1CR0A

Crystal structure of the helicase domain of the gene4 protein of bacteriophage t7
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
277
structure length
241
Chain Sequence
MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKDLRALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DNA PRIMASE/HELICASE
publication title Crystal structure of the helicase domain from the replicative helicase-primase of bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 77
structure length 241
sequence length 277
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cr0A00
3SHFA 2W2VA 2FX3A 5F9HA 5C1BA 4LRWA 3FYHA 1FX0B 2QL6A 1E2PA 2JIZA 3ADKA 1U94A 3DKVA 2VHQA 1T8TA 4NYJR 1R0XA 1KJZA 3WNCA 1IXSB 2A3RA 3LA6A 4V0MA 5FTNA 3BH0A 4DCUA 3ZD6A 4U5XA 4O3MA 5JJIA 4F4IA 3U3JA 3UMRA 4A6XA 4DEYA 1I2MA 1KZGB 2VSOA 1XCMA 1ZD9A 1ZAKA 2OFWA 2UVQA 1ODFA 1G16A 3E70C 2YYZA 1BIFA 2KJQA 4JVSB 4XTRA 5FUWA 5JWRA 4E5UA 5H8WA 1H65A 1G64A 4S2EA 2J0UA 4TYPA 5CITA 1NJFA 4O2LA 2DWQA 4FINA 2JLQA 1CJVC 4LV6A 1XU4A 1RJ9A 3AQ4A 3SDZA 4OI4A 1N6NA 1G291 2E1RA 3K53A 4A2WA 5J4KA 4LHWA 2F1RA 2H7VA 2JLSA 2QI9C 4JMPA 1HT1E 1WDTA 1KK3A 2WSSA 4V0NA 3EXAA 4JKIA 4L16A 3K09A 4R71A 1W0JA 3HU2A 5FI1B 3PFIA 1US8A 1JB1A 1R6BX 4V03A 3VFDA 2D3WA 2ZSEA 3LX8A 4GNKA 4PC1A 4A1FA 4CYMA 4ZI3A 2D2EA 3KKOA 1UJ2A 3VNUA 4P32A 1GITA 4MA4A 3B6EA 4HYYA 4RKEA 3A1WA 5BW8A 2FA9A 3ZDQA 1JAIA 4DCTA 4C0QC 3L2OB 4GOKA 4L8GA 2WHXA 2ZJYA 2XTNA 5DN6A 2ZRIA 3F8TA 1UKEA 2JATA 1MRSA 5DHAA 4IXNA 4FMBB 4OJQA 1RFLA 3TSWA 3IGFA 4RY2A 3Q8XB 4P4SA 3KFXA 1XD9A 4V0OA 1W47A 2O8CA 1U9IA 4P33A 3ZZ0A 3CPEA 4B3BA 2G3YA 4PHGA 1LTQA 2QA5A 3KL4A 3LWNA 4A8JB 1I4TD 4ZCIA 5B30A 1KO1A 3D7MA 1KI4A 3LW8A 4DLXA 1RC8A 4MKIA 2R6AA 4LDJA 1G7CA 4HAZA 5K8IA 1QHSA 5DYGA 2WAYA 1UF9A 3PEYA 1E9SA 4Q47A 1YE8A 2IUUA 1OH6A 1SVSA 1TEVA 3WYGA 4JLOA 2ZYWX 3TQCA 1KY3A 3FMIA 4NYIR 2QSZA 4QM7A 4AY2A 2WJGA 3G5UA 3BAFA 3DPUA 3HYTA 1Z63A 2WICA 5FL3A 1OH5A 4DLVA 3FWYA 1SXJE 2QGZA 5TV2A 5P21A 4Q18A 1P6XA 1TEXA 4UNNA 4Z8XA 1N3BA 1JPNA 4TYYA 4MDFA 4HZIA 2BMEA 1YZQA 5FOTA 3BH7A 1KJYA 2C78A 1DAIA 2VP4A 2JJ1D 3LQRA 1U8AA 4TMVA 2GK6A 4BRUA 2NTYC 3CRVA 5LD2C 5EUQB 2YC4C 2WBLC 2ZS8A 1R2QA 4QFMA 1UADA 3QKRA 1XJ0A 3EWSA 1FP7A 3O8BA 3MWKA 3GLFA 3ASZA 4HAWA 2ONJA 3TGPA 2XSZA 4Q9LA 1ZC3A 1N6HA 2ZSFA 1QG2A 1QRAA 3CB4A 2ZJZA 3KKQA 3X2SA 1I2DA 4AG6A 2J9RA 3I4LA 3U3RA 4V0ME 5J4YA 2O0KA 4A0HA 4BZXA 1SXJD 4NKRA 2W6JD 2GJ9A 4DCVA 2AD1A 2CK3D 2XZPA 2ZS7A 3K0CA 3QPUA 2HLDA 4A0RA 2UZ3A 2VQSA 1K6MA 3L0PA 2O8BB 1NG1A 2VF8A 4CT5A 2E87A 3REGA 4F7WA 1J99A 1Z28A 1W4BA 2KI5A 2ZU6A 4DCSA 2QAGA 3QENA 2VP9A 3EA0A 4LK2A 4JL6A 1KNXA 2OFOA 1EFCA 3QXJA 5DLQC 1N6OA 821PA 3MSXA 1OYWA 1KMHA 2CCGA 4UNQA 5TMPA 1DS6A 3X1ZA 1FP6A 1II9A 1S8FA 2VHTA 3PENA 1FTSA 3AGQA 4OQLA 1AS3A 4QBGB 2QMUA 2C96A 3B1VA 2OO7A 3TJZA 5KSOA 1ZNWA 4YMSA 4WZBE 3SN6A 1W2HA 1SULA 3K8YA 2DPXA 3PUVA 3AVTA 4M1KA 3PR1A 1EWRA 1ZM2A 1ETUA 4Q00A 3VR5A 4FCVA 4D81A 1EFRD 1L4YA 3GCGA 1UAAA 4BLOA 2SHKA 2V1UA 4Q4AB 3O8CA 3P20A 4EPRA 4JLNA 1XEXA 1DAMA 2ZR0A 3A4MA 2IYVA 1DG3A 3MGCA 3V00A 4MYHA 3WMGA 1FMLA 3KKNA 3NEYA 1Z2CA 2FPLA 3TVDA 3PCRB 1W36C 1E1QA 1DOAA 3D6TB 3RABA 3UG6A 2ZJ2A 4BFTA 2CHVA 2MMCA 3ADBA 3GPLA 2WM9B 3QXCA 2BDTA 4M1YA 1J8MF 2DFTA 4QBHA 5C2JB 1MO6A 4G3XA 1SZPA 2Q9AA 3GD7A 2EU8A 3EZFA 3IHWA 1VCOA 2HT6A 4PC2A 3IIKA 5HZKA 3QIAA 4TQUS 1BH2A 1KIMA 4C0SA 1H8EA 2ANCA 4QL3A 4DUGA 4ARZB 5JCPA 4PAMA 4BQSA 4PAQA 3SOPA 3FPAA 2V1XA 1SXJB 1G3QA 2GEDA 4GZLA 2Q9CA 2F55A 4LSGA 4DDUA 2FN4A 4JL5A 3AP1A 3C5CA 4I1UA 5KTYA 3EZ2A 4A0FA 1Q22A 3H2YA 4BLTA 2MMGA 1XTSA 3W5JA 3CKLA 5E7JA 4PO8A 3ZVLA 1E0KA 2YWGA 1HQYE 2AKYA 1YZNA 4A6PA 2O8EA 1AN0A 2GAOA 3DOFA 2ONKA 2I4IA 2GXQA 4Q4HA 3OEEA 5K8TA 1OHHA 4TZ6A 1UDWA 3IPYA 2IS6A 3QXHA 1ZRHA 1A2KC 2G1JA 5KSPA 4B34A 3IQXA 3EARA 4JLVA 4WZAE 4ZIRA 2IXGA 4M1TA 2IS2A 521PA 1X86B 2HDNB 4RZ3A 4EPTA 3UWOA 5C18A 4URZR 3FKQA 1IM2A 2B7BA 1P5ZB 3BE4A 1VHTA 3CRW1 4M1OA 4Y0AA 3W8RA 2FSGA 2IYXA 3K9HA 4IVQA 2HF9A 3R9IA 4F92B 2ZVQX 1E94E 4D4JA 3AVVA 4LBZA 1T5IA 2H18A 3FMFA 1TU3A 3UMSA 2AX4A 3IHLA 1BMFA 3QNUA 2FNAA 4PHHA 2HT1A 4KJZA 5EUMA 4PPFA 4JLMA 4D0LB 1GKYA 2H5EA 1XFAA 1KI8A 1ZM4A 4CT4B 1US8B 1XEWY 5FTMA 2OCBA 1S1CA 1JNYA 1W48A 3U44B 4BFSA 4EPVA 5J4LA 2HCBA 1U8ZA 1Z0FA 5FBRB 2F6RA 1KY2A 4KVAA 4D4KA 3C16C 5IDVA 1P72A 1KOFA 3E2IA 4PC7A 1Q0UA 4OK3A 4KFUA 3SJBA 1V43A 1IY1A 1GNPA 4URWR 1WBBA 4GRAA 3Q5EA 3H4MA 2YNMA 4CZ2A 4BFVA 1G4AE 2A5YB 1W49A 1E3MA 2GK7A 3ZYCA 1TF2A 3P26A 1YKSA 4NZYA 2XEXA 1VCIA 4ZO4A 1W36D 1E9FA 1XDBA 2BBTA 5L3RA 1Q12A 4DDVA 2Z4RA 2IHYA 4LYHA 5IHPA 3UATA 1JR3A 2V54A 1YRAA 1KSGA 3B1WA 4W5HA 4NCJA 4TLBA 3TUZC 5SZIA 2FFAA 1XZQA 4BFWA 1Z8FA 1ZJ6A 4CIDA 1GP2A 3BJIC 3QXSA 3TVTA 3DMDA 1BYUA 5EE9A 1IN4A 2EWVA 3FFAA 4TSFA 1O87A 3KKPA 2RGGA 2QEQA 2C8VA 2YVUA 1GL9B 4GL2A 1K5GA 1MV5A 1GTVA 3CRQA 1M1YE 3TRFA 4EPYA 2NO1A 2Q0HA 1S1MA 3BIFA 1XPUA 4BRWA 3U5ZB 3QOFA 3H86A 4URUR 1GAJA 1FX0A 3CR7A 4PX9A 3UG7A 1QVAA 4E03A 1MR3F 5BYKA 1CR1A 2JLYA 5FOXA 2QP3A 3KX2A 1RRCA 4B33A 1NN5A 5F9FA 3LXXA 1E0AA 3TSOA 4Z1MD 1VCMA 3L0SA 2PT7A 3B60A 2BCJQ 2G9NA 4B2LA 4RCYA 2DWPA 5JBQA 4P4UA 4JT2A 3AKDA 3DKPA 1TPZA 2JDID 4HDQB 5JWOA 4LJYA 5H70A 1CTQA 2YWHA 2ODNA 2I1QA 3QKRB 4YDSA 5GJCA 4A2PA 2O8DB 5FFMA 3X1YA 1E9EA 4WOPA 3RS0A 3OF5A 2BM0A 1G20E 4C7OB 5EQTA 1HTWA 3RYTC 4LWZA 1NY6A 1Q20A 4I1VA 3TKLA 1EX7A 2GXUA 1NRJB 4G1UC 5KUTA 1OB5A 1YJ5A 2ZR9A 4HDCA 2OCYC 4PAOA 3OFNA 4I1OA 4K46A 5E4FA 1G17A 3L0OA 1DTSA 2ZJBA 3ZIAD 1XCGB 3TUIC 1XXHE 4OHXA 4P31A 2AD5A 4B6EA 1XPRA 1AGPA 4NL4H 2XNDA 1RYFA 3PEUA 4Q66C 1NVVR 5FTKA 4XVQA 4KV9A 1A5TA 5C4GB 4FMDF 1VYTA 2GCPA 4G5GA 1J8YF 3EG5A 3LXRA 3I1FA 5E3HA 4UXJA 3ICEA 1KMHB 1LF5A 3ZH9B 2OAQ1 3LLMA 4NCIA 3I5XA 1GZSA 3BB1A 4A8JA 5JHGB 4PC3A 1Y63A 4TT3A 2WMNB 2XZOA 4KSBA 4B43A 3KTAA 3M6AA 2ZQ5A 1T3HA 5FBWB 1KK2A 4DDWA 1NL3A 1ZINA 3RRMA 3WYFA 3OAAD 4D4LA 1Z2AA 4PQFA 1EGAA 4QGFA 4TMXA 4URVR 2Z6VA 1P73A 3NBZC 2C03A 1JQJC 1IY0A 1YR7A 1GRRA 3DOEA 3CBQA 4B44A 1F3OA 1XEXB 2F43B 1ELOA 4E22A 1OXUA 4IDNA 1QVRA 2ZRNA 1NKSA 1TF7A 1OIWA 2QP9X 3X1DA 4EFLA 5KSYA 3A1UA 5LBIA 1JR3E 2YZ2A 3GJ5A 1E2MA 1ESNA 1NMXA 1FNMA 1UEIA 4FMCF 1HA3A 4HAVA 4MYTA 5AK0A 5JI3E 3IPXA 1P61B 2OESA 1R5BA 1YR9A 5BN5A 1MRNA 2BEKA 2QAJA 4QG7A 3QJYA 2Q3MA 3DM9B 4Q02A 4L4UA 1G6HA 3HP1A 4MRPA 5EP2A 3NG1A 1TQDA 3ADCA 3RVBA 1R10A 4G5QA 1Q44A 4NH0A 5AJWA 1KDPA 2G77B 2VP5A 4ACAA 2QU8A 1TTTA 2P65A 1UM8A 4Q48A 3DVLA 2GKSA 5JECA 1G3UA 2OBNA 4DSTA 3LD9A 2W0MA 3B9PA 3W8NA 2AWNA 2GHIA 5FOSA 1BYIA 3B8HA 1DBSA 2GESA 2ZRGA 3DM5A 2IYUA 5G3ZA 4B32A 3B2EA 1DAGA 2O8BA 4QGGA 1GG2A 3OEHA 4QJ5A 4UNPA 3PEWA 2P6UA 1NSTA 3FHCB 5SZKB 1KKMA 1KNQA 2FMXA 4ITRC 2ZU0C 2R6CA 2WIAA 5FI0B 1E9RA 2RGNA 2O8EB 3KZ1E 2ZRAA 2V6IA 2QN6A 2R44A 121PA 3ND9A 5HE9A 4EJSC 1OXTA 5AJYA 4RD0A 2P5TB 1UEJA 1X8KA 1K5DA 1NI3A 4KYUA 4LHZA 2GA8A 4XD7D 2NO9A 3I73A 3RC8A 2RKOA 4RVCA 3V9PA 4BEJA 1VYUA 1GUAA 4NONA 1XNJA 2CEAA 1G5PA 4D0NA 5ANRB 4B71A 1NP6A 1G9XA 4LJ8A 4N0DA 1Z6XA 1SKQA 1E32A 1XXHB 2YOHA 2GVDC 2QP4A 4AI6A 1GILA 3M0EA 1XD8A 3K0FB 3ZVRA 2QTVB 3HR7A 4JIMA 3NHBA 1OT3A 1LB1B 4Q4AA 2OXRA 4JKYA 1KO7A 2GXSA 2F3RA 4DLZA 2OM2A 3W5IA 5KOYA 3QEOA 1IJFA 4WIAA 1IQPA 1TUEA 4RFVA 1X1SA 2GETA 3Q85A 2WKRA 1P3JA 2JJ1A 2BJWA 4Q1FA 4JLKA 5FL7D 1OH7A 3QVUA 5B57C 2GRJA 3THOA 2ZUDA 4D6PA 4M4SA 1JEEA 4JJKA 2JLRA 4TN1A 5JS8A 1Q1EA 4Q7KA 5FR1A 2OAP1 2LCFA 1J7KA 4KXFB 3VU9B 2HYIC 2OG2A 1IOZA 1UDXA 1XD2B 1DVRA 2GCNA 1N5IA 3BRWD 4ARZA 4A15A 3U7EB 3GEHA 2ZI9A 1HV8A 4HLUC 1SXJA 3T06B 4EPXA 2W6JA 4NCNA 2BMJA 2CK3A 1D9XA 3T1VA 2NIPA 1FL9A 4GZMA 4A9AA 4BUJA 2VHUA 1GM5A 3BK7A 2VH5R 1NN0A 4CVNA 2W6ID 4UQOA 1GKIA 2ZUCA 5EP1A 3T1QA 1W0KD 4M9ZA 3L8ZA 4MKGA 1D2NA 1NVXQ 2CVFA 2F1HA 2FEMA 4Q01A 3ZJYA 1OH8A 4UNRA 4B73A 2H17A 4PZZA 2KBEA 4IDQA 1CP2A 1KI3A 3PIRA 4IW3B 2BC9A 1PJRA 5FPHA 3RHFA 1DADA 5IT5A 5B2ZA 1E2QA 4R2IA 2ODWA 1SVKA 3ZS8A 2WJJA 3IIMA 2X2FA 2IYYA 1OFIA 1VHLA 3REFA 2JCSA 4WW0A 3KB1A 2CDNA 2XJ9A 1EFRA 3V4FA 3W90A 3ZQJA 2C2HA 2IW3A 2QM7A 4DRZA 4P0TA 2WTUA 1DAFA 3P4XA 4Q03A 4BZPA 4TL8A 3PITA 4XWAA 4KFSA 1NN3A 2LWIA 4PPNA 4AK9A 2PCLA 1VDZA 4XTCS 1UKYA 2WOJA 1E9DA 2V7QD 1E9AA 2QT1A 3H1TA 3LV8A 1QHNA 2JAQA 4GDFA 2HJGA 4B2PA 2ZRMA 5AJVB 2CE2X 3X1XA 3ZS9A 3U44A 3A1VA 4PFSA 5KPJA 1O3YA 3QBTA 1WCV1 4TQAA 4ABYA 4C0KA 1Y3AA 4NYMQ 1S0UA 2A2ZA 4HUTA 2GILA 3HPQA 4KAXA 1JAHA 1Q1ZA 4MRSA 1KDOA 3DZDA 4G5OA 3OESA 4M1SA 2NG1A 4C0AC 4AD8A 1RPZA 3E5HA 1A7JA 1G8PA 2BHRA 2HXSA 2ORVA 4DLWA 2OV2A 4M9QA 4NBSA 2RAPA 1EFTA 5HCNA 2J7KA 4RD4A 1Z0JA 1G8YA 3DHWC 1CRQA 4MGKR 3OE7D 3R8FA 5AJXA 1SVWA 2IEZA 2RGEA 3GEIA 1LY1A 2AK3A 1U8YA 4G5SA 2GXAA 1VIAA 3QF7A 3PUYA 5KO2A 1ZCAA 3RSLA 3KTAB 3SYKA 3VMFA 2ZUBA 3DMNA 1G3IA 4LX0A 2ZRCA 3L43A 3MLEA 4QHSA 1H8HD 4PHFA 4NPHA 3BD9A 2D7CA 4IDHA 5FUVA 2ZETA 4AYWA 3LDAA 4EAQA 2D4HA 1Z22A 1TU4A 2OCPA 2WIBA 1KDTA 1EX6A 2Z0MA 3RS2A 4QM6A 3M1IA 1G8FA 2WWGA 1LFDB 1XTJA 3LRPA 1JJVA 4IKEA 2HF8A 4JLAA 5FH9A 2XITA 4JBYA 3UKDA 3W6PA 2GTPA 4EQ6B 3F0TA 1JEDA 5K8UA 1EWQA 3VNVA 4MYUA 4AURA 2OLJA 5KU1A 2C99A 3K09C 2V55B 3BB4A 4US1R 4DZZA 5JI2E 2FOLA 4PQYA 2CNWD 3WHLA 2QMOA 4BFXA 1T91A 3VAAA 3SU8A 4GI7A 2VHJA 721PA 2ZVPX 5JEDA 1W4RA 3O8RA 2EQBA 4M9XA 2O8DA 1DAHA 2JLUA 1P9RA 3HR8A 4C7OA 4IEIA 1GNQA 1L2TA 1X1RA 4PPQA 5JS7A 1U98A 2WV9A 2A5DA 3A58B 5FR2A 5IK2D 2GVZC 2IC5A 1R5NA 3RC3A 4EIWA 4H1VA 4MH0R 5LB4A 4W5JA 2L0XA 2OT3B 4CEJB 4JT4A 3AF3A 3SZRA 3EZ6A 1ZD1A 3IO5A 1DE0A 3THXA 3WYAA 3U3MA 1Z29A 3LFUA 1X8LA 1Z08A 4DCNA 2VL7A 3SS8A 3RNLA 5CDFE 2B8WA 2ATXA 4DIEA 2N1BA 4HAUA 2PLFA 5CB8A 3WHKA 1ONBA 1KI6B 2UKDA 1E9CA 5SZJA 1ZUIA 2NZJA 4JBWA 4YMWA 1D9ZA 5DHFA 2OZEA 5HTKA 2G0NA 3AVYA 4ASUD 4NHOA 1JPJA 4YXWD 1GDDA 1W4AA 3GJXC 3C4JA 2A9KA 1A2BA 4LJAA 4UXIA 3X1WA 4PZLA 3TQFA 4GSYA 5CLQA 2WWYA 3EPKA 3HU3A 2FPKA 3C14C 2ZI7A 3ASYA 1R8QA 4EDHA 4GT1A 1JI0A 2QZ4A 1EFUA 1G8GA 2OEPA 1HE1C 2FEOA 3FMPB 1HT2E 2F43A 1JECA 1U81A 2DY1A 2ZAOA 2PT5A 5L3VA 4Z1MA 3K70C 2NOAA 4B35A 4BPBA 1M74A 4U02A 1F2UB 3TAUA 2P6RA 5F2EA 1BOFA 1PLJA 2ORWA 3CW2A 4TLAA 5KYKA 1AZSC 3UK6A 1E2LA 3A6PC 3KQKA 1VECA 2JDIA 5AUNB 3Q7PA 2QRNA 5CYPA 4IDOA 3AUYA 2XTMA 1S9DA 3B1XA 3B1YA 1E4YA 2BMFA 2QUZA 2JLZA 1F60A 4LYJA 4M9SA 2KB0A 3CZQA 3ZZUA 1TAGA 3K0CC 3ZGXA 2OSBA 3BC1A 3W9YA 4ZDKA 4ZI2A 1FQKA 1CS4C 2WOOA 3MRSA 3QSYA 1KDRA 3ZIAA 2QAGC 4Q1DA 3W34A 2QPAA 3GMTA 4LCBA 2H92A 2Q3FA 1ZC4A 3OZXA 3T15A 4AKIA 3N2EA 1HEIA 1LS1A 1VIYA 4DBLC 1AS2A 2B92A 3WBKA 1KKLA 4EKDA 2VRWA 1KK0A 1VCNA 5DI3B 3CLVA 1N25A 2PZFA 5FPYA 5GJWC 3CF2A 4BFYA 1KI2A 2OFXA 5JJLA 2ZRHA 2W83A 4MYCA 1Q3HA 1KO5A 4ERNA 2FGKA 1JXOA 1HE8B 4KSCA 1SVMA 1LW7A 3MD0A 1SVOA 4WZ6A 3IDQA 3F3YA 4PHTA 4PO1A 5CB6A 4XVRA 4CDGA 2Q9BA 1M7GA 4LY6A 1MH1A 1P2SA 4Q7JB 2X19A 3OAAA 3R7WB 3AVUA 3AF1A 2AXNA 3CNOA 4DT1A 2ZJAA 1PLKA 1F6BA 1S3GA 1ZP6A 2CMKA 4DJTA 1QHHB 2J41A 4KYIB 3OIUA 4BECA 3EASA 4GFDA 4LHVA 1VG1A 1XXHA 2D74A 3K0AB 2GCOB 1R0YA 2BKUA 4MQBA 2X2EA 2NZ8A 3K0FA 2ZE5A 4LUCA 1EXMA 3U60B 2OHFA 4TMWA 2XGJA 2VYFA 4DLRA 5A4JA 5EZ5A 4URXR 1Z0DA 2RGCA 4HB4A 4LBWA 4RZ2A 3TR5A 2RGDA 1KSHA 3NBXX 2D2FA 4IVRA 1ZD8A 2ZITA 3RAPR 2FV8A 1Q1QA 4Q9IA 3AGPA 4RKFA 3GJ4A 1YVDA 4Q4LA 4Q9HA 1E99A 3SYLA 2J0SA 3QG5A 4F93B 1NVUQ 1R0WA 1COWD 2ZRBA 4NE2A 2IWRA 3VU9A 1HYQA 1NY5A 1G6OA 1XD2A 4Q1AA 2FFQA 4JJZA 4TTPA 3CPJB 1SVLA 2MSCB 2BM1A 2PEYA 1XMJA 5JLJA 1II8B 4LPSA 3C7KA 1NF3A 5LD2B 2HJVA 1OJLA 3L0IB 2VP2A 3QKSB 1MO4A 5L3QA 4DEXA 3CM0A 3AEZA 3HJNA 4OYHA 5CIQA 4B3CA 2FSHA 2AL7A 2V8OA 3I3SR 4DVGA 1KHTA 1JJ7A 3KQHA 4I4LA 1XP8A 4EUNA 2GBLC 2ZJ5A 3Q5DA 4LV5B 3AKEA 1BKDR 3SJCA 4C3ZA 2IS1A 3NBFA 3WRXC 2GZHA 3QPWA 4IOMA 1XTRA 2R6GA 4KFTA 2ZRLA 1ZU5A 3U61B 3JZAA 2ZRJA 3FMOB 1IXZA 4XD7A 1CULC 4O2RA 3NIBA 1PZNA 4TL7A 4OHWA 1G8HA 3U2QA 4MGYR 1G18A 2EFDB 4A82A 4AC9A 5HZHA 1U0JA 2F1IA 3BFVA 4JLDA 4AIIA 3AVXA 1RW4A 4A0GA 5BN4A 2J3EA 1U99A 2CLDX 2ECKA 2PMDA 2GEVA 3PVSA 1E2GA 3PUZA 4KHZA 2WWFA 3ETLA 3A4NA 1LV7A 4PQRA 2IK8A 2QROA 4ON9A 3K9GA 3PV0A 3CPHA 1NKTA 4LJ6A 1QHGA 2JJ2D 4Q9KA 4V02A 4K81B 3MFYA 5AWFC 1Z07A 2MSEB 1KJWA 3ADDA 1KAGA 3VKGA 1BO6A 3DO6A 3N5CA 4XWOA 1P2VA 4BE7B 1P75A 2RHDA 1WBDA 1F2TB 2RGAA 3PG5A 3HYRA 5FL7A 1RRGA 1SKYE 1FUKA 1EG7A 4UXHA 4AYXA 1ZIOA 2Z83A 1SGWA 3NH9A 1N5JA 1UKVY 2G88A 2IYZA 4LYFA 4TL9A 2QTHA 4TLDA 5TVKA 2H1LA 2FPMA 4TTRA 1IN5A 1E69A 1DO2A 1TNDA 4W9MC 1U90A 2GDJA 3HWSA 2EWWA 2F7SA 2J46A 3JVVA 4V0KA 1FQJA 1W2GA 4ACBA 4C9BA 3EAQA 4HLQB 2YINC 3EIHA 4GOJA 4XSHA 1IONA 3VR6A 5M04A 2PX0A 4XSGA 1W36B 2FF7A 3WNDA 2FZLA 4F38A 3Q7QA 2GJKA 3BFXA 5JJKA 2NO6A 4GPTA 1E96A 3THXB 4NP6A 1XRJA 3EPLA 3QKTA 5HE8A 4H9GA 5EE0A 421PA 4TYNA 3SJZA 1QZXA 2N42A 4JS0A 3CX6A 2E9SA 5C46F 2DFNA 1NSFA 3FE2A 2JGNA 2W6IA 5EXPA 2IBMA 4RFSB 4Q4JB 3HPRA 1W0KA 4IRUB 1NBMD 4NYJQ 2PL3A 2A5FA 3ECCA 2GAAA 3QF4A 2QM8A 5CLLA 4U7DA 1IHUA 1FPMA 2C98A 4EFNA 4JLBA 5FTLA 2ZRFA 3EX7C 2X8AA 4KLZA 3T1OA 2YOGA 4II7A 3BOSA 4B6FA 3OIWA 1KYIA 3RS5A 4IFEA 5FUYA 1KTVA 2IWHA 3BBPA 4J0QA 4CF7A 3NWJA 4DC9A 3QUSA 1YRBA 4FCWA 3GLHB 2QE7D 5LB2A 1N6KA 4B76A 3NDPA 3SC3A 5HKKD 1NLFA 4PC6A 1LF0A 4WXPA 2F3TA 1G41A 1Z6AA 2FWRA 5DH9A 2CHQA 2V3CC 4WA7A 4F4CA 1J2JA 4EQ6A 3EZ7A 1YZGA 2QSYA 1ZBDA 2XB2A 1Z3IX 5A0FA 4RD1A 2BJVA 1T6NA 4DHEA 4I99A 1TQ2A 4UJ3A 3EW9A 4JSTA 5DISB 3SNHA 4O0MA 4HB0A 1JR6A 3O47A 3LH5A 1MABB 2EYUA 4Q1CA 4MDEA 2P3SA 2V7QA 5EE5B 4C4PA 1J70A 3KUCA 3SE0A 1OFTA 1N6LA 3OIYA 3WXMA 3R9WA 4LJ7A 3WMEA 3TLXA 2YC2C 1YHNA 4I81A 1OF1A 1XWIA 1CJMA 1G7TA 3IEUA 3TE6A 4C0BA 2MSDB 4XH9B 5JRZA 1EFHA 1II0A 4CEHA 1N6PA 5HCIA 4JLPA 2XOKD 1XPOA 2CJWA 1TX4B 4MRRA 5BN3A 2OBMA 1ZVQA 2X77A 4B48A 4IOKA 4CEJA 3M4YA 2ZROA 4PSKA 1L7VC 4A8JC 1HUQA 1KI1A 3OE7A 3NHAA 1TQ4A 1AK2A 1UFQA 1G5TA 2QY9A 1SKYB 2B6HA 4DSUA 3RS3A 4TMKA 2CHGA 2P0EA 4TYWA 1XEWX 3GEEA 4NYIQ 4TTQA 5FOWA 1KI6A 4D0GA 2C95A 1H8HA 1JALA 3VR3A 2IA5A 4L9SA 1WXQA 1Q57A 4DT1B 1C1YA 3U3OA 1DO0A 3TUJC 5G53C 4CEIA 4LYAA 4HLUA 4IDPA 1G21E 3A37A 4OHVA 1GOTA 3AF4A 3P1JA 3U6BA 1RE0A 2REOA 2W0SA 2D62A 4K8OA 2DCUA 4KODA 4R2HA 3N70A 4Q5IA 4DXAA 4RSGA 3NBYC 4HDOB 2Y8EA 2IYRA 1CR4A 1G3MA 2QBYB 2FDCA 2BWJA 1OXXK 3VKWA 4B3XA 3AVWA 2N46A 1IXRC 3HDTA 3I8SA 3SI7A 3QKUA 3SQXA 2VEDA 1ZYUA 1F2UA 1XMVA 2BBWA 4QGAA 4BLQA 4D80A 4XOIA 3VX3A 4G01B 3AVOA 1KO4A 3WY9A 3QY0A 5D3QA 2CNWA 3RLFA 3GLGE 4IFBA 2IYSA 3WBJA 3PXGA 1T0HB 3SYNA 2ERYA 1P7CA 3KQNA 3AP2A 1OSNA 2BBOA 2ATVA 3CZPA 3ZZTA 1IY2A 2FU5C 3KKMA 5CJ2A 3RRZA 4AKGA 1W46A 1E79D 5KNCA 4FCTA 4HAXA 4LZZA 5LPNA 4YMTA 4B3GA 4KLNA 2ZTSA 5CJPA 1UBEA 2QPTA 5IK2A 1RRFA 4HI0E 2RCNA 2A7QA 3TW8B 4D26A 1I4DD 3FKSD 1CEEA 1ZW6A 2I1VB 5L3QB 2CXXA 1G7SA 1XF9A 5KSZA 4UJ5A 3EIQA 2NPFA 2BOVA 1M7HA 2KWIA 2OILA 1E4VA 1SVIA 1TUIA 2OBLA 5E7MA 2FH5B 1AQYA 2AKAB 1P9WA 3C8UA 2J1LA 1OYYA 1VPLA 5DI3A 3OFND 4YC7A 3CIOA 2KE5A 2FSFA 2QENA 4D25A 1ZM7A 4OBEA 2LKCA 5DGXA 2YOFA 3UWKA 1XTKA 2A78A 2AFHE 3BORA 3QQ5A 5EE1A 3RSOA 1R4AA 2PJRA 4TMZA 3CH5A 1E6CA 3LVRE 4W7SA 2I3BA 4ASUA 4MKHA 5G41A 4YXWA 1WMSA 5CYOA 4QBIA 5FTJA 3R7WA 1G4UR 1X6VA 1ANKA 2WPDD 4MKFA 4FWTA 4NCKA 1NN1A 2BVNA 1Z6TA 3MAAC 1HY3A 2XX3A 3SFVA 4DLYA 1QHHA 3THYA 3WMFA 1T9HA 2J7PD 4O25A 5TDHA 1M8PA 2J5XA 2JA1A 4JVNA 3VR1A 3PQCA 4QBFA 3VHXA 3U4QA 4DLTA 1IBRA 2J45A 5D3MB 3K0AA 2GCOA 4XWKA 3LBHA 3FFBA 5L3SB 3NKVA 3GJ3A 2IF0A 2EFHB 4JSYA 2VHCA 2IHBA 4OQNA 4TL6A 1OE0A 1HQCA 3TSZA 2HYDA 2WMOB 2ERXA 3A1TA 4X8OA 5CDFA 2VSXA 4A92A 4IHQA 3U6KA 2JLWA 1UBGA 3AKYA 2PMKA 5C4MA 4D82A 4M2LA 1GKUB 1N6IA 3B9QA 4M8NE 1OKKD 1FUUA 4GMDA 4MUBA 5GADl 3CNNA 2QQEA 3HU1A 2RGBA 1LVGA 2KBFA 3AKCA 4YMUA 3ICQB 5HR5A 2HEIA 1SXJC 5JEEA 1P62B 1QBKC 4FN5A 4ZCLA 1Q3TA 3TNFA 4HUQB 4DIDA 1ZM9A 2XTZA 1QF9A 4M1WA 3SR0A 5JFGA 1G3RA 1PV4A 1G5RA 3B82A 4Z8YA 2BBSA 3DEFA 2RHMA 5IF9A 1X8JA 3T12A 4BFZA 4LGMA 2ZSDA 3LO5A 1II8A 5BWMA 3KXLA 1WRBA 2BIFA 4PXAA 1NMZA 3FB4A 1NNEA 3QKSA 4PR0A 3GLGB 2FE4A 5CM8B 3K0SA 3QF4B 3R8CA 3UXMA 5JSZB 4NTZA 4QNMA 2R6DA 4US2R 1T8UA 1OPXA 1YZUA 2C04A 1A1VA 1CRPA 3VX4A 5A5GA 4WVFA 2REBA 2DWOA 1CR0A 4KO8A 2OLKA 2R2AA 2WKPA 4DLUA 5LDDC 3KJGA 3OEHD 4OL0A 2P2LA 3FGNA 3GLIE 4KFRA 4Y0VA 2CE7A 3BFKA 3S1AB 3IQWA 1M34E 5J4VA 2VP0A 4RD3A 5FPKA 2REXB 1V5WA 4X8MA 4OI0A 2JLXA 1ESMA 4JBXA 3FOZA 1E1RD 2FZ4A 4I1SA 1U2RA 4LI0A 4C2UA 2UZIR 2ZPTX 3RANA 4A4DA 3L82B 4IJMA 2V6JA 4JVLA 4PTLA 4N0EA 1ZNXA 1RIFA 5E7IA 2DYKA 1E2EA 4EJSB 4PANA 2GZAA 4JZKA 2WJIA 2D06A 2A30A 3CF6R 2AWOA 3DDCA 2JJ8A 1HURA 1FFHA 5F98A 2J0QA 1ZU4A 2O5VA 2WZQA 1G7RA 2CLSA 5KPDA 3THWB 2ZI6A 2X1VA 1CXZA 4LC1A 2FSIA 2EFCB 4OI2A 2J87A 5CK5A 1D8TA 8OHMA 3FHTA 1F2TA 4LC0A 2WJYA 3MWLA 4FW9A 4HLDA 3VKHA 3P27A 5IRCD 2ZEJA 3JZMA 2WWHA 1XX6A 2XXAB 3RWMB 1Q1BA 3TMKA 2R6FA 1VYVA 1LNZA 3K9NA 2R8RA 4NMMA 4OJKA 5FOUA 1COWA 1E2FA 1CJTC 4IXMA 2FFHA 4PPGA 2R65A 4ZKEA 4DSNA 3EWAA 3KB2A 5KHOC 4CEHB 3AP3A 3LVQE 3G82C 3B13B 2NMVA 2XZLA 2CJWB 4PO9A 4IEEA 4N3NA 4MRNA 4TMTA 1U9IC 3RS7A 2ASEA 1SHKA 4DB2A 2LKDA 3U7GA 5H1YA 1PVOA 4DWJA 5FBQB 1P4SA 1GFIA 5JWHA 3QG1A 2IXEA 3I92A 2ZYVX 1G19A 3VHLB 1OLOA 4DKXA 2IYLD 1S4QA 1W44A 2YWFA 1FW6A 2GF0A 3NC1C 3I32A 4FWIB 2AXPA 3H0KA 1ZM3A 4Q7LA 2BEJA 4RFSA 4Q4JA 3I62A 2EFGA 1CLUA 1ZNYA 4YLGA 4ZDJA 1QHIA 1E2HA 4S35A 5EJEA 1KSFX 1NJGA 2JASA 4WXRA 3T1TA 4P3YA 4CEIB 2CCKA 4WBSA 2K5UA 4KBGA 4AG5A 1Z06A 3VQTA 4OQXA 4ESHA 3MCAA 3UPUA 1DAEA 1MO3A 3AV0B 1NIJA 2W58A 1GSIA 5AUOB 3W3AA 1F48A 2H16A 3GLHA 1B0UA 3TH5A 3AVPA 4QJ3A 1WQ1R 1W1WA 2A5GA 4WAUA 5GJBA 1VTKA 4OK6A 3B85A 1UPTA 2V9PA 4EPWA 2QT0A 4RJLA 2P67A 2OCAA 5J40A 4OQMA 2JJ2A 3QXXA 4BWYA 2FGJA 2JIZD 2RGXA 4OQFA 5EP3A 1XEFA 3WRYC 2CL7X 2NQ2C 4TYQA 1QG4A 2VPPA 4TLCA 5AUPB 4F4JA 3V4RA 2ZI4A 5UKDA 1ZMXA 3G0HA 1D2MA 2RMKA 3KJHA 2GJ8A 3W3ZB 4OHZA 3IBYA 1MABA 2G6BA 1N5LA 5DIFA 3GJ6A 5DNYB 4QJ4A 3T34A 5DSZA 4OK5A 3LNCA 2W00A 3GLIB 2NGRA 5EXXA 4MGZR 4X8LA 4IVPA 2EYQA 2WAXA 1NVVQ 3TR0A 3NEJA 2XJ4A 1MT0A 3KQUA 2QQ0A 1UKZA 4LBYA 4LJ5A 1AGRA 2Z4SA 2WSSD 4Q19A 5TB5A 3R9XA 1LS6A 4Z54A 1AJEA 3I5YA 2F9LA 4M0LA 5JRJA 1W0JD 1FMJA 1HH4A 2VLIA 4QXAA 4ZV4A 4JL8A 2YV5A 3CONA 1AZTA 1U0LA 5H68A 5KNDA 4Q21A 5TXGA 3TBKA 3GJ8A 2C77A 2O52A 1FOEB 1S9HA 4PSVA 3DZ8A 3IKJA 1KMQA 4QC2A 3CF0A 3FTQA 5B58C 2W2TA 2ZR7A 1B23P 2ODBA 1KK1A 1P2TA 2CBZA 3MWYW 5AUQA 4NCHA 1NBMA 3B7GA 5DN6D 3VR2A 5G3YA 1A4RA 3LY5A 1L8QA 4NU0A 1U0HC 1M7BA 1TADA 3L8YA 4NYMR 5AJZA 5FPTA 3T5GA 4IOLA 5CM9C 2GEUA 1X3SA 2IYWA 3NDBB 2VO1A 4DLSA 2O8FB 1CF4A 1YZKA 1E2IA 2FJUA 4Q9JA 2PZEA 3THYB 1GVNB 2P5SA 3NXSA 2XAUA 2WJVA 1WP9A 1R8SA 1Z5ZA 2PCJA 4M1MA 2QE7A 3U4QB 3ZD7A 2R62A 4US0R 5HKKA 3A36A 2ZE6A 4GOXA 2QBYA 1T3LA 4AYTA 2AR7A 2DBYA 1NVWQ 4CRWB 1W5TA 1E2KA 1XBTA 1XTIA 2GBLA 2JEOA 4TLEA 3GLFE 1IN8A 5HPYB 1YR8A 4E07A 3Q72A 1YR6A 3MG9A 4R7ZA 2HUPA 2IXFA 3B78A 1DG1G 3TIFA 1FTNA 3OIVA 5GJVC 1A82A 3AF2A 3QPVA 2GJSA 1N0WA 4JYCA 3K9LA 3C41J 3CR8A 4FI3C 2J0UB 2OUKA 1XJQA 1TQ6A 2GWHA 1K8RA 2Q3HA 2QMEA 2QMHA 3RDPA 3W6OA 1RJ9B 2G0TA 3BWDD 4PSAA 3QI2A 2ZYUX 1DELA 1UBCA 4OKSA 2WVJA 3TAHA 3K70D 2GJAA 3ZVNA 3EA5A 1XZPA 3ND8A 2B8TA 4AWXA 2YKGA 4HZUA 1EESA 2ZRKA 4B47A 3GLHE 2ZM5A 2XOKA 4BGDA 3IEVA 3WNBA 2FFBA 2WJHA 1ZCBA 2RB4A 3U7HB 3BH6A 2ZREA 2C5LA 4ZKDA 1PLLA 3I61A 4AKHA 1NMYA 2XSZD 4G0NA 3NH6A 3I8XA 1XJCA 4KCGA 2YWEA 1I4LD 1Z6YA 3CUEF 3U7FB 3B5JA 1OXVA 2PLRA 5DO9A 1Z0AA 1N5KA 3PJRA 2BCGY 3QVVA 5EZ6B 3PEVA 1XCPA 1DPFA 2IYQA 2QNRA 1IAQA 4TQ9A 3T61A 4TZ0A 2HLDD 2DFLA 1R5OA 1JXMA 2NO7A 4P4SB 2O8CB 1KZ7B 1PUJA 1T5LA 1SQ5A 3A1SA 4LOAA 4YONB 1DARA 2OE2A 4QHTA 1IN7A 1OFUX 1ZUHA 1Z6GA 4QHYA 5CK4A 5B64A 1Z47A 2CVHA 2EVWX 2IUSA 3RRYA 5FUXA 2VSFA 3Q9LA 2CCJA 1E0JA 2B7CA 1XTQA 1OB2A 4GMXA 3BB3A 3LX5A 2IX3A 3IUYA 1N2CE 2IUTA 5DE3A 3E1SA 5BQ5A 4A36A 1OV4A 4C30A 1L4UA 2DHRA 2ZJOA 3IBGA 3A8TA 5G40A 3U3KA 3KXKA 4KVGA 1GRNA 5D3MA 4ZPXA 2TMKA 4R98A 1W5SA 3CWZA 1KI9A 4BASA 2ANBA 4YQFA 5L3SA 4QKQA 1Z83A 4FD2A 4L9WA 2CL0X 5FOVA 4CGZA 4JLJA 3BS4A 3AM1A 5DI9A 1AKEA 1M6NA 2VP6A 4GP6A 1W7AA 4JYBA 2QG6A 1YU9A 3FHOA 5F3WB 4BEBA 4M53A 2WWWA 1NBME 4EFMA 1E2DA 2GNOA 1JBKA 1TMKA 2ZYTX 1E2JA 1MOZA 3GFTA 1S2MA 2Z5FA 4OI1A 1N0VC 4HSEA 1M2OB 3GJ7A 4MITA 3TW4A 4B2IA 1E79A 1NLYA 4D2IA 2F1JA 2ZS9A 4MUAA 3LBNA 3K70B 1E1QD 4N1AA 4HUQA 1IJEA 4X8HA 3CO5A 4FXPA 2W2XA 1GL6A 2YJTD 4R9UC 4C0LA 1OIVA 3RS4A 1AS0A 1GIAA 4YDHB 1YZLA 3FKSA 3SBEA 2ODEA 2IS4A 4QGHA 4KITB 3GLFB 2PJZA 2VTKA 3P32A 3ZVMA 1RVDA 2JLVA 2QPOA 1G1MA 2J0VA 3SEAA 3MWJA 1H8ED 1D2EA 3A4LA 4TWZA 4B3FX 1GRQA 1IN6A 2YHSA 1AIPA 1AM4D 2ZJ8A 4DUGD 1VG0B 3GP8A 4IOJA 4M21A 4CW7A 2C9OA 1S3SA 2Z43A 4AKEA 1OW3B 3GLGA 1D6JA 1EK0A 4F91B 2EW1A 3KFVA 1GNRA 2ZE7A 3AVQA 4POAA 1KI7A 5JSZA 1GWNA 2HXYA 3CRMA 1XB2A 3SHWA 3CWQA 3W6NA 4YMVA 1ZNZA 3D8BA 1P9NA 2XB4A 3K1JA 3MJRA 1Q21A 1OFHA 1T0JB 2H8KA 3RWOA 1WE2A 1CU1A 2QAGB 4W5WA 3VTKA 2AFIE 1KSJA 3EPJA 3UIEA 4XVUA 1VMAA 4UNSA 2DR3A 4KI0A 1E0SA 4P4TA 4Q7MB 3OHMA 5KDLA 3SFZA 4E09A 3ZLJA 4QNRA 2WPDA 3S1AA 3IIJA 1W4CA 4ZDWA 2QGNA 2Q6TA 4URYR 5K8LA 1MO5A 1RKBA 1OHHD 3OEED 5E95A 2C9CA 2J7PA 4DB4A 1UBFA 2IEYA 2ZIAA 4LJ4A 1JQLB 3LQQA 4FMDB 1WA5A 2WWIA 5KDOA 1T3SA 3KQLA 5BXQC 5JZVA 4EJSA 3IO3A 1CIPA 2XNSA 4ILEA 4UKDA 4C0JA 5J4HA 1VKJA 4QRHA 4OHYA 4ZCMA 5AR1A 3THWA 3EC1A 3QBVA 4GBMA 4L5BA 1MKYA 2IF2A 3QEJA 4FIDA 3BERA 4HAYA 1OKKA 4RD6A 3GFPA 1YZTA 3Q3JB 1NLZA 2VA8A 3JVUA 3GFOA 4C2TA 2HV8A 2BMDA 3KUDA 2CL6X 2XXAA 4XJXA 3K0EA 3O8DA 621PA 4XIGS 1R0ZA 3KXIA 1E98A 4LHYA 5EXSA 5L8VA 1BMFD 4C0HA 2CLCX 1NG9A 2WWXA 1QHYA 3BXZA 1RYHA 3AF0A 3NTUA 3ZQ6A 3CH4B 1KGDA 1J90A 2ZANA 3EIEA 4JVMA 4LJ9A 2WKQA 4NDZA 3CX7A 5EP4A 2GF9A 4RZXA 4LHXA 1FNNA 4A2QA 1Z0KA 1S96A 3R20A 1CJUC 3T5DA 2NPIA 3GJ0A 4FMCB 5JCZA 2Q21A 2G1KA 1VG8A 2WSMA 2IT1A 1GL7A 2DB3A 4LBVA 3AH8A 2J59A 4ZDIA 2B21A 3AB3A 2IL1A 2A5JA 4H1UA 2D7DA 1CBUA 1FZQA 1Z0IA 2OXCA 4LV8B 2F9MA 2BV3A 3UANA 3KDSE 1WB9A 1JR3D 5TY0A 3I72A 2ORIA 3MUFA 4Q1EA 1SHZA 4U00A 3FDIA 1C9KA 3WP0A 1D5CA 5CIWA 4RZUA 3B1ZA 4LPKA 4Q4HB 2KSQA 3T35A 2ZRDA 2O0HA 3KJEA 5BYJA 5JMTA 3VR4A 4L15A 1N0UA 4Z51A 1CKEA 1E1RA 4TSFD 3SBDA 1XMSA 1F5NA 4HLCA 1ZIPA 2PZGA 4RCZA 2ZE8A 3F5FA 1N6RA 3TK1A 4G5RA 3UMFA 4ZIRB 2ZI5A 2PH1A 1E9BA 5EE3A 2IYTA 1RRPA 2C9YA 2V4ZA 1RZ3A 4HB2A 2O0JA 5FPSA 1DAKA 2GZDA 3D3QA 3ONWA 3EPHA 1DEKA 3D31A 4Q1BA 4BZQA 1VG9B 4HB3A 1ZUNB 5GVSA 3LAWA 3PUXA 1WF3A 2RH5A 2VF7A 4MRVA 2H57A 2VIIA 3C15C 3DL0A 3N2IA 1C4OA 1NIPA 2QORA 2DFKB 4GP7A 5JHHB 2PEZA 3BGWA 4B3DA 3NVAA 1AKYA 3SQWA 4B75A 1CJKC 1KO8A 3GLIA 5J47A 3SJAA 3J81k 1BS1A 1OIXA 5EXTA 4PZYA 4HZUB 5SZHB 221PA 3MMPA 1TL7C 1XMIA 1AQUA 2ZRPA 1T4GA 2ZSAA 1CR2A 3RRNA 3LW7A 2BKEA 2G83A 2RGNC 4BLSA 1TF5A 2AHOA 1OXSC 3P4YA 3LBIA 4ESVA 3GQBA 3EC2A 4M22A 4BFUA 1QDEA 2P6NA 3FVQA 2EFEB 5KDDA 2VBCA 4BLRA 5FBVB 2ZI3A 3EZ9A 4BLPA 3WP1B 2AK2A 3KJIA 3LLUA 5TARA 2QTFA 3IILA 1KAOA 4HEJA 3MJHA 4MGIR 5J5CA 2NO0A 3CRRA 1E2NA 1YQTA 2FG5A 2PX3A 2XNDD 1PUIA 3PUWA 3CX8A 3AUXA 1AA9A 3CNLA 5DYIA 4DDTA 3H84A 4KBFA 1P60A 4QOSA 5GVRA 2ZAMA 3QE0A 1P2UA 2PBRA 2AN9A 2QRZA 4KU4A 4RD2A 4HATA 4DSOA 2O8FA 2ZSBA 2HCJB 4D4MA 1QHXA 1R7RA 3NC0C 4TT3D 3C5HA 4V0LA 4B74A 5KNBA 2R9VA 5ELXA 2ZXUA 6Q21A 5FBLB
chains in the Genus database with same CATH superfamily
1ORVA 4S1NA 3C3WA 4JP8A 4GEKA 3HN2A 1WXFA 5F9HA 1WXIA 4LRWA 2I8CA 4ARCA 1M73E 5FJJA 1MB3A 5DWQA 1EWTA 1U94A 1Y34E 2C4UA 2HIHA 2VHQA 1T8TA 3AR3A 3HY6A 1YBMA 4LJSA 3LA6A 4NYJR 1C14A 2YXNA 4O3MA 3TQOA 3TZ6A 1Z4IA 3BMXA 1XP5A 2AQKA 4Q12A 4F4IA 1QLJA 1E64A 1WW8A 1NM5C 3LLCA 3AT1A 4ODIA 4UZSA 1C2TA 4CQLA 1NC1A 2XA9A 3C7CB 4RPGA 4D9IA 5IM4F 3E70C 4P7KA 1G8SA 2YYZA 1CY4A 1K88A 1JQDA 4KRYA 4Z9AA 1UDRA 1H65A 4IWYA 5DNWA 3S55A 2J0UA 3RKRA 1P29A 4IUDS 4O2LA 2DWQA 5IXJA 2Y99A 4A0QA 3B48A 2P2ZA 2JLQA 1TJPB 4Y2SA 2XQGA 4A03A 1IUOA 1XU4A 1RJ9A 3AQ4A 4HNHA 3MVEA 4OI4A 4KK4A 4OHOA 2I2FA 1H6DA 1RS0A 2BR4A 2F1RA 2JLSA 3V8MA 3OCJA 3GH3A 4JJEA 4JMPA 3H7AA 1HT1E 1WDTA 2CFRA 2IHKA 2IEGA 3GPBA 3L4BC 2PQ0A 2WHYA 1VJGA 4V0NA 4L16A 2EJUA 5KZMB 3U26A 4E5VA 1KAQA 2VA9A 2HGSA 3PFIA 3ZHYA 4U3JB 4A1FA 4Y6OA 4HH1A 1LLFA 2H52A 4OLBA 3KZKA 4R9SA 5LP1A 3N7UA 5ICGA 3NTVA 2Y9PB 2HQ1A 5LQRA 3B6EA 4WL0A 3DOJA 1NXWA 1AY0A 1U7XA 3FDZA 4IUBS 4QDUA 3NUQA 4RKEA 4D8YA 5L4NA 4WBXC 2X3UA 1RFGE 3A1WA 5BW8A 1GSHA 5NLLA 1JE1A 1EHYA 4CE6A 4WXYB 5LU8A 1X0XA 4EK9A 2QYOA 4L8GA 2PKQO 2ZJYA 4DNPA 2E4UA 2WUVA 1W35A 2FWPA 4FB4A 1KOLA 4RHTA 3QWIA 5EMHA 1CUYA 3F8TA 3ZXYA 1PJBA 4Q6WA 4KXUA 3TSWA 3PXCX 5KQMA 1K6IA 1DRJA 2Z1DA 1YUNA 1TZKA 1V5GA 3HA7A 2NAPA 3IXLA 4HEA6 4JA2A 3TLGA 3X2SA 2NWQA 3BTUA 4BJ5A 1GTRA 4BN5A 3ZZ0A 5K6RA 1N1MA 2O2YA 5HEKA 3TEJA 4EM6A 2G3YA 2P78A 4PHGA 4WNIA 4YCMA 2VJYA 4UBLA 5DHSA 1R6DA 2QA5A 3LWNA 4A8JB 3WI7A 5ABPA 4B80A 4ZI7A 2JK0A 2FZKA 3ET4A 4PYRA 1GAEO 3D7MA 3LW8A 1JHDA 4IQ4A 2HY7A 1DKLA 4JWTA 2BGLA 1JP7A 2AMYA 1K7CA 4LDJA 3KM0A 4ZMRA 1P2BA 1E9VA 2Q0SA 3BMQA 5DYGA 1G59A 3PEYA 5GONA 1HK7A 4DADA 1E7SA 2F62A 3UW1A 4DNFA 4MULA 2OK7A 1SVSA 1DSSG 1TEVA 2WD8A 4JMLA 3VC3A 5A4FS 3IEMA 1MC5A 4JLOA 3WKEA 3ZQUA 4F2WA 4F6RA 5GIPE 4E09A 4LRSB 3M81A 4NYIR 4O4LB 2QSZA 3BXXA 1RE1A 4G0VA 1NZDA 3G5UA 4MKXA 2YV1A 3IEIA 4F3RA 1Z63A 3E7PA 3HBMA 1VJDA 3C3JA 4DLBA 1XTVA 1FS6A 2DULA 1GYQA 2QGZA 1YL7A 4OJNA 3MCZA 4OAQA 2JCBA 2GKGA 2HNAA 3PNPA 5EJ6A 2ZCUA 4UNNA 4Z8XA 3E0XA 1I10A 2I6TA 4NXMB 4HZIA 4TYYA 4HVCA 3CINA 3DJFA 1FK8A 1EP2B 3BH7A 5FOTA 1RWVA 2E7ZA 2C78A 2UZ0A 4GR5A 2FWJA 3BFJA 3O2QB 3LQRA 4Z3KA 2VH2A 1NBIA 3C43A 4FFNA 4BRUA 3OA2A 1YVPA 1O97C 2NTYC 3CRVA 4YNBA 3RF7A 3AU9A 3FYDA 2K87A 5GZ6A 1R0BA 2J48A 1SD1A 1R2QA 2QTMA 4COKA 4C1BA 1OXMA 1FMCA 2H9AA 3AIKA 3SQDA 2XUOA 3V97A 3ZV3A 1RKQA 3SVTA 1B8PA 4K86A 5INTA 5IX8A 4YCCA 3SOZA 3PD0A 3O8BA 3MWKA 4N9WA 3GLFA 4HAWA 3MCUA 5THKA 4DEVA 2XSZA 3UGQA 1ZC3A 1RQ7A 1N6HA 3CB4A 3MMSA 4O1MA 3UK1A 4A73A 3NJRA 2CUTA 4BEWA 1PHRA 1S01A 3AEUA 2O0KA 3BEOA 2BELA 4MO2A 2Y93A 3VC2A 2AD1A 2AOXA 5CB4B 2WE8A 1ZK1A 4K6KA 4RL4A 1K7EB 3L0PA 1QH1A 1CNMA 1I3OA 4U2BA 3DC2A 4ZVTA 2CXRA 3ZHUA 5E6RA 3ICOA 4CQNA 1ADYA 4PZCA 1W4BA 1TW3A 4BU1A 2VP9A 1OAOA 1VE6A 3GHHA 4BQOA 1KNXA 3BDVA 2HUNA 4LRQA 3VISA 2MU1A 3QXJA 4QFDA 3FG9A 1EVZA 1N6OA 3C8DA 4HT3B 1L7BA 1U8UA 3CUSA 3AETB 2GPWA 4PWZA 1KMHA 3E9YA 5HS6A 1Y98A 3A6GA 1DS6A 3QKWA 4HGOA 4NPCA 2C5EA 3MNFA 3PENA 5H4HA 4QBGB 5LXTB 3OZFA 3O4GA 3O0DA 2VCEA 2JVIA 1FYDA 1Y6QA 3DV2A 5KSOA 3DEYX 4AUMA 1XZNA 2Z04A 1L9KA 1ZNWA 2C82A 4HDKB 2R1TB 3HCDA 3VPGA 1D1SA 1J42A 4M98A 1JHUA 3SYRA 1ZCFA 1FDUA 3PUVA 4GU5A 1D4OA 3LQ1A 3N39C 4TROA 2WUGA 4Y0NA 1EWRA 1TMOA 1ZM2A 3BHIA 1TW2A 1H1TA 2GD2A 3M3HA 2EZ8A 1EVQA 1EFRD 2CUKA 1ZMOA 3P0RA 4IP0A 2LD4A 1N2EA 2HX1A 1W4ZA 3GCGA 1M33A 3SKVA 4RA6A 3PLNA 1ZDMA 1DLIA 1XEXA 2QTLA 1W5AA 2OOKA 2WILA 4OU5A 1VE9A 3VO2A 2O7NA 2VT2A 3UUFA 2P9HA 4NHEA 1ISPA 1RLIA 3V00A 3ECSA 5KOHA 3B2QA 4MYHA 4R5HA 1YB4A 2HHAA 2ZTMA 2YJZA 3A3NA 3KKNA 4IH4A 4PQGA 1Z2CA 4FSDA 3TVDA 3PCRB 3RTAA 2MYNA 5ALPA 4ZC8A 2A84A 4HDAA 1XEAA 3RIHA 2MMCA 3JWGA 4IY1A 3ADBA 2WM9B 3GPLA 1T24A 3P9RA 2DFTA 4QBHA 5JNRA 4TSRA 5K5EA 1UMCB 4L8LA 1MU0A 2W70A 9ABPA 4O2BA 1PNVA 4CUKA 1CRZA 4HYQA 2AOUB 3QIAA 2RGUA 1QZTA 2NZVG 1BA3A 4QUAA 1LVUA 2ANCA 3CX3A 4PGAA 3ZE1B 4C0SA 5JC8A 2OV1A 2ZAGA 2F8SA 5CD9A 4MQFB 3S29A 3GFFA 4J16C 4A5OA 4JXZA 3FXAA 4IV0A 1XAIA 2WFAA 3AG6A 4PAQA 2P69A 4L7QA 2V1XA 3E9CA 1NI5A 1G3QA 4MI3A 2HBYA 1YS6A 3ESCA 2NUPA 5F35A 2QLLA 2GEDA 3HKDB 3O4VA 3Q2OA 3R7SA 2VOJA 5C5IA 1NUTA 4TQGA 4B9AA 1FSZA 2XDYA 1WNTA 2B25A 2TMDA 4JL5A 1D03A 1N3LA 3FNRA 1TKBA 1K68A 5COBA 5KTYA 2IU3A 3ILVA 3EZ2A 1A77A 4YQZA 4A0FA 2IP2A 5KX5F 4RY0A 4WI1A 1AHPA 3KSAC 1RYDA 2PX5A 4OM8A 3ZVLA 3HGMA 3KBBA 4PYOA 1CE8A 1R15A 3H17A 3OTHA 1AUPA 4TKLA 4WDRA 2GAOA 3DOFA 2ONKA 3LCMA 4OHRA 4ZPJA 2IS6A 4L85A 1OHHA 4DA6A 1UDWA 5KJ1A 4TZ6A 2M1ZA 4FKMA 1Z26A 1NXTA 1WD5A 2PV7A 5CLIA 1X80A 3ETDA 3P9QA 1RXVA 4L6IA 5LLDA 4QQRA 1AGYA 4EL0A 2IXGA 3EG9A 2RG7A 1WAMA 2GCGA 3IAUA 3H9JA 2Y0DA 521PA 1YRLA 3QVWA 4TXNA 2AN1A 2CMGA 2AUTA 2HDNB 3NJ8A 5BSMA 4RANA 5F5LA 4EYEA 1MHTA 3NHRA 3PDIB 4HYEA 4HGZA 4RZ3A 3G59A 4ZOLF 2V8BA 3G85A 1BE1A 1ZUNA 4MMZB 4N6OA 4Y2JA 2ZDQA 3FKQA 5HILA 4B6GA 1Z75A 5LIRA 4M1OA 4RYDA 4G1MB 5LMCA 4N49A 4CU2A 2FSGA 4BKOA 5FWYA 3IEPA 5J63A 2ZVQX 3O2JA 4BFLA 1L4KA 4LBZA 3AVVA 1LPPA 2H18A 3FMFA 4CKWB 2G5CA 2Z5VA 2ECOA 1HEUA 3IHLA 2HT1A 3IVCA 3P2OA 1RT9A 1VP9A 5EUMA 4X62B 3RNOA 2QOEA 4WSOA 1GVHA 4DCJA 4JLMA 4X85A 3KR2A 1GKYA 2H5EA 2PZKA 3UKJA 1S5PA 1KI8A 4E31A 5BPHA 1XEWY 3CXRA 3K32A 5FTMA 1S1CA 1JQBA 3EHEA 2Z98A 4WZBB 3T6KA 2GFQA 4EPVA 1UBTS 1H22A 1M1XB 3T3PB 3QPBA 2DPGA 1J9ZA 1E2UA 2F6RA 2FE1A 2HRQA 2O2EA 4ID9A 4KVAA 4MWTA 4OY3A 1P72A 2EKPA 3L7CA 3V6MA 2QB5A 3KT0A 4ZCPA 2GVNA 3DR5A 1L1FA 4EABA 4URWR 5CH8A 3MIZA 3C45A 2J08A 2YNMA 3LQ4A 1OBVA 4OYYA 1BE0A 1LDMA 2A5YB 1VA5A 1W49A 3SSNA 2GK7A 1SIWA 2VAXA 3HVJA 2IHUA 5IJAA 1IHPA 3HCOA 1SUSA 4ZO4A 3W2FA 3T1HB 5HIJA 1EK2A 1W2WB 4C78A 4NG4A 4X6UA 3DA8A 4LYHA 5EMJA 5JS6A 3BSYA 2DLDA 3AWIA 2XRZA 4BZZA 4MUGA 5KCZA 2FPUA 1I3CA 1YBFA 2IY9A 1P7ZA 3CSDA 1S3FA 4PLFA 4CETA 2R1VA 5JYDA 4BFWA 1ZJ6A 5ALJA 3NBUA 4BBPA 1W76A 2B8JA 3DMDA 1OASA 5B3LA 4G8JA 2I6UA 5BT9A 3KKPA 2BRUA 2QEQA 2RGGA 2YVUA 3L9WA 3PEEA 3QUAA 3SHVA 4HHEA 4YCAA 1E3LA 2NSYA 1C0PA 1GTVA 1I4OA 1M1YE 2CHEA 2G1AA 2H63A 2PRJA 3AFHA 4NV3A 4A8HA 1S1MA 1EGVB 4BRWA 1Y3IA 1U9CA 3TJMA 2X3YA 1GNSA 3U5ZB 3QOFA 5AP9A 1JSLA 4LECA 3P5SA 3UG7A 4RMJA 1K7XB 2H9IA 1GPDG 3I6BA 3ND6A 4E03A 4MUMA 3JWEA 3A06A 3M4NA 4RIGA 1UODA 3ONVA 3GAMA 1U8TA 5CA1A 4FWBA 2YZNA 3KOWA 2X6RA 4RVHA 2DPYA 4YJHB 4ZHQF 1HE5A 3ZY5A 4G8DA 3IUNA 2G9NA 1TUBA 5FNVB 3EXHA 2IOFK 1U7OA 5B6PA 1EIWA 4JCCA 1NE2A 5DLPA 1Y82A 1L4MA 3CNEA 4LJYA 3OTWA 3WSWA 3PDJA 3L7LA 5H70A 5BQOA 3IRVA 1ACLA 1CTQA 5ALNA 2W6CX 3K1AA 3QKRB 4D8VA 3Q7IA 3OH8A 4CODB 4N54A 2VF4X 3KDAA 1ONPA 4WOPA 3AUFA 3RS0A 4DA4A 1ZN7A 1HTWA 3RYTC 1MJHA 2VKTA 5K4AA 2V6MA 4XGRA 1Q20A 4RHUA 5LQSA 2UUPA 1OLXA 1EX7A 1NRJB 1XFDA 5HJ2A 3OLQA 3RSGA 2G9VA 2HWWA 3EF0A 5AI6A 1W73A 5E4FA 2ZIZA 1P2FA 1LBHA 2BMAA 4GM0A 3T3GA 1EKXA 1NLUA 3K71B 3TUIC 2A7XA 1A88A 1S02A 1SK9A 2IHTA 5E3JA 2QLTA 2PJDA 4LK3A 1NI4B 1T4CA 1RYFA 4Q66C 1QSGA 1ARZA 4XVQA 1VHDA 3MWFA 5SYNA 1SOUA 3LHDA 4G5GA 4UUAA 1J8YF 3EG5A 4I19A 4XEHA 4KE7A 3EA4A 3W9UA 1FVHA 1KH3A 3HE3A 4B81A 1IEXA 1G8AA 3LPLA 4UXJA 5KNLA 1YK1A 3I5XA 2Y2VA 5CA0F 4H4DA 1NFRA 4CM8A 1DKQA 4W99A 1BVYF 4PIVA 2WMNB 3G2LA 3NHPA 4E5KA 4V2UA 2IYPA 4NR0A 4KSBA 4KI7A 1GYRA 1V1JA 3E05A 1X7HA 4R51A 1VHWA 1KK2A 2PUBA 3H8WA 1YVUA 2NYAA 1FRNA 1N3IA 4HEQA 1GUDA 4KO3S 3RRMA 1ORRA 2YRWA 1RP7A 3W1VA 4EW3A 1GGFA 5CU7A 3LXUX 4LMAA 1EFDN 4C29A 4Q15A 5LIPA 1Y4SA 4TMXA 1NR7A 1V1MA 5KYUA 2JKZA 3NBZC 4LNAA 2DSTA 2C03A 1JQJC 3Q9SA 2H4JA 3WK4A 1IY0A 2ZAYA 3LKZA 4OKIA 2PZAA 3UJDA 3AWDA 1BXGB 3CBQA 5THXA 1A96A 4B44A 6LDHA 4RW0A 2WG0A 2ZSKA 2F43B 4UFPA 1OXUA 2C00A 4IDNA 4FM9A 1ZR4A 4JEHA 1MB9A 1NKSA 3GU3A 3JQGB 4F3KA 4LDPA 2FEXA 4I5EA 5FBKA 1T2FA 4FBLA 2FK7A 5ED0A 1VL6A 2XUQA 2MR6A 1V16A 5F2NA 1QGZA 1VIVA 2H1HA 4YRGA 4WLFA 5CG1A 4NOKA 1UPBA 1XNHA 3LRTA 2C2ZA 1OX4B 1O03A 1JL3A 1KDYA 1Z0ZA 1O0BA 1YAJA 3F90A 4L0CA 3TKYA 4QBTA 1FNMA 1TK3A 1AF7A 1WQ3A 3FGZA 4A1OA 1B15A 4DNXA 1HA3A 2ZQYA 2XMGA 3JAKA 4R40A 4OO3A 3VNBA 4MYTA 4HVTA 3IPXA 3NU1A 1WDKA 4JGIA 5A2GA 5BN5A 2UYGA 5NULA 5CCBA 1FXWA 3AUSA 5IJ9B 2CYCA 1DIAA 5C8XA 2ONZA 1M5TA 1G6HA 2YVKA 1DIOB 4FYIA 5JO9A 2Q6VA 1E1NA 4GE0A 2PQ2A 1B3BA 3S2FA 1R00A 4IJ5A 3WX0A 4PG6A 2ACVA 4J8PA 1DFGA 1KDPA 2VEOA 2LE0A 2VP5A 3FYUA 4HL6A 3GB9A 2ET6A 1MX3A 4YRFA 3V6LA 4Q48A 3NKLA 4IIBA 2ZBUA 2OBNA 1CUJA 1YJBA 4EFKA 1PNRA 3OJEA 2WHRA 1UANA 2ILVA 1CDEA 2AUNA 2Z9CA 5FOSA 1BYIA 3DM5A 2GESA 3UO8B 3QHPA 3L7YA 2QVLA 5LFAA 1C9JA 2XE7A 3H9EO 1GG2A 1N5OX 3EFBA 3OEHA 5G0UA 2A1IA 2OGSA 5BW5A 1E89A 1VSVA 5DGCA 3W4KA 3PEWA 5JPCA 3UUWA 2WC1A 1DMRA 2WIAA 1BE8A 4FDTA 3GV0A 1LPBB 1G55A 2CUZA 5D51S 3U3XA 3NHSA 1M1NB 1BS9A 3RFUA 1J1IA 2OORC 2JHPA 2QW0X 3H18A 1V9CA 1NMSA 3OO1A 5F5NA 2NO9A 2B37A 2VNIA 3I73A 2ZIWB 1KY4A 5FAKA 2XUHA 2HC9A 1DKUA 1GUAA 4FCCA 3GZTB 2CEAA 3QZUA 3DMYA 3OHPA 3QU5A 1KRXA 1EZ4A 1G5PA 4FMPA 5ANRB 1NP6A 2YHUA 2YIVX 4B71A 4D92A 3DEIA 3RVMA 3ILXA 1W34A 4FEAA 4E3WA 2AMJA 4LJ8A 4N0DA 5KNDH 1JEYB 2A9PA 5I7AA 4N7MA 1VL1A 2QIPA 1VE1A 1Z8HA 2XAAA 3SQLA 3R24A 2QP4A 1X8XA 1MFZA 5EA2A 2Y4OA 2QTVB 1GFWA 4JIMA 4LWPA 1QIJA 1OT3A 4HVAA 1LB1B 3L6RA 3HJHA 2FOXA 1DAOA 2BFWA 2BR3A 2GXSA 2VRBA 4IZHA 4BP8A 4YV0A 1N4DA 2YIJA 3LUBA 2C7BA 3QEOA 4FQ7A 4OH1A 1HFEL 3F4LA 3VOAA 3RRBA 4GWLA 2D8MA 2WF9A 5HFAA 4DREA 4MHTA 1U5CA 2JFWA 3EDOA 4EF5A 1TQHA 1U7UA 5CVJA 3UCFA 5KKCA 3C70A 2VDPB 3SNKA 5KHLB 3UEOA 4JUDX 1SD2A 5GIOE 4ZVSA 1P80A 4G4GA 2PH5A 3UJCA 5FBHA 5MDHA 3WWEA 3HUEA 3GT0A 4HWGA 1AXRA 1XA0A 4P1ZA 3VC7A 4D6PA 4DLKA 3QBDA 2R4QA 4JJKA 5G0WA 4E6EA 1E5XA 5JS8A 4YUZA 2ILTA 4UHJA 2DHQA 1FFAA 1NLMA 2HA3A 2JHAA 5FR1A 3P2MA 3BF7A 4M76B 4KGXA 3ZIDA 1GG9A 1R6UA 1TLLA 1KR5A 3LBFA 10MHA 1NM5A 4BHTA 3KZVA 2GCNA 3ROXA 1YQXA 4C14A 3EXEA 5E6UB 3E2MA 2G4LA 3OFJA 3V7WA 4QSHA 1VJTA 3JQFA 3KYCA 4ARZA 2AB0A 4A15A 3QE9Y 1GCOA 3GP5A 4X1IB 1IG0A 3M82A 2X76A 3WO0A 4F04A 1DX4A 4MUEA 3T06B 2VNHA 2DT8A 1ST3A 1APBA 1P7WA 3B7WA 3T1VA 3LUDA 1K27A 3NPMA 2CY0A 1N2BA 1ISSA 3QU9A 3L7MA 4BUJA 5LWQA 2YN4A 4G1EB 4P35A 3L4BA 2HADA 4OG2A 4BNFA 1TJ4A 1NU6A 4D8UA 4TVKA 4JI0B 4CVNA 1MJFA 2FI1A 2W6ID 4UQOA 4ZYUA 3INNA 5EP1A 2JAUA 3G68A 1W0KD 2OL4A 1EMDA 4M9ZA 4ND8B 4B3IA 2FLKA 3NRJA 1F12A 4MKGA 1JJBA 1NVXQ 4AZVA 3ZNNA 1CZRA 2WTBA 4B73A 4D9CA 1MRZA 2KBEA 4EG1A 4IDQA 4MRMB 5HSGA 1DT5A 1KI3A 2H4XA 3K9BA 4IW3B 2C5SA 5ICSA 2IUYA 3EZLA 3LP8A 1YRQA 4YJGA 3UZUA 1U8EA 5B2ZA 4J1TA 3ZS8A 5SY6A 3E18A 1SVKA 3O21A 2WJJA 4G97A 3RS9A 3ZXUB 4F3YA 2WHEA 1BGXT 2BFAA 4H6VA 2DPMA 4EB3A 2CDNA 4GKBA 1EFRA 1P3DA 3Q8WA 4E0BA 2FN3A 3K5WA 1UT6A 5DP1A 3W90A 3A9UA 2IW3A 5K8JB 4JY7A 1OGYA 2JFZA 4XFDA 1W93A 4M89A 3DF9A 3Q1LA 1XKTA 2B0CA 3HSSA 4QQKA 1OWNA 4KLRA 2JI6A 3M89A 1Z4QA 1HLDA 1ZLXA 3MQ2A 1HR0B 1NSYA 1NT4A 1X7WA 1Y8RA 3S2GA 4BO4A 3P4XA 1KJ9A 4BZPA 3D8SA 3PITA 3A9WA 4WXEA 1NN3A 2YQ4A 4X3OA 5HKBA 1GPAA 4K7JA 1I3KA 2PCLA 3DL7A 4D3ZA 5E8RA 1VLLA 1QE0A 1PW5A 1EVKA 1UKYA 3A27A 4GE3A 2Y1KA 4F9EA 1E9DA 2V7QD 1M1ZA 2QT1A 3MAGA 4LI3X 4PO3X 4N47A 3LV8A 1E6UA 2UVPB 3DPIA 2DU8A 4E94A 3D2BA 4KQ6A 3MILA 5AJVB 4EUEA 3U44A 3HBNA 5JS1A 2PYIA 1P4RA 2G80A 4ABYA 4C0KA 1FLVA 4NYMQ 5JCOC 3SF8A 1UXKA 1WDLA 2W48A 1HDGO 1ODTC 3UJPA 2VK8A 5AVRA 2GERA 1Y3FE 3RAGA 2XF2A 1YVRA 4BV3A 4Z7NB 1BGWA 1ESEA 1T6XA 3F6CA 3NUGA 4TKZA 1NONA 3JAWB 2R3SA 3LYUA 1NUSA 5LCXA 2BFDA 3HXPA 1GQFA 1UCFA 3R3VA 3E8MA 3THSA 4KDRA 4AQ7A 4GOMD 1GDTA 3I1YA 3GMSA 3OJ0A 5HCNA 2J7KA 4BV8A 1AV6A 4RD4A 5LVAA 1KU6A 4ER5A 4OF4A 4KBYA 3RK0A 4YT4A 4ALLA 3DHWC 1T2EA 2RGEA 5EYPA 3G1TA 3WLJA 2OXEA 1U8YA 2CB0A 4M0MA 4TTAA 3VPHA 3CO0S 4O0LA 3VOBA 4CI0B 5TF4A 5KO2A 3AW8A 2JFFA 3ML1A 5AVZA 5H0IA 1TKCA 1V9LA 4ZREA 2JVJA 1ZH4A 2C3YA 2ID4A 4IIUA 4J1QA 1OWMA 1PL0A 1O5IA 1Y3BE 3TRDA 3VMFA 2WF5A 3DMNA 1G3IA 1I3MA 1L7MA 2Q4TA 4LX0A 5F64A 1IHOA 3LCJA 2FPOA 4K9RA 4NPHA 1IMOA 2Q3JA 4RA9B 4PYJA 4CWAA 1TKRA 5CAEA 5CDGA 1RADA 4C5AA 5LBUA 4ENSA 1J1UA 4AYWA 1SU8A 2X8BA 2JLCA 4IQGA 2D4HA 3UOAB 3IDAA 4D8WA 4TX1A 2GBPA 4DRXB 2C92A 4HWPA 5CYFA 4ZAVA 4WHMA 1QX3A 2Z0MA 3V8RA 4W9NA 1JB9A 4BTVA 1OLUA 2Z58A 1G8FA 3M1IA 4H3KB 1WV0A 5C52B 1XTJA 3D3WA 4YRRA 3RLIA 5C7YA 2EDAA 4L1KA 4Q3NA 4E70A 2O3QA 4CMCA 1G98A 4Q3LA 1F0KA 5FIUA 3A3OA 3F0TA 5EHNA 1Z2OX 3ZE0B 2K2QB 4X92A 4XGKA 3U49A 3V7NA 1MD9A 3ZY4A 3DE2X 3RUDA 5J3JA 3LGXA 3VNVA 4L2IB 3SC2B 4IV5A 5B3JC 5HF9A 5KU1A 1QQTA 4DZZA 3K09C 2PYDA 5JAOA 1Z33A 2B2CA 2FOLA 3BIXA 2NU6B 2C2GA 5FEUA 4LRXA 3RSHA 4Q0MA 3SU8A 3OCVA 1FP4B 1R0SA 2JGFA 3EBOA 5LD2C 1OFVA 1Z5WA 2GO1A 3N0WA 2EQBA 1WMFA 1RRKA 3NJ4A 2O8DA 1FQWA 2XUDA 1H2BA 1P9RA 4MUKA 2BYTA 2FSUA 4AVYA 2V96A 3H6GA 2DMRA 1CD5A 5KTNA 2AI1A 2J8ZA 1X1EA 4BB9A 1JHMA 1L2TA 1X1RA 3BL6A 3JR3A 1UOQA 3NDIA 1A8QA 3OY7A 4J2OA 1N0IA 1GV1A 4L75A 2WV9A 1CG6A 4EI9A 2UU9B 1QTQA 3KZOA 5IK2D 3CJTA 4LCJA 2IC5A 2J9FB 5JQWA 1TYCA 3DNPA 3G0OA 3CGGA 4KQ9A 4LF6B 3GR6A 2L0XA 2OT3B 4FJ1A 5LLSA 2ZJ7A 4BO3A 4HEA1 3D3NA 3ESXA 4FYPA 2WHQA 3BTVA 3DHVA 3DP9A 3KAKA 2NAFA 1XYVA 1LBIA 5DCUA 1ZD1A 2EKZA 4YRLA 2FWIA 2RK6A 3COYA 4ZODA 2FY8A 3EFOB 4FR0A 3UF0A 1THZA 1W30A 4U2EA 1Z29A 3LFUA 2ZWOA 5KQGA 3OQ6A 3UAYA 1KPHA 3QVMA 3BF8A 4KGZA 5GAJA 1YXMA 5CDFE 1YT5A 2ATXA 2WT8A 3ENNA 1L7RA 5ER6A 1ZH8A 5DV9A 5EJ7A 2QQ5A 2WIJA 4O4JB 4S1PA 1ONBA 2BZSA 1E9CA 3QHQA 4MLZA 4CKZA 5K0TA 2Z2IA 3PQ3A 4JBWA 4DLPA 4WJLA 5JJ5A 5L40A 4B8ZA 4J16A 1O6CA 3VA7A 5JVDA 3AVYA 4K6CA 4ASUD 4NHOA 4RDCA 3BHMA 3BMNB 3W5HA 1W4AA 3GJXC 2FPSA 1HBJA 1TYAE 2A9KA 2F2TA 2OR3A 3BRSA 4OQPA 2BEVA 2P8SA 3O74A 5FWAA 5H16A 3I4FA 3K1TA 5REQA 3V2UA 1ADBA 1D1PA 4GSYA 2HRBA 4PSUA 5CLQA 2ZP1A 2GN4A 3WLPA 4EQZA 4ENWA 3EPKA 3HU3A 1K63A 5TMBA 3MB5A 1Q15A 3ASYA 1R8QA 1WVGA 1BEUB 1GDHA 5JS2A 1O54A 3BKWA 4OMUA 2CXUA 1PSWA 2CLEB 4BBJA 1Z7EA 1TIBA 3VU8A 5IJXA 2FEOA 2JNWA 2JD0A 2DY1A 4BIIA 2P3LA 4MVJH 4C2AA 2CNDA 3WWZA 5LOVA 3ZD9A 2ONYA 2NOAA 1FDTA 1M74A 2B35A 5F33A 3OZBA 4U02A 1F2UB 3OCUA 3R23A 3R7AA 4HNUA 5D7NA 4HFJA 3HJFA 4IJKA 3CW2A 3M9WA 1AQLA 4TZ0A 3NORA 5MFZA 3UK6A 3A6PC 1LLCA 1Z15A 1ZOPA 5FYQA 5AUNB 4HWOA 1DC8A 2QRNA 5CYPA 1P1IA 2BKLA 2XTMA 3B1YA 4MQEB 2G28A 2NZYA 1E1YA 2FFJA 3LC0A 2QUZA 4KKXB 1ISFA 2XMSA 2A5LA 2J30A 4QU5A 1ZN8A 3EVDA 4RLHA 3SEZA 4XX1A 1O5OA 3L1UA 3I12A 1T8PA 2YRFA 4F96A 3VVBA 5A4KA 2OSBA 3TI9A 2JJQA 4Z49A 2J3QA 4TV8F 4ZI2A 4FHFA 4QYXA 5EIHA 5KVAA 2I4TA 2WOOA 5B5SA 2HWYA 1E7QA 2PS1A 1EXVA 1OLSB 1KDRA 5JXGA 1SUWA 4H4CA 2LIPA 3T7IA 1I7QB 2OZKA 5CCXA 2AVNA 3P0FA 3OZXA 4MUIA 4NU8X 3THRA 3ETEA 3KSUA 2PH3A 1HEIA 3DD1A 3P0JA 3ZV7A 2P9ZA 4EMUA 3O3OB 2GBFA 2IZ1A 5ES3A 5DM0A 3K6RA 1B4DA 3I1JA 4LOJA 4BX3A 1QOQB 2EKDA 3UJAA 1FDOA 5MGNA 3I64A 5BSEA 3L79A 4L5AA 4BNDA 3REOA 3LY9A 4FDAA 5FPYA 3MBIA 3Q8MA 4Y1RB 4XE5A 1KI2A 1SCAA 1JJAA 3ACBA 2W83A 3H65A 1S8AA 2WZDA 5JBNA 1B0PA 4QDJA 4ERNA 4MVJG 4ZANA 4CKBA 1WUJS 1JXOA 4KSCA 2R4TA 3MD0A 2JL1A 5KC9A 2XDAA 1VRCA 3TOXA 1JQEA 2HZBA 4MKRA 1S6YA 4YUXA 3AJEA 3R5XA 4PHTA 1G20A 3W2HA 1XK7A 3EEFA 2WM2A 4XVRA 4Y2XA 5CB6A 2Q9BA 3OLXA 4OQDA 4LY6A 4U9IS 3UHPA 4Q7JB 1OBFO 4K1LA 1P0IA 1WM1A 1UFKA 3AVUA 1GA6A 1PG5A 1N36B 4YRAA 3IJ5A 3LBYA 3QMPA 3OQHA 2CXPA 4RAQA 4DARA 2J41A 4L51A 1Y33E 2AZ4A 4I1RA 2Y27A 2IHZA 5DCYA 3LZCA 4J6FA 3VHXB 4I50B 1XXHA 2D74A 4EHFA 4P22A 5LYYA 3RG8A 2BFNA 2X2EA 4OB7A 1RTKA 3U19A 4EMSA 5I7HA 1JKIA 5EMKA 3TG8A 3U60B 2E4VA 2O2DA 2VAPA 2XLBA 3MS2A 4TMWA 5LZ5A 2VI5A 4WN3A 3BWEA 2XGJA 4DLRA 5EZ5A 2RGCA 4I4IA 4LBWA 2RGDA 4F4DA 1O5TA 3R44A 4JA0A 4LNHA 4NMWA 4HDNA 1RMTA 2HWXA 1FRZA 4ONEA 2FG6C 3RAPR 4ML3A 2FV8A 1EUCB 3BXOA 1GJRA 5ALHA 2VPXA 3O95A 2Q4EA 3F7OA 3GJ4A 3IBSA 4MIKA 2GD1O 4WUTA 4AFNA 1FDWA 4LYEA 4OJMX 3VO9A 1YR3A 3GH1A 3H11B 4NFLA 3W2EA 4C22A 1NQWA 2HNBA 3N7AA 1DAPA 1RAAA 1H93A 2VYND 3H05A 3OLZA 3LA8A 4XJVA 4Y2PA 4IX1A 2HFKA 1IPHA 1C9DB 4W7HA 5LA6B 5BWNA 2IXDA 3IT0A 4QUIA 4COOA 4KPEC 2DQKA 2C58A 3IOCA 1QKJA 5EIOA 2W22A 4IIGA 1AMNA 1XMJA 1GT6A 4LPSA 2H54A 3W06A 3QEBZ 1NF3A 3S8YA 3KKKA 4O2AF 2DUUA 1IY8A 1K86A 1MO4A 1NW5A 1S8OA 3DTVB 3MTBA 1RLMA 2IJGX 4H7HA 3CM0A 3HJNA 1V11A 5CIQA 5BW6B 1ECCA 4KKVA 2V8OA 1GUFA 4K2HA 3VRHA 4HX5A 1KHTA 2YHBA 2HNKA 4ILKA 4JJ7A 3RYFA 1UBNA 3KQHA 2JA2A 2GBLC 1QUEA 1RHUA 1VRWA 2ZJ5A 3JD4A 3Q5DA 2AFRA 3PBKA 2ZXFA 3O92A 1IQ0A 2GZHA 4IOMA 4KFTA 1XTRA 2Z5LA 5E8JA 2ZRLA 3AB8A 3WRXC 4Z7OB 5IAAA 1AHNA 1H2XA 4O2RA 2XNHA 2PV0A 5IKMA 5A7GA 2W6MA 3U2QA 1G8HA 1I6MA 5HZHA 1KZYC 2I7CA 4Z0NA 3BHJA 2VJLA 1J20A 2GZRA 5FD8A 1N2HA 3HM2A 2DAPA 5DTEA 4J3JA 3SQMA 4DCCA 3OZTA 1QCCA 5BN4A 3A9CA 5B7NA 1TM3E 2YHIB 1QS0A 3L1HA 2FPIB 2J6BA 3S0JA 3FSGD 2CVQA 2IK8A 4D3FA 4ON9A 3K9GA 5FDFA 1M0TA 2I9PA 1L4FA 4MAMA 4YJFA 5KCMA 4LXGA 1ID1A 1NWHA 3DBIA 3PR3A 4RGYA 1ZG3A 3JS5A 2JARA 1Z07A 2XE4A 1WXWA 2MSEB 3TX6A 1KAGA 1ECJA 3CKYA 3N5CA 1UC5B 1H85A 4Y1EA 5AFSA 2RHDA 1F2TB 1F0YA 3HYRA 3RV4A 1SKYE 2V7GA 4J0EA 1XTTA 4GPD1 1NQ5A 4IIJB 5F3RA 1WHTB 2BONA 2BI8A 3P8ZA 1ZIOA 3OICA 4X5OA 4RJKA 1A9OA 2RHJA 3Q6IA 4NATA 3ZNOA 1UKVY 5F51A 4HPWA 2G88A 1JAYA 2H9YA 4EYKA 2H1LA 3VOSA 4TTRA 1IN5A 1V1RA 3D8UA 1KWKA 1DO2A 1SG9A 1PG2A 1JU9A 2EWWA 2F7SA 2GAFA 4G0MA 1DRVA 3U1VA 2PX4A 3EY4A 3R3UA 5E1BA 4LG1A 1FQJA 1U0RA 1W2GA 2W90A 4HP8A 4DM3A 5EC8A 2YINC 1KR2A 5D6NA 4XSHA 6REQA 1L9XA 1LFAA 3GRAA 3AR6A 5JOQA 1W36B 1DKRA 1AVTA 3ELUA 3A9VA 3IP3A 2RJ3A 3GRFA 5IYZA 4MICA 2Z57A 5FEMA 4DW8A 421PA 1B1AA 1TLTA 4UVEA 4AAYA 1TGVA 3CX6A 5CBPB 1GGJA 1NSFA 5AVOA 4GPEA 1JA0A 1U1GA 2P9GA 2JVKA 2W6IA 1Q0TA 4Q4JB 2LR0A 3DFKA 1Q0SA 2AT1A 1I51A 1TVMA 1NBMD 1W0KA 1YNSA 1ECLA 2KQUA 2GAAA 3O84A 4IRUB 4M46A 1UAYA 1J21A 1IHUA 4WCFB 4PFKA 2WD7B 4ZGGA 4U7DA 2O6LA 1V41E 4JLBA 4EFNA 2Y4NA 5JAMA 2ZRFA 2WA1A 5J2UF 2X8AA 3EX7C 3F5SA 1VZ3A 2HREA 4KLZA 5D87A 3NVDA 5AJUA 5ENZA 5AXAA 5GPBA 5HUJA 1USGA 4ZT2A 5KWJA 1EUDA 4J91A 3ZX5A 4IILA 4QOIA 1DDIA 3VPCA 5DJ5A 2IP4A 3OIWA 4B6FA 4CQMD 4KXWA 3BMOB 1PGPA 2H4WA 2QG9A 4OD0A 2OHGA 4OOEA 3G79A 2FCAA 1MF7A 1HOXA 3QA9A 5C1IA 3MA0A 1I7PA 4DPMA 4KXQA 2PGOA 1QG6A 1CZHA 1CJBA 2ACKA 2FW6A 3C2QA 1C3LA 3GLHB 3MPUA 2R6JA 2SICE 5C35A 1TVCA 1VFPA 3FETA 1Y7TA 1Z3CA 3AJRA 4OEHA 2I03A 5DH9A 3UJHA 1O9HA 3PZBA