA 1PVOA 1E2JA 4HDCA 3C4JA 3K1JA 1JJ7A 1U9IA 3IHWA 4PHGA 5EE5B 4LYJA 1DEKA 2PBRA 1OFIA 1JQLB 1YR8A 4X8OA 2WKRA 1T3HA 1XXHB 1KNQA 4O2RA 4EPYA 3ND9A 1NKTA 4MKIA 1A2BA 1M2OB 3MWJA 1O87A 3NVAA 2ZEJA 3MRSA 3WBKA 1H8EA 4OK3A 3SR0A 3AVTA 2Y8EA 3QXCA 1Z6GA 4GPTA 3GLGE 1NVWQ 1XMVA 2YOFA 3EG5A 3HDTA 2NIPA 5L3SB 3Q85A 2SHKA 3DM9B 3FVQA 2YHSA 2BHRA 4H1VA 2BCGY 1VTKA 2B8WA 2QY9A 4X8HA 1RZ3A 2WOOA 4TMVA 4HUQA 3FPAA 2HCJB 3GFOA 3QOFA 2NO1A 4D0GA 1G5RA 1II8A 4PC7A 2O5VA 3CNLA 1EX6A 3SEAA 2ZSEA 4ZDIA 4MGIR 1QF9A 2YWFA 4QHTA 5JEDA 3U6BA 2KJQA 4A82A 1KI4A 2D06A 1CTQA 3CR8A 1RC8A 3PENA 4CW7A 4M21A 1R2QA 2ZJ8A 1P9NA 4KITB 2G9NA 1J2JA 4TLAA 2FWRA 1DG1G 3X1DA 1VDZA 4PFSA 3SJBA 4XVRA 4B3BA 4D26A 4FIDA 1OFHA 3MSXA 1DE0A 3OZXA 2W6IA 4BE7B 2PT5A 1E0SA 2ZU0C 2JLVA 3CX8A 2C03A 4PPQA 3ZQ6A 2DFKB 3CRVA 1UF9A 4P0TA 1A2KC 5BN3A 1IJFA 1E2GA 3SHFA 1TEVA 3EW9A 3GQBA 2RGCA 2JIZA 1KK0A 4KBFA 3R7WB 1JR3E 2V7QA 3WRYC 1FMLA 4DLWA 2WM9B 4B35A 1BOFA 3T61A 3KJHA 2CVHA 2N46A 4JL8A 3NBZC 1E9RA 3CWZA 5FBLB 5G3YA 5KTYA 2DCUA 4FMDB 1FP6A 1VYTA 5E7MA 2GCOB 4AYWA 4BQSA 2J0SA 1FQJA 3I72A 2YKGA 4F38A 2CHVA 3NEJA 4LJAA 2OXRA 1OH5A 3U7FB 2IYTA 4NYJR 2QTFA 2CE2X 2RAPA 4Q1EA 2P65A 3C8UA 4MRPA 4M4SA 5DNYB 2RGXA 4NONA 4D6PA 5JWOA 4II7A 1E1QD 2C9OA 4RKEA 3U44A 1IXSB 4EFNA 1MO6A 3NTUA 4HUQB 4CVNA 1CJTC 3UMRA 2YWHA 4A0FA 4M2LA 5A4JA 1WDTA 3T1VA 2I4IA 1CJKC 1NBME 1KAOA 4MRRA 4Q48A 5FTJA 4M1WA 2CL6X 1PJRA 4LCBA 4PC2A 4KFUA 4NDZA 4UNQA 2I1QA 3EWAA 4JLAA 4LC1A 2DY1A 4BLSA 3QKUA 3WYAA 3HR8A 2PEZA 3BWDD 1N0VC 4NKRA 4TSFA 5C4GB 1NRJB 3RRMA 5JSZB 2EYUA 3T5GA 3R9IA 1ONBA 4DT1B 2WTUA 2ZSBA 2VPPA 3D3QA 4MYTA 4US1R 1E9EA 5IDVA 3P4YA 5A5GA 4H9GA 4HLUA 4KFRA 3EZ7A 4DSUA 4A15A 2F1HA 1LW7A 1ZNWA 1DOAA 1G8PA 4KO8A 3AVVA 1K8RA 2QMEA 3GLIA 1EK0A 4WXRA 4D81A 4LV8B 2ZI6A 1J7KA 1T9HA 1Z6YA 2BMFA 1KMHA 3FMFA 2OAQ1 3L8ZA 4CEHA 1SXJE 1IAQA 3OE7D 4TT3A 3U7HB 4EDHA 2WWHA 1BYIA 2RCNA 2QG6A 1RE0A 1Z6AA 3V4FA 2EW1A 3A4LA 2O8EB 3THYB 1TF7A 3QPWA 3HWSA 4FCTA 1UJ2A 1NJGA 1VKJA 5FL7A 1RJ9A 1YRBA 2J9RA 3K0AB 1UBCA 3QF4B 2IYYA 4IFBA 2C9CA 5CM9C 2VBCA 3TAHA 3VKHA 3NDBB 1WXQA 1GNPA 3R20A 3TK1A 4QNMA 3ASYA 3SU8A 1JJVA 1ZJ6A 4I1OA 2EFGA 3BD9A 2EQBA 3VR2A 2QPTA 4BFZA 1DG3A 4UNSA 3NEYA 3ZIAD 1YZLA 1W44A 4KLNA 3VQTA 1QG4A 1EFRD 4RZUA 4WAUA 2GZAA 4Q4AA 1T91A 3KDSE 2IHBA 3TW4A 4OI0A 3LDAA 3C16C 3RC3A 3M4YA 4DLYA 2RGBA 3TQCA 3PFIA 3T1TA 2FGJA 2O8FB 4TWZA 4DDUA 1XRJA 4Q00A 4WVFA 2WWXA 4ZCMA 1I2MA 3IBYA 4Q1BA 1I2DA 4M22A 3TUIC 1W4AA 3ADCA 2VP5A 3P26A 3QENA 4BFVA 2KSQA 3MWKA 1P73A 2VP0A 3I5YA 4L15A 1GL9B 4IXNA 5KNDA 1KK2A 1YRAA 1TF2A 3IUYA 1W46A 3CF0A 2W2VA 1CR4A 4EKDA 2QGNA 4C30A 3BS4A 5J5CA 4XSHA 3O8BA 4ZKDA 1EESA 1ZUHA 4O2LA 1SVKA 3SZRA 4F4CA 1T0JB 4YXWD 4P31A 4PX9A 1XPOA 1Z0JA 3M6AA 3EA5A 2OEPA 5EXPA 3AGPA 2QAGC 3SE0A 3RHFA 3A1SA 4DCNA 1JNYA 4GL2A 1CULC 4DJTA 1KNXA 4TL6A 5FOWA 1KO4A 2HXYA 2V1XA 2O8BB 1EWRA 3ZJYA 1G3MA 1RJ9B 4FD2A 2BBOA 5AUNB 3CRMA 1CS4C 2OBMA 4IVRA 1OIVA 4Z51A 1G8FA 1E99A 4E03A 1H65A 2Z83A 3TJZA 3K70B 3FHTA 3A58B 1KSHA 1RFLA 2DWOA 3FYHA 2W2XA 3KKMA 2W6ID 4G01B 5CM8B 2F3RA 1Q44A 2ZAOA 4DSNA 1PLJA 1LF5A 2REBA 1CR0A 3K0CA 5EP3A 2XSZA 2QAGB 3ONWA 2YC2C 1I4LD 3K9HA 5KSPA 3WNBA 3DM5A 2JJ2A 1E98A 3PQCA 3EPKA 3U4QB 3W6NA 5SZIA 2G6BA 3A37A 3FDIA 3OIWA 1W0JA 4M9XA 2NO9A 2CXXA 4ARZA 2OV2A 4X8MA 4C7OA 1F3OA 5D3MB 5FL3A 1H8HA 4MRSA 1N5JA 1XP8A 3DEFA 4RD6A 5EE0A 4BFWA 3SI7A 3VTKA 2ORVA 4I99A 2VRWA 1XPRA 2WVJA 1SKYE 4GP7A 3CKLA 1ZM9A 3DZDA 3SFVA 2ZJOA 3SYNA 4EPWA 4W9MC 2VHQA 4D4LA 4AKHA 3QSYA 1Z63A 3GLGA 3P4XA 1GAJA 4LBYA 1TTTA 1L4UA 2EWWA 4LJ6A 3PJRA 4PPGA 3VR3A 1YQTA 1JECA 4C4PA 2ODNA 1E0AA 1GILA 5HKKA 1ZNXA 4HLDA 1R6BX 4MKFA 5DI9A 2AR7A 2WMNB 1NN3A 5HZHA 3GLFA 2C78A 2GESA 3EZFA 3W5IA 2DR3A 2QAJA 1D2MA 5LB4A 3TGPA 1MABB 2D3WA 3HYRA 1MRSA 1KTVA 1IBRA 4JZKA 3SFZA 4OHZA 1IONA 4DB2A 3B8HA 1W0JD 4URUR 4C0JA 2Z4RA 4CRWB 4WBSA 1D8TA 5G40A 1U98A 3B85A 1W5SA 3LA6A 2XGJA 2IHYA 1DBSA 2FOLA 3GCGA 2O8EA 3LLUA 1Z8FA 2PX0A 4FXPA 4AK9A 1KO5A 2G0NA 2EFDB 3NC0C 1S9HA 1TQ6A 5HPYB 5BQ5A 2AFHE 4XTCS 2GKSA 4R2HA 3EZ9A 1AGPA 1F2TB 1N6NA 2R8RA 1OYYA 3LD9A 1EFTA 2PJRA 1OIXA 2VP6A 3K9NA 1JEEA 2YYZA 3AP2A 4GOXA 4PHTA 1FNNA 2F1JA 4B43A 1GSIA 4AG5A 4D0NA 4OBEA 1RW4A 4XIGS 5D3QA 2R6CA 4O25A 4EPXA 2CCGA 3KQLA 2ZRLA 3NWJA 2A78A 5E95A 4BZXA 3QPVA 2VO1A 3BOSA 3KQUA 4M1MA 4XH9B 1DELA 3AQ4A 3LO5A 4JBXA 3W8RA 3CNNA 1NVXQ 4PSAA 1D2EA 1NI3A 4QHSA 2CK3A 3O47A 3MGCA 1KIMA 2BJWA 4RD3A 4MQBA 1OH7A 1ZBDA 5FBWB 3CW2A 1HQYE 4POAA 5FUVA 1CR1A 3SN6A 3DMDA 3H2YA 1VMAA 2GNOA 4KFTA 3W5JA 2QNRA 3FKSD 1NLZA 5FUYA 2FEOA 1E0JA 4DDVA 2J7PD 2N42A 4ZCLA 2Q9CA 4JSYA 4UKDA 1XMIA 1IHUA 1GITA 2B92A 2NO0A 2OUKA 3TR0A 5FBVB 1F6BA 3CPHA 2DPXA 1X86B 3SBDA 1WB9A 2UVQA 4HI0E 2IYLD 4ASUA 1UBFA 3MUFA 2RHDA 3FTQA 4TQ9A 1W47A 2IYZA 3B82A 5DO9A 3V00A 3EX7C 3RYTC 4OKSA 3FE2A 1COWA 3GLIB 2QL6A 1NF3A 1Z22A 2GEUA 3GJ8A 1Q12A 1MOZA 1P3JA 4NCNA 1RKBA 4DZZA 3D7MA 1IN7A 2RGNC 3CONA 4U7DA 1TL7C 4DIDA 1HY3A 4DEXA 4EAQA 1AIPA 3EWSA 1OSNA 3LW7A 4JL6A 3AUXA 2GVDC 4ZPXA 3EASA 3UG6A 4Z8XA 1LS6A 3WXMA 2GAAA 2ZS8A 5AWFC 1CIPA 3A1VA 2GJ9A 2W0MA 2ZR7A 4Q4JB 3IEVA 2VA8A 4A8JA 4LJ7A 5FR2A 2ZAMA 2PEYA 1E0KA 5DISB 1XWIA 5LDDC 2AKYA 3K53A 4NYMQ 3B1WA 2ZVPX 2IS6A 4FCWA 1QHHB 3PCRB 5J4YA 2WIAA 4BLRA 2F1RA 4RD0A 2D4HA 2WIBA 1T4GA 4GMXA 1CBUA 1P2VA 4B3CA 5CLLA 3GFTA 2KWIA 1QVAA 2OM2A 4DC9A 2D62A 2WHXA 3QEJA 1OW3B 3ZGXA 2ZTSA 4LHYA 1QHNA 4MKHA 2L0XA 3VR6A 1ZM7A 3B78A 5AJWA 1L4YA 1T5LA 2CJWA 5JMTA 5H8WA 2ZI5A 4XVUA 1SZPA 3B1VA 3RANA 3MJRA 3SHWA 3G82C 2G88A 4LJ8A 4EJSC 4DB4A 2KI5A 2GILA 3KJEA 4B34A 1FP7A 1XXHA 2Q6TA 521PA 1H8HD 3KFXA 4W5WA 3TAUA 3F0TA 1R0WA 2BV3A 4D2IA 3F8TA 4TN1A 3CM0A 3JZAA 5C4MA 3IEUA 1R10A 1T6NA 1TAGA 5DN6A 2J46A 4RZ2A 4V0NA 1G1MA 1W36B 2PLFA 2QT1A 4B47A 2ZJ5A 1ZD1A 3HPRA 2GF0A 3UXMA 3KTAA 5JSZA 1G6OA 4Q1DA 2XEXA 3ZQJA 1WBDA 2QRZA 1MABA 4V03A 4N1AA 2NZJA 3A8TA 1AK2A 3LVRE 3QKSA 2ZJAA 2WWGA 4KI0A 4DDTA 5JCZA 2YZ2A 4IEIA 3IPYA 3FKSA 2XB2A 2ZROA 3OEHA 3NC1C 2HJVA 1FX0A 3KJGA 4V0KA 4PQRA 4JVNA 1L7VC 2C04A 4WZBE 2ONJA 5E3HA 4PZLA 2ZYUX 2QQ0A 5BN4A 2ANCA 4Q01A 4YMVA 2JJ1A 1QHIA 2HDNB 2ZE5A 4HDQB 1ZP6A 3M1IA 1Q21A 3W6PA 2AKAB 2VHTA 2IYQA 1XCGB 1XZQA 3AP1A 4GBMA 1KI1A 2W6JA 1KO8A 4KYIB 3G0HA 2R44A 4URVR 2YWEA 2XJ9A 3HPQA 2DFLA 2HJGA 5IK2D 1XEWY 2C99A 2GCPA 4AYTA 1CLUA 4C0HA 4QRHA 1JXMA 2AD1A 1OKKD 2P5SA 1FZQA 4R9UC 2UZ3A 3ICQB 2DB3A 2C5LA 1D5CA 1AKYA 3H86A 4JLKA 4LBWA 4IOKA 5C18A 3QI2A 2ODEA 4LJ4A 1D2NA 1Z0IA 4BGDA 1GZSA 1SXJB 1U99A 1UADA 2FMXA 2OCPA 3BH6A 3RRYA 4PO9A 1E2HA 3GLIE 4RVCA 2H16A 1FFHA 2W6JD 3FMOB 4S35A 3WRXC 1OIWA 1XEFA 4AWXA 4QGGA 4N3NA 3K09A 1X1RA 1XD2A 3CB4A 3CRQA 4RFVA 5B64A 3U3JA 2FFHA 4I4LA 3CPEA 3CRW1 1KI6A 2VP9A 2ZJBA 2PX3A 2QA5A 4K81B 1ZUIA 1KDOA 2ZREA 5F3WB 3JZMA 4BZPA 3UIEA 2CLCX 3AVUA 3KTAB 1V5WA 2A3RA 2BM0A 1LNZA 4ZI3A 2ZI7A 3CH5A 4MDEA 3QF7A 1MRNA 2R62A 1OHHA 2WPDD 4DIEA 1U0LA 3U3OA 3QXHA 3VNVA 5JWHA 1ANKA 2CL7X 3NBYC 4NL4H 4QGFA 2GZHA 3GD7A 1G18A 4PQFA 4KJZA 4PQYA 1SVWA 4NYIR 2V8OA 4B71A 3ZYCA 4B2LA 1NJFA 2BBSA 3WHKA 2IW3A 2QTHA 5TMPA 1VG1A 4QHYA 1GFIA 1XTJA 221PA 4DT1A 2RH5A 4B6EA 3B1ZA 1IJEA 1VCOA 3LWNA 2FJUA 1P61B 1ZNZA 3AF1A 2GXUA 1NN5A 2JAQA 1BMFA 4GOJA 4HB4A 4LV5B 1FW6A 1ZUNB 3S1AB 1NBMD 4Q66C 4TTQA 2J0UA 1ZRHA 2OE2A 5CYPA 2GAOA 3K8YA 4G5QA 1IN5A 1KMQA 1WRBA 1GVNB 1QHHA 1VPLA 3FKQA 4MGYR 3JVVA 1KI8A 4BEBA 5F9FA 3BFVA 4FMBB 2ZI3A 4TTPA 3GEEA 2MSCB 1ZC4A 2ZXUA 1E2LA 1SXJA 2G83A 1TUEA 1X1SA 4EPRA 3BORA 3NHBA 3PVSA 4A92A 3OIUA 2ZE8A 2OFWA 2JJ1D 3U4QA 1EG7A 4LX0A 3SJZA 5IHPA 1S2MA 4ON9A 2FX3A 2JASA 5D3MA 4NZYA 1N0WA 1U8AA 1G20E 1L8QA 1WP9A 4MGKR 4QNRA 3SC3A 1II0A 3DL0A 4YXWA 5DSZA 4K8OA 1WCV1 2WJYA 4DSTA 3EC1A 3RS3A 3LNCA 4HUTA 1KDTA 3TQFA 2QP3A 2BMJA 2FU5C 1W4BA 1XJQA 3PEUA 2R9VA 2IUTA 4LPSA 3QEOA 2Z6VA 2LKDA 2ZYWX 5KDLA 4XWOA 5JLJA 1LV7A 3LVQE 5KNBA 3DDCA 1E79D 4R2IA 1JALA 3LH5A 4QG7A 3ZVNA 4XD7A 1N6KA 1DAGA 2QORA 1KDRA 5UKDA 3SOPA 4HAXA 2QU8A 4TLDA 3FOZA 5JRJA 1E6CA 3NDPA 4HAWA 3IIMA 4LC0A 3AF2A 2XZLA 1OYWA 1OV4A 1VG9B 4DLRA 4MGZR 4PAQA 4JIMA 4M1TA 4QGAA 3UATA 5EXSA 1FX0B 3CR7A 3KXLA 3BAFA 3TSWA 2H18A 2OCYC 4KV9A 3MAAC 3B9PA 3EA0A 1E9FA 1FPMA 3S1AA 1HH4A 1YR6A 5GVRA 4ZV4A 4N0DA 3IIKA 3ADKA 1EXMA 1JR3D
chains in the Genus database with same CATH superfamily
2ZS9A 3UGTA 2VPQA 2CNOA 5B55A 4UNRA 4XDGA 1EPUA 5C4MA 1VSUA 2WZCA 4CF7A 2ZUFA 1I0LA 3WMFA 2XAUA 3DV0A 1E9BA 4JBIA 3X2FA 3GELA 3QPBA 5NLLA 1XQVA 4LKRA 3O8CA 4PLZA 1ZA2A 1U04A 3BDAA 4WK6A 4YO8A 3UMSA 3V6LA 4PCVA 1DNPA 1ZVQA 3T35A 3CNEA 3FOFC 1EK5A 3NTOA 2YTZA 5I7OA 4JBYA 4J3JA 1XZJA 3RC9A 1R8JA 3R6DA 3OAAA 1OBVA 2J87A 3RSLA 2EEPA 2ZM5A 3BHNA 3RTAA 4AF6A 1SMKA 2HO4A 5T7BA 1D04A 2FB9A 3LZCA 3J7TA 1U3GA 5JCJD 1CK4A 4RMIA 1GFWA 1UEIA 4XCQA 5DTJA 3QTBA 1V8ZA 4E12A 1DX6A 4WX2B 4FOLA 3N5CA 1PNVA 5CAEA 1CRLA 5JPCA 1JHDA 2OB1A 3DOIA 4EG4A 4D9FA 3VZDA 3RHTA 4H1HA 3JYLA 4MCAA 5KPJA 1UK7A 2FJ0A 3DEJA 3KB6A 4FR0A 4KGDA 4BNKA 1VKOA 3D5QA 1GDTA 3DD1A 4EWLA 2I4OA 5DLQC 1HURA 4HDOB 1W0KA 3RAEC 5EE9A 1Z36A 2J1LA 5F51A 4WK2B 4ZOAA 5DCYA 2QB5A 5IVKA 4J6EA 5DB4A 1D1TA 1RXVA 4HWKA 2G1JA 1B15A 2O20A 3NXKA 2JGEA 4KQ1A 3FPHA 4NEHB 4TLBA 5IT0A 3E9RA 4LHXA 2ZATA 3GLGB 2NUAB 4WTOA 1BROA 3CF4A 5KNCA 5TE9A 5A4DA 2R6HA 2ZRMA 3CV3A 3R3VA 5B53A 3ESDA 4C4TA 2CXQA 3FSRA 2PIDA 1Q0RA 4BHTA 4AAYA 5KSZA 4H60A 4ZPJA 4P0QB 3B1FA 5E9QA 2VNSA 5BOSB 2O2XA 2VQDA 4W5HA 3MRVA 1MBZA 2OHGA 1M2NA 2UAGA 2JLSA 3B1JA 1DXQA 1N6LA 4HB3A 3A6FA 1L4BA 4LDQA 1L7MA 1NSYA 3LYAA 1Q7GA 2F1OA 3REQA 2CUTA 2M6LA 3WZLA 1NU8A 3B13B 1QVRA 1WXEA 4DL9A 5BSVA 4D25A 2CVQA 4XRGA 5IANA 3MA0A 1H2XA 3G85A 1TMKA 3ZU6A 2F64A 4MR7B 3LT2A 5JWRA 4ALLA 1YR7A 3KE8A 5GJVC 1QIIA 2P11A 3ZR4B 1MG5A 5LFAA 1MHTA 4FHDA 5K3SA 1YO6A 5CA1A 1SB9A 4BU1A 1E2PA 4Q7MB 1VJ5A 3EUAA 4H27A 1HWYA 3IS3A 4EQ6B 1SXPA 4LKOA 4IG4A 4W1QA 3D0OA 4PLCA 4RZSA 3RYFB 1YULA 1ZESA 5H02A 3PQDA 4A2WA 2OD7A 5ITZA 1NJ6A 5ITVA 2A94A 5KB3A 3NH6A 5JTTA 4RJ2A 2RIRA 2J9YB 3NP9A 4GOND 4MV5A 1WQ1R 1L5MA 3DJFA 2FJPA 3F46A 4MUXA 1GA4A 1TNDA 4O63O 2WD7B 5THKA 1IMJA 3U80A 2JLWA 4QBKA 1T8TA 1B0UA 3AR7A 3HJGA 4AJ4A 4EKEA 5DM0A 4K1LA 3EZLA 3ZDEA 4JJ6A 5FO0A 3O4GA 4CLDA 1KJJA 3TW6A 4MZDA 2W8BB 4PONA 1BQ4A 2HCRA 2PH5A 3KJNA 4GGOA 2C1ZA 4ABYA 3PUWA 3R6TA 1PFKA 3BRCA 4OYLA 2EV9A 3OCXA 4EHFA 3HU5A 3IPCA 4EM6A 3W8EA 4DSOA 3L7IA 1VKNA 4F2PA 5FNZA 4OB7A 4DFDA 1ZVJA 3HMKA 4O59O 2ZVQX 4NY1A 4KSCA 2QENA 3MMSA 3Q8XB 2WHEA 4WL0A 4Z1MA 1NM5C 4UPEA 2C7QA 3C4QA 5C2JB 1XU9A 1WXGA 1WWKA 2V4ZA 1U3CA 3LPMA 4EF5A 1LSUA 2JATA 3O4FA 2ZIXA 1LZKA 3U1BA 4BMDA 3ZXSA 4MJXA 3WWCA 4LBZA 4Q7EA 1SVMA 2C42A 2N47A 1LPPA 3QZUA 3PPYA 4UAVA 4DLPA 1JFFA 4EYOA 2WJ3A 5I51A 2JLUA 3A31A 2PX5A 2PVSA 1KIAA 3PTAA 3FAZA 4JITA 1JPVA 2RB5A 3KLBA 4DLVA 4YUZA 1ISIA 2ACVA 3FCSB 4NOLA 3TMKA 5IT4A 2PT6A 3PX3A 1Q20A 4BBAA 2QL5A 3G3EA 1ODFA 3HTXA 3UOWA 4GAEA 5TGTA 1QOZA 1KXJA 3DZKA 8MHTA 1RNLA 4CUZA 1QDEA 4OQMA 5FP0A 2GETA 3EHDA 1VC2A 4MPRA 1AKTA 1DBWA 4P32A 5KNBH 3RJMA 1K68A 2YC4C 3BWYA 2FPIA 1BGXT 1JWAB 3I76A 5H81A 3HXLA 4EBFA 2IOFA 5B58T 2HL6A 2ZAGA 3IAM1 1E5LA 3QFHA 5KNCD 5KBYA 3R0JA 1P6QA 3LMKA 4HAUA 4WOJA 3CUVA 5DNUA 3JRWA 3OZVA 1PL0A 4UD2A 4K9DA 2PR2A 1UPUA 2PX8A 4LPKA 4EA6A 4Y2YA 1A5SB 1G7TA 3ZW8A 1X7XB 5PNTA 1EI9A 2RAFA 3RH0A 1OWNA 2P9EA 4BB9A 1S3GA 4ZCTA 4DLBA 4BJ6A 2P2SA 2ZYDA 3AFMA 5DGXA 4CKCA 1G7RA 1I13A 2QMUA 5DHPA 1OYOA 2O7QA 5H3LA 3BJMA 3NOVA 2Z09A 1G5PA 3O9MA 2Q3FA 2E4YA 3K35A 4B3MB 1EDEA 3CWQA 1LJ8A 5HKOA 2HT6A 2R4UA 2JLQA 4PZ9A 1MF7A 4G5YA 1QV9A 3EXFA 4UM7A 1LPAB 3W1VA 1CF4A 3LL4A 4LGVA 1IXKA 1XCLA 2ODBA 4JHXA 1LBIA 1WCWA 4N7JA 4TTIA 4YP9A 3TW8B 5CVUA 1R9GA 3NDIA 1N3YA 3AOEC 1N7GA 1F0KA 4G0YA 4Y6PA 4IKEA 3P71T 5IDQA 3WL3A 1RYMA 1KZHA 3N58A 5JAOA 3QFFA 3EN0A 4BBZA 1HNXB 2C77A 3NALA 1GEGA 2FFQA 2GN0A 3B3FA 2G80A 4F5YA 4C1BA 4OFXA 1I4OA 3PUYA 1XK7A 4YJ2F 1E4YA 1PK8A 4IIJB 1WZIA 3TLMA 4NU0A 1XQWA 3FRJA 2FSHA 3QJ5A 4V02A 1EKXA 3MEQA 2BEJA 3X1XA 3VKGA 4GX2A 2C0QA 4OB8A 4IS2A 2ORWA 2WIJA 4M7PA 4GYYA 3FCEA 3H2JA 2J6IA 4QBIA 3FTCA 3ISVA 4ZIRA 1K63A 3JU3A 3ORRA 3T0IA 2IHUA 4KOAA 3MG9A 1Y9JA 4HQOA 4PN3A 2F3UA 3GFVA 3KHSA 3V8BA 4PG7A 5EE3A 1A88A 2Q1YA 3D3KA 3G7NA 2W6OA 4PYLA 3FNQA 3VDQA 1KJYA 2HU7A 3PNPA 5J4KA 4UNPA 1FMFA 3ZK7A 2XYVA 1NVFA 4ZU1X 4QO7A 1C9NA 2FPRA 1I7PA 2WKQA 4BMPB 2MR6A 2WTMA 2X23A 4DV2B 1XSEA 4KGXA 1MGPA 1ZNQO 3HO1A 4QBGB 3SS7X 1HG1A 1WY5A 1YR3A 4IDQA 5HFNA 3WBJA 3IAEA 1F1JA 3FLBA 1ZINA 4L74A 5AJVB 4X66B 2P90A 1UBTS 2MIIA 3K9LA 4OHOA 5EOVA 2H1WA 1S2IA 5DM70 3WYFA 1Q7EA 1KI7A 5I9IA 5FI0B 5H82A 3TIGA 2J0UB 5LIRA 3Q9NA 3KZKA 4LECA 3VNUA 3NATA 1R6AA 3V1LA 4KDRA 5AHXA 1W35A 2PWZA 2TECE 3KKOA 1Z0AA 2IEYA 3K09C 4LJ9A 5AK4A 2BTQA 4ZAZA 1R88A 1X3LA 3S44A 3ZLUA 4DQDA 1CDEA 4RADA 1GPAA 4F8YA 4UMVA 4G1UC 4EK9A 4J7UA 1V8FA 4Z7OB 3UT5B 4EP1A 2OPBA 3NYWA 1UDXA 5DKFA 1AQJA 1QP7A 2GM9A 1Z08A 3MJVA 3WYEA 5ULLA 1E5VA 3IHTA 2I67A 4O33A 4YTEA 5KOJA 1LSJA 3TTWA 5L45A 1HORA 3N2IA 4OXNA 4RDHA 2O8DB 2WJAA 4NC9A 3AH8A 1NVUQ 4G9GA 5C5DA 3Q6NA 2WSBA 5EIWA 3UOGA 1FTQA 2R0QC 2IH2A 2FRXA 4YVFA 3F6RA 2VP3A 1FTSA 2J09A 3WK4A 3WQBA 5F9HA 3D3NA 4G37A 1HZJA 1ISMA 3CGWA 3II6X 2CEAA 3TL2A 3PNQA 3G5MA 4XSGA 5K99A 2HUPA 3WJ7A 5KYUB 3VNBA 1CY4A 1R4ZA 4TUYF 3UCXA 3C3XA 3OESA 4NICA 1QMPA 4NULA 1FDWA 2BKXA 2FE4A 3CR3C 4G26A 2PE5A 2P27A 5DGHA 3NXSA 2C8VA 2CLLB 1C1DB 1O03A 1U63A 4BV3A 1YQ9A 3ENNA 3H5RA 4B3SB 4MCHA 4P4TA 3ILYA 1MZPA 1C8BA 2PBLA 3VR2D 3PJEA 4V0MA 2EOAA 4TLEA 3EDQA 1KJ9A 4GWGA 1Y3FE 4F5DA 1GM5A 4V2UA 1Y3AA 5JDCC 2GNPA 1NQWA 3CLTD 4KQ6A 2NYVA 2WILA 3MS7A 5C1IA 4EHIA 2AHOA 3LL7A 3WQRA 5A0VA 1UQRA 2Z4SA 2DFPA 4QYIB 1SBQA 1HQCA 4KXVA 2BCJQ 1T1IA 2GKGA 2JA1A 2W2KB 1DMRA 1XEWX 3PB3A 4BX3A 1UZLA 2I4NA 3IR7A 2GNAA 1EDBA 8ATCA 2IE0A 1ES9A 1OT3A 2IY7A 4QU5A 5HCUA 4YCNA 3ZE6A 3M3PA 2HB6A 1E7QA 3KCNA 3GX1A 1F17A 4TXLA 3V48A 4YJGB 1EU1A 3L4KA 2Q7XA 4HSEA 3GAFA 3Q8KA 1OZFA 1C3XA 3T94A 3O82A 1Q1EA 1UKZA 3L0DA 4KIWA 1NNI1 4JYMA 1BE8A 3NKVA 1E20A 5A71A 2X0FA 1G21B 5CLQA 1F8UA 3BCHA 1TUBB 3KJIA 4XLTA 1RPAA 1MUUA 3O38A 3VGPA 2B7BA 2WUEA 3FPSA 1P5HA 3MC1A 2MTBA 4R0NA 1NJ1A 1A5TA 2PUBA 3ACDA 4LXIA 3RTEA 1PJZA 1FMJA 2GCGA 1XLWA 2YFYA 3CF2A 2YS7A 3RUDA 4DG9A 3A05A 2E1RA 4ND3A 3NOOA 2HHAA 4PIPA 1AGYA 2EZ8A 3SBEA 1NW6A 1PS9A 1NTRA 2OMKA 4FDMA 2WIDA 4UBJA 1FJHA 1XEXB 2XZPA 5HQ3B 1ZFNA 3I34X 2ECQA 1U8EA 1SAYA 4JBGA 2E2WA 1BFKA 3FOEC 2JZNA 5IK2A 5CDSA 1NG9A 3N75A 4FW9A 4WXHA 1MV8A 3A11A 2GCNA 1NN0A 2MWMA 1N5LA 3KOZA 2W42A 3QVXA 1SUEA 3WLMA 1M2OA 4YYEA 3QEAZ 1AD2A 1E2DA 2PT9A 1QQBA 4CQLB 4I1IA 5AVWA 5EWLB 2MSDB 2EBUA 1TZCA 4O3FA 4IIJA 3AESA 2BGWA 1TJ5A 1UBEA 1Z5UA 3W9UA 3M70A 4WFKA 3WI7A 1RTTA 2P2LA 1O6GA 4FUTA 4XDZA 3TMAA 2QN6A 2WKSA 2C7VA 3DFFA 3IEPA 1P4HA 1YMUA 4RULA 1THGA 3CLRC 3GLFE 1D09A 4HOYA 3G0IA 4LWZA 4OI2A 1O97D 1T24A 3FB1A 1VZ2A 1EMDA 3PEYA 1OF1A 2F3TA 3ZV6A 2QXTA 1AA9A 1JG1A 1UT8A 1NP7A 3AINA 1SHTX 3FOCA 4QTZA 1FA9A 2YOGA 3FWYA 4RA6A 2ZJ2A 2ONZA 2Z2KA 1R9NA 5HK8A 4OHMA 3K8QA 4AIRA 1ICEA 3D6NB 1XALA 2EX4A 5ALHA 4IEEA 3CLRD 5BSWA 3RYHA 4XCXA 4C01A 4PINA 1KWKA 1DAEA 3KP1A 1UDRA 2QMHA 5K09A 4IO0A 3AR4A 1G3UA 3R9WA 5AVRA 5GADl 4UOQA 2VTBA 1FQKA 4RVHA 3CC8A 2EGGA 3A7DA 1JA0A 3FMVA 5CJ2A 1UMCA 3U09A 4FOOA 5I48A 3UKOA 3KETA 3K2BA 4Y7CA 1IZ0A 1O96B 5DT2A 3K0CC 3TLXA 2IPLA 2R751 3LYUA 4Q3AA 4QOEA 3ZW7A 3FZEA 1FS4A 5AW2A 5K0ZA 4NK5A 2H7VA 3ZHXA 1M8FA 4C0LA 1EIWA 3WA7A 3F97A 3PGA1 3U44B 3KPJA 4HGYA 5F98A 5A3JA 3S2GA 3VBEA 1ESZA 4ZDKA 3AF0A 1FXUA 4ZHSA 4BYMA 2D1SA 4FN5A 4O8ZA 4OMDA 1ZCAA 1G9TA 1SQGA 3VU1A 1DAIA 3PUJA 1FVFA 3OZDA 1JFRA 2NWQA 3QLEA 1RHQA 3TRHA 4M9SA 5MN5A 3AHGA 3QBDA 4A36A 2ZCVA 4RX1A 4F9TA 4EUFA 3GBSA 3EY9A 3HABA 4UEJA 3WX0A 2IH5A 4X20B 3JQAB 2OHOA 2YN2A 4R16A 5IWAB 2NQ2C 2IF0A 1FF9A 1L7RA 4Q4CA 2XXAA 2OFOA 4N3AA 2REXB 1G60A 4HQLA 1EA5A 2XUIA 3MLBA 5EWLA 1EFHA 1AS3A 3TIXB 1RXIA 3DE0X 3RIMA 1XJCA 2RMKA 3DVSX 3RVLA 4L4ZA 1I9GA 3A9UA 5DNCA 3SE7A 1AKRA 2VP2A 3THWB 4DWJA 1PFVA 3PHGA 3QFSA 3ZWVA 4RTQA 4LQLA 1JDVA 2V6FA 4UXHA 1H4QA 1XDZA 1U9YA 4M1EA 5EMHA 3HCAA 5IAEA 2JJ2D 3HO8A 4K9MA 3ZWDA 1LY1A 3ACCA 5IM5A 2N1BA 3AL3A 3GMIA 2IFTA 3WSVA 2FPOA 2B4RO 1KEEA 2NMVA 3OCUA 2FPPA 2HRBA 3K6SA 3AI3A 2Y0CA 4IHJB 4NBRA 3KT6A 1ZI8A 2CL0X 4KXUA 1E1QA 2VRBA 1GG2A 1WB4A 3MWDA 5CA0A 3TL6A 3VJMA 5K8JB 2AYZA 1URPA 4H15A 4TTSA 4B17A 1RMQA 4LJYA 2PA0A 1FFEA 1KZ1A 4WKOA 3TYXA 4WBNF 2IYFA 1YQWA 1CZKA 3UO8B 3PCXA 2CYCA 3LPCA 4JUAA 4WZBA 4R9SA 1TM7E 1K75A 1P0MA 4GP6A 2VJOA 2IXFA 5I4BA 3LZDA 5AJZA 2C84A 5GM1A 1YJAA 4D74A 3HHEA 4P5PA 4E0BA 1QQ7A 4BX8A 2D7DA 1G6Q1 1SBHA 2RKBA 2IBTA 1N3LA 1GU0A 2XMRA 2DQYA 3OSUA 5AK0A 1RRGA 4MLDA 4KC0A 1OFTA 1ZK3A 1N9ZA 2V6BA 1VHLA 2P5TB 1QRAA 1C3LA 1ZOLA 3A3OA 2OKCA 3AXSA 3EVEA 3KQWA 4S0XA 3TGWA 4ZZIA 5GV8A 2AFIB 2JGRA 4N12A 2IEZA 3LGXA 1MEOA 1VYUA 1Z68A 2DM6A 1X1CA 4IW3B 1QONA 2QV7A 3AVQA 3AERB 1NY6A 4GMHA 3ZC3A 5HM6A 3QUBA 4W82A 1MTZA 2YX1A 3B9QA 2B7LA 4BL5A 1YS7A 2VKTA 1P75A 4IXMA 4BLUA 2AW5A 3UN1A 1I3NA 3DBHA 2Q5QA 4FJ1A 3TWOA 1MCZA 1PG5A 3UCEA 3VUEA 1YS4A 4W8OA 3ZIAA 2BLNA 4QKQA 2BFFB 3A2LA 2ZQZA 1YQUA 3FIJA 5HIJA 5L9AA 1VIYA 2V7BA 2PXCA 3CFYA 1AUOA 1JNXX 1X7WB 3FCOA 4PYKA 4X1YA 4YUVA 2PXAA 2X2FA 2YV5A 4IP0A 4YCMA 2BGUA 4OY3A 5EQTA 5KWJA 2X8JB 4TKUA 2XKJE 4QYMA 1QORA 4DNFA 3GEHA 3QSGA 3DOEA 3ZXXA 5IU6A 2WJPA 4RTSA 4J0HA 1RPZA 1MHPA 1GHTA 4RV9A 3DH0A 4Q4AB 4XXHA 5DDIP 1YVDA 1MEEA 1QUFA 3IMKA 5CD1A 1SKUA 2QV0A 1V4NA 3AZPA 3A6EA 2IDJA 2W83A 2XNSA 2ACEA 1I32A 1U1DA 2HPZA 3H1BA 4QXAA 2BSAA 4A10A 1DX9A 4D96A 4NARA 1QVZA 2Q4EA 3R4VA 2PLWA 4TL8A 3U60B 2XUHA 3UANA 5HJ7A 4N39A 3ZEAA 4JLJA 1W5EA 5ELLA 1MJFA 1T35A 2VHYA 5CX1A 3A6GA 5AUQA 1Q2XA 3WKAA 4CT4B 4HLQB 4DIBA 1ACJA 2YXPX 5J1TB 3EPRA 4YDHB 1YBFA 4Q12A 1QRRA 4HNQA 3ESZA 1VGQA 1RXSA 1IQPA 1FNCA 1S9DA 4JU8A 2M6RA 4ALJA 2I03A 4FB4A 2QXYA 2QDKA 2GDJA 3SHQA 4CF6A 2WK1A 1MJGM 5T6BA 1BS2A 1E7MA 2BUCA 3GR6A 4D79A 1WSAA 1U1IA 5D87A 4E5KA 2K2QB 1GKIA 2EDAA 4QQNA 4C1NA 1ZRMA 4G5FA 1MVNA 3TVYA 2VDNB 2BMWA 1NBMA 1L4MA 2HTEA 3CBQA 1QNLA 3R6LA 4WEQA 4MYUA 3RI3A 3RLIA 5SYMA 4KSBA 1DKLA 2X0KA 3LUBA 4AN1A 4X3CA 3KX2A 1YJXA 3MFQA 4MKGA 4YMWA 1UBMS 1I7NA 1I80A 1X80A 4KP7A 2RHOA 4X3PA 4PO1A 3C6ZA 1RQPA 5HF6A 1XCPA 2GTPA 4C6RA 4JUBA 1N2CA 2Z56A 1ESMA 1VHQA 1VECA 1NRXA 3F5FA 1BH6A 1Q1BA 4IVPA 2H2WA 4KPUA 1G2OA 4Q4HB 3I45A 3RWMB 1DC4A 3DEKA 5FI1B 1NDQA 4RIGA 3REGA 2ORYA 1NNUA 1II8B 3RTGA 3TZBA 1EWTA 1Y3HA 2GJKA 3EPPA 1T0BA 5IKOA 3MT7A 1H2AS 1ND5A 4B5KA 4U9UA 3U5TA 2FV8A 1Q1ZA 2ECFA 1R4MB 1EUDA 4QICA 1GPUA 5JJBA 3OQHA 3ZBPA 5A04A 3X1ZA 4X7MA 3M2PA 3X2EA 4PC1A 4RY2A 2PMEA 4JJKA 4EG8A 4TKVA 1FLVA 2N9UA 2II6A 4FMDF 2ZI9A 5KVAA 4J2OA 4YRAA 1GRVA 2QM8A 2VEDA 3GP5A 5K01A 4FT4A 2CHGA 1G9XA 1NFRA 3GJ4A 4FYIA 5DULA 2ZRCA 4WKPA 1WKCA 4D1YA 5BT8A 2F7SA 1TO6A 2G9UA 2XX3A 5AI0A 3PR3A 5FV4A 3H75A 3LUFA 2WSLA 5AQEA 3R3XA 4TSFD 1V11B 5AVKA 1P60A 1IDN1 4HN4B 4Y9TA 2ZRQA 5FBQB 3Q7TA 4CFYA 4UE3S 1L7QA 3N87A 4AKIA 1W0KD 1A8SA 1NUUA 4NZZA 1SA0A 4R40A 1CUYA 1KFBB 2QRVA 2ZVJA 1AS0A 3C24A 5AKYA 5CAEB 4DYDA 2R8OA 2R7KA 4Z9FA 4AWBA 4YBRA 1DDGA 2CWDA 4GOOD 4ALIA 4DQ0A 2PX2A 1L5VA 4G3XA 2CVPA 2YZMA 3OE7A 3IP1A 2CT8A 5AH0A 3ZVMA 5AO9A 3IEMA 2RHLA 2FFBA 1MX9A 2HJRA 3MD0A 4LE0A 4X63A 1N8TA 1QZUA 3KEOA 1QQAA 2WM8A 4PGMA 4F8JA 2VHCA 1PN3A 2C2GA 4QT0A 3ZLJA 1G5FA 3KT3A 5LXTF 2J3DA 3L4BC 3LX8A 2I8CA 2EC5A 2R6GA 3P9KA 4S1TA 1TU4A 3KQNA 4EG0A 3N28A 1G4UR 2V6MA 3GROA 5ENZA 5TV2A 3FHOA 2O2HA 3JWPA 3RVBA 2A9PA 2NPIA 3EBOA 3C4VA 3FX2A 3KDAA 3LT0A 3GZTB 3HY4A 2WE8A 1C14A 3LXUX 2Q21A 1WSDA 1H3NA 1XL0A 4F6LA 3FWNA 5JO0A 1RKVA 4K46A 3STVA 1ULSA 4R8MA 1MRZA 3EDOA 4EJ0A 1REQB 1TEHA 3HDQA 4PTLA 1CNMA 4QT4A 1TZKA 1CVIA 1GGVA 1FW8A 2JHFA 1I30A 4TYNA 3VR4H 5C32A 3Q8MA 1SU7A 4GX0A 4KO2S 5AW9A 1QYDA 4ZODA 1E79A 4D56A 3I9LA 3IUJA 1F2TA 1YFZA 2ATIA 3FH0A 3MGKA 4J1TC 4RLQA 4UTXA 5I7VA 3L8GA 2JHPA 1N6HA 2I2XB 1CVRA 3B89A 1BA3A 3TSZA 3UZUA 1ECJA 1PR0A 2ZIVB 4AS1A 1RHMA 2FQQA 1GUBA 2JARA 5T4BA 4K86A 3ZKWA 2E37A 1M8PA 1XQ6A 2R97A 3MWLA 3OZGA 3GYGA 1MA0A 4KE6A 5CURA 1N7IA 1TJ4A 3FMIA 1YAJA 4UHBA 3OEWA 1W96A 3PEVA 4YP5A 3H2SA 3LZ6A 4MW9A 1YA8A 3ZV3A 1NLUA 1UXHA 4DAEA 1I2CA 3V2IA 1H2RS 1MKYA 3FSJX 5DH9A 4G9EA 4ZVMA 1X94A 5FOUA 5JQGF 1OWLA 1H2ZA 4MS1A 4TKZA 3I1FA 4HK4A 1BMFD 1F8XA 1LI7A 2I4TA 2AF3C 5AI8A 5DWDA 3WDSA 3FM9A 1P1FA 1X9GA 4BB6A 5HRAA 4P58A 1M5UA 1VRWA 1EX7A 2GD2A 3KQTA 3GARA 2IWHA 4RTMA 4M9CA 2QVGA 2J5KA 4MPDA 5HMLA 1P74A 1WE2A 4ILEA 1P8JA 4DIMA 3GF4A 4HS9A 5K3CA 1KY2A 1ODKA 2HU8A 1ZJJA 4ZEXA 4EYQA 3WP1B 1QH1A 2VNIA 4I5EA 4HLNA 3RT7A 3PG5A 4J1NA 4PE5B 4C7BA 4JAVC 1J25A 1JPJA 1ZVMA 1NMXA 3UAVA 3UAYA 3VAAA 1RQXA 2KQUA 1NI5A 2XB6A 5IKMA 3I3SR 2HFKA 2O4CA 2R8PA 3M1LA 3R0QA 1YXMA 4F56A 3HXMA 3S2SA 4Y0AA 1HL3A 1UM8A 2C92A 4HY3A 3PRYA 4Q0MA 4N5DA 3K0BA 4UBIA 3H4MA 4B79A 3CVYA 3V1YA 2NP7A 1QLHA 2CXRA 3A4MA 1QH8A 4KMRA 3KB2A 4UTRA 5KTOA 4PG5A 4YMGA 4P81A 3FBTA 3A32A 4A4DA 3UHJA 1Y9ZA 1L6RA 4IGFA 4QECA 4EYGA 4B6QA 1WCIA 2JAHA 1T3LA 4OP2A 1C4WA 2O52A 3VZQA 1U2DA 2A3NA 2ZUDA 4AP5A 2EW8A 1V4BA 4J75A 3A3YA 1SGWA 3GN2A 3K1YA 4W7SA 3ROZA 3CLSC 4BNZA 2WFMA 1JIQA 4KMOA 2VZLA 5JD4A 1XA3A 3GFRA 4PLGA 4TQGA 3VDNB 4EUHA 2NO7A 4B0PA 2NUTA 4QPJC 5TPWB 3U7GA 1ZG3A 2NACA 3PXAA 4BKPA 2IDZA 4F2WA 2I54A 2WT8A 1MB3A 5FFNA 3U3ZA 2GN9A 3S8YA 1EFKA 3ZV7A 2QD3A 1Z5OA 3Q98A 4LYAA 5C1DA 1EAYA 5CGQB 3SQXA 4CL8A 4YJFA 3G9TA 1M2FA 3ABQB 2WSSD 5DTIA 2JAPA 1XGKA 4QELA 4ZEWA 2E3JA 3KHTA 3UWPA 4JA0A 3KVRA 1AXEA 2AI2A 4P9NA 4F06A 4N8SA 4AO7A 3UPTA 1TU0A 1NPDA 5JBIA 1MD9A 4TKLA 1MNQA 5KCMA 3ISTA 4K6OA 3NTXA 3D31A 1CVLA 4RZ3A 5C8XA 3TOCA 2HXSA 2WHYA 3WTCA 2HWUA 5D86A 3HVKA 4RTNA 3NO4A 2QLFA 4K03A 3QG5A 2BC9A 2BKLA 1ZQ1A 3IAS1 1ELOA 3L8FA 2CYAA 3W5BA 2VK1A 4YCDA 1KOGA 3WL7A 4J90A 2KE5A 3PFWO 3EPHA 1J49A 3I8SA 4L9SA 4ENUA 1NP3A 1RRPA 3HXPA 1SPBS 2IPAB 2EJCA 1KOJA 3AB8A 3NJ4A 3S2FA 1B3BA 2WTEA 3ORHA 4X5OA 3ZLVA 1LLFA 3OJLA 1CU1A 2ZDGA 4Y1GA 3ZHBA 4NZOA 1YOBA 2C59A 4Y98A 4F86A 1U0GA 2VEOA 4IJVA 3ZWPA 4A91A 3LC1O 2BSQA 1T6BY 4BY9E 3KFLA 1ZAYA 1A8UA 2DX7A 4ZKEA 3SYTA 4HXEB 1E2EA 3I52A 4IRUB 4RK4A 2E87A 2GB4A 3UWSA 4C7OB 4NHEA 4HNGA 1Y4UA 2FOIA 2FMHA 1J24A 2NXNA 2JFGA 3FCAA 2D1RA 1JYEA 4DBLC 3OA0A 4NV3A 1OTYA 5EZYA 2FSUA 4UHEA 2YNMA 2JAUA 5K51A 3DOOA 4ARAA 1TPZA 1NUTA 2OV4A 1UBKS 3WWDA 1KZ4A 2C5GA 2VN8A 3CNHA 3ZZ0A 3I2HA 4PPYA 1SC3A 1WQ4A 2ZRPA 4LXHA 2V7EA 1AKMA 3OY2A 4RIFA 3RK1A 2H52A 4FFWA 4O4HF 3ESYA 1HDOA 1ZCFA 3PHLA 3JALA 1GG8A 3PUZA 3CX6A 3DCJA 3IAHA 4HXFB 3VPSA 2V0NA 4LXGA 5KQMA 1UT6A 5DX1A 2Q3MA 1NW9B 1S3FA 1UMBA 2QJRA 3EUFA 2XUZA 4R8KA 2VDPB 4Z4GA 4Z4CA 3G1WA 3ZWCA 3H7AA 4D8YA 3SOZA 1SUFA 3JVIA 4FJ0A 2CD9A 3ZK9A 1PR6A 5I4CA 5AKZA 5JSFA 1BVUA 2H9AA 3B1YA 2WDPA 1E69A 3RS5A 1Z5PA 4ZO4A 4IINA 2FQXA 3WLSA 2IPXA 2AXQA 2C2YA 5AKLA 4PYJA 3FUCA 1PS8A 4KQJA 4Y18A 4YJKA 1MB2A 2ODPA 5I01A 1C7IA 2ZPAA 3NHUA 3UUFA 2OL4A 2R2GA 3M6WA 1R16A 4HR7A 3GRZA 4OQNA 3QVSA 3LRTA 3SXPA 3AM5A 1D2CA 5DSTA 2R6ZA 5G3ZA 5KYXA 3L18A 4ZT2A 2FUKA 2F48A 2OQRA 2AC4A 2PH3A 3HDGA 4MIOA 1UJ5A 3QXJA 2NGRA 1OYVA 1MX3A 4NZ9A 1IOZA 1V3QE 5DWQA 1QIMA 2ZJZA 3DWIA 1Z6XA 1EJ6A 1T6YA 2F8MA 3VR4A 3WAKA 1WNTA 2B0CA 3T3DA 3JQ6A 1MEJA 4P4LA 4YONB 1G20A 1VL6A 2M98A 2O3RA 2PZKA 3OM8A 3OPYA 4Q19A 4Q47A 2A0XA 1M66A 5M3BA 2DBVO 5K0TA 3SXUA 2FZVA 2I76A 5BQ3A 1OXVA 1QE3A 2H2IA 1J39A 1OI4A 2PSEA 2XMCA 1I0IA 2FEAA 4LQDA 4RY9A 5DE3A 2JG3A 4YQYA 3L6RA 5E9WA 3LFHA 4BLTA 1T3TA 2WAAA 2FQWA 2RGRA 5T8KC 3JQ9A 1T6ZA 1DKUA 3I32A 4QPNA 1VMDA 3M3HA 4CIBA 1ISFA 2WF8A 1DWPA 3F3MA 3T4XA 2OFFA 1NX6A 3PXEA 1MVLA 4RF4A 3ZVRA 2J8ZA 2GLTA 3VGJA 3KXKA 1Z74A 2ENUA 2P68A 4HGNA 2QDXA 3IP7A 1EFUA 2KM1A 2IZ1A 1XP5A 2DJ5A 3BHIA 4L22A 2Q45A 5IARA 3R7WA 4LJRA 1TMGE 3N7UA 1M83A 1CJBA 2HXGA 4WNIA 1R9JA 3A1UA 1CEQA 3M1YA 1D9ZA 1E1RA 2P9HA 2QW1A 2JFVA 2ZYTX 3E3LA 3L0SA 2G5TA 3AUYA 1Y81A 1OU4A 3B6MA 2OECA 3KXIA 4NPAA 5D7NA 2HSWA 5EEHA 3DVLA 1PZNA 2OZVA 3BRWD 5FUXA 5CFQA 4A2QA 4ALKA 4XX0A 4U7PB 1YKFA 1JAHA 4ZGGA 1HYQA 1VIAA 5CEFA 4UTOA 5JRDS 2D13A 3PNLA 1MO5A 1Z33A 3ZI0A 3I2YX 1P7WA 3Q5GA 3EVFA 5JE8A 1KAMA 4FOPA 1JQDA 3P1JA 1GO2A 4WUTA 2BH9A 2X58A 2CDAA 4LJ5A 1NA5A 2FCRA 2V59A 3PITA 1N1GA 1I0ZA 4KBYA 5AHWA 1K3TA 1UANA 1XTKA 5E7IA 4AP6A 4CU2A 3NHRA 1LDNA 2IS1A 4NOMA 2HV8A 2OHIA 4Z2AA 1W36C 2H4JA 4O3MA 2FWMX 1LTHR 3GDGA 1XA4A 3OFVA 4F4DA 1QB8A 4HYTA 5LD2C 5AHRA 1W73A 3B7PA 3X2SA 1N2EA 3COVA 2H00A 1I8TA 2VH1A 5CIWA 4M0LA 1M75A 3MS4A 3O31A 1J90A 2VHUA 5CLGA 3L9XA 1L9XA 1WDKA 3GC6A 4MRNA 3LQYA 3OLQA 4MI6A 1UINA 3EVZA 4GLOA 4QBHA 1RMTA 3V1UA 4Z3KA 4BE4A 3JWHA 3FYTA 1R9MA 2HA6A 4S12A 1R0ZA 2IRWA 2WIGA 5IAAA 1V11A 4GOLD 4YREA 1JEQA 6ABPA 3K0HA 1YONA 2ZE6A 2O5CA 3EXAA 4K9SA 3K96A 4CDGA 3R5KA 3E70C 2YJGA 4F3CA 3G9XA 4WCFB 1OAKA 1KYQA 1UEXC 4BQQA 1PWZA 4LRQA 3UV3A 1J23A 5JATA 5KYWB 4MIYA 2I6QA 1BNCA 2QMQA 3WGOA 4BRZA 2CVFA 1T29A 1DKOA 2FA9A 2BKAA 2NOAA 2Q3JA 2P1ZA 3F3YA 3N8KA 3UJPA 3S2UA 5IJZA 3IKJA 3C70A 1LRLA 2J4DA 5DI3B 3OBIA 3LKBA 2C5AA 2FWJA 4EGFA 2XIQA 3EIWA 4P2GA 3QU5A 2QUHA 4S24A 3CUYA 2X4LA 1KEUA 3AWDA 4XVHA 4C03A 4YALA 1BS9A 2V9CA 1FYXA 3OF2A 5REQB 5JAZA 1ULUA 1RP1A 2IC5A 5ALXA 3LUPA 1R74A 2Y93A 4HS4A 4TV8A 4EO7A 1VGRA 3HJAA 4JSRA 4WOPA 2CDBA 3C8HA 3IKTA 3C1UA 3ND8A 3BD8A 2UZ1A 3LFUA 4PYQA 2OCDA 1XF1A 1DZ3A 5E2BA 4F6RB 1V1RB 3TTSA 3HKEA 1C3OB 4JUFA 1K6JA 4RAOA 1LB1B 1EZ1A 3LF1A 5DLYA 1IEQA 3NHZA 2E85A 2KBFA 2AFHA 2QUZA 4QDTA 2OK7A 1LRKA 3HEAA 4G65A 4DZRA 2AJDA 4F21A 4URXR 3GRYA 3IDFA 3ETLA 1JE0A 1MO2A 1NVDA 2QQFA 3GIDA 1Q1GA 2OCAA 4LTMA 2RGDA 3D6AA 5JJ5A 3O1HB 3Q0EA 5FULA 2QGZA 2YW2A 4FFOA 4LQCA 4B3FX 2ONCA 4LF5B 2CNLA 1THZA 1H0KA 3ND5A 4W4TA 4OHKA 4NX2A 4D4HA 2GARA 3PHJA 4JI6B 5GIOE 5HUQA 4BO7A 3PSAA 2LCQA 2X0DA 2Q7DA 2I2AA 4GKVA 2NVUB 3WO1A 1NDHA 4RH0A 4LF7B 4K0KB 4Q4HA 1XDSA 3GJYA 4H1TA 3L0OA 1Z0ZA 2PAFA 2G8NA 2ZPUA 1JIJA 4AU1A 3ST7A 4Z9AA 2HQSA 1ZSVA 2FZ4A 2WAMA 3GJQA 1L9KA 3KR1A 3L84A 4HZUA 2F3QA 3T9DA 1MDFA 4UREA 1AHNA 4RETA 4BNJA 1C1YA 2ZIGA 4HB0A 1SU4A 3AV0B 1OZ0A 5ALOA 4AECA 1NF2A 2ONYA 1PDOA 2IYUA 1ZCJA 3IT0A 3QVWA 1P7ZA 2BMVA 2FW0A 4RM2A 2C5BA 3TOXA 5KYNA 2CVOA 1RZVA 3QWAA 4FT2A 2FSGA 2C3OA 3G2LA 5D7BA 4IR7A 3RBXA 3C3WA 1U90A 2AG8A 2IA5A 3MWYW 1W29A 2HREA 3QM1A 4WGFA 4AKEA 4QTXA 1JHRA 1NTOA 3B3AA 3HZZA 4PX5A 4Y6LA 5BQOA 4BP3A 1U0FA 3PC4A 4CQMA 4E30A 1USVA 5DOZA