1CR0A

Crystal structure of the helicase domain of the gene4 protein of bacteriophage t7
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
277
structure length
241
Chain Sequence
b'MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKDLRALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA PRIMASE/HELICASE
publication title Crystal structure of the helicase domain from the replicative helicase-primase of bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase
total genus 77
structure length 241
sequence length 277
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cr0A00
1T3LA 4ZPXA 2KE5A 2RGCA 1E32A 1BIFA 4AI6A 1TQDA 3AP2A 1QG2A 5EE5B 5G40A 4AK9A 5GJWC 2C2HA 3SBDA 1CR2A 2ORWA 1IY2A 1X6VA 3RS0A 3K09A 2BBWA 5AR1A 2PEZA 2G9NA 2ZROA 2W2XA 3LBHA 1R0YA 2AK3A 2Q3HA 3EWAA 2ZXUA 4UNPA 2F1RA 3KQNA 1AGPA 4JL8A 3U5ZB 3P4YA 3QKTA 2AR7A 3W34A 2HLDD 4NYIR 1P2TA 2DFNA 2W6JD 1NN0A 2D7DA 4A6PA 3CO5A 4HUQB 4RD2A 2AXNA 2ODEA 3FYHA 2P5SA 3F5FA 2RGDA 5D3MB 5EXTA 4G3XA 2QN6A 1DAEA 1XEWX 4D26A 2SHKA 4AY2A 4D0NA 1KSFX 1UBGA 5FOSA 2WKRA 1IM2A 1G8YA 2YWFA 1JEEA 2WWGA 1W36B 2CE7A 4HAYA 4HLCA 2J7PD 1EXMA 1OIXA 2GEUA 2R6AA 4M2LA 5FOXA 2GESA 1ELOA 5ELXA 2BCJQ 1IAQA 4KBGA 3OAAA 2OCBA 1KI2A 1ZNWA 3DPUA 3PV0A 4RD0A 4ZCLA 4FWTA 2B6HA 3R7WA 2X2EA 4RSGA 1XXHA 2WWXA 3GLIB 1JALA 1ZD8A 2IYTA 1TUIA 3QXXA 3W3ZB 4O3MA 4UNQA 1JECA 5B64A 1AJEA 1G4AE 1CJMA 4A8JB 4JLPA 3GJ4A 2J0VA 2JJ1A 1K5DA 4NHOA 5EUQB 1KDOA 4RFVA 3FKSD 2O8CA 2C99A 5KPDA 1IN5A 2PT7A 2QNRA 1Y3AA 1OIWA 1Z22A 5DLQC 3D3QA 5FBLB 5HE8A 4ACAA 5J4YA 3NVAA 4U7DA 1WRBA 3UMFA 1DG1G 4DLXA 4E03A 2Z5FA 4IJMA 3L8YA 5BN4A 2PX3A 3UK6A 3AH8A 2GBLA 3EA5A 5BWMA 2A7QA 2KWIA 2ODNA 1WA5A 3C4JA 2BVNA 2FV8A 421PA 5EE0A 1DPFA 1S1CA 3TUIC 1E1QD 2VLIA 4Q9JA 3FMOB 1G41A 5DI3A 1NKTA 2BMJA 1RW4A 3VU9B 2EFEB 3DOFA 4TSFA 4PAMA 4Q01A 1L7VC 3TAHA 1RFLA 3ZYCA 1ZM4A 2PZEA 3B13B 1XMVA 2HXSA 4MRVA 4BFVA 4NYMQ 5GJBA 2HT6A 1DEKA 1OXTA 1LS1A 3A36A 4NZYA 1IXRC 4TMXA 4UXJA 4DSUA 4DLWA 1EGAA 1WQ1R 1XCMA 3PUXA 2GK6A 1OSNA 2A78A 4MRRA 2QAGB 5F98A 1E99A 2XNDD 1XJQA 3K8YA 2B21A 2WV9A 4EFLA 2VHUA 3B1ZA 2A5GA 3PUWA 4PHGA 3QXCA 1KAOA 3WP0A 5IK2D 5KUTA 4U5XA 5TY0A 1XTIA 1XTQA 1N6OA 1GDDA 1OF1A 3B1YA 3AKYA 4IDHA 2AD5A 1S4QA 2AL7A 2GF0A 4YONB 4W5WA 2JDID 2JIZA 4L5BA 4JBWA 3BRWD 1NMZA 3VR3A 5H70A 3IPYA 4F38A 1G8GA 1QHSA 3QBTA 4XJXA 2JLSA 4W5JA 3WRYC 3VMFA 1F2TB 2WJYA 3DO6A 1GNQA 2ZRLA 2CCJA 4I4LA 4AIIA 4JLJA 1R8SA 3AP3A 3P26A 3MWKA 3T1QA 3Q7PA 2ZUBA 4TMWA 1TL7C 3HPQA 4RD3A 4L16A 3R9WA 2XXAA 3QG5A 2WSSD 2FWRA 5A4JA 1JXOA 1E2GA 3WBKA 1UBFA 2X2FA 3K9GA 3CPJB 1TEVA 4F91B 3U4QB 1DE0A 3VR2A 2ZI9A 2JLRA 1VG8A 2GXUA 4GI7A 3EZ6A 5JI2E 1U2RA 5BN3A 2BDTA 1NBMA 3NTUA 3K0CA 3L0SA 3OF5A 4KFSA 4KV9A 1COWA 4V0NA 5JS7A 1N6NA 1JR3A 5IHPA 2ZRBA 1YQTA 4LBVA 3UG6A 5FUVA 2RB4A 1NVVR 4KVGA 3UMSA 4XVUA 2P6RA 1HH4A 3U7GA 3U6KA 1FX0B 2BOVA 3LW8A 2H18A 4PR0A 4PX9A 3Q7QA 4IDQA 3KQKA 2R62A 1ZM3A 3CONA 1U0LA 3G82C 1T8UA 3T1OA 2QRZA 3I72A 2BHRA 4AYTA 3CPHA 4OHYA 1E0KA 1W36D 1P9NA 1JAIA 1Z07A 4H1VA 2ERYA 3SI7A 3RS4A 3ZH9B 2XGJA 4FIDA 5DSZA 3B82A 2D2FA 3PXGA 1VIYA 3OEHA 5GVSA 1M6NA 3CX8A 1GL6A 2ZRCA 4IOKA 4DB4A 1H65A 1SVKA 5AJVB 4KLNA 4XSGA 3BS4A 4B43A 2C96A 1AS3A 3BH7A 1VCMA 1KIMA 1D8TA 2GKSA 2DY1A 2V6JA 1IN4A 2Q3FA 3WBJA 2OBMA 3CR8A 4TLDA 3THXA 1NF3A 4Q7MB 4BFUA 2R6FA 4Q7JB 5AK0A 3SNHA 4AKGA 4URVR 2Z6VA 4ASUA 1M8PA 2WJVA 4Q4JB 4AKEA 1P2VA 2VF8A 1VHLA 2AFHE 1JAHA 3RANA 4B73A 1AA9A 5G53C 3VR4A 2WBLC 1HQCA 2K5UA 4DLZA 1M2OB 2ZEJA 2ZI3A 1KO4A 2QZ4A 1S8FA 4Q03A 3ZS8A 3THOA 1E79A 2ZR0A 4K46A 4WW0A 1SVIA 3KUDA 1FFHA 4MA4A 3MMPA 3HJNA 1XNJA 1Z28A 4N0EA 2O8DB 3KKOA 3AUXA 1IN7A 2IYXA 4EQ6B 4QBIA 1XBTA 4PSKA 2W6JA 4YLGA 3NBZC 3BGWA 4NU0A 2QPOA 4LBYA 3VFDA 1FUUA 1ZIOA 1D2NA 1HURA 1ONBA 2JJ8A 4Y0AA 4GP7A 4A6XA 4E5UA 2ANBA 2RGNC 4EJSB 5KO2A 5BYKA 2D4HA 2AD1A 2QTFA 1OXXK 5KDOA 1NY6A 2C9YA 4QFMA 4YQFA 1RJ9A 4FCTA 2FN4A 4TMVA 5B58C 4DXAA 2G0NA 4AYXA 5EXSA 4TMKA 2YINC 3GJXC 2XTZA 1FP6A 5TXGA 4DUGA 5EQTA 3A1VA 3MLEA 3CRMA 1GKIA 4Q1CA 4MYUA 2Q3MA 4CW7A 1E0AA 1ZIPA 1SXJE 4QGHA 4Q9LA 3QVVA 4JBYA 3TMKA 1FMJA 2OM2A 5JWOA 3JZAA 4QBGB 3CZQA 3TW4A 5CLLA 3LVRE 4L8GA 2IWRA 2J87A 3K9LA 2ZS7A 1XX6A 3I5XA 4MGYR 5AJXA 4EPRA 4G5QA 4MGZR 3QUSA 1G5RA 2P67A 3CUEF 3N2EA 3OFND 1UKEA 3O47A 1F3OA 3ETLA 1I4LD 2ONKA 2W0MA 2F55A 3S1AB 4C0SA 1A5TA 5LD2B 1XDBA 4IVPA 3SBEA 2VP5A 4XD7D 1LY1A 1TQ2A 1E2JA 3FKSA 1S1MA 1KSHA 2QG6A 2CHVA 3N2IA 4MYHA 1W46A 4IRUB 1G16A 2CJWA 3KJHA 1Z8FA 4HZUB 2O8FA 3C16C 2DWOA 4LHWA 3TBKA 3CNLA 5FUWA 1NJFA 1R0WA 4TZ0A 5K8UA 3AF3A 1FQJA 3SOPA 1XF9A 3DVLA 2V9PA 4ACBA 1KI8A 3B78A 4Q02A 1ZUHA 3FMFA 1KMHB 4PAOA 4Q5IA 4IVQA 2E9SA 3LDAA 5FI0B 3RVBA 2R9VA 4X8HA 2I1VB 4DCUA 1XCGB 1C4OA 1KDRA 4GP6A 4LJAA 1E1QA 2VRWA 4FW9A 1NLYA 3UWKA 2OFXA 2FSHA 2TMKA 5JWRA 5L3VA 2REXB 4GPTA 3AKCA 2A30A 1ZMXA 3UKDA 2ODBA 4ZKDA 4JL6A 2HT1A 1W1WA 1KSGA 1NL3A 1Q1BA 4LYJA 5E4FA 4PPFA 3BORA 4ABYA 3B6EA 1Q21A 4KHZA 2ZREA 4B75A 5HKKD 1NLFA 4BFXA 3FE2A 1MH1A 4WAUA 1N6HA 4KFTA 2GJ9A 1BKDR 2XNDA 1KY2A 4PQYA 2DWPA 1OB2A 3BERA 3R20A 5LPNA 1RIFA 4QGFA 4URZR 1MKYA 3LNCA 3QF7A 2IEZA 2ZS9A 1U90A 2O52A 2JA1A 2L0XA 3CRVA 4PZLA 3W5IA 3K09C 2ZRMA 1JQLB 3CR7A 2WZQA 3I8SA 4F92B 4D4MA 3A1WA 4R98A 3IBYA 3T1TA 3R9XA 2ZSEA 2J7KA 4PSVA 3I4LA 3ZVRA 1KI6A 2JAQA 3K70B 2LCFA 3FMPB 4CZ2A 2FEOA 5F2EA 2QSZA 5FBRB 4G5GA 3ASZA 3VX3A 1R0ZA 2P2LA 1Z08A 1SVOA 4HEJA 3QKRB 1CJUC 2WSSA 2EQBA 1NG1A 3ND8A 1CRQA 3HR7A 3TQFA 4P4SB 3V00A 3GJ8A 3CWZA 2PBRA 3T15A 1HE1C 3BFXA 4RD1A 4PC7A 4DIDA 3VX4A 2JLQA 4B6EA 5E7IA 3F0TA 1U98A 2R6GA 4IFBA 1W4AA 5TDHA 1N0WA 3W8NA 1PLLA 1R6BX 1OKKD 2OHFA 5DHAA 1QVRA 1I4TD 2ZSFA 3Q3JB 3QPUA 3B1XA 4C0QC 2QPAA 4TL7A 5D3MA 1B23P 4CIDA 3IIMA 4L4UA 5IT5A 2WAXA 2VSXA 1CU1A 4XTCS 1J70A 3AUYA 3DM5A 1XTKA 4QGGA 2NZ8A 2PMKA 2QM7A 2HEIA 3CW2A 2RMKA 4URUR 1VCOA 2PMDA 1MO5A 3A4LA 2H92A 3NC0C 1G3QA 4YMVA 1ZBDA 2ECKA 1QDEA 4C2UA 2FJUA 4US0R 3E1SA 3KQUA 3SYNA 1Z0FA 2OG2A 1CEEA 2R6CA 4TT3A 1KKMA 2XOKA 4YMUA 2QRNA 5DHFA 4E09A 2CCGA 3K0SA 4QBHA 1E0JA 4D0LB 2QP9X 1P9WA 2OLJA 2GHIA 4NKRA 4CGZA 4QL3A 4GT1A 2YOFA 3U3KA 4A9AA 2GF9A 1AGRA 4G0NA 3VKHA 2WJGA 3TJZA 3ZVLA 2GBLC 3CM0A 5GVRA 4DKXA 2ZJ2A 1Q20A 3HYTA 3U60B 4WVFA 2HF8A 1KZGB 3DDCA 2VHCA 3TK1A 1SZPA 3SYKA 3DZ8A 2QA5A 3DKVA 1S2MA 3W5JA 4Q7LA 4LDJA 2IYLD 3NBFA 5K8IA 1GP2A 2NTYC 4NL4H 3V4RA 2NO1A 4OQLA 5CIQA 4ZO4A 2P65A 2Z83A 2IYVA 2JATA 1M7GA 1US8B 4TMZA 3BH0A 5UKDA 2B7CA 2NIPA 3KKNA 3P1JA 4M1KA 5HTKA 3GLGA 2EFCB 4G1UC 1Z6AA 4AURA 3OIUA 2Q21A 3SDZA 4M4SA 2QMHA 3OZXA 2Q9BA 4N1AA 4RD6A 4TQ9A 3BBPA 4NYJQ 1CP2A 4DCVA 5FH9A 1W4CA 3QPVA 1E4YA 5KDLA 1QBKC 1MT0A 4JS0A 3WYAA 4LHYA 4HDQB 1KO5A 3RS3A 2NQ2C 3EWSA 4LYHA 4JVSB 5CLQA 2CL0X 2UZIR 2D2EA 1T91A 2KB0A 3KDSE 3N5CA 3P27A 4TMTA 3LAWA 4O25A 1JQJC 1IY1A 2ZJOA 1OYWA 3QPWA 3AVQA 4QM7A 2J41A 4DEYA 3ZZ0A 3OFNA 3SJBA 4NPHA 4WZ6A 1G64A 1P2SA 3FFBA 1VKJA 2ZU6A 3TVTA 4NCKA 4BLTA 2GRJA 3TSOA 3TUJC 3W9YA 2ZE5A 4MKIA 3PUYA 4AKIA 2OSBA 2XTMA 1T6NA 3X1YA 1N5LA 2HJGA 5GJCA 3QXJA 4DCSA 3PITA 1GWNA 1NIJA 4GZMA 3L43A 2CLCX 3LLMA 4HUTA 4UNNA 1HE8B 3K70D 3CPEA 2ZVPX 4DB2A 2PCJA 4QGAA 2W83A 3QIAA 3QF4B 5FUYA 3KTAA 4M1OA 4PHFA 3GQBA 3K0CC 3EARA 3ZD6A 5CB6A 4LBWA 4TYWA 1NVWQ 4EKDA 2QM8A 3SJAA 4MDEA 1AKYA 4M22A 1P9RA 4X8MA 1GM5A 2MSCB 5EP2A 2QTHA 4KLZA 1RRCA 1XJCA 4LWZA 5IF9A 2FPKA 1QVAA 4BGDA 4CEHB 3PEVA 1S0UA 4F93B 3MCAA 1FX0A 2AXPA 2O0KA 5C46F 3KQLA 3B8HA 1RRGA 1ZYUA 4EPVA 3RHFA 2A5FA 4B35A 2WIBA 3B5JA 4V0MA 3K0AB 4C0BA 4W5HA 2D74A 4M1TA 2VEDA 2XZOA 3ZZUA 5J47A 5HKKA 5KTYA 5C18A 1YR6A 1SHZA 2VPPA 1KAGA 2GK7A 3X2SA 3AP1A 4JMPA 2F9MA 4KJZA 2QTVB 5JCPA 2W58A 2BV3A 1ESMA 1HY3A 1G20E 1XZPA 2E87A 2KBEA 4RKEA 4QM6A 4QJ4A 4XIGS 5TARA 3U44A 4M1WA 3HWSA 3I8XA 1UJ2A 4Q9HA 3I73A 1A82A 2CMKA 4TLEA 4Q4JA 1KO1A 3X1WA 2PH1A 1XPRA 2X8AA 1XP8A 3D7MA 3O8DA 3PG5A 4OQMA 3GLFB 1ZCAA 3LQQA 3G0HA 3TIFA 2F43A 1LS6A 3CIOA 2D62A 3CRRA 2VP6A 5C2JB 3GLHB 2HV8A 3TH5A 4LY6A 4YC7A 3L0PA 4TZ6A 1KJZA 2IA5A 4S35A 2AHOA 1UBCA 3ECCA 4YMWA 2O8DA 2O0JA 5DI9A 4MGKR 1UDXA 2V6IA 4NONA 2R6DA 2BBSA 1QG4A 4A4DA 4AG6A 4WXRA 1GRQA 4B34A 3CZPA 5FUXA 2J0SA 1KDTA 1GILA 4F7WA 2DBYA 2XNSA 5EP4A 3U3JA 2ZYTX 2GWHA 1OKKA 4II7A 4LYFA 4Z1MD 3UG7A 1RZ3A 3AVVA 1E9EA 1G6HA 1GKUB 4P31A 2ZSDA 2YWEA 4IKEA 3VAAA 3X1DA 2XB2A 4DIEA 1E9AA 4G01B 4QC2A 1N6KA 5C1BA 1XFAA 8OHMA 4HYYA 1X1SA 4JSYA 5AUOB 1EG7A 3VQTA 4V03A 3SU8A 2WJHA 3T1VA 1OH8A 3RRZA 4OQFA 4HAXA 1WE2A 1Z0IA 3EXAA 2PL3A 5FPTA 2IUSA 1FW6A 1CF4A 4D80A 1M7HA 3BC1A 1GITA 2KI5A 3H86A 4EPTA 1DAFA 2ZU0C 3CBQA 5LB2A 3ZS9A 1P73A 2GEDA 2ZYUX 3U6BA 1KI4A 3LWNA 4EPWA 3RAPR 1Q3TA 3OESA 4ZI2A 4LCBA 3X1ZA 3T5GA 4MYTA 1JBKA 2WAYA 3I61A 3S1AA 2V3CC 2ZIAA 2OXRA 2V4ZA 4JLOA 4D4JA 1SQ5A 1JXMA 4GL2A 4FMDB 2D7CA 2Q0HA 2CHQA 4AKHA 3C5HA 4LV5B 4GOXA 2CL7X 4LHXA 1JEDA 3EPKA 4QJ5A 1U94A 3B2EA 3QNUA 5J40A 3QJYA 5KYKA 3C41J 2BMFA 2WWYA 4DSNA 4LZZA 5FFMA 2N46A 3FHCB 2OUKA 4ARZB 1A2KC 5KSZA 2IS4A 2KBFA 2X1VA 1BO6A 3NIBA 1KMHA 3QKSB 4P32A 1KK1A 2FSIA 1Z2CA 4GSYA 5EP1A 4XWOA 2BEJA 3IHWA 4J0QA 4M9QA 3QQ5A 3AVTA 3IDQA 3U3OA 1TQ6A 4WA7A 2ANCA 4OHWA 2YJTD 3QG1A 1J7KA 1OHHD 4XWAA 1OXVA 2HJVA 2PEYA 1W0KD 2AWOA 4Q1AA 1OV4A 3CX6A 4AC9A 2RKOA 3EIHA 1KY3A 2BMEA 2F1JA 4Q9IA 1ZW6A 5L3SB 2WHXA 2QAJA 4M1YA 3C5CA 3HU1A 4JZKA 1UDWA 2AKYA 2FH5B 4PQFA 1YZLA 3RRNA 4CT5A 2O8EB 5JSZB 1IXZA 2ZJ5A 5CIWA 3GEHA 5D3QA 5FPYA 1GOTA 2UKDA 4IVRA 4M1SA 3LO5A 3Q8XB 1YE8A 2FU5C 1XRJA 3RC3A 1ZUIA 1E4VA 4DDVA 1E2PA 3BE4A 4GMXA 1KK0A 1EFTA 2GZHA 4DEXA 2ORIA 2FEMA 5GADl 1Y63A 3ZGXA 5C4GB 2FFAA 2GXSA 4QNRA 1IJEA 1KMQA 4MITA 2XTNA 4Q47A 5F9FA 3W90A 4FCWA 1DO2A 1CS4C 1MRNA 3ADCA 5L3QB 3WHKA 4X8OA 4B3BA 2V7QD 1P72A 3BB3A 1H8ED 4BFSA 2Y8EA 1TNDA 5J4VA 2N42A 1P75A 1XJ0A 1GRNA 2EFHB 4FXPA 4IOJA 1IOZA 4C0JA 5F3WB 3TAUA 4URYR 4I99A 3QKRA 3SQWA 3FHOA 1N6IA 1J99A 3VKWA 1E2NA 1NKSA 2YC4C 3FGNA 1PLJA 1XEXB 1RRPA 4Q4HB 5FI1B 2G88A 4RCYA 4URWR 1ZC4A 2QGZA 4A1FA 4BLQA 2IYQA 2FOLA 2C78A 3KFVA 3RC8A 4TL8A 3GFTA 2VF7A 1HTWA 2JASA 2BEKA 2VIIA 1XD8A 2RHMA 4Z8YA 1WB9A 3B1WA 4FMBB 2GJKA 3VKGA 4JLVA 1X3SA 3ZJYA 2JGNA 2CNWA 4MYCA 1TF5A 3W8RA 4LV8B 2Z0MA 1W49A 3KXIA 5KNCA 2QUZA 1CULC 5AJYA 4JT2A 1HYQA 3H4MA 1XD9A 1UBEA 5JRZA 2WIAA 3T34A 1N5IA 1X8JA 2OFWA 2GILA 5EXXA 1TQ4A 3A58B 3BOSA 2KSQA 3DM9B 3AF2A 3IEVA 5A0FA 3EA0A 5KHOC 1S96A 2BJWA 3AQ4A 4B74A 1HA3A 1HT1E 3KXKA 4ZIRB 4C0KA 1IN8A 4B2PA 4LHZA 4CYMA 4D6PA 3IPXA 1F2UB 4PZZA 1XMIA 5DN6D 1R7RA 4QHSA 4XVRA 2JEOA 1TF7A 5CYOA 3LX8A 5FBQB 3AVOA 3SQXA 3A37A 1IBRA 1N5JA 1MR3F 1XXHE 4M21A 2CK3A 3EZ9A 2AWNA 1EK0A 1NJGA 4WXPA 2WPDD 3HPRA 4JVLA 1G18A 1P61B 2NMVA 2C03A 1MO4A 4OI1A 4RFSB 4P0TA 4CEJB 1U81A 2J0UB 2VHJA 3CRQA 4JVNA 3LY5A 4G5RA 4A2PA 4ESHA 4Q48A 3AV0B 3WMFA 3CH4B 1E9SA 4PC3A 1M1YE 5FTLA 4CEIB 2V1XA 1E9BA 4KXFB 4Q1DA 3RSOA 1RKBA 5E7MA 2WWHA 1XCPA 4OHZA 1BYUA 1T9HA 3R8CA 5DGXA 5JJLA 1FTNA 3GD7A 4JIMA 5IDVA 1D2EA 3TGPA 3K0EA 3KJEA 2HLDA 4U00A 4EFNA 3B85A 4Q1EA 4QHYA 4C4PA 4O2LA 4C0AC 4A82A 1AZSC 3SS8A 4ZCMA 2HF9A 2OAP1 2QU8A 5K8TA 4HB3A 1OH5A 1UEJA 1LNZA 1QHYA 1EFCA 5KSOA 4MDFA 2QMEA 3FWYA 1MABB 3CRW1 4BQSA 4C3ZA 4D0GA 2J45A 4C0LA 1JI0A 4HLUA 2XJ9A 3IIJA 4JLBA 3KJIA 1Z0DA 5DYIA 3WMGA 2WWFA 4W7SA 2CXXA 2J7PA 3KQHA 3WHLA 3RYTC 3TUZC 1AS0A 3QENA 1R5OA 1ZRHA 4JL5A 1R5NA 2ZUDA 4POAA 1YZKA 1S9HA 4WBSA 3KL4A 1VDZA 1Z6XA 2Z4SA 2CCKA 1E98A 1Q12A 4AD8A 2AN9A 2OT3B 4LK2A 2VP9A 2F6RA 3DZDA 4ZDKA 5JLJA 1LFDB 5DE3A 3QF4A 3L0OA 1TMKA 2IW3A 2VSFA 4NCNA 5G3YA 4BFTA 2OBLA 2ZS8A 2QQ0A 1T5LA 2B8WA 1XPUA 1OXUA 2J0QA 4HZIA 1NG9A 1KO8A 2BM0A 4M9XA 2QMUA 1LVGA 4E07A 3ASYA 3TNFA 4JLKA 5F9HA 2XAUA 4PSAA 1VG9B 5LBIA 4Z51A 1MO6A 4CEHA 4ZCIA 2IHYA 5FOWA 3LH5A 721PA 1OHHA 3AF1A 3SN6A 1K5GA 5CDFA 1KGDA 2OCYC 1U0HC 1G3RA 1OXSC 2PX0A 1M7BA 1NBME 4JLNA 4NBSA 2JJ2D 3BXZA 5A5GA 3FTQA 3P32A 1JR3E 2GCNA 4JLDA 3R7WB 1D2MA 4K81B 1OT3A 1IY0A 1ZM2A 2C8VA 1Z3IX 1XMJA 1KOFA 2ZRFA 3AVWA 1OFTA 2PZGA 3GJ6A 4D81A 3O8BA 1V43A 2J59A 1UKYA 4BE7B 1L8QA 1KNQA 2IXEA 1I4DD 2ZJBA 1E3MA 3J81k 1TF2A 5CK5A 2DFTA 2QMOA 4MKHA 1FMLA 2VO1A 5HCNA 3ZZTA 4F4JA 1VCIA 3LBIA 3ND9A 4DLSA 1DAGA 3SHFA 2GCOB 4I1SA 5M04A 1OFUX 2V7QA 2OV2A 3K9HA 2CLSA 5DIFA 2GCPA 1AM4D 5IK2A 3GLFA 3PVSA 1H8EA 1AKEA 5L3RA 1T0JB 1OLOA 2RCNA 1KK2A 3ONWA 2JDIA 1BS1A 2ZITA 3K1JA 3KKPA 4NE2A 4QNMA 4TQUS 2XJ4A 5DI3B 3IHLA 5TB5A 4A0FA 3M0EA 1YJ5A 5CM9C 1ESNA 3NKVA 1W5TA 2OXCA 4KCGA 3ZQ6A 1E1RD 5J5CA 3NDPA 1VPLA 3M1IA 4GZLA 3QSYA 4ITRC 4BFZA 3NEYA 2R2AA 621PA 4ZDJA 1RPZA 1YRAA 3P4XA 1G7RA 1NN5A 1CJTC 4LJ9A 1C1YA 3MUFA 1Q44A 2BWJA 1SXJB 4PPQA 4FD2A 5J4HA 1ZD9A 2EYQA 3O8RA 1M34E 4CDGA 1N5KA 2XZLA 4I1OA 4OYHA 3A1SA 4YXWD 5FPSA 1SVSA 1LF5A 3RDPA 4HUQA 2ZE8A 4LPKA 2J3EA 4KBFA 2ZAMA 1GUAA 3SFZA 2OLKA 4TWZA 2IYZA 1FTSA 2GZAA 3FVQA 2ZI5A 3I62A 4A0GA 3I3SR 1S3SA 1L2TA 3Q5DA 3GFOA 2W00A 5LD2C 3ADKA 4KVAA 2R44A 2GJSA 3LRPA 3NH6A 4NCJA 4PC1A 5FTNA 3PUVA 4US2R 4XOIA 4BEJA 3VTKA 4B33A 4P33A 3ADBA 4GOKA 5GJVC 4KITB 2YWGA 3W6OA 1DAHA 2ATVA 1J2JA 2EYUA 3K53A 4B71A 2XXAB 2YNMA 5JJKA 5G41A 2FPMA 3B1VA 2FDCA 2GDJA 2C9OA 2WKQA 4R7ZA 1XZQA 3MG9A 1U8ZA 2PCLA 2YOGA 1WBBA 3B7GA 3C14C 3GLIA 5JHHB 1FNMA 1S3GA 4OI2A 1Q1ZA 3NBYC 4A8JA 1ANKA 4NYIQ 1GKYA 4ARZA 3QY0A 1O87A 3AKDA 4KI0A 4PAQA 3EZFA 4LBZA 3UPUA 3KB1A 3B60A 2NO6A 4EDHA 4MKFA 3QKUA 4GOJA 1A4RA 2XITA 5CK4A 1NVUQ 1YRBA 5JRJA 4PTLA 3A8TA 2YV5A 2WWIA 3AF0A 2NOAA 4RJLA 1CXZA 1ZNXA 3HU2A 4HB2A 4FI3C 5EE3A 3EASA 3MJHA 5KOYA 4NP6A 3E5HA 3OAAD 1FQKA 5L3SA 5FR1A 4TYYA 1R4AA 1E2HA 4KU4A 3BJIC 5B30A 1Q1EA 3NC1C 2W2VA 2F9LA 2DFKB 2OE2A 4DLYA 3EPLA 1SKYE 3EG5A 1X86B 3VU9A 4HDOB 4Q1BA 3AF4A 5E7JA 4BLPA 2ZRAA 5AWFC 4Q00A 4LOAA 2IS2A 4B3GA 4FMDF 2YKGA 3L82B 2MMCA 4LUCA 821PA 4EIWA 1TADA 2DHRA 2B7BA 3H2YA 4OQXA 4BEBA 3K70C 1IQPA 1IHUA 2QAGA 2Z43A 4UJ5A 4UNRA 5KSYA 2IYWA 1Z2AA 5L3QA 3ADDA 1UKZA 4OHVA 4DZZA 4A92A 3BB4A 1OYYA 2BM1A 1G1MA 3M4YA 4B76A 1QHGA 3ZQJA 3AEZA 1Q1QA 1E0SA 1UPTA 1A2BA 3L0IB 4Q4LA 5H68A 4EPXA 2H1LA 5EUMA 1L4YA 3W6NA 5C4MA 1DTSA 1RVDA 5J4KA 2DB3A 4ESVA 3WNDA 2GAAA 3E2IA 5H1YA 4XD7A 5IRCD 2FGJA 5DO9A 1F2TA 1G7SA 2YOHA 4TSFD 3GFPA 2FX3A 1GL9B 1RJ9B 4C7OB 3IEUA 1JR6A 4UQOA 3VR5A 2YHSA 1XEFA 3KZ1E 4ZDWA 3EX7C 4JT4A 2WICA 4ERNA 1WP9A 1F5NA 2DCUA 1UM8A 1E94E 5DNYB 1TUEA 1QHHB 4EUNA 3THWB 1YU9A 4QXAA 4LPSA 3LW7A 4DLRA 2RH5A 3MD0A 1SXJD 1E2IA 4PXAA 1XMSA 3UATA 1DVRA 3SJZA 3U4QA 3HP1A 2QT0A 3AVPA 4RVCA 1KI3A 3VR6A 1KO7A 2JJ2A 3EIEA 1W44A 5FOUA 2V54A 4JYCA 5HCIA 4A0HA 4HAZA 2WOJA 2ZYWX 3LX5A 2IEYA 3IO3A 2C77A 1UEIA 1XTRA 1GRRA 1XD2B 2CVHA 2DYKA 2FZLA 4C0HA 3ZD7A 1N0UA 3SEAA 5TV2A 4A2WA 1K8RA 2RGXA 1PZNA 2REOA 1E6CA 1WXQA 4ZIRA 1MOZA 2ZI6A 2IF2A 4X8LA 1ETUA 1OFHA 1PUIA 3WMEA 3FDIA 2IYSA 3GJ5A 1FZQA 2PT5A 3CF0A 3WNBA 4MRPA 3PEUA 1R5BA 2AKAB 1EESA 2BKUA 4MUAA 4LC1A 2WWWA 4TL6A 4US1R 1XEWY 4B47A 2ZM5A 4V0LA 3WXMA 5EJEA 1ZM7A 4C30A 2VH5R 3TLXA 4LJ4A 2BKEA 1DADA 4PHHA 4Q21A 1W7AA 3TSWA 2NPIA 3HR8A 4Q18A 1VG1A 3FB4A 4OJQA 1COWD 3MFYA 4DT1B 3UIEA 4LC0A 1BOFA 3E70C 2C95A 2FFBA 1N6LA 3IUYA 1MV5A 1A1VA 1UADA 2J0UA 1AN0A 1UF9A 4ON9A 3RLFA 4C2TA 1LB1B 1NVVQ 4PO1A 2C9CA 3GJ0A 3DKPA 2CL6X 2PJRA 3MAAC 1LF0A 2EVWX 2FPLA 3OIWA 3OE7D 4LJ5A 5E3HA 2ZETA 2C04A 2ZE6A 1ZJ6A 3LVQE 3TR0A 4E22A 2ZAOA 1E2QA 2QI9C 4RZUA 4EQ6A 3C8UA 2QP3A 3H0KA 4IW3B 3TW8B 3EPHA 2GAOA 1U99A 1EFHA 1QF9A 2JLUA 1ODFA 3VR1A 1NNEA 4PANA 3AVXA 1T3SA 3LA6A 1NRJB 4FN5A 4Q4AB 4TYNA 1UFQA 2NO7A 4YXWA 2V8OA 1DO0A 4EJSA 2JLXA 3SJCA 4MQBA 3GLGE 4LSGA 1GNPA 4JJKA 4HLUC 5FOVA 2I3BA 1II9A 3Q5EA 4N3NA 2OO7A 3WNCA 3TSZA 4XWKA 3SE0A 1G19A 1EWQA 3CH5A 4ASUD 1MABA 2WSMA 2ZR7A 5KU1A 2ZJZA 3CWQA 2NG1A 4HLDA 1EFRD 2JLZA 3BH6A 3OIVA 5L8VA 1VCNA 1E2KA 2HCBA 4NMMA 2W6ID 2IT1A 4KFRA 4KFUA 4B6FA 2GA8A 2FMXA 1KI6B 3RRMA 4WZBE 1YZQA 2NZJA 3MWLA 4JLAA 1EWRA 1E79D 1Z47A 4RZXA 2ONJA 1G5PA 4IDPA 3K0FB 4F4IA 4QG7A 1G7CA 4TLAA 3QEOA 1KNXA 2BBOA 2G3YA 2CE2X 1GFIA 4TN1A 2FE4A 5FBVB 3THYB 5FL3A 4IOMA 3SR0A 2WTUA 4TYPA 1P7CA 1XB2A 4A15A 2X19A 1F60A 1WDTA 5B57C 2PZFA 2H57A 4H1UA 2Q9CA 1B0UA 2EWVA 3MRSA 4K8OA 1DAMA 1HT2E 5JS8A 2ZANA 4DVGA 5HZKA 4DUGD 1CTQA 4HZUA 2CBZA 4PZYA 4DDUA 3B9PA 1Z6GA 3EC1A 3I32A 4MGIR 3ZVNA 4NTZA 4IXMA 3NWJA 3NHAA 1CJVC 4DDWA 2VP0A 4DCNA 3JZMA 1KI9A 2I1QA 1SHKA 4PQRA 2NGRA 4LJ8A 1T8TA 4JKIA 4BUJA 4M53A 3SZRA 3U7HB 1VECA 2OFOA 4JBXA 1W5SA 1MO3A 1E2LA 3GEIA 1KHTA 1NIPA 2NO9A 4OJKA 2ZRKA 2BJVA 3REFA 4I1UA 5B2ZA 4FMCB 2F3RA 2HXYA 2DWQA 2QL6A 3GJ3A 1ZAKA 4NYJR 2DFLA 4IEIA 1JJVA 1G6OA 3DOEA 1I2DA 2GTPA 1SVLA 521PA 4V0ME 4P3YA 1FL9A 3KKQA 3C7KA 4TLBA 1W0JD 1ZU4A 3CF6R 4OK6A 4BZQA 4ZI3A 1VYUA 5J4LA 2H17A 1P60A 5KSPA 4UKDA 2RGAA 1N0VC 3IO5A 3NHBA 3KUCA 2O0HA 4U02A 1D6JA 1F48A 1QRAA 5AJWA 2GCOA 1BMFD 3U7EB 3VNUA 2VBCA 1IN6A 3QBVA 1X1RA 1W4RA 4B3CA 4DSOA 4GRAA 5FTMA 1Z0JA 2RGEA 1NY5A 1E9CA 3KFXA 2LKDA 3BD9A 1HUQA 2FZ4A 2ZQ5A 2ORVA 2YC2C 2I4IA 2OAQ1 4Y0VA 3GLGB 1AK2A 5SZHB 4OI4A 2IS6A 2GJ8A 2GXAA 1GZSA 4R71A 1II8B 5JEEA 1OB5A 3FOZA 2QBYB 4HB4A 2JLYA 1NVXQ 1OIVA 4PO9A 1P62B 3AGQA 5CB8A 3WY9A 1SXJA 2CEAA 1ZM9A 2IXFA 4P4SA 1DELA 4Q19A 1NP6A 2GETA 1SULA 4TQAA 4BFWA 1U9IA 4A2QA 3PIRA 2IL1A 2WJJA 1FOEB 5FBWB 1VYTA 2GXQA 4LJ7A 2ZJYA 4IDOA 2J9RA 1JPNA 3L8ZA 1W36C 5JJIA 3CX7A 1JJ7A 5CYPA 5EE1A 2A9KA 1G8PA 1KI1A 3EZ2A 3FPAA 4P4UA 3TQCA 3GMTA 2XEXA 4HAWA 3FKQA 4JLMA 5EZ5A 4A0RA 3MGCA 4BRUA 3EPJA 2VL7A 3LFUA 1MRSA 1NMXA 4KSBA 1DOAA 3NH9A 1Q0UA 2BBTA 2V55B 1KJYA 2XB4A 2O8BB 4DRZA 1T4GA 1TPZA 2MSDB 4PC2A 3PEWA 3IGFA 5BQ5A 2JCSA 1UKVY 3KTAB 2W2TA 4S2EA 4CRWB 5JCZA 1PUJA 4MRNA 3OEED 1W48A 5DH9A 1Z83A 1QZXA 4A8JC 1GL7A 2EFGA 2RGBA 3U61B 1WMSA 2B8TA 2QROA 3D6TB 1ZNZA 4UJ3A 2IS1A 2NPFA 1ZD1A 2DPXA 4NCHA 3EC2A 2C98A 4TTQA 4JKYA 1FUKA 2A5DA 3WYGA 4YMTA 4HB0A 2ZRHA 2Q6TA 2ZI7A 1X8KA 2JLWA 4TYQA 2QP4A 4KODA 2GNOA 2VSOA 1ZC3A 4QHTA 4ZV4A 3OE7A 1E69A 1G5TA 1RE0A 3DMNA 2CLDX 2F7SA 3ZVMA 3RWOA 3AVYA 3BK7A 4L15A 1CKEA 3C15C 3PJRA 1XPOA 1Q22A 2H7VA 4KYIB 2H5EA 1KDPA 5EZ6B 4KSCA 2G77B 4TTPA 2H16A 4RCZA 3CNNA 4HLQB 1US8A 5CM8B 2UZ3A 4DSTA 1G8FA 4TT3D 5SZIA 2XOKD 2ZVQX 3UMRA 3QEJA 1DARA 2RHDA 3WRXC 3U44B 2OEPA 4Z1MA 1T3HA 1PJRA 1OFIA 2VHQA 4OK3A 4BZPA 1RC8A 1PLKA 2QAGC 3BAFA 2FGKA 2WOOA 3IKJA 3R9IA 1XTJA 2PLRA 3EW9A 4BASA 4BRWA 1R8QA 1EFRA 3BFKA 4WOPA 1I2MA 4LYAA 1SGWA 2W6IA 2F43B 3T5DA 4V0KA 1N3BA 3QI2A 2D3WA 2BCGY 3BFVA 1YVDA 4DDTA 1VYVA 2HYDA 3H84A 5G3ZA 3PR1A 3ZIAD 4R2HA 1IONA 2ZRJA 3NDBB 4PO8A 4RD4A 2P0EA 3WP1B 2CHGA 2OZEA 2OILA 1Z5ZA 2ZSAA 3TR5A 3X1XA 1H8HD 2FFHA 3CF2A 4M9SA 2REBA 4DCTA 1J8YF 1SVWA 2DR3A 1XTSA 2GVZC 2JLVA 1G21E 3NBXX 5FOTA 2ZRIA 5TMPA 4LX0A 4C7OA 1VTKA 2VA8A 4YDSA 2AX4A 4JYBA 4MRSA 5BW8A 3KX2A 3PFIA 1QHHA 3THWA 1YZUA 4QKQA 2XSZD 1GTVA 2IC5A 1J8MF 1YR9A 1CBUA 1M74A 2FA9A 2GJAA 3T12A 2G1JA 2IYRA 2YVUA 1TU3A 4M0LA 5FL7D 3IQWA 3D31A 1VG0B 2ZTSA 3NG1A 5KNBA 3RS5A 1Z6YA 2R8RA 1SVMA 2HDNB 5JZVA 2VHTA 1W2HA 2OESA 1ZU5A 3TKLA 1YZNA 5HZHA 4W9MC 1DAKA 4IXNA 4OK5A 5EE9A 1W0KA 3AM1A 1P5ZB 1WCV1 1XD2A 3LXXA 1TX4B 4GMDA 2CVFA 1YZTA 4Z54A 2QGNA 1PV4A 3K0AA 1YR8A 1W0JA 1YHNA 4HAUA 1CIPA 2VP4A 1XXHB 1R10A 5SZKB 1QHXA 2QPTA 4LGMA 3I1FA 1VHTA 4JJZA 1DBSA 1BMFA 2QEQA 4N0DA 1FP7A 6Q21A 4NYMR 3A4MA 4G5OA 5BXQC 3SFVA 3REGA 2OCPA 4FCVA 2UVQA 4HSEA 4RZ3A 5FTJA 4LI0A 2RAPA 3PENA 2O8CB 5AUPB 3DL0A 3P20A 4F4CA 4O2RA 2IK8A 5ANRB 1NSFA 2FNAA 1E2MA 3HU3A 2P6UA 4DT1A 5AUQA 4EAQA 1ZP6A 3CB4A 2A2ZA 3WYFA 3IILA 1P3JA 2G6BA 1GAJA 2OBNA 2F1HA 2EWWA 3H1TA 1E2EA 3KKMA 3RNLA 2WMOB 1KSJA 1N6PA 3I92A 3GLHA 4KAXA 1OH6A 1DAIA 3RS7A 3G5UA 3A1UA 2V1UA 1JB1A 1KTVA 2FG5A 1AQUA 2HYIC 2VTKA 3UWOA 3LQRA 4WIAA 4EJSC 4RKFA 2OCAA 3N70A 1LTQA 3K9NA 1TTTA 3UANA 1G291 3KJGA 4FINA 4DLUA 1G4UR 4Q1FA 4Q4AA 4M1MA 1HV8A 1II0A 4DLTA 2IX3A 4HI0E 1OH7A 1CLUA 4A36A 2FSGA 2AFIE 1NMYA 2QY9A 2H8KA 1L4UA 2MMGA 1OJLA 1SKQA 2WM9B 4O0MA 1YKSA 1OW3B 4DHEA 4V0OA 5CJPA 2YWHA 1F6BA 3BIFA 4IOLA 5JBQA 3D8BA 2IWHA 2VYFA 1KYIA 2IYUA 1AIPA 1U0JA 3CKLA 2R65A 1KKLA 1LW7A 2IXGA 4OQNA 3TVDA 2E1RA 5EP3A 2QE7D 2EU8A 5EXPA 4CVNA 3JVUA 3TRFA 3M6AA 3OEEA 3RABA 1G7TA 3K0FA 1Z0AA 4R9UC 1D9XA 5HR5A 1UAAA 4LJ6A 4IEEA 1OE0A 2A5YB 3T35A 1DG3A 3THYA 3U3RA 1VIAA 1HEIA 5DN6A 221PA 3RWMB 4DJTA 4C9BA 4MUBA 3OHMA 1T0HB 4DLVA 1EX7A 2IUTA 1X8LA 3QOFA 4I1VA 4Q7KA 5AJZA 1KZ7B 3R8FA 1NSTA 2N1BA 2WKPA 2G0TA 2G83A 4IDNA 1A7JA 2EFDB 1P2UA 2WPDA 3TE6A 3PQCA 5BN5A 2PJZA 2ZRPA 1CJKC 4XTRA 5JECA 3QE0A 5TVKA 3Q85A 1G3MA 2FFQA 2QQEA 1JNYA 2IF0A 3FHTA 3AKEA 3BB1A 3AGPA 1GVNB 1V5WA 1GIAA 2LWIA 3QKSA 4OKSA 2P3SA 5KPJA 3I5YA 1VMAA 2B92A 3A1TA 5K8LA 2HCJB 4BPBA 1KJWA 2ZPTX 4XH9B 1EX6A 4H9GA 5LDDC 4G5SA 4OI0A 5P21A 1EFUA 5DISB 5JHGB 2ZYVX 1ZVQA 4BWYA 1Z6TA 4URXR 3U7FB 5CDFE 3LLUA 5AUNB 3HDTA 1Q57A 2ZR9A 1ZUNB 1R0XA 3UXMA 3T06B 2ZSBA 1JPJA 3VHXA 2BIFA 4DC9A 1G3UA 2VQSA 3MWJA 1J90A 2O8EA 2YZ2A 2XX3A 4HATA 1NI3A 3PCRB 5E95A 5JSZA 5H8WA 2ZE7A 3AVUA 5JMTA 3QXSA 3THXB 4OL0A 1O3YA 3GJ7A 1C9KA 4D25A 1Z63A 3QXHA 4Z8XA 3ZIAA 2IUUA 4LJYA 1YZGA 2JJ1D 3IBGA 1RYFA 4TTRA 4BLOA 1K6MA 4GFDA 4YDHB 3SC3A 4BLRA 4BLSA 1WBDA 4PPNA 1XWIA 1R2QA 4V02A 4D4KA 1H8HA 4DWJA 1W2GA 3CNOA 2BC9A 1D9ZA 2P5TB 3DHWC 5KNDA 2ASEA 3BWDD 4UNSA 1BYIA 3F8TA 4HAVA 1TEXA 5BYJA 2ZI4A 3T61A 2ZUCA 3GCGA 4LHVA 1E96A 2ERXA 4TL9A 3U3MA 3GLFE 3PEYA 3LXRA 1D5CA 4LRWA 3DMDA 3GLHE 4WZAE 1SXJC 5FPKA 1G8HA 3KB2A 3RRYA 3U2QA 1IJFA 1E9FA 2J46A 4R2IA 1II8A 1E2FA 2NO0A 3MWYW 1GSIA 3NEJA 3W3AA 4UXHA 2QORA 2QBYA 4EPYA 4OHXA 4Q66C 1U9IC 2Z4RA 4ILEA 4B48A 4GDFA 1NN3A 1GG2A 1IXSB 2XSZA 2IBMA 1XEXA 3A4NA 4Q4HA 3SHWA 5CITA 4XVQA 4FMCF 4L9WA 1WF3A 4MH0R 1P6XA 4BFYA 5JWHA 2F1IA 4OBEA 5FL7A 2LKCA 1G9XA 4MKGA 2J5XA 4IHQA 1LV7A 2C5LA 2QSYA 5JFGA 2ATXA 2P6NA 4BZXA 3ICQB 3SYLA 1Z0KA 2RGNA 2YYZA 2ZRNA 2BMDA 2QT1A 3F3YA 4M8NE 3Q9LA 4BECA 3VNVA 4NH0A 1ZNYA 3MJRA 2RGGA 1RYHA 4UXIA 4B2LA 4B3FX 2O5VA 4B2IA 2GEVA 2A5JA 3NXSA 3GEEA 1Z29A 3OIYA 2WMNB 4PHTA 4JSTA 1BH2A 3MSXA 4KYUA 1E9RA 4QOSA 4PC6A 4RZ2A 4D2IA 3FMIA 2FF7A 2O8BA 3RSLA 1N25A 2W0SA 2HUPA 4PPGA 2IHBA 3W6PA 4AYWA 2JIZD 1NLZA 2MSEB 1P4SA 1ZINA 3FFAA 2ZRGA 3EIQA 4DBLC 4QJ3A 1U8AA 1RRFA 4AG5A 1ZCBA 1T5IA 1TAGA 2FSFA 1Z06A 4D4LA 3GPLA 3VHLB 2QENA 1DS6A 2J1LA 1F2UA 4LV6A 1CR1A 5FTKA 2CJWB 2ZRDA 2O8FB 2F3TA 1CR4A 3QVUA 3IIKA 2ZJ8A 1YR7A 2IYYA 2VP2A 4GNKA 4NDZA 2WJIA 1Q3HA 4B32A 5KDDA 3ZLJA 5HPYB 2PLFA 4B3XA 4JVMA 4XSHA 1NN1A 2CNWD 2GZDA 1W47A 4HDCA 4RY2A 3LV8A 1CR0A 3B9QA 5CJ2A 4D82A 3GLIE 3EZ7A 1PVOA 3O8CA 5JI3E 1NBMD 3EAQA 1JR3D 1KI7A 2CDNA 4QBFA 4RFSA 4FWIB 4Q9KA 3V4FA 4CEJA 1AZTA 5HE9A 1SKYB 2KJQA 4ZDIA 1OPXA 4GBMA 1E1RA 3IQXA 4KO8A 4B3DA 4TLCA 3ZDQA 1QHIA 1TU4A 1E9DA 3JVVA 4PFSA 1G3IA 4AWXA 4CEIA 3ICEA 3GP8A 3KXLA 1U8YA 4L9SA 3Q72A 2EW1A 2GVDC 1G17A 3LBNA 4I81A 2WVJA 5JEDA 4ZKEA 1S9DA 1N6RA 4IFEA 1AQYA 4M9ZA 1N2CE 1KK3A 4CT4B 4P4TA 3AB3A 2ODWA 2XZPA 5DYGA 2A3RA 1XU4A 3OEHD 3LD9A 4NCIA 3PUZA 3A6PC 3DEFA 1QHNA 1W4BA 4QRHA 3CLVA 3V9PA 2G1KA 2D06A 2CK3D 121PA 1AS2A 2Q9AA 3HYRA 5FPHA 2AK2A 5LB4A 4EFMA 4B44A 5FR2A 3RS2A 2X77A 3L2OB 5SZJA 4CF7A 1FPMA 1E2DA 1GNRA 1HQYE 2QE7A 1FNNA 1CRPA 2ZJAA 4YMSA
chains in the Genus database with same CATH superfamily
4IIJB 3CGGA 1Z82A 5AIBA 1QK3A 4EKEA 5EE5B 5GJWC 4L22A 1N2SA 2JHAA 3AXTA 2ORWA 1NHGA 1MXFA 4LI3X 1K06A 4P3NA 4R9RA 2GD0A 3PQ2A 3C3MA 4LFAB 4PFKA 1PFWA 2LD4A 2PYZA 2XCRB 3SEQA 3LBHA 1K6IA 2Q3HA 4G1EB 4XX1A 4Z4CA 1TTPB 1Z0ZA 2HRDA 4KMRA 3GJTA 4LTDA 3R2JA 2AW3A 4R8MA 3VPXA 3KQNA 3BJZA 4QUJA 1Z5UA 3H17A 2JA2A 3I2YX 4OQZA 4BQIA 1XZDA 3FPLA 3KPJA 4LA4A 4AW9A 4ZQHA 1PZGA 5K8CA 2Y71A 5DGCA 1H3FA 1AB6A 4ZGWA 3ILSA 4QJBA 1X39A 3J7AC 4HUQB 1A8QA 4ICIA 1DBPA 2A6PA 2AXNA 3HBMA 3LP5A 2GTIA 2ODEA 2VYNA 2FMIA 3IRVA 5G4KA 2P5SA 3R77A 1GYRA 4O8ZA 4LDZA 5D3MB 5EXTA 1TC2A 1CUEA 4JJGA 3PP8A 4G3XA 4B6PA 4D0NA 1KSFX 1Y7TA 4RC9A 2ZYSA 2WZCA 1VOTA 4TTVA 5FOSA 3PGXA 2YWFA 3DR5A 4ZU1X 1VKRA 2WWGA 4JP8A 1E59A 3IDFA 4RL4A 2J7PD 2VJQA 4TKZA 2VAPA 2HPAA 2WA2A 1I3NA 1WDWB 3KZNA 2IOYA 2FX5A 3ENVA 5FOXA 3SMVA 3W2FA 1KMCA 2PH5A 3KWJA 4A10A 5IJ0B 1IAQA 2Y0EA 3PLRA 2C9ZA 2XH8A 4AB1A 4HGPA 1CB7A 2P9BA 5D85A 4NCXA 3DPUA 2YWCA 3PV0A 1A95A 1X7YA 4D41A 3BWYA 2XCSB 2B6HA 2X2EA 1U7DA 4RSGA 2WWXA 3GLIB 4JGGA 2HTFA 2DVMA 4M8IA 1ISPA 3LKVA 4MR9A 1Y1PA 3CXUA 4BIIA 2R68A 5ALWA 1AJEA 4IXDA 1I7NA 3MB5A 4X1KA 3SR3A 5HUJA 2UUAB 1K5DA 3E2MA 5DW3A 1KDOA 4RFVA 3VYVA 5J3JA 4PPYA 1DQSA 3WVNA 4B84A 4F8JA 5AESA 1EZ1A 3E4CA 1TCBA 2C99A 2O8CA 1ZY2A 4LRQA 3JATA 4YAIA 4ND2A 1Y3AA 4EHNA 3H2ZA 4GPBA 1KEEB 4B45A 5BV7A 2QM0A 2H9YA 1MXHA 2P2GA 2QMZA 1OA0A 1WQ3A 2HLNA 2OCLA 3CSUA 1L4GA 2GD1O 3NIWA 4DLXA 4NBTA 4P4LA 4HR7A 1J5EB 4E03A 2Z5FA 2YV4A 3DE4X 1U3DA 4ZVSA 1UM9B 3LBYA 3OO0A 4XUCA 3AH8A 4DKJA 2BFMA 1JKXA 1LJUA 5E8RA 1VMIA 3FTDA 3JQCA 1KZ9A 2KWIA 4MQEB 5DKFA 4CCAA 7YASA 3WK4A 1XE3A 1S1CA 1JA1A 2WF9A 2XD4A 1ZSYA 3ITNA 2GB4A 3I23A 3L6DA 4EY8A 1AN9A 4RTLA 3FJYA 2JBHA 3LSTA 4P83A 3ZHTA 3NB0A 4L5AA 3TIGA 2IOHA 1CDZA 3ANLA 1T2VA 3RROA 4XDYA 2R8ZA 1ZM4A 3G8BA 1AQLA 4YRAA 1KL7A 1JB9A 3FTEA 4JUAA 4BFVA 1KMNA 1YOVB 1JTFA 4JH0A 4NZYA 4GEGA 2UUOA 3CUVA 4TKUA 4K9MA 3DDHA 5G2OA 3V3TA 4R1PA 1K4MA 4QARA 2GK6A 4YRRA 2EHJA 1N8KA 4KMOA 3PUWA 3BWXA 3K6KA 4LVOA 5I5GA 1Q0PA 1PP4A 3E8SA 1N6OA 3O03A 1QV6A 2PR7A 4Y9DA 1J21A 2ASVA 2P0AA 3OLVA 5GIOE 3MGKA 3V4SA 2A14A 2GF0A 3PX2A 4W5WA 2JDID 4X65B 3ZY6A 5ICCA 4QXQA 3BRWD 4UAVA 4NCAA 3PIIA 1IHXA 2GGSA 3IPYA 3STHA 1G8GA 1PF7E 3LUGA 1BS9A 1LDMA 1SD1A 3QBEA 3QBTA 1C7FA 3B3QA 4FFPA 3PHHA 4TV8A 5EWJA 3WRYC 3EH1A 2A1IA 1L5FA 4FEYA 3WLIA 5K0ZA 2HK7A 2PWPA 1UFVA 4JLJA 2CVZA 2OWEA 3DA8A 1C3EA 2FWPA 3VU8A 4UOZA 4TMWA 1TL7C 4RD3A 4QUIA 3AJRA 2G70A 4DGSA 4DWVA 3BMQB 5E9WA 2GN2A 3QG5A 2WSSD 3WB0A 5A4JA 2QY6A 3LQFA 1N32B 4FI3F 3WBKA 2BGMA 4KK4A 3ESYA 3CPJB 5KQMA 4GZ5A 1R9MA 2ZI9A 3DT8A 1JJIA 3EZ6A 3KEQA 1U2RA 4L4RA 3L79A 4XB6B 3S2EA 1NBMA 3M6VA 3TLZA 1W52X 3L0SA 3AF5A 3E3AA 1COWA 5JS7A 4LBVA 4E12A 2ATIA 1B14A 2X42A 3N07A 1LCIA 3T3IA 4KVGA 3NT2A 1B3RA 1ZJ5A 2A0XA 5AVZA 3U7GA 1NDQA 3EE6A 5DXFA 3F49S 4MJLA 3AEQA 4PR0A 3IBCA 2VBGA 2Q6OA 2EBUA 3DTTA 4M8LA 5KS2A 2ZR8A 1B6GA 3Q7QA 5CAEA 2VAXA 2R62A 2OQVA 4DXHA 1LQTA 5K2MA 3I72A 4ITVA 3C4QA 3WTBA 3V3KA 1Z07A 3ACDA 2RSLA 2V98A 1R27A 3OBBA 4TXMA 3ZH9B 3VSCA 4N39A 3FCUB 1NF2A 5DSZA 5IDQA 2PV0A 2I6SA 3ZD8A 5GVSA 3S8YA 2B0JA 4D3ZA 1M6NA 2ZGVA 3GRVA 2ZRCA 5JJ5A 2R3SA 3WKEA 1JHDA 2B4QA 1D09A 2YVAA 2YR0A 3BS4A 3E9RA 2AB0A 3ONNA 4HEQA 4DV4B 1AS3A 1XYGA 1VCMA 3BD7A 4G8DA 4M99A 3H4VA 1KYYA 3FCOA 4N3CA 1IN4A 2OBMA 2RHBA 3GT4A 3M34A 2RGUA 4G0YA 4G4IA 4YAFA 1EUZA 1QVZA 2ZCUA 2FR0A 4URVR 3GVIA 3TTYA 3UH0A 4AZVA 1CNEA 5IT0A 5EJ7A 2DBZA 5A62A 1P2VA 4D9CA 4AZ3A 1YIAA 1CRPA 3NTOA 2CBXA 1YSCA 3QJ5A 1JAHA 4MVJA 4PZEA 2QX7A 4U2CA 3QYPA 2OK7A 3RANA 3VR4A 5KOJB 4MYDA 1HQCA 3D2LA 1H9AA 4H3SA 4MV1A 4DLZA 2FRDC 2UYQA 2ONZA 3ZCXA 2DPGA 3E27A 4WQMA 1NUSA 3PR2B 4BX0A 3ZS8A 2I3DA 1GU0A 1P39A 5CDGA 1M0TA 1SVIA 4MA4A 1F7VA 1XNJA 3STTA 4GC5A 2O8DB 2DU8A 3KUUA 3AUXA 3W0LB 1IN7A 1IQRA 3G7UA 3NX4A 5AI8A 4ZJYA 2EZ9A 4A23A 4CM4A 4PSKA 4Q9DA 4YLGA 3NBZC 2VDRB 1NFRA 1EYZA 4HAOA 3VFDA 1ZOPA 4GBED 1D2NA 3VUFA 4EJSB 5MDHA 4A6XA 4GP7A 1JWLA 2QN7A 1OMOA 2D4HA 4J2OA 5C37A 4B85A 1SC4A 2AD1A 2QTFA 4KO3S 1RTTA 3AI7A 4IMJB 4YQFA 2C9YA 5K6AC 1RJ9A 2FEKA 2QS9A 2MT9A 3PC2A 4DXAA 3SZGA 2G0NA 5B6JA 1ZX1A 1I9CA 4ZXPA 4DUGA 3D3JA 4JA0A 3A1VA 2YWJA 2YJ6A 2C5AA 2FXVA 4BLRA 3NP7A 5F33A 4MYUA 1X92A 4ZQFA 4MQ4A 4BO6A 1E0AA 1DC4A 1ZMOA 2EJBA 4EY6A 1Z5GA 4Q9LA 3QVVA 3TMKA 3QOWA 1IY9A 4QBGB 3KWFA 3CZQA 3PDHA 3L40A 5AT1A 5A3SA 5CH8A 4PNEA 1G6Q1 3K9LA 3QLUA 3WL3A 1VJ1A 2JRCA 4JHLA 3V2UA 5CDHA 4MGYR 1DJOA 1QH8B 1U7ZA 4LC9A 4LMBA 4X93A 5AJXA 3SHQA 1ZA2A 2ONCA 3I2KA 1U2PA 1XA3A 4G5QA 3PNLA 5COQA 1YI0A 3IMKA 4KE8A 1G5RA 4HNTA 2PXXA 3FYTA 3N2NA 1KH2A 2Z56A 4MVJF 4QGBA 1UKEA 5DSXA 1F3OA 4H77A 2ZUSA 1FU8A 1TEZA 3ZHOA 2W0MA 3I04A 3R5JA 1H6CA 1XWFA 4J7CA 4PTZA 4ZOLB 3UWSA 1QMGA 5BPFA 1EVYA 2VP5A 3H1GA 1UT8A 5LZ4A 3HSSA 5H4HA 1NOIA 3TO5A 1KEKA 1E2JA 2AG0A 1V39A 1E7YA 2P3LA 2Q6LA 3IHKA 3E9DA 1S1MA 3KOMA 4MEBA 1IVNA 1WABA 2QG6A 3N2IA 5KU7A 4FKBA 1G16A 2JJMA 4QYTA 4Y6RA 5MN5A 3O4RA 2N75A 1BX1A 3IAM1 4O63O 2FPOA 5J43A 3D4BA 3AFMA 4V3BA 5FUWA 1Q50A 4TZ0A 3INGA 1V41E 3SOPA 3DVLA 4XVCA 4UVHA 2IQ5A 4TXLA 4UBNA 1VLHA 2X0EA 2WPNA 1ZUHA 1SXQA 4PYOA 3MZ0A 4TTJA 4EL0A 3PA6A 5KC9A 3GA7A 4IVQA 2IH4A 3HN6A 2H1SA 2IZOA 3T3GA 4R1QA 4ZP1A 4V1CB 3MK31 2PWYA 1V9LA 2EBFX 1FIUA 1E1QA 3R6WA 5LP6A 1Q0SA 1UOQA 5JWRA 1ACJA 3RREA 5L3VA 3GJQA 2REXB 1YUMA 5IVKA 1B2RA 1KDZA 2PGIA 4B6OA 2JZOA 3IJPA 4NENA 3L6EA 3MWDA 1F4VA 1W1WA 3EWNA 4PLHA 3HTXA 2PKRA 1NF9A 3MGAA 3X2EA 5E4FA 2ZPUA 1CVRA 1THMA 4PPFA 1ADBA 4GQAA 5FFFA 4XFDA 4JELA 4X1YB 4TSRA 4KHZA 4NEQA 3N0RA 1NLFA 3EW7A 5CPBA 1YCHA 3I83A 1IL0A 3RYCB 1N6HA 3PD7A 5BRJA 4ER3A 5C1OA 2NP7A 2XNDA 3ZDEA 4PGHA 4H6PA 2I7TA 1U8FO 2VQDA 1OB2A 3ZHVA 2V7EA 3BERA 3K5HA 3VPGA 1L7QA 4W9NC 3KLNA 2WF8A 3TI9A 5LKAA 1IUPA 4CLDA 1NNUA 1HFJA 2DKFA 3C6KA 4BJHB 2YJ4A 2UUCB 1Q7RA 4JFAA 4BMPB 4RHEA 1A5AB 4KQXA 2GRUA 3DMTC 2LPMA 1PJAA 3SY8A 2L0XA 3LHFA 4OF4A 3OQMA 4AS1A 4KN8A 3JAWB 1JQLB 1L5NA 3ML1A 4F92B 2OA0A 2IBSA 1SOMA 4D4MA 3DFIA 1I24A 3IBYA 3R9XA 2ZSEA 4R2XA 1K92A 4IDAA 4PSVA 1GZ6A 2ZWOA 5HTOA 1PZEA 2HGZA 4YUXA 3LM8A 1C3JA 2FEOA 1N2GA 3KPWA 2E5FA 1Q5PA 2Q1SA 1PD0A 2NAFA 2ZPAA 2PV7A 3ASZA 3QMMA 4G5GA 4IIGA 4IIBA 3P2YA 1YXMA 4I5IA 1PQWA 2OHVA 5AK3A 3NAZA 3QKRB 4RO0A 3BM5A 3OD5A 4NOMA 1E1YA 2OFPA 4ZYXA 3T3NA 4UHBA 5TQ2B 3RTCA 4NJEB 4R1UA 1BEZA 4P4SB 4DMUB 2GLTA 1UMBA 3V00A 3GJ8A 2GSWA 2PBRA 4G0PA 4WCFB 5DLYA 1KIAA 4RD1A 4MW5A 3NV9A 4E5MA 3F0TA 4GLBA 2PRSA 4E88A 3CNBA 4A8HA 1E20A 3KEGA 3SXPA 2C4VA 2HCTA 4OUDA 5L7YA 1CUAA 3ISTA 1I32A 2ZSFA 3Q3JB 2IPNA 2XT0A 4N6GA 3LT1A 4OL9A 4P3PA 1HNWB 4C0QC 3H1BA 2QPAA 5EMHA 3TXYA 1D03A 1HDXA 1V11A 4L4UA 4CIDA 5IT5A 4B4DA 1DBIA 3SDZA 2JEYA 2ZSJA 3OG9A 1PX2A 5ICEA 1V8OA 3ESXA 2NZ8A 4QGGA 3KYDA 4URUR 2RMKA 5LUBA 2PMDA 4M0FA 2CSXA 5EINA 3I9JA 1K8YB 4KLRA 5FYQA 1JSCA 1JG6A 2OC4A 1VLJA 4IH1A 1E5DA 3HA2A 3HDVA 4C2UA 1FEZA 4NR0A 3PJDA 2N9UA 1AZLA 3FJ1A 3E1SA 1V1JA 3NJ4A 3R7DA 5IWAB 3AIKA 3G13A 2GUWA 4WY5A 1IM5A 2I1LA 1KVTA 4TTTS 2OG2A 4V24A 4JDPA 1BSVA 2V5UA 1HKUA 1UPCA 5KYUA 1DC6A 3ZCTA 4YMUA 3K6SA 2PH3A 1FVHA 3V1MA 4Y6LA 1MQ9A 4DV6B 4R6XA 2A0YA 5JY6A 4MB0A 2OLJA 1FSGA 1NNLA 2CMGA 3D8NA 2RB5A 1D2CA 3E9YA 1L9KA 2FF5A 4P3OA 5GAJA 4BO3A 2H1HA 1XQXA 3W5UA 1CQWA 2GFIA 2D0OB 2ESRA 1E5QA 3KNZA 4DNQA 3DVQX 3QELA 3N3BC 4IYJA 3UFBA 5M7EA 3PHGA 2H00A 5DHUA 4AMUA 2ZJ2A 1Q20A 1QANA 2CXPA 4BMSA 1WSWA 2KS6A 1FNDA 2BGUA 2Q1TA 3MCTA 2CJFA 1SZPA 2QA5A 2YWBA 1YJAA 4MVJH 5TNXA 3IKVA 3HN7A 3VR4H 1DWOA 2IYLD 3NBFA 3W5JA 5J1TB 5K8IA 3EF0A 4GXQA 3DLIA 2NO1A 5BSHA 2PMEA 2BR5A 2H59A 4ETIA 4ZWNA 4CF3A 1VJTA 3ONFA 4QEDA 1M7GA 4DM7A 5CB4A 4GGPA 5TC4A 3TKYA 3EVAA 4GQBA 5HTKA 2Z8YA 2FOXA 3UK2A 4C14A 4EYEA 4J4TA 2OL4A 2E6KA 1VLZA 2H0RA 4QPPA 1NTOA 4BVLA 2QMHA 2QG9A 4RD6A 3BL6A 4EQZA 1GPKA 1J97A 1AC5A 1ZH6A 1EMDA 3A28A 3OPXA 4JS0A 5KQPA 4LHYA 4HDQB 1UJ4A 1KO5A 1PO7A 1EFKA 3L6RA 2NQ2C 4G8BA 4QQNA 4I19A 1DWQA 4LYHA 4UTNA 2BFFA 3NW9A 4J0HA 2HO4A 4PLZA 3U0VA 3UJ6A 3AUUA 2UZ0A 2UZIR 1QP4A 1CYDA 2GHRA 5D00A 3MMZA 4EX7A 3IYLW 3V46A 4O25A 3LGSA 4YXFA 1NFFA 3JW8A 5DTMA 2WWRA 3RFXA 3AVQA 2C3MA 3NASA 3ODPA 3P9ZA 4DEYA 2C92A 3F96A 1F4LA 4WDRA 1CRZA 4BE4A 3UHAA 5B1DA 4J7UA 2L19A 1UBJS 1P2SA 1POXA 1OYVA 2FZGA 1K08A 3KBBA 4YPVA 2OXTA 2QV7A 4BMXA 5LDHA 1WPRA 2IELA 1YBVA 4EG4A 3W9YA 1XRQA 5AM0A 4WNAA 2XTMA 4B9AA 1XYYA 1Q15A 1Y3BE 5CJJA 5ELLA 4DCSA 1V45E 4GZMA 2IV2X 2OO5A 2C8JA 3E22A 4O5OA 4POOA 1JKJA 4MRAA 3CPEA 3I53A 2BRUA 4RSHA 5ALOA 3SJ7A 3QIAA 3IEXA 2C5GA 3QF4B 1U7PA 2RGWA 1T9GS 1PR6A 2JD1A 4JBGA 3S2UA 1CY8A 4MQUA 4U7WA 4IDGA 1MC8A 1RPNA 3KT0A 3EARA 4F8EA 5LQKA 2VNSA 3L8FA 2QX6A 2ADFA 2GAJA 3ENKA 2NV2B 4EKDA 5CB4F 2QM8A 1U5AA 1AKYA 1ORVA 3HI6A 2MSCB 2G9RA 3D2BA 2XDQA 1YBFA 1CUUA 4R7TA 2QTHA 4RHXA 2B98A 1OCEA 3EGDB 1KYXA 3DLTA 3RF7A 2FPKA 3ZKAA 4AVYA 2QT9A 3TLBA 4AZ0B 2Z5GA 4CEHB 2RCYA 3H5NA 5FNVF 4YV2A 2PBZA 3OJEA 4LSWA 4F93B 3MCAA 1RYDA 5C46F 1KWGA 3B8HA 4GZ6A 3G9UA 3AMVA 3HR4A 3I0NA 4FN4A 1D6MA 4A2CA 2JHPA 4K9LA 4L74A 3G8AA 1HOXA 2WUEA 4KUEA 4ENVA 1JA9A 1U04A 4S12A 4B7ZA 4HVLA 4E4YA 4CU2A 1XN4A 2V59A 3AR5A 3KQQA 1TT5B 2O48X 1HC7A 1SHZA 1C7JA 3HRIA 5ER9A 3E5RA 2ZAGA 3AP1A 2X5JO 3JQQA 2HMYB 1CETA 4DR3B 1CZKA 1M5TA 1RXSA 4X85A 3RRBA 4C03A 2BV3A 1HY3A 1XZPA 3OE1A 1C7QA 5AW5A 3V6MA 2E87A 1AHHA 3C7TA 4GOLD 1U1EA 2G40A 1LTKA 2KBEA 1IMJA 2QD5A 3X1MA 2RC5A 2QRKA 4QJ4A 4RNCA 3HJAA 1RC0A 3ILXA 1B8UA 2XUJA 3TCXB 3HWSA 2BFAA 2GDZA 4LJLA 5F21A 2NQTA 3DHYA 3EB9A 4KE6A 4DC1A 2V03A 4Q9HA 3V1LA 1A82A 2CMKA 4TLEA 1THZA 2ID8A 2P2CA 2PH1A 1XPRA 1JFRA 2CD9A 3D7MA 5ECDA 2E2WA 3GLFB 3LQQA 2PVPA 2ECQA 4CETA 3DW1X 4BL5A 1B3BA 1LS6A 5C2JB 3ZDDA 4ZYYA 4C7BA 3LZDA 4HCJA 2FUEA 4LY6A 3NGLA 1G5IA 2GAIA 3DOOA 3Q3GE 1XRPA 3GK3A 4XOUA 4LDPA 4TZ6A 2R1VB 1F12A 1KJZA 2X9VA 1NR1A 1R8YA 3BDVA 1JU3A 2AHOA 3BFPA 3ECCA 3I6IA 4HQOA 3VJMA 1Q6ZA 3JQ8B 3FNRA 4IIHA 4NSNA 4HD8A 5BRAA 2O0JA 2PKEA 4N54A 5DI9A 2XB9A 1T6XA 3NM4A 4G1VA 4MGKR 3WNVA 1JAZA 1NVBA 2BBSA 5IW8A 6CHYA 1S2GA 4K3VA 1PQ4A 2A4KA 5ICSA 1U3CA 3F67A 4ZO8A 3RVSA 1T6YA 4B34A 4OPMA 3DMFA 1S2OA 3WLMA 2A3NA 3WWDA 5IVHA 4C78A 2ZYTX 3O93A 2GWHA 5J63A 3MWGA 5L4LA 1DWPA 4JU8A 4Z1MD 4BWFB 4PN7A 5AI4A 4BN5A 1G6HA 1BGXT 2VS1A 4CR6A 3EFHA 1ST3A 1XF1A 1VMKA 1GGHA 4MWDA 3VAAA 3W9UA 1Z3CA 2W2MA 5K3FA 1V37A 4QC2A 3A9SA 1RRMA 4FE4A 1QQBA 2D54A 5A5FA 5HMMA 2Z1NA 3BMCB 3R5KA 3WYNA 3IPLA 1RLUA 1EG7A 3M6FA 4CFSA 4RORA 1FUEA 4R4JA 3K2BA 3O1IC 4CTJA 3JASB 5DTRA 4QQKA 3T1VA 1UDRA 2FFRA 2R1TB 2VUTA 4PICA 4S24A 2WA1A 3PXXA 4N47A 1JS1X 5FPTA 2QN8A 4IWYA 2IUSA 3JWGA 4FK8A 1CF4A 3FZQA 3ZXSA 2G6TA 1IXKA 5KEIA 3H86A 2KI5A 1ZFNA 4BFLA 4EPTA 3P0JA 4G0WA 3SHTA 1P73A 3NEPX 2ZYUX 5EJIA 3U6BA 2PGDA 2C07A 3RAPR 2Q1WA 5B53A 1B43A 3PS9A 4ECAA 1U2GC 1JBKA 1JI3A 2C31A 2QRVA 5K4AA 1SQ5A 3OJWA 1SAYA 4FQ8A 1NXQA 4PBRA 2D7CA 1YHYA 5C0OE 4HGZA 3JR3A 1ADCA 1XZ8A 5H80A 1BROA 4AKHA 1K27A 3FF4A 4PCUA 3HKEA 3I9V6 2EJUA 3CE9A 4LHXA 5AP9A 3I05A 4PLCA 4HPXB 3EPKA 5CPFA 5CD9A 3V8EA 4CKWB 5KX5A 3ZEIA 2BMFA 3ZWMA 2B8JA 4FKZA 4LZZA 1F0YA 3OCXA 3G0BA 5DX8A 9GPBA 1QC5A 4EG3A 2I33A 1RZVA 2KBFA 2X1VA 2C1ZA 4NFSA 5EIFA 2ZJ1A 3WWCA 4CMIA 1QDUA 1KMHA 4WI1A 4P32A 1KK1A 2R5FA 2WTXA 1Z36A 1K2VN 3HXPA 4A91A 1TGYA 2CXNA 3IHWA 1ZS9A 1SFRA 3U3OA 1BJTA 3JALB 2ANCA 2X15A 3ROEA 3OUTA 1GNSA 3QG1A 4D02A 2CMFA 5HKBA 3I9FA 4ZJPA 4QVGA 4C6TA 1Z75A 3KQPA 1W0KD 2H07A 4ZC8A 3N8IA 2WWVD 4BNMA 1VKOA 2V7VA 2VJMA 4HX5A 4HDRA 6LDHA 3LCUA 4D92A 4AC9A 2RKOA 4OBBA 1OPRA 1KY3A 1UBNA 5L3SB 4ZQGA 3KOOA 1Z0UA 3FOEC 2X3FA 2O8EB 1JHOA 3FROA 3HGQA 4Z9YA 1IXZA 1XHLA 1X7WA 1IB6A 4HPWA 4ZTZB 5JCOA 3UV7A 2BGRA 4PZ9A 2CT8A 3KJNA 4EI8A 1GOTA 3R0VA 2PIAA 3Q8XB 3PT9A 4KXWA 4J0DA 1YVEI 1R6DA 1ZUIA 1MIOA 1QAOA 4PS0A 3D6VA 2ZWVA 3SIPA 1EFTA 1O5TA 1RQPA 3M6XA 1GZVA 1F51E 5AOAA 3OZBA 4CM7A 3JQ9A 2C57A 3RT1A 2FMKA 1Y63A 2IU6A 4ZAWA 2MOKA 1G0OA 2A1UA 2EF1A 4QNRA 5T8KA 5EQDA 3NBKA 4JXJA 1QB7A 1CEYA 4K8RB 1O9HA 2GHTA 1DO2A 1PG0A 1BU8A 1LBQA 3AONB 1RI4A 3NHSA 1IZ9A 5DRTA 3ZI7A 3MOSA 4YWHA 3RW9A 4CG0A 1G21A 2V58A 5CFOA 4DJEC 1DJLA 2GD6A 3GVHA 2N42A 1XVLA 5FJJA 5KYTA 1P75A 3HQ4O 1WB6A 1XJ0A 3BGSA 1YCDA 3M1YA 3W2TA 4OSOA 2AJTA 3TAUA 3VVMA 4URYR 2VEOA 4PS1A 2O5CA 4BAGA 1JSLA 2J9ZB 2QVYX 4RY8A 1E2NA 4MW0A 2WD9A 2Y1KA 2HMAA 4ZOAA 3U17A 5K9ZA 2EV9A 2G88A 5C8VA 4BTEA 3VPAA 1ZC4A 2HSJA 1IWOA 1OX4B 1TIKA 1UBTS 3IXQA 2FOLA 1V9CA 1HLFA 2XUKA 4X71A 3B1KA 1RAGA 3ORQA 3RC8A 2R1ZA 1HTWA 2YIJA 3GYGA 1GFSA 2ZBFA 2P27A 4LVCA 3EDRA 1K3FA 2VIIA 4K6FA 4RVNA 3P52A 3Q98A 5JMPA 1FRNA 3DYIA 3IT3A 3VKGA 3GBSA 2BEUA 1S2NA 2C7PA 3W8RA 2DR2A 2R60A 3JPYA 4X24A 1LNQA 3BJEA 3H3FA 4YV7A 1DEAA 3O3MB 3AEUA 3ZGVA 1CULC 3DZKA 4ODIA 8GPBA 5HNKA 1UBEA 4WLOA 5JRZA 5IFKA 1HXHA 3P9NA 3VR6H 1A4XA 2CHEA 1TZKA 1M8JA 2X6RA 2DQSA 2XRYA 3MQ2A 5I7RA 5B3JC 3OMWA 3D8HA 4JROA 3AF2A 4TRJA 3IEVA 5A0FA 2WFZA 2ZB7A 1XO1A 4EFKA 2FPGA 2H51A 3DDUA 3WWZA 3M70A 4IHKA 1ULHA 1YQDA 3Q8KA 4C20A 1QAQA 2B7LA 2BT4A 3LHDA 2BJWA 1HA3A 3BZUA 3NUZA 1HQKA 2AJBA 2OHOA 3P5SA 4C0KA 2VUHB 2XMBA 4CYMA 5JXHA 1MCZA 1Z8DA 1QX4A 1JMKC 3DLCA 4NG4A 4P7KA 3S3TA 4AMGA 5GTDA 1XMIA 1EUCA 2JEOA 4YMGA 5HA5A 3SICE 1VMDA 5ETJA 1XJWA 3QUBA 3H9EO 2EBWA 3LX8A 5FBQB 2QRJA 3EQ6A 3A2NA 4BP9A 2MYUA 5A4FS 2X9GA 5C7IO 1ZL2A 2V8BA 2PTHA 1OZFA 4DE5A 3BZBA 1NDHA 3EJWA 2HIAA 4D42A 4OXXA 2CK3A 4NNPA 3ZWCA 4RGVA 1TIBA 2AWNA 5HZGA 4WCDA 2WHEA 3RAGA 3AFNA 1CR6A 1ARZA 4JVLA 2NMVA 3WLPA 2C03A 3FSJX 3W7VA 1JILA 2VZEA 3F47A 1MO4A 3QMVA 2IYPA 3AZQA 5LYJA 2D4AA 4EZIA 2FSVC 3LQ2A 1UK6A 3OM0A 1M73E 4L3VA 4PYIA 4ESHA 4L8FA 3O0DA 3CH4B 4HJRA 5D5HA 1R8XA 2PO5A 3WAJA 4E2XA 1QWOA 2V1XA 3AG5A 2XCIA 3R0IA 2VWHA 4KXFB 4Q1DA 4Y9TA 3RSOA 4A03A 4BS9A 1TM7E 2B8EA 1EQAA 1RHKA 1RKBA 2R11A 4XIIA 5JSUA 1XCPA 4QTUB 1BYUA 4M0DA 2Y0BA 4UHCA 3FUVA 3IT1A 3VGPA 5DGXA 3WLAA 1O95D 3A7EA 1U6KA 3QHPA 4QTTB 2IOFK 4IHJA 2IHVA 3PWZA 3LUDA 3D7LA 2ZBPA 3KJEA 4L51A 2ZJ4A 3SEFA 3QH4A 1H0RA 3BULA 2VTVA 4CKCB 2QQGA 4KQ2A 2JKYA 5GOZA 3WKBA 5C4IA 3AHEA 4M0MA 4G9BA 1AZSC 1KJ8A 1YS1X 1A9XA 4ZCMA 3IT2A 2AJDA 4M36A 2JK1A 1SG9A 5KKNB 2W48A 1Z12A 2QU8A 2VSYA 4EB8A 1YIDA 3TFWA 2YHIA 4FYIA 2DSTA 5KSOA 2V7XA 4ND1A 2VNKA 3PFHA 4MDFA 1DUVG 4B8YA 4MARA 1KP3A 4BQSA 1XWWA 3CRW1 3UHOA 2OBBA 3TEJA 3ZX5A 1EVEA 1RAEA 4JLBA 4RIHA 3NVMB 2JFNA 2O1WA 1L4EA 2J7PA 4OHPA 4D57A 3TRHA 2PMBA 1ECLA 1A97A 4KN5A 1ZRHA 3A04A 1R5NA 2ZIZA 3ICPA 1OGIA 2AVNA 4IYRA 1GADO 1YI1A 2C2XA 3K9WA 4POAA 4G0UA 3KL4A 4RQBA 5ULLA 5C7YA 1Q11A 4AUKA 3IUJA 5BURA 1OZ0A 4AD8A 4AJHA 2OT3B 5C7LO 3ZX4A 4NVRA 4OHKA 5GONF 4MIOA 1TJYA 4MAAA 3WFIA 5JLJA 1V47A 1NUPA 1NVKA 3L0OA 1BE6A 4RY0A 5E9QA 5A4AA 4NCNA 1E8MA 5G3YA 4MW6A 3IQZA 4WUTA 3SKVA 2ZS8A 2QQ0A 1T5LA 4Y8VA 3RD5A 1MV8A 4MVJI 1ID8A 5AM1A 1PS8A 1MOQA 1X19A 1NG9A 5HIMA 3THSA 1JG3A 5D51S 1JR2A 5HF8A 1IJBA 3CZ5A 1X7XA 3CZ4A 3VR5D 3NWPA 4P86A 3NWEA 4IHJF 5F9HA 2PXCA 2XAUA 4CG1A 1CLEA 1K9VF 1MO6A 2AOTB 4GD3Q 3U16A 3DEAA 3HEAA 3DOHA 3LH5A 4RA9A 3M49A 4XDZA 1OHHA 5EOVA 4Q7QA 3SN6A 4L76A 3VZQA 4ONEA 3PDCA 3C8HA 3GG9A 2G9VA 3KQVA 4ZVVA 4BVJA 3H1PA 3E9MA 3MLBA 1NBME 4NBSA 4JLNA 5C1IA 2JJ2D 2JGIA 4HX2A 2FI1A 4I46A 2W6QA 3OOEA 1ZM2A 2C8VA 3HJGA 3ZQUA 4Z3OA 2B1QA 3AVWA 4YJDA 3AR9A 4RYLA 4D81A 2I6UA 3VYRB 3IUMA 3ZV4A 3W06A 4KW7A 2A5LA 3JD2A 4AAYA 4GPAA 4H08A 1ISIA 1I0IA 1N0IA 1G59A 3P19A 3ZU6A 4L4ZA 4OBXA 1KU0A 1I3LA 1I4DD 1JU9A 1CC1S 1CUWA 2AFHB 3HUTA 2FQXA 1SQ6A 5JVDB 4N01A 4MKHA 4AXBA 3OTGA 4OJMX 2JS7A 3MCWA 1N8NA 1YAJA 2LP4Y 1QTIA 3ND9A 4LGCA 1PSWA 2LW7A 2GCOB 3ACCA 1HDGO 3NWBA 5KJEA 2GCPA 4JI6B 5A9SB 1XZFA 1H8EA 2LE0A 4X1IB 2QL5A 1DDOA 4XKJA 1L6IA 3UPDA 5JAIA 3DV0B 3QX9A 3WQSB 4CM1A 1PNOA 4O2BF 5JIBA 3RJMA 1TB4A 2H7CA 1JXAA 3R5HA 4P4GA 3ND6A 1ISMA 2JDIA 2F1KA 1XC7A 1OU0A 5DI3B 4G37A 1EWYA 1YJ5A 3PFBA 3RF6A 3UHFA 3ZCVA 4BBZA 3ZI4A 5IP5A 2J30A 4MVJE 3NWOA 5F35A 4FSHA 2XDAA 4BNKA 4UULA 3DLAA 4R54A 3UFXA 4ZYVA 4GZLA 3M1IA 1X87A 3E35A 2QVGA 4PNPA 3DE0X 1CQXA 4LDRA 4ATNA 1OYOA 3BWMA 3L41A 4IVNA 1L3BA 4JNCA 1REQB 3A1FA 1FS6A 3WV5A 3VOSA 2VOEA 2BWJA 1C3LA 1XRLA 2ACEA 4Z9BA 1WCWA 1RHQA 1ZD9A 3KPVA 5AVQA 1PR1A 1M34E 1T3TA 1N5KA 5BSUA 3VZDA 2XZLA 1JQDA 2CB9A 3UJ7A 2IEIA 5FPSA 1SVSA 4YT8A 5ELMA 4HUQA 4IZ6A 4P5DA 4PNHA 5TQ0B 1A4IA 1PJQA 3COSA 4I5GA 4M1EA 5ECWA 1V5GA 1IC6A 1B0PA 1GUBA 2X0RA 2YVLA 5KKCA 3HA5A 3MAJA 5HGJA 2LXNA 1S3SA 2NU9B 4REQB 4UUOA 2QLMA 1L2TA 1JW9B 1VI6A 2W00A 4JBIA 5LD2C 3MTIA 1SHTX 2R44A 3GFFA 2GJSA 4ZYUA 1H5NA 3NH6A 3UUGA 3A9TA 2F00A 3LMKA 3ZK9A 4WN3A 3ZLUA 5BVHA 5CM2Z 3G88A 4OMCA 4QXMA 2YWGA 5JAZA 3H65A 3V8QA 3K94A 3KOYA 6AT1A 2XXAB 2YNMA 4N41A 3PQ6A 1E6WA 3B1VA 4MUMA 1JIIA 5F7JA 5HG0A 5HBGA 4QT4A 1SQSA 3NTLA 1AB5A 1XZQA 3OF2A 4G56A 4QO7A 1FF9A 1HEUA 1O7JA 2YOGA 1OY1A 3DMYA 3GLIA 2A33A 2K6GA 1FNMA 4OQYA 5EPEA 3SDSA 3RQIA 2QD1A 2ZYHA 1Q1ZA 1OWMA 3NBYC 1JDVA 3O83A 4NYIQ 2PUCA 2PJUA 3QY0A 1BJKA 1QKKA 2X0IA 2ZBGA 4WFIA 3KB1A 2P9EA 2YMLA 1JJFA 3RTEA 3QUCA 4L72A 3U19A 1KEEA 1YRBA 3QVJA 5AKYA 3BXPA 2C4NA 2CWDA 4WDQA 4LXTA 2YV5A 5LWHA 2WWIA 1X1EA 4KRFA 3QYFA 3AF0A 2HH9A 3PDUA 4HB2A 4H1HA 5C9ZA 1N2CA 3HSYA 4H1TA 5EE3A 1E1DA 3EASA 2NUTB 1L3IA 1ZN8A 4QDOA 1TJ3A 1E2HA 1PK8A 3M5PA 3IOCA 4H16A 3SLKA 2R8BA 3NC1C 3MJTA 4D7AA 2W2VA 2F9LA 3QUQA 1TIPA 1SKYE 3IX7A 4PBSA 1QVVA 3N6RA 3MMSA 1X86B 4CMEC 4Q1BA 3ZHSA 1IJKA 5A3JA 3K9CA 3ITKA 2P79A 2YW9A 2ZRAA 4S1OA 4TXNA 2XF2A 5AKHA 4ZVOA 1T25A 5J2UB 1YDMA 1YVRA 1VE9A 2CLHB 4XVHA 4PCVA 1PGNA 4RKRA 2FPIA 4JJEA 5F7OA 1ULBA 3F6PA 2D2XA 2XGMA 2RKWA 3DXYA 4OQXA 1M1XB 2JFBA 3TMAA 4EB3A 3LDHA 4FGLA 1B76A 4QRDA 1GPAA 4FEGA 2XBMA 2I03A 3R3YA 2AOUB 2HHAA 3PGMA 1EBFA 4ZRDA 4A92A 4BVGA 4DEVA 2OP0A 2BM1A 3M4YA 2IZ1A 4TGLA 1H3NA 3UH1A 1QHGA 3BL8A 2VZ9A 1EA7A 1IEWA 2BFWA 2G4CA 5DWDA 1W9HA 1Q1QA 3WAKA 4GH5A 2VDMB 1E0SA 1KQ3A 1A2BA 3C6MA 3L0IB 3OOSA 2E4AA 2XY4A 3LPDA 3PNSA 4Q4LA 5EUMA 5H68A 4EPXA 3SD7A 1LW6E 2WAOA 3R6LA 5TQJA 4UOEA 5TMBA 4ESVA 3WNDA 2PS0A 4YCCA 5BPHA 3ZZNA 2C94A 5AW9A 3E9QA 4N9QA 5IRCD 2G5PA 2FGJA 4Y2HA 2GBIA 3R09A 4K9DA 4TSFD 3GFPA 2OLEA 2FX3A