1CR0A

Crystal structure of the helicase domain of the gene4 protein of bacteriophage t7
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
277
structure length
241
Chain Sequence
MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKDLRALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA PRIMASE/HELICASE
publication title Crystal structure of the helicase domain from the replicative helicase-primase of bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase
total genus 77
structure length 241
sequence length 277
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cr0A00
1WA5A 1BYUA 2OM2A 3S1AB 2ZI9A 2ODNA 4I81A 1Y63A 3SYLA 4UXIA 2CL6X 4OL0A 3VR6A 4DCSA 4DIDA 2AXNA 1NBMA 1ZM7A 4GZLA 1Q3HA 2PT5A 4MRRA 4PPQA 2CMKA 3ZD7A 1E0JA 2H57A 4Q1FA 3AF4A 3BXZA 5C4MA 1GVNB 3GCGA 4YQFA 2W0SA 5KSOA 1SVOA 3TE6A 1SVIA 2EFDB 2XEXA 1MV5A 5KTYA 2JCSA 4D6PA 1AKYA 4QGFA 4DKXA 2WOJA 1H8ED 3VR1A 1OH8A 4OQFA 3DZ8A 5D3MA 2ZJ2A 1ZNZA 3AB3A 5FUWA 1FMLA 2FMXA 1Z3IX 2O8DA 4HDCA 3I8XA 1JECA 3THXB 2HDNB 1E0SA 2OSBA 3M1IA 3T5DA 4E09A 1KYIA 3SQWA 4RZUA 3MWJA 1TF7A 4DLWA 2X1VA 3MD0A 2ZUBA 4FCWA 2EYUA 3H1TA 3VHLB 2J9RA 3LVRE 4ZIRA 4URZR 3ZH9B 4V0NA 1Q57A 5DI9A 2AK2A 3BGWA 4B2IA 4ZI3A 1G291 1L7VC 3SJZA 2RKOA 4NCKA 1A82A 3H84A 1KAGA 1O3YA 2F9LA 1DAGA 3NBFA 4AKGA 4BFVA 4TN1A 1FP6A 1NVUQ 3DKVA 3NHBA 1F60A 4QJ4A 1N25A 5FPTA 4A0HA 4A8JC 1P75A 3ZQJA 3F8TA 5IK2D 1II8B 1QVRA 2BMEA 2ZI7A 1S4QA 1E9EA 2GAAA 2R8RA 2CJWB 4PSVA 4HATA 4NPHA 1CJUC 2ZREA 1JB1A 1NL3A 1UM8A 2WKQA 4HB0A 5J40A 3AF2A 5FTNA 1P4SA 2PH1A 1KMQA 4ZPXA 3W3ZB 3SBDA 2Z5FA 4HB3A 1QHIA 1W5SA 2ZANA 4C9BA 1ZP6A 1D8TA 2XNDA 1Z0DA 4P4SA 2ZU6A 1G8GA 2VHQA 4IEEA 1W1WA 4POAA 4XTCS 2DPXA 3CF6R 1AZSC 3KFXA 1I2MA 3KXKA 2IYSA 1G5PA 1MOZA 1N5IA 1Q0UA 1CR0A 1ZM2A 2QE7D 1E6CA 4LYAA 4ERNA 1J7KA 4GT1A 2ZE5A 1R5OA 1XTSA 2WJJA 2PBRA 3I32A 3PUYA 3CONA 1GRNA 1ZRHA 5DYIA 1TTTA 2OEPA 2ORVA 1Z83A 2ZJ5A 1YZGA 5BN4A 1E2EA 3U5ZB 1B23P 2XTZA 2ONKA 5EQTA 4MH0R 1BOFA 3A37A 3SYNA 1MKYA 2GRJA 4I1VA 2AX4A 3UMFA 3PUWA 2QUZA 3R20A 4HUQA 4P4TA 4L16A 4TT3A 5JHGB 5AJWA 2ZI6A 3KTAB 5J47A 1XNJA 3BH7A 3QXHA 2F1HA 4YONB 1G16A 1ZCBA 4F4IA 4RZXA 3K0EA 3I72A 1TNDA 2J0UB 3T06B 1SXJD 2GCNA 4LPKA 2A3RA 1G7SA 1TUIA 1M34E 2H8KA 4AG6A 4IW3B 2V6JA 3MCAA 1AGPA 5KDLA 3UWKA 2CXXA 3GD7A 1XX6A 3CRRA 2JLQA 2QMEA 1ZUHA 1J99A 1QHHB 4LJ7A 5K8TA 2IXEA 2GA8A 1MABA 1Q1QA 3QG5A 3GFOA 5JEDA 4TWZA 3A36A 2FH5B 2F43B 3PIRA 3WMGA 1XTRA 2ERYA 4FMDB 4TLAA 5G40A 4XVQA 4DC9A 2QM8A 1Z07A 3FTQA 2PL3A 4KV9A 4TZ6A 1EFCA 1WCV1 2HCJB 4Q47A 4OQMA 4QJ3A 2FSGA 2QMHA 2IS1A 3B85A 1UBGA 3FMIA 2ZRMA 1R5NA 1Q20A 1W0KA 2ZJAA 5L3QB 1IHUA 2C9OA 4BFUA 1IXRC 3K0CC 4X8OA 1CEEA 2NO0A 1XPOA 3EWSA 5HE9A 3W5JA 1GKYA 4ASUD 3W90A 2GF0A 4JS0A 4C0SA 3UWOA 1RRCA 2JLRA 3LQQA 3EPKA 3DOFA 3H2YA 4KFSA 5BN5A 2I4IA 5DIFA 5FOXA 4DLVA 1VTKA 4DRZA 4TQAA 1F2UB 3LX5A 4DWJA 2RGNC 4LV8B 1AA9A 4GFDA 4ACBA 2FDCA 621PA 721PA 4K81B 3SNHA 4B33A 2GWHA 4XTRA 1ODFA 4AKEA 2NMVA 5L8VA 1JXMA 1FW6A 3QKTA 4Q9LA 3U61B 1DO0A 4Q7KA 4TLBA 1G19A 3TUIC 1LTQA 4ZDKA 3L0SA 2QN6A 1H8HD 1S3GA 1XWIA 3PJRA 2XB4A 2YYZA 1VG9B 3MRSA 4A6PA 4AWXA 5SZIA 4DT1A 1RE0A 1KK2A 3TVDA 2WWXA 2OXRA 1G1MA 2ZRBA 5HE8A 4UNSA 3U4QA 1KI2A 1XTIA 2ZAOA 4JLVA 1ZC3A 1M1YE 2JAQA 3EAQA 3C4JA 4LYFA 1U9IC 4C0KA 3QJYA 2VP6A 1X8JA 1XD2B 3I3SR 4XH9B 4U7DA 1KZGB 4IVQA 5J4YA 1IAQA 1OW3B 5JS7A 5JJIA 2JJ1D 4UJ5A 4BFTA 5CDFE 3J81k 2RAPA 2WJHA 4LJAA 4ZCMA 4W5HA 3CW2A 2OCBA 1ZBDA 4JLAA 4KU4A 1XD8A 1PUIA 4TL9A 3KJGA 4LV6A 3DKPA 2GXQA 5H1YA 4OK5A 2FFHA 1Z29A 3QNUA 1Z0JA 4R9UC 2O8EA 2J59A 4B34A 2FGJA 4JZKA 4DCNA 3KQLA 4AURA 4AIIA 4KJZA 5IDVA 1UAAA 1M7BA 4UJ3A 2QY9A 4XWKA 2V55B 1FQKA 4NCHA 5TARA 3CNNA 5JCZA 3NH6A 1KK3A 3K0SA 1SQ5A 1ZD8A 1LNZA 5JS8A 1G3QA 4B32A 2PEZA 2H1LA 2J41A 4QNRA 2F9MA 3QKRB 2VQSA 4IOLA 1CRPA 2NPIA 3PITA 3DO6A 1K8RA 2F7SA 1Q1ZA 2H92A 3P26A 3AEZA 1SVSA 521PA 2QT1A 2CL0X 4LBVA 4QHSA 2X19A 3D8BA 3Q5DA 3ZZUA 2Q9CA 2N1BA 1R0ZA 3AKYA 2VP2A 3ZYCA 5JI2E 3QIAA 4RFVA 2OUKA 4OQLA 4Q21A 4D4LA 3PQCA 3VR2A 2Y8EA 3UG7A 4M9XA 5IF9A 1TQDA 1TL7C 3AF3A 3N70A 2ZRCA 3FMPB 1HY3A 2WWIA 4C0QC 1N6HA 2JLYA 1XPUA 4WIAA 1NJGA 2NO6A 4M4SA 3GFPA 3HU3A 1RC8A 1YZKA 1A2BA 1T91A 2D7DA 4CEIB 1VG1A 3U3RA 2WJGA 3ZJYA 3EZ9A 2OESA 3WYGA 4CZ2A 3IO3A 1M2OB 1ZW6A 5C18A 5K8LA 2G9NA 5TDHA 3CPJB 3CNOA 4JJZA 2FEMA 1K5DA 4LSGA 1W47A 5LB2A 2ZVPX 3T61A 3NBZC 4EPRA 1TU3A 4BE7B 1N6PA 5FOVA 4JYBA 1US8A 421PA 2WOOA 4Q9JA 4V0KA 5IHPA 4QBIA 5KNCA 5CK5A 4GP7A 2BBOA 2OHFA 4CRWB 1OB2A 1SXJB 1KIMA 4Q01A 1KNQA 2QENA 4PHFA 4PHHA 1T8TA 2AXPA 5HCNA 4GSYA 5TY0A 1AKEA 2CVFA 3AV0B 5GJVC 1NY6A 1XXHE 5FFMA 3BORA 4B71A 4KODA 1SHZA 5G41A 2QM7A 4MYUA 4BFWA 2ZAMA 2BC9A 4K8OA 2ZYTX 3KKOA 2ZYUX 3NIBA 4F93B 4E03A 4TMTA 3MAAC 4Q9IA 1ESMA 4M1YA 2XGJA 1E1QD 4NKRA 3AVQA 1Z0FA 1GAJA 1W2HA 2GILA 3GJ0A 4U5XA 5FI1B 5BXQC 3KQNA 1SHKA 1OLOA 4OK6A 1GUAA 2EW1A 3VMFA 1NF3A 5H8WA 4EKDA 2CLDX 4M2LA 1W4RA 2JJ1A 3QUSA 1J2JA 3QVVA 3F5FA 1LF0A 1KAOA 2VEDA 4XD7A 2OE2A 4P4UA 5DO9A 5B57C 4BQSA 1BO6A 1OIXA 1SXJE 2FN4A 1KHTA 3RAPR 1XJCA 1T5IA 5FL7A 1YZQA 5KDDA 4RCZA 4DZZA 4DHEA 4JKIA 1KTVA 1ZINA 1JJVA 2GJ8A 3FPAA 5TB5A 2CE7A 3B78A 2YNMA 2FPLA 3U60B 1CF4A 2Q0HA 2VHJA 3NXSA 2HYIC 1ZNXA 1N6IA 3L8ZA 3K0AB 2IA5A 3ZVNA 1TPZA 4MYCA 1COWA 4IHQA 2OLJA 3FHTA 2ZRJA 4IRUB 3OIUA 3PG5A 4LX0A 2CCKA 2ZRNA 1T8UA 3LNCA 4KBFA 3CB4A 4DIEA 5FR1A 4E22A 1Q44A 2LCFA 3V9PA 4DLYA 2J3EA 4LHVA 1OPXA 1AQUA 4OQXA 2NO9A 1XTJA 1RKBA 3LO5A 1OSNA 3EPJA 5LB4A 1KY3A 4D80A 1G64A 3TR0A 1TAGA 1Q21A 4EFNA 3P20A 1GNQA 2HLDD 1BMFD 1E9AA 2WMNB 4C0LA 2IX3A 3RNLA 1VG8A 2Q9AA 2QEQA 1RYFA 1TEXA 4NTZA 5B2ZA 4C7OA 1CR1A 2YWGA 2F55A 3NKVA 3MFYA 4RD0A 1N0WA 4DUGD 2BVNA 2FOLA 1XRJA 2IT1A 2ZM5A 4TTPA 1PJRA 1T3LA 5GVSA 1E98A 2VL7A 3AQ4A 3CR8A 4US1R 1ZJ6A 3BFKA 4JLPA 1XPRA 2E9SA 4Z8YA 4EFLA 3QKSB 3W6PA 1GFIA 2P6RA 4WVFA 3EA0A 1MT0A 2QTFA 4TMVA 3A4NA 2QPAA 4HB4A 3IHLA 3F3YA 2ZI3A 1IJFA 2KE5A 2OFWA 3ZVMA 1TUEA 5FBRB 2BEKA 3N5CA 1YR6A 3U2QA 2FEOA 1R5BA 3VR5A 1WBDA 2XSZD 5ELXA 1BH2A 1M7GA 2V7QA 5IRCD 3KB1A 5FH9A 3BIFA 3TIFA 1YHNA 5KSZA 4Q1AA 4ITRC 3VQTA 2WSSD 1HE1C 1NVVR 1Z22A 3EPLA 3EZFA 3THWA 4C4PA 4QKQA 1YKSA 3X2SA 4P32A 2DFLA 5FPYA 4DLZA 1SGWA 3QF7A 1Z6XA 2BV3A 5TXGA 2CVHA 5JWOA 3OESA 4B3DA 2GVDC 1Z06A 2WAYA 4ZKDA 4N1AA 4HI0E 4RKFA 3PFIA 3G82C 4OHXA 3LA6A 3ADKA 1T0JB 2PLFA 3OFNA 3AVVA 2PT7A 1KNXA 4YXWD 4F7WA 1GTVA 2QAJA 3PVSA 3U44B 1VCIA 2IS6A 1EESA 1GNPA 3DPUA 3FGNA 4LK2A 1SVMA 6Q21A 1CKEA 4FN5A 3ZVRA 3CUEF 2BKEA 3FHCB 1JAHA 2JIZD 4M9SA 5KSPA 2QSZA 3SC3A 1T0HB 3IEVA 1IONA 4HDQB 2J1LA 3W6NA 4IOMA 4PZYA 2NTYC 4FIDA 1WMSA 4XIGS 1R6BX 2QAGC 3NVAA 5EE5B 4CEHA 3LW8A 3WRXC 1W0JA 1Z0AA 5HTKA 3THYB 2GESA 1IY1A 4PX9A 3ZS9A 1CR4A 2O0KA 1MH1A 2ZR9A 1AM4D 3LLUA 1IXZA 1AIPA 3RS0A 4FMBB 1X1RA 2DHRA 4JMPA 4DEYA 2I1VB 2A5GA 2IYQA 3K0FA 1FTSA 1BYIA 1UPTA 3FKSA 1YR8A 3TH5A 2ZVQX 4AKIA 5KPDA 1E94E 3ADCA 2X8AA 1S3SA 3AP2A 4PAQA 1FMJA 1NN1A 2QBYB 5HKKA 1RRPA 1Z6YA 3UXMA 4MA4A 3K9NA 4KFRA 5EUQB 4JSYA 2GTPA 2A5DA 1UFQA 2WJVA 4B2PA 3BC1A 4H9GA 4RD1A 3T1VA 1D9XA 1I4LD 5CIWA 4I1OA 4Q03A 2XJ4A 1ONBA 4A2PA 1ZD1A 3OAAD 2O8BA 1O87A 4BASA 2QP3A 5FUYA 1OFIA 1I4TD 4NYMR 2J7PD 1D2MA 4HZUB 4PC7A 5B58C 2UZ3A 2XXAB 3HU2A 1KK1A 3L0OA 2ZU0C 3UATA 4MUBA 3GLHA 1FP7A 4TTRA 3BB1A 3CR7A 3GJ3A 2C9CA 5SZKB 3TW8B 3WHKA 2AD5A 3ND9A 2QPTA 2B8TA 1ZM4A 2W6JD 3R7WB 3MWKA 5JRJA 5BW8A 5EP4A 2DCUA 4M1SA 2VYFA 2O8CB 3HPRA 1RJ9B 2WTUA 3CF2A 3A1VA 3CWZA 821PA 2HT1A 2R44A 1P2SA 2W58A 1VMAA 3TQFA 3LW7A 3X1YA 4B75A 2MMCA 3BOSA 3IIJA 2WM9B 4Q1EA 1QVAA 2ZRAA 5GJWC 5DI3A 1CJTC 1J90A 1WP9A 2QQ0A 5FPKA 1XP8A 2OO7A 4MQBA 1KY2A 2GCOB 3LBIA 4EQ6B 2ZITA 1CTQA 2FV8A 2OXCA 4NL4H 4V0OA 2FPMA 2WPDD 2IYLD 4OJKA 4KI0A 5JSZB 3THXA 3X1WA 3R9XA 3TAUA 1P3JA 3KFVA 4PO1A 1P2VA 4B3GA 4D81A 2ZJ8A 5FUVA 1ZU5A 1TMKA 4QHYA 2C98A 1NY5A 1NSTA 4W5JA 5CYOA 2J5XA 1OXXK 3SDZA 1SKYE 4WBSA 3ADDA 4BPBA 1AN0A 2GXUA 2ZETA 2QPOA 1E2NA 4ESHA 2QQEA 4PFSA 5B30A 4L9WA 3RLFA 4EJSB 2B92A 1G5TA 2PJZA 2QZ4A 4G5SA 1E9BA 1UJ2A 4MGYR 4EPXA 3T1TA 1WQ1R 3CM0A 3O8CA 2ZS7A 4ZI2A 2XB2A 4IDNA 4JLMA 4JVNA 1OFTA 1CS4C 1K5GA 5KO2A 1S9HA 4A82A 1Z0KA 4Q19A 4LJ9A 4Q4JB 1LFDB 3NEYA 3W8RA 2JEOA 1ESNA 5KPJA 1G8YA 3MMPA 4OHYA 4GNKA 2JJ2A 4Z1MA 4B2LA 5GJBA 1YZUA 1OHHD 2HJGA 2BCGY 2ZE8A 3NBXX 4Y0AA 3BB4A 3KJEA 5KOYA 1WRBA 2AD1A 2BIFA 4JBXA 3ZVLA 1M6NA 4V02A 4O25A 1NLYA 2H16A 2CK3D 3SJAA 1HQCA 5FBLB 1EFTA 3FYHA 4OHVA 4V03A 3IQWA 4R71A 2CNWD 2JLXA 2REXB 2WJYA 3X1XA 2ZRHA 1T3HA 1R0YA 3TK1A 2VRWA 3ASZA 3IEUA 2XZLA 2QGZA 4LJYA 5FTMA 4BZXA 1CU1A 4QBHA 1PLKA 2CHQA 3MJRA 3A4MA 5FUXA 4CW7A 3HJNA 2ODWA 3ND8A 1KK0A 4HLUA 1E79A 3KTAA 5GVRA 5G3ZA 2OAQ1 1PVOA 2ZE7A 2GF9A 1Z08A 3R9WA 2VLIA 1GL6A 221PA 2V8OA 2ZRKA 3VKGA 4B48A 2J0UA 4U02A 4JJKA 1OYWA 2GJAA 2R62A 4LUCA 2DBYA 1IXSB 1EFHA 1T5LA 3ZIAA 1F48A 4QBFA 4D4KA 5L3SB 1UKYA 4TQUS 2NQ2C 1CJVC 1Z0IA 1KSGA 4YMSA 5DNYB 1EWQA 1QHHA 4C0BA 2NGRA 1MRNA 1JR3E 2JLZA 3GLFA 1MRSA 2F43A 3QPWA 4JYCA 2A2ZA 2Q3FA 3MWLA 1YE8A 2PEYA 4IDHA 5BN3A 4Z51A 2Z0MA 1Z8FA 3EZ2A 2Z83A 4GP6A 1DAKA 1JQLB 5AK0A 4A15A 2BCJQ 3D3QA 4P3YA 2ZROA 1GL9B 2OBNA 4KFUA 2O8DB 2FZ4A 3SBEA 2GK6A 4B6EA 1OKKD 4Q1CA 2BMDA 3I1FA 4IDQA 5L3QA 3IO5A 1DOAA 1KJZA 4DSTA 5KDOA 3TNFA 1GDDA 4MGIR 3OE7A 4DLUA 2RGAA 5A4JA 3I62A 5EE0A 2A7QA 1KSJA 4JIMA 2BBTA 1M74A 4ZIRB 3VNVA 1KMHB 2OAP1 1NBME 1GG2A 4GMDA 2W2XA 5CB8A 4F38A 4B3FX 4TSFD 1KSHA 3BK7A 1YJ5A 1DAHA 5CDFA 1C4OA 2R6FA 3DMDA 3K9GA 2ZYVX 1RZ3A 1F2UA 3AVUA 4KITB 1RVDA 1JNYA 1NIPA 2MSDB 2IUTA 2OT3B 3AKDA 4KLZA 2VIIA 4DEXA 3LV8A 2AFIE 4II7A 3ZZ0A 4B43A 4EPTA 2GXAA 3ZQ6A 2QNRA 1PZNA 2IF2A 1L4UA 4ZCLA 1HT1E 2DWQA 5JZVA 4YDSA 5EUMA 3RS3A 3QVUA 1Z6GA 1H8EA 2AKAB 3L82B 4QG7A 2J0VA 2H18A 1P72A 1L2TA 5JFGA 2GBLC 1DAFA 2J46A 2ZRGA 4KYIB 3VU9B 2C8VA 1FTNA 2PZGA 1OXUA 2BMFA 4DSUA 3QKUA 4TQ9A 3B9PA 1VIYA 3BJIC 5JMTA 2XTMA 4EJSC 1W2GA 2R9VA 3WP0A 1E4VA 1FQJA 2DWPA 4KFTA 3IIMA 3GFTA 3QBVA 1ZUNB 2WWYA 3VX4A 1FUUA 2CLSA 2XOKD 4V0MA 2DR3A 5G53C 1IN8A 3RRNA 3JVVA 5HPYB 3RABA 2G1KA 4NDZA 2ORIA 3V4FA 4E5UA 2WAXA 2ZPTX 3WBKA 3CX6A 2PJRA 2CHVA 4KLNA 4US2R 4ZO4A 2YKGA 3B13B 4NCJA 2V6IA 2F1JA 4HDOB 5JEEA 4DDVA 4LYHA 2XX3A 1G17A 4B3CA 1FZQA 5G3YA 4K46A 5IK2A 4HB2A 3HYTA 5KNBA 3Q8XB 2ZRIA 4Q9HA 1KO7A 3CPHA 1D9ZA 2Q21A 1UBEA 4HUQB 3IUYA 1KI7A 3Q7PA 4FI3C 4ON9A 1DO2A 2CE2X 4A2QA 2VP4A 3REFA 1ZIOA 5JLJA 4JVLA 1V5WA 1L4YA 1OXVA 2PX0A 4KVGA 1HT2E 3DVLA 1J70A 4LY6A 3CH5A 1E9DA 1XZQA 1G8HA 4PQYA 3QF4B 4NCNA 4Q4AA 4W5WA 2V1XA 3LXRA 4IDPA 3JZMA 1IBRA 1S1CA 1SZPA 1VDZA 1NMYA 3C14C 3RS7A 2DWOA 1XMIA 3LAWA 2JJ8A 4JL6A 4TMKA 3ZS8A 1KI6A 4GI7A 4R2IA 3FMFA 3KX2A 4BFXA 1N5JA 4L4UA 2P5SA 2REBA 3O8BA 5K8UA 4OJQA 4WW0A 3G5UA 2FE4A 1UDXA 3ZLJA 1MABB 1NN5A 2GVZC 3KJHA 1Z28A 2QE7A 2RH5A 2ZI4A 3KXIA 1FX0A 2OFOA 3B9QA 5TV2A 4BUJA 1OH7A 4PR0A 2O8FA 2IXFA 5FOUA 3K09A 4HAXA 1A4RA 1YR7A 1GITA 3LFUA 5J4VA 5GADl 2QU8A 121PA 1NVVQ 3VKWA 4CEIA 3CX7A 4L15A 2QTHA 3T12A 1TQ4A 3ONWA 1Z2CA 2ZSEA 3MG9A 1OIVA 4M1MA 1Z63A 5AWFC 1MO3A 1Y3AA 2YWFA 4Q5IA 1II9A 1Q1EA 2E87A 1G6OA 4IDOA 4BLTA 3IPYA 2VO1A 3OIWA 3SHFA 2C5LA 2IUUA 2PCJA 3W34A 4PPFA 1NG1A 2H5EA 1G18A 1ZNWA 2R6GA 3A4LA 1CULC 1VCNA 2AR7A 2D62A 3KXLA 4CEJB 2QMOA 1JEDA 2ECKA 4GPTA 1SXJA 4URVR 1EG7A 5JI3E 1XEWX 4NCIA 3LVQE 2PX3A 3RANA 1W7AA 1YVDA 3V4RA 2W83A 2VHTA 3DMNA 1ZU4A 2RGDA 4UNNA 2ZIAA 1KJYA 1KO1A 2ORWA 2VF8A 1KOFA 2LKCA 4B47A 4IJMA 4GOXA 1GRQA 1UKZA 3TQCA 2WVJA 3VTKA 1GWNA 4NP6A 2B6HA 3BS4A 4MKIA 4D0LB 1UEIA 4DT1B 1G3IA 3GJXC 3B1XA 3EARA 5CIQA 1XXHB 3TKLA 3U4QB 1VHLA 4D25A 1A7JA 4GOJA 4PQFA 2OCYC 5BQ5A 3PEVA 5LDDC 2P3SA 4RSGA 4LBYA 1HURA 1TF5A 2JLUA 4ESVA 4PPGA 2GXSA 2VTKA 4Q4HA 2ZEJA 3ICEA 3GLGB 3GP8A 4TYQA 2GEVA 2BMJA 4G5QA 1XBTA 3AGPA 4ASUA 3CLVA 1GRRA 3PR1A 4DCVA 2NZ8A 1ETUA 3IBGA 2VHUA 3GLIA 2BKUA 1ZYUA 2Q3MA 4DDWA 2O52A 4DB4A 1W36C 3RSOA 3BFXA 2ZSBA 4PTLA 5AUPB 3KQKA 1E2LA 2ZE6A 3W9YA 3MSXA 5A0FA 2JLSA 4XWOA 1DAIA 2PZEA 2EU8A 2OZEA 1ZCAA 4CDGA 3T15A 1OV4A 5FTLA 3P1JA 4BECA 2AWOA 2ZI5A 3PEYA 2P6UA 2QAGB 1G4UR 4IEIA 1VECA 4A0FA 1FUKA 3KB2A 1E2QA 3QQ5A 1FOEB 4HAZA 4NYIQ 1A1VA 1H8HA 4PXAA 4EPVA 1NKSA 3NDBB 5EXSA 5FBQB 2G83A 2W2TA 4OBEA 1ZUIA 2OV2A 4KXFB 4EUNA 3GLGE 2V9PA 4HYYA 1J8YF 3LD9A 3H0KA 4WZAE 5SZJA 1KDOA 1Q22A 5AUOB 1LF5A 4C0JA 4AI6A 3U3KA 1U94A 2GJKA 3OEHD 1PV4A 3L2OB 3VHXA 3REGA 3ZD6A 3PUXA 1CBUA 1S9DA 2P5TB 3U7EB 3CZPA 2HYDA 1IY2A 3CRVA 2ODEA 2HF8A 4I4LA 1E1RD 4ARZA 1T4GA 1X8KA 3AP3A 3T1OA 2QRNA 1NJFA 4X8LA 2N46A 1DARA 2ZRLA 3SFVA 4JT2A 2BM0A 1U98A 4DLSA 4E07A 4BFSA 3QY0A 4DDUA 1A5TA 2A78A 3OZXA 1E32A 2ZR7A 3QKSA 2RB4A 3RDPA 2G1JA 4M1WA 4RVCA 2QL6A 1RIFA 4BGDA 5JJKA 1EGAA 4BFZA 2QI9C 1OF1A 2D2FA 1OT3A 4DSNA 1NP6A 1SULA 2WV9A 1G41A 3O47A 4X8HA 1N5KA 2Z43A 4MDFA 3M4YA 2OCPA 3AF1A 3CZQA 4AK9A 1XZPA 1TX4B 2ZSDA 4AY2A 1KI9A 3A8TA 2BJVA 3T1QA 1XMVA 3MGCA 1KI3A 1U0HC 2JDID 1CLUA 2BBWA 1VKJA 4NZYA 3TUZC 2JLWA 1X1SA 1GIAA 4L9SA 4G5OA 4EAQA 2QT0A 4URYR 4LOAA 2QROA 3CO5A 2G77B 4HLCA 3WY9A 1ZIPA 3RHFA 1G20E 3ZZTA 4RFSB 4HAUA 5A5GA 1EFRD 3DEFA 2ZRDA 4JLNA 3SQXA 1CXZA 3TW4A 1Z5ZA 4XSHA 2YC4C 1DG3A 3QXCA 1M8PA 3RRYA 5D3QA 4BLOA 1P61B 2WKRA 4UNRA 3B1VA 1JALA 1N6LA 4CYMA 5KHOC 3C7KA 4NE2A 1OH5A 5AJXA 1VPLA 2VH5R 3SJBA 1N6NA 1R8QA 3NC0C 4DBLC 2HXYA 2WWGA 3FHOA 2AFHE 4G01B 5DN6D 4DLRA 1DTSA 3LXXA 5IT5A 4MKFA 5F98A 4Q7JB 2DFTA 3Q3JB 3I5YA 1KDTA 3U6BA 4HAWA 5C2JB 3QSYA 1DBSA 1OE0A 4TMXA 3AH8A 1LB1B 5DYGA 4Q1DA 4QC2A 4OI2A 3SN6A 1C9KA 2HV8A 4A8JA 1NIJA 4D0GA 5DHFA 1XDBA 4CGZA 3B8HA 2Z4RA 3WXMA 1VYUA 1PLLA 1IQPA 3U3MA 1IOZA 2R6AA 1NN3A 2OBMA 5CJPA 3SI7A 3L0PA 4B6FA 1Z47A 2AKYA 1ELOA 1TQ2A 3EIQA 3IBYA 5EE3A 2W6ID 3EG5A 3FFBA 2TMKA 5KYKA 4CVNA 4G1UC 2IYXA 1YZLA 5EZ5A 1K6MA 1LS1A 4L5BA 5F9HA 2ASEA 1P9NA 1E2DA 1N6OA 4H1VA 2KBFA 1JR3D 3LH5A 1GKIA 2FFBA 2FNAA 3B1YA 1HQYE 4GMXA 1KDRA 3TJZA 3L8YA 2OCAA 3OEED 4G5GA 4UKDA 2BOVA 1E0KA 4A4DA 1LW7A 1TU4A 3BH6A 1E1QA 4Q7MB 3AP1A 4XOIA 3VX3A 2RGGA 4Q66C 5E4FA 4LJ6A 1KO5A 3OHMA 5GJCA 1XMSA 4EFMA 1EXMA 3IKJA 1UF9A 2V3CC 1MO4A 3KUDA 4EPYA 2HXSA 5JJLA 4OK3A 3TGPA 3TSOA 2IYZA 5E3HA 1P9RA 2XXAA 2RHMA 4XVRA 4KCGA 4IVPA 3IILA 1N0VC 4QNMA 4F92B 2O5VA 2GKSA 5DSZA 4RD6A 3RVBA 2EFEB 2FWRA 2KBEA 1G7TA 2RHDA 2JGNA 4W9MC 2WIBA 4XWAA 4D2IA 5E7IA 5CJ2A 2J7KA 2F3RA 4C2UA 2DYKA 1NBMD 1GL7A 1UDWA 1SKQA 3LY5A 4Q00A 5DLQC 1AZTA 1E2IA 2PMDA 4I1UA 3UANA 1KSFX 4PC2A 3UPUA 2W0MA 3R8CA 2FGKA 2YOFA 1E9FA 2YVUA 3FB4A 4C30A 1WE2A 4C3ZA 2FZLA 2EWWA 3QI2A 3RS4A 1G9XA 3P4XA 1LVGA 1AS2A 3IHWA 2CDNA 4LRWA 2ZUDA 4N0EA 1W49A 1N5LA 1RRFA 4FCTA 4DB2A 2WICA 3AM1A 1GNRA 4BEBA 4URXR 5LPNA 3B2EA 4JKYA 1OH6A 5FR2A 3AVXA 2XTNA 1XF9A 3THWB 2B7CA 2ZS8A 1IN7A 2XAUA 4FD2A 1E4YA 4XSGA 2HLDA 1DELA 1AK2A 1BMFA 2ZXUA 1DG1G 2UZIR 4US0R 2Q6TA 2WIAA 4QBGB 2VP5A 1XEXA 1OYYA 2FSHA 2KJQA 2VSOA 3AVTA 4DUGA 3QPUA 2X2EA 4TYWA 2J0SA 2BEJA 2WHXA 3EIEA 1N3BA 3K1JA 3S1AA 4NHOA 2FPKA 4URUR 3K70C 3NG1A 2VHCA 3K0CA 4B3BA 2FSFA 1SKYB 4LC0A 1X8LA 4ZDJA 1U2RA 4GL2A 2KI5A 2GZAA 1ZM9A 3RWOA 5LBIA 2FG5A 2YOHA 4EPWA 1AS0A 1S0UA 3QEJA 3EPHA 2NPFA 1W36D 3DM5A 4HEJA 1RFLA 3FE2A 4BWYA 5JHHB 4Q4JA 4PHGA 2W2VA 2CCGA 3SOPA 3W3AA 5AJVB 2RGNA 2XSZA 3TVTA 1WXQA 2WJIA 4CEHB 2RCNA 1U8AA 1LY1A 4M1KA 4KSBA 5BYKA 2CEAA 4M53A 1GP2A 3B82A 2WSSA 5AUNB 4URWR 1E3MA 1H65A 2REOA 4JL8A 3RC8A 2VA8A 5J5CA 2OFXA 4BLQA 3K0FB 3K9LA 5AR1A 3NC1C 4O3MA 2ANCA 2YOGA 1P2UA 1QDEA 5AJYA 2D2EA 4DDTA 2C78A 5KU1A 3PV0A 2J87A 2B7BA 4MYHA 1QHNA 4GRAA 4MRVA 3SFZA 1N0UA 3RYTC 2WWFA 1KGDA 1JEEA 1SVWA 1U9IA 4KAXA 1T9HA 4YXWA 1D6JA 4IVRA 3PENA 3WNCA 2GETA 1G3MA 1R8SA 5FOWA 1AQYA 1PUJA 5FL3A 2H7VA 3BFVA 3HU1A 3QE0A 4QGGA 1XTKA 4LWZA 3O8DA 4OYHA 3P32A 4FMCF 4TYPA 1II8A 1G8PA 3KUCA 2G6BA 2JIZA 3A1WA 4FINA 1XCMA 4ZDWA 4PO9A 3UG6A 4TT3D 1UKEA 1XEFA 2IYRA 4U00A 3TAHA 2CJWA 4TTQA 4GDFA 2CCJA 3EIHA 4IXNA 3GLHB 1VG0B 2MSCB 3GMTA 3D7MA 3CF0A 3QEOA 2AL7A 2AWNA 4RZ2A 1OIWA 2IW3A 1XCPA 2IS2A 5BYJA 3UMSA 3T35A 1P2TA 3RRZA 2GEDA 4TYYA 3A6PC 4M1TA 3TMKA 1S2MA 3OIVA 2HF9A 2WBLC 5L3SA 3AVPA 1CRQA 1IY0A 3HPQA 2EYQA 2ZJOA 3KZ1E 2IUSA 1ZNYA 2YV5A 1JAIA 3E70C 4M9QA 1NI3A 3I5XA 3CWQA 4Q7LA 1I4DD 3WYFA 4YMUA 4PSAA 5DI3B 2N42A 3I8SA 4IOKA 4GBMA 2C77A 4UQOA 3CRW1 3L43A 3TUJC 2BDTA 1J8MF 1ZD9A 3F0TA 3H4MA 1VCMA 5EE9A 4FWTA 1BKDR 4QJ5A 4BLPA 2GCPA 3CRMA 5ANRB 3ZGXA 4DCUA 4MRNA 1W0KD 2WZQA 1XTQA 3CBQA 3GLHE 4KVAA 2L0XA 2EFHB 2FFQA 3FFAA 3G0HA 3U7GA 3OAAA 2EVWX 3NDPA 2P67A 5JWHA 2J7PA 1FNMA 3ETLA 1KMHA 3CPEA 3IPXA 3TLXA 1I2DA 1F2TB 2HT6A 2ATXA 3TSZA 4NMMA 2A30A 2VP0A 2RGBA 1N2CE 1U90A 2W6JA 5CITA 2EWVA 3JZAA 1E2MA 3CX8A 4LCBA 3WMFA 1P5ZB 4QHTA 2VSXA 3KQUA 2IK8A 2OG2A 4BLSA 4JLDA 1E99A 4JLJA 4S35A 3Q7QA 1ZC4A 2XZPA 1KI1A 3SZRA 4XVUA 3D31A 1R2QA 4JVMA 4MDEA 2NIPA 3JVUA 1N6KA 5K8IA 4KSCA 3IIKA 3AUXA 4QXAA 1W5TA 1W4CA 4LHZA 4OQNA 5FBVB 5CM9C 5J4LA 1KZ7B 1B0UA 3Q72A 3HWSA 3QXJA 5D3MB 3BD9A 4QM6A 2WPDA 3VU9A 1CP2A 3R9IA 4FXPA 4YC7A 4V0LA 4G3XA 3GJ6A 2J0QA 2V4ZA 3PCRB 1XD9A 3BERA 5EXXA 4QRHA 3C15C 3BE4A 1U81A 2IXGA 1SVLA 2QA5A 2KSQA 3FWYA 3K8YA 3KKMA 3CIOA 1WB9A 1W4AA 3WYAA 1IN4A 2LKDA 1FPMA 2D06A 2CL7X 2ZJZA 3AUYA 2E1RA 4PAOA 5AUQA 3B60A 4M21A 8OHMA 5JRZA 4PC1A 2QSYA 2Z6VA 3I4LA 4HZIA 4PANA 3RRMA 4TZ0A 4PZLA 3VR3A 2JLVA 4IXMA 4CT4B 4OHWA 3L0IB 3WRYC 4L8GA 5M04A 4YMWA 1P60A 1P62B 2ZTSA 4MUAA 2P2LA 5F9FA 1IN6A 1HA3A 1QHYA 1XEWY 5SZHB 4WZBE 4KHZA 1U99A 2CBZA 1HV8A 2IYVA 2WMOB 1W36B 2X77A 3IGFA 1C1YA 4LI0A 5FTJA 3IDQA 5C46F 3B6EA 3EWAA 2O0JA 4JBWA 1XFAA 1GZSA 3ASYA 4DLTA 4O2RA 4AG5A 3QF4A 4UNQA 4P0TA 4YDHB 5EXTA 3C5CA 1NLFA 3GJ5A 1OFHA 4A1FA 4TYNA 3T5GA 1VYTA 2YHSA 3C5HA 4UXJA 2IEYA 3C8UA 2GDJA 4LJ8A 1OHHA 3D6TB 4WZ6A 2G0NA 1XD2A 4MGZR 4P4SB 3DL0A 3MWYW 3EXAA 4ILEA 2CK3A 4MYTA 4AYTA 1MO5A 1RPZA 3GLFB 2HUPA 4R7ZA 3EX7C 1HYQA 1LS6A 2DY1A 3UK6A 2CNWA 4IKEA 3CNLA 4B44A 4TLDA 3N2EA 4KYUA 2YWHA 2DFKB 1WDTA 2NZJA 3TRFA 5EP3A 2WKPA 5FI0B 4N3NA 3X1ZA 3BAFA 1ZMXA 3I92A 2H17A 5E95A 3ZDQA 1QRAA 5JECA 4HUTA 4Q9KA 2KB0A 5DHAA 3M6AA 4ZDIA 3K70D 2D4HA 5JBQA 1VYVA 4CEJA 2GNOA 3QKRA 5DGXA 3W6OA 1XU4A 4ACAA 4AD8A 1G4AE 2WWWA 2MMGA 4BLRA 4RY2A 4F4CA 1QF9A 1YZNA 2LWIA 4YMTA 3U7FB 2AN9A 1CJKC 1KO8A 2GEUA 2QP9X 3DHWC 1HTWA 2VSFA 3HDTA 4KBGA 4MRSA 2DFNA 4TMZA 3GLFE 1JPNA 2QG6A 3PEUA 5L3VA 1G21E 4ZKEA 4ABYA 2C04A 1VHTA 1DAEA 1EX7A 4NYJR 4B73A 2ZRFA 2YC2C 1W4BA 3GEIA 1W44A 2ZRPA 3KL4A 3PEWA 4LHYA 2FJUA 4LZZA 5CLQA 1TEVA 4O2LA 1XXHA 2FA9A 4FMDF 2F1IA 4LHWA 3MLEA 5UKDA 1EK0A 3AVYA 3KKNA 3KQHA 1DS6A 1OKKA 3AVWA 1KKLA 1EX6A 3K53A 4TLCA 3BH0A 1BIFA 2K5UA 1NMZA 4P33A 4OHZA 2IHBA 1QBKC 1ZM3A 3GLGA 1W48A 1D5CA 4XD7D 3DZDA 1UADA 1U8YA 3RSLA 3T34A 1EFUA 2FX3A 4OI4A 3TR5A 2AK3A 1YQTA 4WOPA 4MITA 4PQRA 5HZHA 1QHSA 5FL7D 1BS1A 3UIEA 4TSFA 4JBYA 3P27A 2ZSFA 1UKVY 3A1SA 2P0EA 5FPSA 4TLEA 1TADA 1KO4A 2ZSAA 2O0HA 1DPFA 2D74A 3GJ4A 3LLMA 2BJWA 1NRJB 1NG9A 2ANBA 2F6RA 1COWD 1NMXA 1XMJA 2QAGA 3ICQB 2PZFA 1DEKA 1V43A 2ODBA 4DCTA 2GJSA 1OXTA 2C2HA 4D0NA 1TQ6A 3W5IA 3ADBA 1KDPA 3RC3A 3BRWD 1NNEA 5DISB 2F3TA 5KUTA 5HZKA 4Q4AB 4A2WA 3HR8A 4DLXA 3QBTA 4V0ME 3AGQA 1KI6B 2NOAA 1VIAA 1G7CA 1GKUB 3M0EA 1NLZA 1NSFA 4LJ4A 1YRAA 2VPPA 1UEJA 5CM8B 5EJEA 2XOKA 4IFEA 2BWJA 3LBHA 1E9RA 1R0WA 1Q12A 1FX0B 1ANKA 1GM5A 2IYWA 2ZUCA 1IJEA 2C99A 4B74A 5KNDA 2O8FB 5LD2B 5JCPA 2RGXA 4A9AA 4HLDA 4HLUC 2O8EB 5EZ6B 4LGMA 3GEHA 4R98A 3NHAA 1OB5A 3WMEA 3DDCA 5CK4A 4ZCIA 2G0TA 4NYMQ 4D4MA 1HUQA 4Q18A 5TMPA 1WBBA 3E1SA 3QG1A 3K0AA 2NO1A 1S96A 3OF5A 1N6RA 1YU9A 4J0QA 4PHTA 4RCYA 3VR4A 4YLGA 2CLCX 2A5JA 3A1TA 4RKEA 1EWRA 4TL7A 3LBNA 2GHIA 5H70A 3R8FA 3CKLA 3PUZA 2QMUA 2V7QD 4FW9A 1X86B 4M1OA 3WP1B 3SS8A 2YWEA 4OI0A 3HR7A 1FL9A 2QP4A 3TBKA 1NVWQ 3LX8A 3P4YA 2Q3HA 3VAAA 3NWJA 2GZHA 4YMVA 4RFSA 4WXPA 2AHOA 3Q9LA 1XJ0A 4Z54A 3O8RA 2W00A 3WHLA 3CH4B 1LV7A 5FOTA 1OJLA 2IYUA 3GJ8A 5KSYA 1DVRA 3KKQA 1S8FA 1F5NA 1D2EA 1T3SA 3SU8A 2IBMA 3GEEA 4F4JA 3AKEA 2PMKA 3OFND 2F1RA 3GPLA 1QG4A 1Z6TA 5CYPA 1E0AA 2XJ9A 4LYJA 2I1QA 1UBFA 1QHXA 2G3YA 1MO6A 4LC1A 3AF0A 1R4AA 4M8NE 5P21A 1HEIA 3AVOA 4PZZA 4D82A 4Q4HB 1CR2A 5B64A 1GSIA 3U3JA 2MSEB 2V1UA 2P65A 4NU0A 4BRUA 3VKHA 4B35A 1R10A 4WXRA 5F3WB 4C0HA 3K70B 2I3BA 1US8B 4F91B 4LBWA 3GLIB 3LDAA 4Q4LA 5EP2A 1IM2A 2VP9A 2UVQA 2EFGA 1W0JD 2C03A 5J4KA 2IS4A 1OXSC 1JXOA 2IEZA 1JBKA 3U3OA 4QL3A 2G88A 5H68A 1YR9A 3WNBA 4H1UA 3WNDA 4HSEA 4LPSA 3X1DA 3FKSD 3RS5A 4BEJA 3EA5A 4QOSA 4I1SA 5DE3A 3QXSA 4PC6A 3TSWA 4LBZA 3Q85A 1TF2A 3Q5EA 4LV5B 3KDSE 5HKKD 3I73A 4MKHA 1JPJA 3SEAA 4BRWA 1G5RA 5EE1A 4BFYA 1F3OA 5EXPA 1NVXQ 3B1ZA 3B5JA 4LHXA 3I61A 3U44A 1PLJA 2XITA 3ECCA 4TMWA 3QOFA 3C41J 1NKTA 2HEIA 3EASA 1SVKA 4A92A 4A0RA 4I99A 2QGNA 4IOJA 3VNUA 3GLIE 1GILA 5E7MA 1E2PA 4AYWA 1DAMA 4DVGA 1AJEA 1KJWA 2FFAA 4CIDA 5BWMA 4UNPA 2B21A 4Z8XA 4ARZB 4GOKA 3GJ7A 1E2FA 4M0LA 4NH0A 4X8MA 2R65A 2JASA 3EC2A 4JSTA 4QGAA 4DXAA 5EP1A 5E7JA 1T6NA 4NONA 4DSOA 3BWDD 2FF7A 1MR3F 1G6HA 1RYHA 2NO7A 4C0AC 2IF0A 1W46A 3THYA 4IFBA 3GQBA 1DE0A 4TL6A 1P73A 2NG1A 2RMKA 1E2GA 4Q48A 4EIWA 3A58B 5C1BA 4A36A 1G7RA 4BZQA 2BHRA 2XNSA 4FWIB 1G8FA 2GAOA 3FVQA 2GJ9A 2XZOA 1QHGA 2PLRA 2QBYA 4Y0VA 2J45A 5DH9A 1E69A 2IWHA 4UXHA 3PXGA 3UKDA 4HAYA 3B1WA 3MUFA 4G5RA 2D3WA 3SHWA 2JA1A 2JATA 1XCGB 3U7HB 1CJMA 2QTVB 4WA7A 2DB3A 2ZJBA 4JL5A 2OBLA 5LD2C 5FTKA 1YRBA 3IQXA 2IYTA 3K09C 2EQBA 4PC3A 3K9HA 4M22A 5CB6A 1RRGA 2X2FA 4OKSA 4QFMA 2A9KA 3OEHA 3UMRA 1UBCA 4CF7A 3QPVA 1AGRA 3FMOB 4AC9A 1KI4A 4HZUA 2ZJYA 2ZYWX 3BB3A 3LQRA 4XJXA 1E1RA 5HR5A 4C7OB 2RGCA 1RW4A 1E9SA 1IN5A 2IL1A 4RD3A 3R7WA 1S1MA 1QG2A 4LJ5A 1YZTA 1Q3TA 2GZDA 2C9YA 3E2IA 3HYRA 4PPNA 4OI1A 4C2TA 1F6BA 2SHKA 2O8CA 1E9CA 2D7CA 2R6DA 3EZ7A 2ZR0A 1X6VA 1E2HA 1RJ9A 2P6NA 2YINC 4B76A 1E96A 1U0JA 1M7HA 2WWHA 5J4HA 3THOA 1R7RA 1SXJC 4B3XA 4D26A 2OILA 1U8ZA 2YZ2A 4RD4A 4RJLA 4TL8A 1E2KA 4PAMA 1KKMA 3VFDA 2B8WA 3KJIA 5TVKA 4LDJA 3RWMB 3EC1A 3NH9A 4HAVA 4W7SA 2R6CA 1L8QA 2Q9BA 2GCOA 4EQ6A 1Z6AA 1VCOA 2JDIA 4A8JB 3NTUA 2ZS9A 2JJ2D 4O0MA 5JSZA 1II0A 4Z1MD 2Z4SA 1DADA 5HCIA 1P7CA 3SJCA 2YJTD 3RS2A 1D2NA 4A6XA 2KWIA 2V54A 5F2EA 1EFRA 2ZQ5A 3LRPA 3WBJA 2GBLA 1G3UA 4D4JA 3QENA 3FKQA 4FCVA 3C16C 2ERXA 2GK7A 3FDIA 3PUVA 4M9ZA 4G0NA 1AS3A 1HE8B 3V00A 4JLBA 1P6XA 1GOTA 2IC5A 4MGKR 4EJSA 2VBCA 5L3RA 1U0LA 1FFHA 2BBSA 4QM7A 4Q02A 2C95A 5C4GB 4FMCB 2VF7A 1OFUX 2EFCB 2QRZA 1CIPA 3MJHA 4JT4A 4KO8A 2ONJA 3QXXA 3U6KA 3FOZA 3SYKA 3NBYC 1XJQA 2RGEA 2A5FA 3N2IA 2A5YB 5DN6A 3NEJA 1Q1BA 2IYYA 2ATVA 3H86A 2OLKA 4JLKA 1E79D 3W8NA 5CLLA 2QORA 4AKHA 1QZXA 3CRQA 3DOEA 2FSIA 3KKPA 1FNNA 3DM9B 1JJ7A 2PCLA 1ZAKA 4EDHA 1P9WA 4NYIR 1HH4A 3LWNA 4MRPA 3A1UA 2HJVA 5FBWB 3ZIAD 3SE0A 2HCBA 4A0GA 3E5HA 2XNDD 4AYXA 2CHGA 4GZMA 3BBPA 1G3RA 1Z2AA 4WAUA 4JLOA 4R2HA 4BZPA 4Q1BA 4N0DA 4DJTA 4RZ3A 2W6IA 1XB2A 5FOSA 3B7GA 4HLQB 4CT5A 3SR0A 4PO8A 3AKCA 1JQJC 2IWRA 2FU5C 1E2JA 1JR6A 2WSMA 5JWRA 1JR3A 4S2EA 3OEEA 4P31A 4JVSB 4MKGA 3EW9A 1X3SA 5AJZA 5FPHA 4PSKA 1ZVQA 3EZ6A 1R0XA 1JI0A 4NYJQ 4NBSA 1A2KC 3OE7D 2IHYA 2O8BB 2R2AA 2C96A 2UKDA 2BM1A 3HP1A 4QGHA 1F2TA 1KI8A 4RD2A 1NN0A 1XEXB 1WF3A 3OIYA 4ZV4A
chains in the Genus database with same CATH superfamily
3ZR4B 5T41A 5KC9A 1BZYA 1FYDA 4OQZA 5FAKA 1BYUA 4RADA 2NT3A 1JQDA 2O1SA 4N40A 3ZHZA 2ODNA 3DE1X 3JQFA 1QOZA 1Y63A 2POCA 4ZCQA 3MHTA 4HG2A 3Q3IA 4GUAA 5FA5A 4CR7A 1VRVA 2Q46A 3IOCA 2YYYA 4WINA 3AESA 3EGEA 4QD3A 3V2UA 4UFPA 4ZOBA 3H4IA 3ZCVA 4UBJA 4E33A 3RFFA 4BCBA 4KV7A 4N5LA 2BGMA 4HWRA 5K0FA 3BXZA 3GWZA 1M2NA 1KAEA 3OOJA 5J2TA 3IMEA 1PGJA 3OCYA 2D5AA 5EMLA 1GZHB 1N3YA 4D79A 2QZSA 2EFDB 4YQFA 2XT0A 2Y0EA 3HU5A 3WI7A 2PBFA 5IANA 4WLVA 3L8CA 1H2XA 3F3SA 4CM1A 4CM6A 5JC1A 4NIMA 4X1IB 4M6WB 4M99A 4WADA 3VR1A 5LP1A 3DZ8A 5D3MA 1Y82A 2IOYA 1O95A 3AB3A 3DR5A 4GSKA 5L7WA 1MORA 1FMLA 5CFQA 5L7YA 2FMXA 4I1RA 1RHUA 3D1VA 4IJQA 1U9YA 3PSHA 3EUWA 1E0SA 2OSBA 1PDWA 3T5DA 3OZ7A 2OZKA 3NALA 2OOKA 3OWXA 4KTVE 2B37A 4ESEA 5LYYA 3HA7A 1TF7A 1X13A 4UAVA 4NU6A 3LK7A 4P7JA 1MAAA 5IAOA 2QTGA 2ZUBA 4IF4A 1X19A 3SMVA 3H1TA 1E7SA 4S0XA 1TZBA 3LVRE 4ZIRA 3ZH9B 3A31A 1E3EA 1JEQB 1Q57A 2AK2A 3DHNA 4IG4A 4IDBA 4X71A 5DI9A 4RHEA 2RI0A 1UQUA 2JA2A 3SJZA 2RKOA 3I01A 4QDUA 1RWOA 3DWEX 4NCKA 1KAGA 1O3YA 4PG7A 4EYGA 2HPHA 2QXUA 2HK6A 4D4IA 2WWRA 1TT5A 1U3WA 2JFZA 1FP6A 4LE1A 4KQ6A 2ATCA 4RM3A 1NDHA 1F0YA 2XCIA 1J8QA 1OU4A 2I7XA 2ZTMA 1YS4A 5IF3A 3U31A 3V2GA 4IUCS 3ZQJA 1KFCB 5IK2D 1D4FA 3SYTA 2AW5A 2A88A 1E60A 4PRYA 3STTA 1E9EA 5I9MA 2GAAA 4JDUA 4KR7A 3SE7A 3C7CB 2XVAA 4YACA 4Z2AA 4RDIA 4NMWA 4PGHA 4UVGA 3C6QA 3GG2A 4UHCA 4YRQA 3FVWA 5JH7B 4GKVA 4NPHA 3IKVA 3SIPA 2ZREA 1NL3A 2WKQA 3RVKA 1DRKA 2IXTA 2PVSA 3LNTA 4XASA 2CLHB 2C8LA 5TE9A 1P4SA 1KMQA 3I23A 4ZPXA 2EHDA 4WL0A 3FOFC 1QHIA 3OOHA 5I4IA 5B3JA 3A25A 3F7OA 4WY2A 3DONA 5DCYA 3GRUA 1M6WA 3QY9A 2XNDA 1USUA 3EJWA 2BFMA 1GPNA 3IEIA 4IEEA 1W1WA 5EYPA 4JKOA 1I2MA 5KYYB 1Q0UA 1GGKA 3L7KA 4LYAA 3NB0A 1ZM2A 2QE7D 1E6CA 3TQRA 4JJ8A 1FTYA 4G4JA 4RZSA 5LZ4A 3Q98A 2PBRA 5KKCA 4YT4A 3MEQA 3I1IA 3PUYA 3V7FA 1GRNA 3TNYA 2C8KA 4I5EA 2OEPA 3TI9A 1YZGA 2Q49A 1M3SA 3A6ZA 5FB3A 4L4RA 5BN4A 2XTZA 3FFTA 3FOWA 1B23P 2XAAA 5EQTA 4S0ZA 4N76A 2ZZMA 1JE1A 4IGAA 4ZXPA 1ZKMA 1MKYA 3G1TA 2H7XA 2NVUB 2AX4A 4RWZA 4EO7A 1HLFA 4P4TA 2AEFA 2H4XA 4HUQA 3PXCX 4B17A 5JHGB 4JA2A 1MU0A 2EF0A 2NUAB 2YN0A 5J47A 1XDWA 4YUZA 2NU9B 1FLAA 4NBTA 4U63A 5LQSA 1Z7WA 4FN4A 1DLJA 1I8TA 1G16A 1WV1A 4X0EA 2H11A 3ZV3A 3ORFA 4B5KA 3FTPA 7MDHA 4O4LA 2P62A 4CQNA 4IEFB 2WD8A 1OAAA 1TO2E 4PPYA 3MCAA 4YP5A 1Y33E 2WU3A 3UWKA 5LQJA 3TQHA 3UUEA 4YJ2A 1EX1A 3CCBA 2JLQA 3H2SA 5FO0A 3GJRA 3CFYA 3LT5A 5C3MA 2GA8A 3AK4A 1Q15A 1NW3A 2X86A 1E5VA 4Q3EA 3U0BA 1TD1A 3A36A 2VUUA 1CS0A 4XQCA 1DPGA 3H8SA 3JVEA 2NXNA 2ERYA 3HBJA 5GOTA 1FYEA 4XVQA 1K68A 4FEYA 1N1EA 1P2BA 2JCVA 3TTUA 1KPIA 2XRFA 3RUFA 3SF0A 4P4LA 4BP3A 4UPVA 4CETA 4OQMA 3UMGA 2XDYA 3RIHA 2QMHA 3QU4A 4P3KA 5T7BA 1SN7A 3B53X 1UBGA 3FMIA 1U0SY 2OP0A 2OG1A 2ZJAA 1W0KA 3FYUA 1WHSA 3L3BA 1E0DA 5AMXA 4DG9A 1BDBA 5L3QB 3K0CC 3U3XA 5AK5A 5IM4F 1V26A 4DCMA 1IVYA 4HC4A 3EWSA 1XPOA 4JS0A 2HLPA 4HQRA 3DBVO 4CV2A 3NI2A 4ATNA 4IMRA 2H1OA 4FEGA 3UC9A 5I7AA 1FS6A 5T6MA 4WOCA 2PYIA 4TV8A 1R6XA 5I3ZA 1XELA 4TQAA 3KT8A 4XI9A 4MDYA 3Q6NA 3NCTA 4X6LA 4B33A 1IHXA 4EFKA 3A1EA 2VDQB 2XMRA 1P4GA 4RV4A 1EMDA 1KJNA 1RXIA 4EEKA 4OXNA 4PYJA 2NMVA 1LPOA 1JXMA 1FW6A 2A1UB 3BIXA 4F9FA 3U61B 4QOIA 3LCMA 1J56A 2C4UA 5HA5A 5FBZA 5GGYA 3PJRA 3FRHA 2YYZA 4D9KA 1EGQA 1UAGA 3BRCA 4A6PA 2PGXA 1JG4A 1IHDA 1RE0A 3E7FA 3AXSA 4K5QA 2C3OA 1HGXA 1U7PA 4YJ3A 2W90A 4C5AA 4Z9FA 4Z4HA 1MHTA 1PNTA 1R0KA 1XTIA 2C1XA 3DTVA 2E4AA 1ZC3A 3ESYA 3AU9A 4ZGBA 3MQ2A 1M1YE 1B6SA 4XRRA 2OQVA 3EAQA 4F3NA 4B2YA 1J09A 1JQEA 1U9IC 4KAJA 3W4JA 4D8TA 5F5LA 4BU1A 4EUSA 2OCIA 1FDWA 2BRUC 2QRQA 3I3SR 5D7NA 3OU7A 4DBVO 4IVQA 4JOSA 1I7DA 1OW3B 4KW7A 2JJ1D 3J81A 5LWHA 2AZTA 3WO1A 3R3ZA 4LJAA 1P29A 1ZBDA 4ZJPA 1A5AB 2VHEA 1PUIA 1QLWA 3CQ9A 4ND8B 3VPGA 3GU3A 5HF5A 4BLWA 1WHTA 2OCXA 2GXQA 3FNFA 5BT8A 1WSDA 5FJJA 1Z29A 2C9ZA 1Z0JA 3QNUA 3ZWXA 4QRDA 4LF8B 2FGJA 1DI0A 2B8EA 2FE1A 2PR2A 2VFAA 3FDFA 4JZKA 4KX5A 4AURA 4DCNA 3KQLA 3WLEA 4RTRA 5K1ZA 2QY9A 1XVLA 4RQAA 3CN9A 3ZW7A 3PC8A 2O06A 2ZB4A 4BBJA 2BM9A 4EHJA 3K0SA 1Y5IA 1GCIA 1G2OA 1SQ5A 4I55B 1G3QA 1NM5C 4HQKA 5AM4A 1HM5A 4Q37A 4B32A 3UVEA 3UMJA 4IJ6A 4PLYA 3LUGA 3HDVA 3HH8A 4M55A 4H3KB 3LVBA 3WLQA 3ZPXA 2QN2A 3ETGA 3QKRB 1E1NA 3FXAA 2NPIA 2P2DA 5T3UA 2XY4A 3FPEA 3IL2A 3P26A 2OO5C 1PGPA 2QT1A 1PG5A 2CL0X 3ET4A 2X19A 3D8BA 4QHSA 1LPMA 3TBFA 3DP7A 1FDSA 2V3VA 4H4CA 2KM1A 1ESDA 3R5KA 5DIZA 4C2AA 3ILHA 1NJ1A 2H59A 2GPSA 3MJFA 3DFMA 3NHRA 4JGIA 4H6WA 4UU7A 4LQ4A 4D4LA 1IWPB 2Q6VA 2Y8EA 3E3OA 5IF9A 1VKZA 3EW7A 4RNCA 3F6SA 5EEHA 1I4OA 4NBWA 4BX8A 2WWIA 3KC2A 4IH9A 1HT3A 1QO7A 4TKVB 4WIAA 1XPUA 2DLDA 3WZMA 3OHPA 1ABEA 1NJGA 2Y1LA 4JNCA 1L5WA 4M4SA 4JI6B 3INTA 5JAUA 5EKDA 3WK5A 1DB3A 1YZKA 3DMFA 3NWBA 3O4GA 4B0OA 1BHJA 1VG1A 1AHIA 2AEJA 7REQB 4CEIB 2B4KA 4BJ1A 3ZJYA 3BSWA 3C5VA 2ZULA 4UTXA 5LJLA 4AJ4A 2FMUA 2J30A 4MX8A 1MTOA 3CNOA 3TD2A 4ZTUB 2SKEA 2CBXA 1N2EA 1FSSA 2G9VA 2HU7A 2P68A 4LSGA 2WFMA 3NBZC 5C81A 2D7JA 1L5LA 2W98A 1TU3A 2JIRA 2VQDA 5F52A 3E03A 1Q0ZA 4XJSA 1R3UA 2Q50A 2ZTHA 1US8A 3A9WA 4JYBA 5CGZA 5CR9A 3TNLA 3TQTA 4RAOA 1WZEA 5IHPA 3KTFA 5EJFA 2AFHA 4OX9B 4QBIA 2DLCX 3O84A 2NZWA 4GP7A 2OHFA 4QOGA 5IVPA 3T1YB 1A5SB 5FA8A 5KNCH 3ACCA 1JJIA 1ECBA 3AEKA 1U0BB 3QMVA 4KN8A 3LFTA 2OQ2A 1QH8A 3CVWA 1EVEA 3KWFA 1KNQA 4KQXA 2VUSA 4C08A 1C1XB 5TY0A 3UMBA 4GSYA 1AKEA 1NX9A 3RTEA 1D04A 2JBHA 5GJVC 1XXHE 1N9ZA 1GPDG 3N28A 3Q1LA 4OHKA 5G41A 1FBNA 5L4SA 2ZYTX 4HDMB 1F9AA 3Q3CA 4YMIA 1BGXT 4O8ZA 3RIXA 1EEXB 3NIBA 4TZKA 3WMRA 2H9YA 2XE7A 4BB5A 3TNJA 1QCZA 1ESMA 2HIHA 4M1YA 2N3ZA 3PKJA 1IEVA 4LDAA 3UBTA 3ZV4A 2QWXA 4YHBA 4D9CA 3O83A 2XH8A 2GILA 3AVQA 1THTA 3QGMA 2OV6A 4U5XA 1G98A 2Z2KA 5D5PA 1SHKA 2FW9A 3DFUA 5BXQC 1GGNA 2FEPA 3AIIA 3VMFA 4V0SA 4GC9A 2PAFA 1O58A 1NF3A 2JC3A 1SU4A 4YB8A 5H8WA 3FHJA 2ACWA 2CLDX 4OP1A 1X2EA 5BR1A 4FTWA 5EXDA 1HOTA 2WAOA 3F5FA 3VNAA 3UHAA 4B4DA 1CR6A 4BNWA 3FVVA 1SXJE 4ZMRA 1XJCA 2MYPA 3PHIA 1X38A 4ND2A 1L7DA 1BXGA 1RKVA 3L02A 3LQYA 4UC0A 2B5WA 3K8ZA 4WX2B 1Q95A 5FL7A 4CQLA 5JROA 3UICA 4JB0A 3HJRA 4DZZA 1NE2A 6ADHA 4I4NA 5H02A 2X8WA 5AO9A 3WSVA 1X7YA 2ZCJA 1JJVA 2NV0A 1FS4A 4KQ2A 1NYRA 3PNBA 2CLOB 4KUGA 4ZT7A 3B78A 1FRVA 2C0CA 4ZT3A 3DV2A 3WXBA 3H13A 4AZWA 5IUJC 2X5NA 4HPXB 1CF4A 4WHMA 1CY2A 4MWTA 1H05A 3MRXA 2BAGA 3QWFA 2LR0A 2WJWA 2AX3A 1TPZA 1U7HA 1WMAA 2ZG6A 2HJHA 4IHQA 3L1KA 3TDMA 1DMRA 1LZLA 2HHLA 2JRLA 3NHWA 4WXEA 4EHKA 5HMLA 2ZDHA 4EEXA 1VL1A 5E8JA 5TF4A 2X0FA 1T8UA 5L45A 1DIHA 4JCOA 4DIEA 3BRWA 5EIWA 3UJCA 4E22A 5I47A 3COZA 3FNEA 1ZOSA 1VOTA 1Q44A 2LCFA 3IDAA 4CE6A 4DLYA 3UV6A 1OPRA 4O4HF 5ADWA 4R1NA 3WO0A 4MR8A 1F6WA 1SJ9A 1XTJA 5KVAA 1XK6A 1RRVA 2XUKA 3LO5A 3TR6A 3ANXA 4GR4A 3F2VA 2D1FA 3C74A 3QVTA 3LLSA 1ZD3A 3FKJA 3HVJA 1TRKA 3AF5A 2ONZA 1PR3A 4EFNA 1DBQA 2HLDD 2ZW9A 2YY7A 1BMFD 3C3DA 3HCBA 2AKEA 1HWYA 2TYSB 4LDPA 1GA6A 1VG8A 4AB1A 1BEZA 2QEQA 3CJQA 4NTZA 2QB5A 3PBKA 3CUVA 4U2GA 2WP0A 2CLLB 4K9LA 1MAWA 3ESAA 3MFYA 4QT4A 1VKRA 5ALQA 2BVNA 4ZVNA 4DUGD 5KTTA 1RWVA 2G5GX 2OYCA 1XLTA 2IT1A 5HBGA 4WJLA 4A0SA 3FVTA 1UMBA 3ETDA 2O6LA 4US1R 1G8MA 3MPUA 2E9SA 4Z8YA 4OFBA 5ELLA 4YV7A 1HQDA 1FFXA 3W6PA 1Y6JA 2QLFA 3JU3A 2AYZA 4WOBA 4BJ3A 4C6TB 4BNUA 3EA0A 2ZTUA 1A9QA 1DQZA 1POXA 2B4AA 2HQOA 2M9MA 2QTFA 1M75A 1U2EA 4KSYA 1IB0A 1JIJA 2H1FA 2ZI3A 1IJFA 1PQYA 3N9IA 3F73A 2OFWA 2VF5X 1E1CB 4GVPA 3AEUA 3U2QA 1SIOA 3S5UA 4Y2XA 3VR5A 2G82A 2IQ5A 2XGOA 2XSZD 4ZAWA 3LBAA 3R23A 2Q4EA 3KB1A 6YASA 1EVIA 3TXYA 2YIJA 3WLKX 2XDQB 4FYYA 5L4LA 3BIFA 5HCUA 3TIFA 4R51A 2IELA 2CLKB 3T7DA 2RGYA 1HE1C 3EPLA 3HVHA 3H4VA 1JDTA 4L4YA 3K20A 2V5VA 4GKAA 4QKQA 5IXSA 5KJCA 4KPFC 1WG8A 2DFLA 2Y1WA 4L85A 3BK1A 4NENB 5NLLA 4LDQA 1FVXA 2CVHA 4NICA 1QGAA 3O7WA 2WAYA 4K9DA 4F04A 4N1AA 1M9NA 3T7IA 5A9RA 3QEMA 4C0WA 4OHXA 5C5CA 4ZK6A 2PLFA 4R6WA 1Z17A 3VH3A 4D8VA 3V8NA 5KSWB 5ER9A 4F7WA 3U44B 2IS6A 3ZHOA 3DPUA 4LK2A 4CQJA 3OPVA 1GTMA 2P77A 3TEFA 4YUVA 3E4CA 1N2BA 4BMCA 2FEXA 3EUAA 1CKEA 3R7SA 1AH2A 3FJOA 3UJ6A 3NNSA 3ZVRA 2WG0A 3CUEF 2ZWPA 4K6FA 2CUZA 3EY4A 5H83A 1E7WA 4IMJB 3D9QX 2BR5A 4MUXA 1YRWA 5MFZA 3IEVA 1JDUA 1UJ6A 1IONA 1ACJA 5J2UA 3W6NA 1MB3A 4PZ0A 2X9NA 4K40A 5EZYA 4RORA 2MTBA 2QAGC 3NVAA 5EE5B 7ABPA 3WRYA 4DDKA 1NRWA 2YHBA 5MGNA 1Z0AA 3O31A 2ZT6A 5ALZA 2Q2NA 2GESA 3G8CA 3OP1A 4JSRA 2B25A 2KLBA 4FUTA 4PYMA 5F1KA 1MH1A 3ZS9A 1UDBA 1PFGA 1IXZA 2AQKA 2A0FA 5CFNA 3RBVA 1CB7A 1HZZA 3HB9A 4YPFA 4RPIA 4YWHA 4MUJA 4UUAA 3K0FA 2K4MA 3U9LA 3FKSA 3QOYA 1VJCA 2ZVQX 3KBOA 3ADCA 4AKIA 3KPJA 5IC4A 1PJZA 1V8DA 2X8AA 2XBLA 3NCHA 3H0EA 4INJA 3TTSA 1EEHA 4ARIA 1VJRA 1E18A 3OQIB 5EIFA 3LC2O 4JITA 3BWEA 1SCBA 4PQGA 4YY3B 3HSYA 4MA4A 3K9NA 5FI5A 1CQXA 1NVBA 2HTFA 2WNSA 3M5WA 3W4IA 5A3RA 2GTPA 3BEOA 4GX5A 5CXSA 1QGUA 3USZA 1UFQA 4B2PA 3BC1A 1QX3A 4RD1A 4R05A 3T1VA 5DYWA 1SG6A 1E5QA 4X65B 4CTJA 3DD5A 4Q03A 2DGDA 2XJ4A 3TTVA 5JOQA 1HZJA 4A2PA 1HEUA 1EUCB 1RYZA 3R5HA 1SBZA 2ADMA 2J6BA 4FHZA 2H07A 2PX8A 2QP3A 5C1DA 3NO4A 3PP8A 3D4IA 2VUHB 2UZ3A 2XXAB 4Y9DA 1IZ7A 1KK1A 3D8RA 4KR2A 3GLHA 3MPOA 3BB1A 3BQMB 4R16A 1ZWLA 2AD5A 1YKFA 4HQ0A 3E15A 3R7WB 3CG0A 1I32A 3BGIA 1SCAA 4FYIA 4I66A 3A1NA 3ZJ4A 4R2MA 4DARA 4YRNA 1QVVA 2VDPB 3HPRA 4L6AA 4AX8A 1VJDA 3E22A 4PGAA 3CF2A 3A1VA 2WTUA 1D09A 2R44A 4E3WA 1A9ZA 3TQFA 4CFYA 1GNVA 3BWBA 3FCXA 1K9SA 3IIJA 2WM9B 4AICA 4NDAA 3IOYA 4EYSA 3P0IA 2PU5A 3IR6A 1NUTA 4P3XA 4EB6B 1XP8A 4R2JA 2B4RO 3KELA 2XRYA 1CUFA 5C34B 4NL4H 2FPSA 2FV8A 1REQA 1YQGA 2FPMA 3HV2A 4PYOA 3W8FA 2WIDA 1NQ5A 3AC0A 3F6EX 4OJKA 5JSZB 2RHHA 3JASA 1ETHA 4YECA 4XCQA 5AVQA 3KT3A 5GZ3A 5EQDA 3LSTA 1P3JA 1YVRA 1NT2A 2ETVA 2H06A 5KVSA 3MMNA 4R2WA 5ABPA 4PZDA 1YQQA 4WNAA 2HFJA 3P5BA 4PYRA 2ZJ8A 1USVA 4QHYA 3NORA 4PE5B 1SK8A 1NY5A 4RA9A 3SZLA 2J5XA 1OXXK 3QX7A 2WNHA 1FNBA 3AFGA 4KKXB 3AOGA 3ADDA 1ISHA 1PD0A 2GXUA 1CUXA 2J08A 2ZETA 3UGTA 5IFLA 4NMXB 1PTJA 3C7DB 5EG5A 5FWYA 4PLTA 4HNVA 2BZ1A 1M72A 3OUUA 1XFDA 3A4IA 4NJEB 4R68A 2UZAA 4U9IS 3RLFA 1JLKA 2BR3A 4MRAA 2HCTA 3W2TA 1ZUWA 1UJ2A 4MGYR 4C7KA 3SFTA 4G4IA 4EPXA 4CLOA 3JQCA 2W71A 2VDUE 3SVLA 1MIOA 3FZYA 2OD2A 2CKDA 1NUSA 1JFVA 2ZS7A 1GQQA 1KQPA 5M2QA 3PEFA 1UPAA 3TRJA 1VHDA 2FSUA 3ZJTA 5E2AA 1O08A 5KEIA 1CDDA 3GDHA 2A0KA 4RUKA 2BGUA 1K5GA 3F6CA 5KO2A 1S9HA 3BE5A 4F12A 1MX3A 3W8RA 3UXEA 2C4HA 4L2IA 4V3CA 4MWBA 3JAKA 2IV7A 2R8ZA 1KZHA 1HL7A 3TKYA 4PLZA 3GN1A 4HO1X 4A8TA 2FCRA 3O4JA 4PAWA 1M2EA 4IRMA 2BGTA 1MQSA 4WBNB 3IP1A 2JJ2A 3RRXA 3TMAA 4EY4A 1UBKS 2QN1A 3B3QA 2PX2A 3IUPA 1VFNA 2HJGA 2BFAA 3UEOA 2MDTA 2XLBA 3A9UA 4HXYA 4Y0AA 1H2HA 1CZKA 2H65A 2JGJA 4MVWA 1JZQA 5BSWA 5JO0A 1XDZA 5K45A 4WN9A 3DBRB 1YDWA 2P9FA 3MJTA 4HX5A 5H7XA 5AW5A 3VC3A 1K75A 1DBVO 3DZJA 4V02A 4O25A 4TYMA 4XYGA 2NYAA 1M34A 5DGHA 5DM0A 1M76A 5KYVA 4O2AF 3V3KA 4K0RA 2C2GA 1EFTA 1V7CA 3PIDA 5TVGA 5KQMA 3OU2A 3IQWA 3F4BA 5G0UA 3EXG2 4YV0A 2JLXA 3PXUA 2ZT5A 4EI8A 2XKBA 2ZRHA 3AU8A 3HY4A 1R0YA 2B34A 3R7LA 2X8JA 2DBRA 3GBPA 2VRWA 3D0KA 3I2KA 3OC0A 3PK0A 2AG0A 3HKBA 3I12A 1GGMA 3T5BA 2XMPA 4LJYA 2GZ3A 5COAA 1RLUA 1V11B 4QBHA 1HYGA 4OQYA 4DL9A 4YK7A 3RHTA 1I24A 1LK5A 3LGXA 3LYLA 5ICEA 5B53A 4J7UA 3OO0A 4DJ5X 2H4ZA 5DCUA 1WNFA 2SICE 1E79A 2PZMA 3K0KA 5GVRA 4D02A 1ZR2A 1OQAA 1PVOA 3FPLA 3ILVA 2L2QA 2M1ZA 3AW9A 1QB7A 1Z08A 3MJSA 3QX9A 5IZCA 2CT8A 4DREA 4PLCA 4AFNA 4V24A 2C3UA 1DV2A 1WUYA 1DRUA 4B48A 2J6IA 4CQMD 1U0RA 3ONFA 2HOQA 3A2NA 1ULHA 4FHEA 2GJAA 1T5LA 1PNQA 1IHPA 5L3SB 3OTQA 2DSNA 2Z56A 3AESB 2PLNA 1CJVC 5F4ZA 2FR8C 4Y67A 4BO0A 1CUGA 2V8BA 4NFYA 3WWCA 2DFPA 5K0TA 5DNYB 4I1YA 3ZDXB 4RHUA 1QHHA 5J2TB 3D54D 1ZG3A 2DETA 4G37A 1MRNA 3H0CA 3WDMA 2IPXA 4YRJA 4PGGA 3V4OA 5DOZA 1MRSA 1QDLB 2A33A 1O89A 3EBOA 3OX3A 2E49A 3MWLA 5BN3A 3IP5A 4P7FA 3UY4A 1V7QA 2J07A 1G21A 3E7PA 1Z8FA 4ZRMA 1XWWA 4AD8A 3D3QA 2ZROA 4KFUA 5DHSA 3FNIA 2FZ4A 1ZK3A 1MDBA 4R2LA 4IHKA 4Q1CA 1PZGA 2JGLA 2IE8A 5HUQA 4N6GA 3IO5A 4GICA 2F67A 4OFWA 1KJZA 1X7DA 4DSTA 1GDDA 4RYDA 3I0NA 2BTOA 1QNLA 3NHLA 3OE7A 3UUGA 2WQ7A 5KYUB 3GRKA 3UJPA 2C1ZA 3I62A 1EAMA 2C88A 1SVUA 3MAGA 1TKRA 1XZEA 1M74A 2NYUA 3IT0A 4I4IA 4ZIRB 3VNVA 5TMEA 4QUJA 4N7RA 4EP1A 3SPXA 2HRBA 3WL5A 1K27A 1RXWA 1UQRA 3DMDA 1RQ7A 1RZ3A 4K1XA 5BUQA 3PLNA 1Z8DA 4M60A 4D0SA 2DH6A 3QP9A 1H4TA 2HB6A 5CEEA 2BH9A 3AFIA 5HFAA 2ZGVA 2IUTA 1H6AA 3L07A 2IW1A 2WJ6A 4GX1A 2BKAA 4YCNA 2GXAA 5T4BA 2AFIE 2WHEA 4NPCA 4B43A 4EPTA 4NCAA 5KOHA 3KEGA 1U0FA 3N2ZB 1L4UA 3PGJA 4HY3A 3KO8A 3FYCA 2DWQA 4O0LA 5JZVA 3V7UA 5EUMA 1PZFA 3O5AA 3RS3A 5CHYA 1SUEA 3QVUA 4LKRA 3V2HA 1H8EA 2WAAA 1W5BA 4I0WB 4X20A 4QG7A 4YCAA 1EP2B 3VU0A 5JFGA 2PUBA 5ADVA 5AHWA 3VU9B 5AXBA 4PEVA 2PZGA 1X7ZA 3QYJA 5JAMA 3TJRA 4LNUA 2FZWA 4FE4A 3BJIC 1A96A 5EHXA 3C3AA 2VCYA 1W2GA 1LRLA 1QJ4A 5DCLA 3X0DA 2YXLA 3S4YA 4JXXA 2R9VA 3WP0A 3QU7A 5A4KA 2BR4A 2V45A 5HG0A 3M6MD 3QBVA 4BNVA 1ZUNB 4L51A 3DBOB 1SCKA 2QDKA 2XOKD 4V0MA 5EYPB 3LZCA 1UZLA 1LX6A 5G53C 1TJYA 3JVVA 4CMBA 1M1YB 2WMDA 2IPOA 3NM5A 3ABQB 2G1KA 3EHDA 2UZ1A 3V4FA 3GPBA 1H9CA 1R8JA 3E5MA 5A9SA 3OPXA 1TKCA 2PJRA 1WBJB 1IZZA 1JFFB 2QUJA 2OO3A 4ENTA 2YKGA 1ZGCA 3HXKA 3B13B 1D6NA 4NCJA 1EGHA 4WT7A 5CT9A 1P1HA 5BN4B 3RU3A 4Y6SA 4YRZA 5JUWA 4HDOB 4L78A 2RC5A 4LYHA 1K6JA 3C3MA 2GTIA 2ZYIA 1I01A 4RVNA 2SKDA 5DNEA 5K6RA 4HB2A 3HYTA 5KNBA 2PFKA 2ZRIA 1FBTA 1D9ZA 2BEUB 4HUQB 1ULUA 2AVNA 2CDBA 4U2DA 1L5SA 3PQ8A 2VP4A 5DWQA 1NX6A 4A2QA 4F96A 1V5WA 2PX0A 3DSRA 1HT2E 1UOPA 1UBHS 1P45A 1YMUA 2VTEA 1FNSA 4XB6B 4PQYA 5HQJA 1E77A 2A0YA 4IHJA 4P7GA 4R84A 2PRSA 1TM5E 2HREA 4N3CA 1NMYA 1RACA 1WXEA 4O4LB 3RS7A 4JL6A 1CUVA 3SHOA 3ZOZA 2BMAA 4AX4A 4GI7A 3EXHA 4UVHA 1O6CA 2DFVA 3EGVA 2P5SA 2REBA 2RG7A 1OZAA 1EHIA 2PN1A 2Y1GA 1ADYA 1UDXA 2GCIA 4IXTA 1NN5A 1TGYA 2A4MA 3ETCA 1T8SA 1Z28A 2HI0A 3H42B 4JIGA 4Y2RA 2D59A 3AI1A 1N3LA 5HIJA 3WGIA 1QU3A 4BUJA 4OX9Y 2M6RA 5LXTA 5B6IA 1GZ7A 1TD9A 2A94A 2WINI 4HAXA 3H9UA 5EJ7A 5J4VA 2RGRA 3M4XA 1NVVQ 5ECWA 3R7BA 5I7RA 2IU4A 2ZSEA 2RJ3A 2ECOA 4QOHA 3AYZB 4BLVA 4FGKA 1GCOA 3A06A 3ENNA 4WY5A 4YQZA 2NP6A 1YIOA 3JQFC 5HWSA 4C78A 2Q1SA 4YASA 3VO1A 2E87A 4OB6A 3I04A 4LOHA 2VO1A 3WGNA 3SHFA 2AOTB 3HFGA 2IUUA 4IIJA 1C7QA 1RP1A 2C42A 3FF4A 3ZHXA 4E51A 3W34A 1G18A 2YWXA 3LRTA 1IOLA 4INAA 1CULC 1XZLA 1LVUA 2AR7A 2M1XA 3BRSA 1S2GA 2ZKIA 1ZIYA 3EXG1 1GUDA 4LIPD 3VPCA 2BGRA 3OE4A 2ECKA 3QKWA 3N2LA 3A05A 3ZYZA 2W42A 3GX1A 4CQMB 2JB9A 4PNEA 4MV1A 2XHEA 1I0IA 4BB9A 4KRYA 3PYXA 1PFKA 1O95C 3MWGA 4G4SP 3BWMA 4EB0A 4BS9A 5EXEA 4JYMA 3WNVA 1PFYA 5DW0A 3V4RA 3ED5A 3TCNA 2VHTA 3DMNA 1YMQA 4FP9A 4UNNA 1KJYA 3GPIA 2VWPA 1XYVA 4KO1S 4EKGA 5CH3A 3L5OA 1UKZA 1Z5UA 3AUAA 4J4BA 4PBSA 2QVBA 5B7GA 1GADO 1UFOA 1FFDA 5EHNA 3TG8A 4INOA 1UEIA 1G3IA 2JCGA 1C0LA 1JQ3A 1XXHB 5A1TA 5IXJA 1A7JA 2VNSA 1GL3A 2OCYC 3L7MA 4PQFA 5BQ5A 4B6SA 2XI4A 3DTVB 3GLVA 3G7NA 2P3SA 3DT9A 3GT3A 2FPPA 4J8PA 5DXJA 3PQ4A 3TPCA 2P9CA 4E21A 4XYMA 2GSWA 4ZMBA 3PXDA 3OZSA 1C8BA 2ZEJA 3DDWA 3KT6A 2YJ3A 4RIGA 3PJEA 3NVDA 3GLGB 3GP8A 4TYQA 1RBMA 5G0TA 4DBLE 3HJCA 3JSAA 2I6QA 4RMHA 2CXQA 4FUQA 3PR1A 4GYWA 1YQ9A 3URKA 2NZ8A 5JQGA 2X4LA 1XNHA 2AQIA 2VHUA 3CSSA 3FPSA 5DW3A 1H2AS 3FBWA 1KBOA 5C4IA 2FK8A 3MCVA 4XM1A 3BFXA 5F12A 1YS2X 3AY7A 1E2LA 2QLJA 2ZE6A 4PZUA 2P1RA 4EABA 5GQSA 1VP9A 3MSXA 2JCXA 5HEKA 5B3LA 3ERCA 4TUYF 2PZEA 4RK4A 4W5NA 4FLFA 2BFBB 4GQAA 1T9AA 1VL6A 5IKPA 5B3JC 4MDHA 3A0UA 1KE1A 3H17A 1XHEA 1Q83A 2HBQA 1VKNA 2JIMA 1WCYA 4IEIA 1Z26A 1GT6A 3QQ5A 4HAZA 4HCJA 1D0IA 5JJ5A 1CUAA 3TZCA 3O4IA 1XHFA 4J0IA 8GPBA 3SLRA 1KWGA 4KE6A 4O4HB 1X14A 2YDXA 3F3MA 3D0RA 4RE5A 2W2TA 1W4ZA 4KXFB 2OV2A 4QTUB 1KDVA 3VNSA 1U2SA 4M88A 1XTPA 1D8AA 1B2RA 4IHJF 5SZJA 1KDOA 4M7OA 5EMHA 4DCJA 5AUOB 3HB4X 4AI6A 3U3KA 5A4IS 3FNHA 3OEHD 4L5YA 5A3VA 2IDJA 3Q9UA 5I51A 1NU8A 1O94D 3L8GA 1GSOA 1CBUA 3DLCA 2P5TB 3U7EB 4C0XA 3CZPA 1IY2A 1HFWA 2SCUB 5DXAA 1IWOA 2ODEA 2VHZA 1C9EA 3LXMA 4QYXA 5CH8A 2FG6C 1RP7A 1T4GA 1X8KA 4AKSA 4XAQA 2QRNA 4DXHA 4N9QA 1Z5WA 2AB0A 2N46A 5LQKA 4IUDS 1DARA 2Y9PB 1GAWA 1W5EA 2OVFA 4JT2A 5D87A 2Q0XA 5LXTF 3VZSA 1FDRA 2A78A 3OZXA 4U5QA 4DIBA 3QKSA 4BGEA 5AVWA 4M1WA 1TW3A 2QL6A 1NVTA 4EG6A 1RIFA 4LYDA 5JJKA 4R8VA 3M9XA 4R0NA 4J75A 4I2NA 2GN9A 4BFZA 4OQEA 2ZUFA 4DSNA 1L7PA 2AE2A 3V42A 2WV9A 2YJ5A 3T4XA 4A7PA 2GO7A 4Y2SA 1M5RA 4BO9A 1HRDA 2Z5GA 4AK9A 2A3NA 3O3CA 3J7TA 2RHTA 3A8TA 1T15A 3CUTA 3ICVA 3K73O 3OP4A 2RSLA 4PF1A 4XDHA 3T1QA 4AN4A 2X0JA 5LUBA 3TTYA 2AZ4A 1LQTA 4IIJF 3X3HA 2QG9A 3HACA 3MS7A 3P9RA 2JLWA 4IIYA 1JJBA 1LGYA 4HQ6A 1HT0A 4KPGA 2C2KA 2JKYA 3AEKB 4G5OA 4MULA 4EAQA 1XQXA 5LWQA 3OQMA 1JHRA 1GPJA 5EKUA 3E58A 2OSVA 2G77B 2DCMA 4W6QA 2IEDA 1ZIPA 3IELA 3RHFA 2C4WA 4ALMA 5DSZA 2FEAA 3EDMA 3FPHA 1Z15A 1M2JA 2HU8A 2X22A 1EFRD 3CXRA 3DEFA 1GPUA 1QS0A 2CB0A 3A70A 3PFCA 4QTYA 5GY7A 4R9VA 1T26A 2ZB8A 3FYUC 2JAUA 3T3MB 4YMGA 3FPKA 4J49A 4LKOA 1F2DA 2FAXA 4L72A 2YC4C 3RPEA 3UTDA 3RRYA 3ULKA 1Y1PA 1P61B 3K96A 3FYTA 2WKRA 4HDNB 4UUOA 2QZJA 3V48A 5BMOA 3J7AC 3B1VA 5DBHX 2I6SA 2QRVA 2D5IA 3I76A 3G9QA 2NU7B 1W88B 3MXTA 4HF7A 1E6MA 3FI0A 2FSSA 3DUFA 4BWGA 2AT1A 3D6VA 3M4ZA 1N6NA 1R8QA 3G1WA 2WWGA 3GJSA 1KPHA 2IY8A 3K4QA 3M3HA 3SP1A 1RMQA 3VDNB 4LF9B 3QPBA 3H8JA 4CR6A 1K6IA 2BEVB 3KETA 1SG0A 3LXXA 3U4AA 2HKIA 1Q16A 3CN7A 5D5HA 3ZWOA 1PRYA 1GTG1 1KDTA 2DF8A 3U6BA 3DJFA 2Z2YA 1U0GA 1X3LA 2JZOA 2NQ8A 3EFBA 4BQFA 5C2JB 4HVAA 4DV2B 5JD4A 3CWCA 2Q3EA 3AH8A 3JWJA 4CQLB 1EXNA 5HJ7A 3SN6A 4A8JA 4OP3A 1C9KA 2HV8A 2PRZA 3VGJA 4MMYB 1P2DA 4IIVA 4FNMA 5DHFA 2GFHA 1X7YB 2PS3A 2YXPX 4H4DA 1R6VA 2V03A 4DV5B 1A2QA 4BUZA 3WXMA 1PLLA 2AOXA 3ICCA 3KHUA 3U3MA 1RD4A 3ZU4A 1D1PA 2V6FA 1D0VA 1RYDA 3PQ7A 1S8OA 1J8FA 4Z9AA 5B4VA 5BNIA 1GAQA 4XUGB 5E6SB 3ZZMA 1Y48E 1TRHA 3NVMB 3OI7A 4IS2A 2TMKA 2WYHA 1E1DA 2QD4A 1P91A 1SG9A 2I6TA 2J48A 2R8OA 2X0RA 3F8SA 1YZLA 3NJRA 5AKZA 2KYRA 2C00A 2P9QA 4OKIA 3CY6A 3OC6A 4MKRA 1YB1A 1YL7A 2NZUG 4BTEA 5LMCA 1NWHA 1ZGGA 1GKIA 3LH5A 2L18A 2R86A 3ZK8A 1VLLA 3COVA 4YALA 5ELMA 2V98A 4LY3A 3WK4A 3BH6A 2PAAA 3GR6A 1E1QA 1DDOA 1UQTA 3HWX1 4L8WB 4MR8B 3BZBA 1KVUA 2O3JA 2RGGA 1F0NA 4I1IA 4KN6A 1XMSA 2ZIUB 4RQUA