1CR2A

Crystal structure of the helicase domain of the gene 4 protein of bacteriophage t7: complex with datp
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
277
structure length
239
Chain Sequence
b'MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKSGALRQLSDTIIALERNNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA PRIMASE/HELICASE
molecule tags Transferase
source organism Enterobacteria phage t7
publication title Crystal structure of the helicase domain from the replicative helicase-primase of bacteriophage T7.
pubmed doi rcsb
total genus 75
structure length 239
sequence length 277
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cr2A00
4WAUA 3N2EA 1G7RA 3ZLJA 3LXXA 4GP6A 4GL2A 2WJGA 1N2CE 2JLUA 3CH4B 1DAFA 2FGKA 2OCAA 3C4JA 4PC6A 3O8DA 4PQFA 5FH9A 1NNEA 3I62A 2EYQA 5CYOA 4UNSA 5FR1A 4B3XA 1FUKA 2B7BA 3TVTA 4V03A 4Q9IA 1KO8A 3OFND 2WJIA 3GEHA 4C0QC 4QC2A 4F93B 3BFXA 1TF7A 1NBMA 5JWHA 4Q01A 2QUZA 1ZU4A 2QORA 1OT3A 3WNCA 2YOFA 3U3OA 2P67A 4DUGA 3CPEA 2DFKB 2OM2A 3ND9A 4D4JA 3NEYA 3K9LA 4ABYA 3C5CA 1WBBA 4NMMA 5FTMA 4NKRA 2QM8A 3B1VA 4A0GA 2CNWA 5HCIA 4DRZA 2X19A 1GVNB 4D0GA 3WBJA 3P20A 1ZNWA 2XAUA 3A1WA 2F43B 3TKLA 2IEYA 4JYCA 4S35A 3A58B 1Q57A 3NKVA 1E96A 3KX2A 1OFHA 1OXSC 1XEFA 2QTVB 4RKEA 2PT7A 4A2QA 2JEOA 2Z4SA 5J4VA 2D7DA 2RHDA 1E1QD 1XD9A 2WIBA 4Y0VA 3GLFA 2J45A 2ZR9A 4XD7A 1M7GA 4ESHA 1W5SA 4JBYA 4PPNA 2O8DA 1WMSA 1E2NA 521PA 1OXXK 2ZUBA 4EJSA 1IHUA 5HR5A 2P6NA 1S2MA 4HZUA 3B6EA 1N6IA 4KLZA 5FOVA 2FZ4A 3SU8A 5J4KA 2OV2A 2DWPA 1VMAA 2ODWA 4KSBA 4ZO4A 1VG1A 4C7OA 1CLUA 2FSGA 4WIAA 3PUYA 4TSFA 1T5IA 4DZZA 1UKYA 2BMDA 2BV3A 2Z5FA 1QG2A 3Q5DA 3GLGE 2ZI9A 2ZJ8A 3THWB 1Z83A 2C96A 2KBFA 3PUZA 1E2DA 1JXOA 2RGXA 3QPUA 2R6FA 4YC7A 5DISB 3NH6A 2OBMA 4OHVA 3FGNA 3CO5A 2QPAA 4WZAE 2PZEA 1LB1B 3IPXA 2C9OA 2YWFA 4Z51A 4QOSA 5KHOC 2NZJA 5GVRA 4OK3A 5G53C 1W5TA 2YHSA 3VTKA 4F92B 3VKHA 4RCYA 2O0HA 3SJBA 4B74A 4LBWA 4PC7A 2JJ1D 3U7HB 3FFAA 2AWOA 2J0VA 1T0HB 2ZJYA 2CLDX 3W90A 1N6HA 1M7BA 3U7GA 2ZR0A 2IF2A 5E7MA 3B7GA 4XIGS 3A37A 1EX7A 1IN7A 3MLEA 1E98A 3PUVA 4KITB 2KJQA 1AM4D 1I2DA 3AP1A 3EG5A 3TUIC 3EWAA 4ZIRA 2IS4A 2PLRA 2WOJA 4QFMA 4ZPXA 1KK2A 1LW7A 2VHQA 3RVBA 1GL6A 5J4LA 2HUPA 2GZAA 3MFYA 5IDVA 1JPNA 1Q1BA 5JSZA 1GILA 2OE2A 1G17A 5FI1B 3BFKA 2V54A 2OLJA 3MGCA 4BLPA 5KNBA 1AQUA 2AWNA 4W5HA 4A0FA 4PSAA 1UAAA 4Q9JA 1J99A 2P65A 2AR7A 2P6UA 2VRWA 5DHFA 3LBHA 4ERNA 2ZYTX 2GCNA 1N6KA 1Z0AA 1S0UA 3ND8A 3QKUA 3W34A 1FFHA 1VG8A 3UIEA 3NTUA 3NBYC 3A1VA 2V6IA 1DS6A 1KZ7B 1CRPA 1H8ED 4JLAA 5FL7A 3EPJA 4WZ6A 4XWAA 4FW9A 2DB3A 2GEDA 4NPHA 4KI0A 4CIDA 3QF7A 2GAOA 3LAWA 5FTJA 1GDDA 3KXKA 1S9DA 1SXJD 2AHOA 3HWSA 4YMTA 1J2JA 1HQYE 2ZSEA 3OAAD 2ODBA 2VHUA 3OAAA 4LC1A 4PHFA 3CW2A 3H2YA 3W5JA 2BEKA 2OCYC 4C30A 1DO2A 4D6PA 3G5UA 4WW0A 3SFZA 1XF9A 5FUWA 4TT3D 1R4AA 5E3HA 2JASA 4NCJA 3BXZA 1AK2A 1JR3D 1ZNXA 1SULA 2ZJOA 2A5FA 4CRWB 4EPVA 3T34A 1RYFA 4FWTA 5GJWC 2G3YA 2IUUA 3ECCA 1NN5A 3CIOA 4G1UC 1JAIA 4DT1A 1E2GA 1HEIA 1GRNA 2A2ZA 2IA5A 3MD0A 2RGGA 5AR1A 1KSFX 2C9YA 2KI5A 3AKYA 4BASA 4TMWA 1OF1A 4UJ3A 3VFDA 3ZH9B 4ZDJA 5AJYA 1ZIOA 2IHBA 4M1SA 3THWA 1RZ3A 2JJ2D 2REOA 3THOA 1ANKA 4PSVA 3LW8A 5FOSA 3FMIA 4KHZA 2ZE7A 1MO5A 4LJ5A 4Q66C 4D0LB 1AA9A 2JIZA 3P4XA 2WMOB 4TLBA 3Q72A 1NKSA 1UBCA 2WJHA 1P2SA 1P60A 1XTKA 2FSFA 5KSYA 2BKEA 2FGJA 1ZIPA 3TQCA 3LBNA 2A5DA 2D06A 3BC1A 4IJMA 1C1YA 3QIAA 3C16C 5BW8A 1E2PA 2BJVA 3K09A 1CR2A 2CE7A 3PEYA 1KMQA 1P2VA 5B58C 2G9NA 3D3QA 3KJIA 4R98A 1II9A 1T8TA 2Q6TA 4BGDA 2OO7A 2F9MA 1E9BA 3A1TA 2F7SA 2LKCA 4HLUC 2O8BB 1MV5A 1GM5A 4F4CA 1MT0A 1KSHA 1O3YA 2IBMA 3CX6A 4YQFA 3UMRA 1N6OA 2FSIA 3TK1A 2JCSA 3KQKA 3WBKA 2G88A 1Z0JA 4ASUA 5K8TA 1MABB 2YV5A 3LD9A 3AP2A 2VIIA 2QAGB 4PZZA 3TVDA 4B73A 3SC3A 1OFIA 5L3RA 5JWOA 4R2HA 3TLXA 1AS0A 4Q9HA 4IEEA 4EPXA 1NSTA 2B7CA 2GCOA 3JVUA 3RLFA 4HDCA 2FFQA 3DZ8A 5HZKA 4A9AA 5JHHB 4V0MA 4P4SA 3DMNA 4IDOA 1G4AE 3TQFA 1PJRA 2B8TA 2GBLC 2MSCB 1S1CA 1XXHA 3THYB 1CTQA 2W2TA 2VP0A 3RAPR 2XGJA 4TLCA 4DCSA 4DDWA 3FMOB 3LBIA 2NPFA 1N6LA 3MJRA 3TR0A 1HH4A 4A6XA 1XEWY 2OFOA 3ZJYA 4UQOA 2XNDA 4UNPA 2BWJA 4QHSA 4HLDA 1E6CA 2QZ4A 4KFSA 4RJLA 5AJZA 2ZI6A 2G0NA 2ZYWX 4C0SA 3HU1A 1J8YF 4L8GA 4P3YA 1ZM3A 2ZRLA 4L9WA 1WDTA 2OBLA 3HYTA 3W8RA 3T1TA 2D2EA 3DVLA 1R8SA 2FEMA 4NE2A 2XB2A 4Z1MD 3EPKA 2D3WA 3K70B 5BWMA 1HYQA 2WJJA 4OK6A 3DHWC 1CULC 1Z6XA 2ORIA 1P72A 4IRUB 4MGZR 1GL9B 4TYNA 3ZIAD 1XFAA 3FHCB 2FFAA 5J5CA 5CITA 4ACAA 1W4RA 4B3GA 1L2TA 2XJ4A 3AUYA 3X2SA 1XTQA 4D0NA 4MA4A 5LD2C 1KDPA 1ZM9A 3T1QA 1F5NA 2QP4A 4DLRA 4JL5A 8OHMA 4G0NA 3EARA 3F3YA 4IEIA 2WPDD 1II8A 1P62B 2B6HA 3GFTA 5DGXA 2HJVA 3EZ9A 4HSEA 4QGAA 4R7ZA 3R7WB 4M4SA 2QPOA 5JEDA 3KQHA 2IYRA 3BB4A 1ZINA 3NBZC 4PC3A 1R5BA 1SVMA 1VHTA 1Z6AA 2Q3FA 2NO7A 2YC2C 3GP8A 3QG5A 3W6NA 3DOFA 5HZHA 1FNNA 1R0XA 4URYR 4Z1MA 1NN1A 1JI0A 1DG1G 3MWKA 4DLSA 2ZS8A 4ZKEA 2OESA 1ELOA 1P2TA 2ZI7A 3OEEA 1YZKA 3WP0A 3I92A 1Z5ZA 1R7RA 1DARA 1VCIA 4ZDIA 3PVSA 1XPOA 3TW4A 2VO1A 1Q20A 1IONA 1XJCA 2JDIA 2ZI4A 1E4VA 1G7CA 3QKSB 5FUYA 2WAXA 3PR1A 1CEEA 4HDQB 1A4RA 4QGHA 1G21E 1U0HC 1I4DD 1HUQA 2YC4C 5DN6A 2QTFA 4BLQA 4R9UC 5LB4A 1CJKC 3TSZA 1Q1EA 2E87A 2OG2A 2QRNA 2RGNA 3WYGA 1GNRA 2HLDA 4HEJA 1JNYA 3B1WA 2HJGA 4D25A 1MH1A 4IHQA 4PO9A 3K0FA 2Q3MA 2WWYA 3TGPA 1RFLA 4K46A 3ZVLA 4NONA 4M1WA 1KDTA 1U8ZA 1GKIA 4BZXA 1ZRHA 4DUGD 4XVQA 3THYA 2JJ8A 1OJLA 4JMPA 1RPZA 4GOJA 3RYTC 1P4SA 4XSHA 2ANBA 1N6RA 1KO7A 1UEJA 5SZJA 5CLQA 1GNQA 2NGRA 4PAQA 2GJAA 4JBXA 3SEAA 3CRQA 3RRZA 3UMSA 3L0OA 1NJFA 2ZRKA 2YVUA 2PLFA 2R6CA 4MYCA 4BLRA 1KHTA 3IIKA 5E95A 2F43A 3HR8A 2NO9A 2ZRFA 2Z4RA 4G3XA 1Z0KA 2CLSA 3OHMA 5L3SB 4ILEA 3EX7C 5SZHB 3Q9LA 3ICQB 4HUTA 1P75A 1AS2A 2ZSBA 5H68A 3C15C 4OQFA 2GAAA 4OQLA 1EX6A 1P73A 2GXQA 3SI7A 3WYFA 1JBKA 3BOSA 2ZJAA 3NC1C 3CRMA 4Q7JB 2J9RA 4MQBA 4TTQA 2BMEA 2OSBA 1XTJA 2YWEA 4PPQA 5HPYB 3TIFA 5EE1A 2PZFA 4HZUB 4TMZA 3W3AA 3GLHE 3AQ4A 4B3FX 4UJ5A 3F5FA 4JLOA 3R20A 1P5ZB 3O8RA 4Q9KA 4FMDF 3I8XA 2R65A 4DEYA 1F2UA 4OI2A 1CJVC 4WZBE 4A6PA 2FNAA 2ZREA 2BCJQ 4LYFA 1SXJC 4TLEA 1OHHA 2ZUCA 4DSUA 2Q21A 3VKWA 4RD6A 2HYDA 3B1YA 4LPSA 4BFXA 3GLIB 1C9KA 1E2LA 4BUJA 4R2IA 5GJCA 3REFA 3CR8A 4JL8A 5JFGA 1JECA 1G16A 3NEJA 4KBGA 1KZGB 3SOPA 1ZMXA 3AF4A 2DFNA 4U02A 1Z2AA 1SVSA 1BYIA 2VBCA 1GAJA 3MG9A 4MYUA 4YXWD 1HA3A 1PUIA 3DKPA 4A15A 2WWHA 1I2MA 5CK5A 1W0JA 4POAA 3TE6A 3Q7PA 5FFMA 5FR2A 3PEUA 2F1RA 1Q22A 3GMTA 2WBLC 3LLUA 1JEEA 1XEXB 1IM2A 1ZM7A 3ZS8A 4CDGA 1E4YA 1F6BA 4N0EA 5SZIA 721PA 1CIPA 1NN3A 4B6FA 1S8FA 2OHFA 1KSJA 1YZGA 5JMTA 4B32A 1XP8A 2FFBA 1B0UA 2TMKA 2ZYVX 3BH6A 1Z63A 1S3SA 2H57A 2C2HA 4GMDA 4V0LA 2G0TA 1YR6A 2E1RA 4H1VA 2AL7A 4HUQA 4BFYA 4XOIA 4OI4A 4DIDA 2V8OA 5BQ5A 1DAMA 1XNJA 4R71A 2GBLA 4Q7MB 1VKJA 4PAOA 1N25A 3ZZTA 2CHGA 3H1TA 2FF7A 3DPUA 5FOTA 2V6JA 3ETLA 4B35A 5TVKA 1RRFA 5AWFC 2HV8A 1OHHD 3DM5A 5EUMA 1W36B 2REBA 4I1VA 2W83A 4M1TA 4ITRC 2QT1A 3DM9B 4KVAA 4XVUA 1M74A 1E9EA 1AKYA 2ZRAA 1Z29A 3IUYA 2XOKA 1XMIA 2PL3A 2EFCB 2VP2A 1NVUQ 3KXLA 4M9ZA 1NY5A 3UKDA 1AN0A 3ZD7A 2XTNA 2C78A 3QVUA 4LV5B 1P9NA 1G7SA 1KK3A 1UKVY 1A7JA 4C4PA 2ZVQX 3K9NA 4FCVA 4TYPA 4IOMA 3WXMA 3ZDQA 1WF3A 1P9WA 2I4IA 4OQNA 1CP2A 4KVGA 4LSGA 4IW3B 3NH9A 4DKXA 4EQ6B 3TUZC 2JJ1A 1NMXA 3DZDA 3LQRA 3TSOA 2GETA 2D2FA 4C3ZA 4TSFD 2ZRIA 4FCTA 1MR3F 4TL7A 2OCPA 1DPFA 2ZPTX 4A2PA 3OIUA 2EWVA 3OIVA 4RCZA 1QDEA 3KKPA 1QF9A 3CH5A 4HZIA 2GNOA 3REGA 4B71A 3WMGA 3R9WA 1QG4A 2QN6A 4DLYA 3VKGA 4ZDWA 2HT6A 3IO5A 4AI6A 1E9AA 1Z2CA 1FX0A 4A8JA 4XD7D 5C4GB 4AG6A 1XMSA 2NO0A 2FH5B 3EW9A 1G5PA 4RD3A 3LQQA 1ZCAA 4PAMA 4B48A 2R9VA 3LWNA 4YDHB 1VPLA 3CZQA 1TPZA 1BOFA 4TYQA 421PA 4E03A 3W9YA 4JLPA 2ATVA 4FI3C 4MKIA 5HCNA 3IDQA 1IN8A 2HXYA 3EC2A 4G5SA 4B2LA 5L3QB 3SNHA 3THXA 3EIEA 4FMBB 1ZJ6A 1N0UA 5FTNA 1NMYA 2QL6A 3FHOA 5G40A 4DSNA 1US8B 4P32A 2GK6A 4BWYA 4MGYR 2JLYA 4Q1FA 4EIWA 1G7TA 2FSHA 4NTZA 2PCLA 3AVWA 2YKGA 3SZRA 4DLUA 1AQYA 1G8YA 1KAGA 2GXSA 2QAGA 5EXXA 4MGIR 3E70C 1W47A 2JLZA 1TEXA 5CJPA 1A5TA 2O8EB 4YMSA 5E7JA 4RFVA 1XTSA 3VR2A 1U98A 2WV9A 3LVRE 3MMPA 5DE3A 1C4OA 3K0AB 3FWYA 1SVOA 4LBZA 4LY6A 4DSOA 5IT5A 4MH0R 4Q9LA 2R6AA 3B1XA 4HAWA 1V43A 3D6TB 2IS1A 2H8KA 2RGBA 1JR3E 4PSKA 3T1OA 5DH9A 2IYVA 1EGAA 2IWHA 3BBPA 2NO6A 1OB5A 5KNDA 2QQEA 3PEWA 3WP1B 2A3RA 2BOVA 2W2XA 3LVQE 1XTRA 1TNDA 1JQLB 2WVJA 3BB1A 3U6BA 5EP3A 3QXJA 3U7FB 4IDQA 1F2TA 2QENA 4NZYA 1VCOA 2A5GA 4LPKA 2ZITA 5J4YA 2XTMA 4TT3A 2A5YB 1YR9A 4MUBA 4NP6A 4EPRA 1T0JB 4W5WA 3GLGA 2V1XA 4GOKA 2F6RA 3ZVMA 2ODNA 2NPIA 4DB4A 4JSYA 1VG0B 3B82A 4PXAA 1YRAA 4WXPA 4DIEA 2I1QA 3RS2A 4A1FA 2IYUA 5KYKA 3RNLA 1GL7A 5LB2A 2QMOA 1LNZA 4US0R 5EE5B 3ZZUA 3FKQA 2ONKA 2AKAB 1Z06A 2ZRBA 3QKSA 4OKSA 4NDZA 1IY1A 4Q4JA 4BRUA 4FXPA 4E22A 1MO4A 4EFLA 5DI9A 5L8VA 1TL7C 1U90A 3V00A 4C0AC 1LVGA 1FQJA 2WMNB 3QNUA 2ZYUX 1K5DA 1DADA 4JBWA 4PQRA 3U61B 1CJTC 3NVAA 2R44A 3K0CA 3FFBA 4B34A 3BRWD 2XZOA 3GJ6A 3C8UA 4UKDA 1S96A 3VNUA 2KBEA 2GDJA 2C77A 1EXMA 5HKKA 1U0LA 5CIQA 1D9XA 1ZD1A 5JS7A 4AY2A 1Q21A 4AC9A 2Z0MA 1OIWA 3D8BA 1G4UR 4PR0A 5TY0A 1BMFD 2F3TA 4LJ7A 3Q85A 4M22A 3ICEA 5EE3A 3IGFA 2G1JA 4LHZA 1L7VC 4OHWA 1HURA 5IHPA 5FBLB 1MO6A 4A4DA 2KSQA 3EPHA 1E1RA 5G3ZA 2ZE6A 3IPYA 1XRJA 4P33A 1N6NA 2PCJA 1ZNZA 4DDTA 3MSXA 2CHQA 2P3SA 4Z8YA 2ZSDA 1RJ9A 2F9LA 4GRAA 1TF5A 3KJHA 4PQYA 3FKSD 3THXB 4NBSA 3RSLA 5AK0A 3VX3A 1OFUX 3HU3A 2DHRA 2EYUA 3SJCA 4PHHA 4DB2A 1KI8A 4ESVA 2Z43A 3QPVA 1BYUA 1UKEA 4WXRA 2JLRA 4IOKA 4G5GA 2NMVA 1FUUA 5JSZB 1PV4A 4WVFA 1QHHA 3LNCA 3L8ZA 1UBEA 4KLNA 3OE7D 3U60B 2CCKA 2WTUA 2ANCA 3G82C 2WIAA 4NCNA 3U5ZB 5KDLA 2QMUA 5EXPA 3SBEA 1W44A 4IFEA 5FI0B 4LBVA 2QT0A 2CEAA 3CPJB 2EVWX 1E2EA 3K8YA 1W1WA 1KGDA 5AJVB 4M8NE 1G8FA 4TL6A 3UANA 5KNCA 1GRRA 3VNVA 1F2TB 1CRQA 1EWRA 3I8SA 3KFXA 4PC2A 3AF2A 4LHVA 4TQ9A 2IXEA 3SJZA 2H5EA 1KI6B 3GPLA 1HV8A 3MWJA 4KFUA 4RZ2A 4CEIA 1Q1QA 3RS7A 5FOXA 2QNRA 1TMKA 2P6RA 4MDEA 4GZLA 2CL6X 2BMFA 2QE7D 1Z08A 1ZC4A 1UBFA 5B30A 1HTWA 4W9MC 4IFBA 3QBTA 5UKDA 1KI1A 1PLKA 3ADBA 2XZLA 1SVKA 2XITA 2ZRHA 4IXMA 4KXFB 2VHTA 4LJ6A 4B47A 3LRPA 2OBNA 2UZ3A 3GJ7A 2IT1A 4IVPA 4JT2A 1F3OA 5BN3A 4Z54A 1UDXA 4TTRA 2WWFA 3UXMA 2QY9A 3SN6A 4Q4JB 1TQ6A 1UM8A 3DOEA 4EDHA 4ZKDA 1XJQA 2W6JA 1II0A 4GBMA 3EZFA 1KMHB 1TU4A 4HB2A 3W8NA 2YWGA 3QG1A 3VMFA 2O0KA 3QI2A 1TQ4A 4BE7B 3GLFB 4TMTA 5FPYA 4CT4B 1Z22A 2HT1A 4KU4A 4JIMA 4M9XA 2H92A 2J7KA 5EQTA 1OXVA 2P5TB 1IXSB 1ZBDA 1J7KA 3CB4A 4LYJA 1RW4A 2FFHA 2QE7A 1FMLA 2RGAA 1KDOA 1G3QA 4LI0A 2OCBA 4LWZA 4EPTA 3I72A 2OEPA 3NHAA 3OEHD 4G5OA 4TMVA 3R8CA 3V4FA 1IAQA 3SYLA 3IEVA 2RGDA 3A1SA 4A36A 1FP7A 3A4NA 3M1IA 3KUCA 1G8GA 4UNNA 2XNSA 4Q4HA 5CK4A 1X3SA 5HTKA 5HKKD 1KKMA 3I3SR 4JJKA 2F1HA 4QKQA 1KJZA 2H18A 1RE0A 3FYHA 1JB1A 2IYZA 4P4SB 4H9GA 1E99A 1FPMA 2JJ2A 3B1ZA 4NYIQ 4BEJA 2NIPA 3L8YA 1ZD9A 2IXGA 1DAEA 4Q1EA 3UPUA 2PEYA 2XB4A 2VP4A 4GT1A 3CWZA 4F7WA 1Z6TA 1UKZA 2BBOA 2X2FA 3QXSA 2R6GA 3EZ6A 3T06B 3RHFA 4DCTA 3AUXA 1U81A 2QP9X 4BZPA 2HDNB 3OESA 3UK6A 1NLFA 1KIMA 1YQTA 2CLCX 1X1SA 2JA1A 1JR6A 3FOZA 3K70D 1MABA 4KODA 3FKSA 3M0EA 2IEZA 1CR1A 3JVVA 2FZLA 1NVVQ 4CEHA 3GFPA 2I1VB 1OFTA 4Q21A 3GJ4A 3HR7A 2CJWB 3IILA 5CDFE 1L4UA 4MITA 1G8HA 2VSOA 4F4JA 4GP7A 1K5GA 1E1RD 2BJWA 2I3BA 4AURA 5SZKB 4US2R 1UFQA 4RZ3A 1KI3A 4LV6A 3K0EA 3NBFA 3CWQA 1X6VA 3KKOA 4A0HA 3WRXC 2HF8A 4Q18A 1YRBA 3HPQA 5KOYA 4C0KA 2J0UA 3AVUA 3X1DA 4QBHA 4ZI2A 3FVQA 4JYBA 2O8FB 5FBVB 3Q8XB 1N5LA 4Q03A 4TTPA 5E4FA 3DL0A 2WSMA 5JZVA 4WOPA 2AK2A 3O47A 4NL4H 1SKQA 1YZUA 4DLXA 3PG5A 1I4TD 3W5IA 4NYJQ 4CEJB 1JAHA 1KOFA 1WP9A 3KJEA 4JL6A 4AKIA 2GJSA 2Q9CA 1U9IA 3A8TA 2EFHB 4O2RA 1OH5A 1D2MA 2IYSA 2IYWA 3EWSA 4LCBA 1RIFA 4EPYA 3FB4A 1E9CA 2FA9A 2ZI3A 2VF7A 3SYKA 2J87A 4G5RA 3LFUA 3B9PA 5DI3B 2CDNA 1Z0FA 1E2HA 3K0AA 2F3RA 3KTAB 1NRJB 4YDSA 2NOAA 4LHXA 3U3RA 3CRVA 1MRSA 3AVQA 5KU1A 1CU1A 2D74A 2QRZA 3K0SA 1XZPA 2C5LA 2VYFA 2F55A 4OQMA 2QSYA 2FV8A 1L8QA 2XZPA 3KKMA 5TB5A 1XTIA 3U3MA 3CNNA 4M1KA 5EP1A 3BB3A 821PA 1ZVQA 3T15A 5F3WB 1B23P 2ZTSA 2OZEA 2EW1A 4P4UA 4OHYA 1SXJE 4JVLA 4JKYA 4JLDA 2ZAMA 5AUQA 4M0LA 1TQDA 2NTYC 4KJZA 1E2IA 2B21A 2RHMA 5JWRA 5G3YA 3FE2A 3HU2A 3OIYA 2GA8A 1N0VC 1WCV1 4BFWA 4A92A 1QVAA 1A1VA 3F0TA 2NG1A 1LF0A 4JLJA 3OEHA 2J7PA 1ZNYA 4IVQA 5FPSA 1LY1A 3LO5A 1JJVA 2QG6A 1VYVA 2ZJ5A 1ZP6A 1SZPA 4IDPA 4DLZA 1FP6A 1UPTA 1O87A 3CONA 3DEFA 3T5DA 2BM1A 1EWQA 4DCVA 4QNRA 2CHVA 1VECA 3PENA 3SFVA 4TZ0A 2ODEA 5M04A 1QHXA 3HDTA 4RZXA 1GUAA 1W4BA 1E1QA 3R9IA 1BH2A 2C8VA 4ZIRB 1T8UA 5J4HA 4EQ6A 4UNRA 1BKDR 4B2PA 2H16A 3RSOA 1SVLA 1AZTA 4OBEA 3PJRA 2YZ2A 1X8JA 1ONBA 3AGQA 4KCGA 3EZ7A 1J90A 4FN5A 4XVRA 3X1YA 2AFIE 3WMFA 1XBTA 2BKUA 1KNXA 3OE7A 2W0MA 1D5CA 1ODFA 1L4YA 4JVNA 1U99A 1F60A 4QHTA 1OIVA 1NVWQ 2PX0A 5K8IA 3RRYA 3GFOA 3QUSA 5CM9C 3VQTA 4B75A 3RS4A 3ASYA 3CNLA 1WXQA 4RY2A 1P3JA 2BVNA 2BBSA 5FTKA 4BFVA 2CCJA 1E0SA 1W49A 3KB1A 2CL7X 4OHXA 5H70A 4ARZA 3UG7A 3VU9A 1FMJA 121PA 5DSZA 4FMDB 5EP4A 3ZQJA 2O8FA 3PQCA 1SVIA 3W6PA 1M1YE 4QG7A 3U4QB 2GEVA 2NQ2C 3SQWA 3QE0A 2J7PD 4YMUA 1G1MA 2IUTA 2Z6VA 2OFXA 2ZJZA 4L9SA 1E32A 4V0KA 2X1VA 1G3IA 4B33A 5GJBA 3EZ2A 1DBSA 2GRJA 1QHSA 1RRCA 3NDBB 4OYHA 1Q0UA 1EFUA 4CW7A 2CVHA 5JJIA 2BIFA 1TU3A 5BXQC 3EAQA 2C95A 3D31A 3LX8A 2IWRA 4C2UA 1G64A 3SR0A 3KQLA 4DC9A 1VG9B 3KQUA 2DFTA 3VHLB 3QXCA 2AK3A 4D81A 1E79D 3QF4A 5A4JA 2ZU6A 4U7DA 1KI9A 3MWYW 4Q4AB 3GLIE 3KXIA 5KUTA 3FDIA 4M9QA 5FL3A 2QP3A 2ZUDA 4CEIB 4LRWA 1DO0A 3TJZA 1FL9A 2WHXA 5EP2A 3U44B 1N5JA 2GVZC 4MDFA 1XMVA 1VCNA 3BIFA 1E2KA 4Q4HB 3K9GA 4XTRA 1XPUA 3E1SA 2D4HA 4QM6A 4DLWA 3GJXC 1K8RA 1R5NA 2JLWA 2IF0A 3AM1A 2BBTA 3RS3A 3NWJA 1S1MA 2WKPA 3AVVA 4KYUA 3BAFA 5B64A 3WMEA 2HF9A 1DE0A 4ZCMA 2NO1A 5KPDA 5JJKA 1P61B 4X8HA 4F38A 3RANA 5EZ6B 4B3CA 3FMFA 1IN6A 1E2MA 1DVRA 4MKGA 5F9FA 5IRCD 1X8LA 2ZJ2A 4ON9A 4LYHA 1NP6A 4IOJA 1TTTA 3GLHA 2IYYA 4RFSA 3Q3JB 1S3GA 3TW8B 3B5JA 3K9HA 2VF8A 4U5XA 3IBGA 1GP2A 1KO5A 2ZR7A 1VHLA 3WY9A 4L16A 4TYWA 4HUQB 1KYIA 3PFIA 4BZQA 3HP1A 5LD2B 3EIQA 4URVR 4C9BA 1GG2A 1SXJA 4LZZA 5L3VA 4M1MA 3QKTA 4PTLA 4TL8A 1DG3A 1Y63A 4LHYA 4ASUD 1Z28A 4ZV4A 5JCPA 4Q00A 3LV8A 2VTKA 4E09A 1JXMA 2AXPA 2VH5R 1WBDA 1XWIA 1NVXQ 1ZUNB 2A5JA 2N42A 2RMKA 4K8OA 2O5VA 1KNQA 3PIRA 3X1WA 3QOFA 2ORVA 4JJZA 3PUWA 4RD0A 5C46F 4CGZA 2QROA 4LOAA 1E3MA 1BO6A 2EU8A 5P21A 3A6PC 1DEKA 4QBIA 2GESA 2FJUA 2V3CC 4PO8A 1QHNA 2JLQA 5D3MB 3ZGXA 3WHLA 1TUIA 5JRJA 2ZETA 1W0KD 3WNDA 4M1OA 1KO4A 1H8HA 3WRYC 3U4QA 2JLVA 2VP9A 2BCGY 5FBQB 3AVYA 4M1YA 4GNKA 1W36D 3MRSA 2V7QD 4CVNA 1WQ1R 4PHTA 1TAGA 4FWIB 1KMHA 3KUDA 2XXAA 4KSCA 3LY5A 1EG7A 2ATXA 4DLTA 3TAHA 4OJQA 5F2EA 3T5GA 1XU4A 3ZS9A 4DVGA 1PLLA 3FPAA 4DDVA 2IS6A 1U8YA 1G19A 1MO3A 2GZHA 1E2FA 2W00A 3BH0A 3VHXA 3PXGA 4URZR 1HY3A 4C0LA 3H0KA 4PZYA 1T3SA 4MGKR 1IN5A 3K0CC 3N70A 4X8OA 2O8DB 5JRZA 2QBYB 2FOLA 2YWHA 2CJWA 3CUEF 4CZ2A 2J5XA 4EJSB 1AZSC 3CLVA 1M2OB 4NYIR 3U44A 1VYTA 5LBIA 5FBRB 1NI3A 1N5IA 5FOWA 4AYWA 5A5GA 3SHFA 3QEOA 4HAUA 5EJEA 1ESNA 3I73A 4C0JA 1ZW6A 1E2QA 1KI6A 1X8KA 2D7CA 2QM7A 4BFSA 4BEBA 3MCAA 2ERYA 4QXAA 4LK2A 2N46A 1YE8A 3R8FA 3QEJA 2QA5A 5FOUA 3P1JA 4LX0A 4XSGA 5IK2D 1R0ZA 1FTNA 2KWIA 1GRQA 3QKRB 4D2IA 4DCUA 3C14C 2F1JA 2C9CA 3TR5A 3KTAA 4Q7KA 4HB4A 2H1LA 4W5JA 3FMPB 5FL7D 2MSDB 2P5SA 1R8QA 1A2BA 1N0WA 4XH9B 4WA7A 5J40A 4OI1A 2ZAOA 3A36A 1VCMA 2GKSA 1AS3A 1YU9A 4LYAA 5FUXA 3I61A 2GJ9A 2XSZD 4Q1CA 3AEZA 5DI3A 3QXHA 2JATA 3TMKA 1ZUIA 2ORWA 4LBYA 4IDHA 4JZKA 1II8B 2CVFA 2W6IA 2QU8A 3A4LA 3G0HA 3OZXA 2W2VA 5K8UA 5AJXA 5F98A 4E5UA 1GKUB 2XNDD 3CKLA 2CK3A 5E7IA 2ERXA 4U00A 1OLOA 5C18A 4A8JC 1ESMA 4BLSA 2ZROA 1OE0A 2ZEJA 3VR4A 3WYAA 3AVTA 5CB8A 2R6DA 1XD8A 5GJVC 5IK2A 2RB4A 2ZRGA 1W7AA 1G18A 2VP5A 4QHYA 2X77A 4D4MA 4Y0AA 1V5WA 2ZIAA 4I1UA 4YMVA 1AGRA 1Q3HA 5C4MA 4CYMA 1M6NA 4DJTA 3LDAA 2IL1A 1P2UA 3IO3A 2CCGA 5D3MA 3GLGB 1IJEA 2A9KA 1Q1ZA 4MRSA 3RWMB 1WB9A 2VP6A 1FZQA 1IOZA 4Z8XA 1A2KC 4YXWA 2WAYA 3IIMA 3BD9A 2N1BA 3EA5A 4Q1BA 1IY2A 3IKJA 4URWR 4UNQA 5KSOA 2ZQ5A 1T6NA 4RSGA 2ECKA 2LWIA 1RRPA 2L0XA 3EASA 4MRVA 2QMEA 3SYNA 1D8TA 3B2EA 3DO6A 1KI4A 3AH8A 1IBRA 3CX7A 1QHIA 1G3UA 2WPDA 1GWNA 2OFWA 3K0FB 5AUPB 1D6JA 1DOAA 4D26A 4JVMA 3UATA 1XEWX 1Z0DA 1ZAKA 3AKEA 1GSIA 1YHNA 5HE8A 1U94A 4LC0A 4FMCF 2FEOA 4EPWA 1T4GA 2CL0X 1H8HD 4AD8A 2J59A 1Z6GA 1ZD8A 4BPBA 3R9XA 1P7CA 1VTKA 4TLAA 3CF0A 3PV0A 5C2JB 1VIYA 1W2GA 3AF1A 2VA8A 2IYTA 3MUFA 3IBYA 5EZ5A 2FMXA 4LHWA 2XTZA 2AXNA 3CR7A 5CIWA 3T1VA 1E9DA 2QMHA 1FX0B 3LH5A 4A8JB 2A7QA 2GHIA 3IIJA 4TL9A 1XD2A 5FPKA 1EFCA 2J0QA 1KJYA 2PH1A 3AV0B 3CX8A 4Q7LA 3TNFA 4ZCIA 3RS0A 3OIWA 1W0KA 4X8MA 3E5HA 3L2OB 2PX3A 1HE1C 1RKBA 1RVDA 3K09C 5F9HA 2ASEA 4NYMQ 1K6MA 4D4LA 1RJ9B 1E9FA 3RRNA 2XSZA 2OAQ1 2FPKA 3GEIA 1KKLA 3T12A 1LS6A 3QKRA 1YVDA 1NF3A 1VYUA 2ZXUA 5BYKA 4KAXA 5JEEA 2G6BA 3LX5A 5JLJA 5DNYB 4V0NA 3VR5A 2YJTD 2BEJA 1IXZA 1IN4A 1ETUA 1OV4A 2QI9C 3CNOA 2VL7A 1OXTA 4HLQB 4DT1B 5AUOB 4QNMA 4YLGA 3TH5A 4QJ4A 4XJXA 4OHZA 4DCNA 3SE0A 1ZU5A 1Q44A 2QSZA 5KTYA 2ZRJA 1T5LA 2Y8EA 2HLDD 2IXFA 1Y3AA 5GADl 2ZRNA 1Z0IA 3L0PA 4NU0A 4TMKA 2JGNA 3QVVA 2Q9AA 1CXZA 4BQSA 1OYWA 1NMZA 1CJUC 3GD7A 2GILA 4HI0E 4IKEA 2WSSA 3QF4B 3MWLA 2XX3A 3DMDA 4PC1A 4I99A 2E9SA 5D3QA 1OH6A 2B92A 3BH7A 1NLZA 4EUNA 4LJAA 2WJYA 3BGWA 3CM0A 1M34E 2J46A 2GK7A 1R6BX 2FDCA 4B2IA 4HAYA 2GZDA 3N5CA 3IEUA 3SDZA 1M8PA 1QVRA 2F1IA 2YOGA 2W0SA 3H84A 1M7HA 4XTCS 2ZSFA 1RRGA 3BWDD 3NIBA 5G41A 4JLVA 4EAQA 1KJWA 1J70A 2CK3D 3AB3A 3KJGA 3DDCA 3LLMA 1XCGB 2A78A 4S2EA 2RGCA 1COWD 2FPMA 4O0MA 4FD2A 5ANRB 4DHEA 2WKRA 4MYHA 2EWWA 1KK0A 2GJKA 2PMDA 3QJYA 4MRNA 4AG5A 2QGNA 1DAKA 1EK0A 4NCKA 4AYTA 5KDOA 1SKYE 2WZQA 2VHCA 3OF5A 4G01B 1G291 1FQKA 2RKOA 1HT1E 1PLJA 3I5YA 4DBLC 4EKDA 4HLCA 5KSZA 5DHAA 1T3HA 5ELXA 2EFGA 4XWKA 3FHTA 1JR3A 2IYLD 2IS2A 1H8EA 3QY0A 4IDNA 1YJ5A 1GFIA 3HYRA 2QAJA 3AVXA 1QHGA 1NLYA 4C2TA 2GCOB 5DO9A 3MAAC 1X86B 1TF2A 4MRPA 1W46A 5J47A 3RS5A 5C1BA 5EE0A 1OXUA 2FPLA 3SHWA 4EFNA 1COWA 2IK8A 1PUJA 3GJ3A 3GLIA 3S1AB 4TQAA 4JKIA 1XZQA 2WICA 1U8AA 1IXRC 4GZMA 1D2NA 4UXIA 2PJZA 3BERA 4DEXA 2ZANA 1KY2A 5CJ2A 3EPLA 2QGZA 2WKQA 3NXSA 4Q4LA 4TWZA 2FN4A 3CPHA 3GLHB 4JS0A 4QL3A 4DSTA 4B44A 2JIZD 1GKYA 3KKQA 2XXAB 4C0HA 2VSXA 1CBUA 2DR3A 5DLQC 2DY1A 2Q9BA 2VLIA 1JPJA 4IXNA 4A2WA 1T9HA 2RGNC 3TAUA 1SHKA 3QENA 4QRHA 2DWOA 1OSNA 4I4LA 4KFTA 2MMGA 3R7WA 1XB2A 2RCNA 2ZSAA 4JLMA 2BMJA 2V55B 4N0DA 4PHGA 3ZVNA 1E9RA 5DIFA 4RZUA 4D80A 1W4CA 5JS8A 3UWOA 4KV9A 3X1ZA 4NCHA 1R0WA 2UVQA 3QBVA 3C5HA 5AJWA 1GTVA 4G5QA 5FPHA 3ASZA 4JLNA 2HCBA 4QJ5A 1R10A 5KPJA 2YNMA 4Q02A 4D4KA 4L15A 1CS4C 1YR7A 2WSSD 4AIIA 3ADCA 621PA 221PA 4KFRA 2VQSA 1TQ2A 2IYXA 3IQWA 1QZXA 2IC5A 1D2EA 1NN0A 1KO1A 3P4YA 3CF2A 2AKYA 5K8LA 1NG9A 5TDHA 1OKKD 1D9ZA 2MMCA 3NG1A 1KK1A 3B8HA 2ZRMA 4NH0A 5JHGB 2WOOA 2W6JD 5DYGA 1AJEA 4AKEA 2J3EA 2C03A 1BS1A 2KB0A 1G6HA 3BFVA 2QAGC 2P0EA 5EUQB 3L43A 1Z47A 1QRAA 1LFDB 3A1UA 5CYPA 1W48A 3IQXA 2GCPA 2O0JA 4BLOA 1NBME 3KL4A 5CB6A 4OK5A 2K5UA 4E07A 4HATA 3EXAA 4QJ3A 5CDFA 3BORA 3D7MA 1XXHE 1PZNA 4NYMR 1WRBA 3OEED 2ZS9A 4NCIA 2IHYA 4N1AA 4ZCLA 2JLXA 1TEVA 1Z3IX 1VIAA 1W4AA 4NYJR 4OQXA 1IJFA 3B9QA 2CBZA 1HE8B 4LJ4A 2GJ8A 1WE2A 4Q1AA 1XXHB 4W7SA 2ONJA 1NIPA 2Q3HA 1CR0A 4DLVA 4P4TA 1WA5A 3Q5EA 2FG5A 4HB0A 3NC0C 2D62A 2CNWD 3ZZ0A 1DTSA 1E2JA 2B8WA 2UZIR 1U9IC 3RC8A 2O8BA 1DAHA 4F4IA 3ZD6A 1NY6A 1E69A 2G83A 3T61A 2ZRDA 2VPPA 4GMXA 4FMCB 5L3SA 2XEXA 1KAOA 4Q48A 4ZI3A 1OB2A 1T91A 1YZNA 3AF3A 2BHRA 5TV2A 5IF9A 2O8CB 1CKEA 4X8LA 3RC3A 3L0IB 1G9XA 3NDPA 1XX6A 4GFDA 4QGGA 4TLDA 2H17A 1LTQA 1OW3B 5FPTA 1UDWA 3GCGA 2CE2X 4OL0A 4HYYA 3W3ZB 3ZIAA 3F8TA 3ADDA 4F91B 3GJ5A 4Q47A 4KYIB 5H1YA 5B57C 1U0JA 2HEIA 4D82A 3L0SA 2FU5C 4CEHB 1UEIA 1XPRA 5JJLA 5LPNA 2QBYA 2AX4A 1SKYB 3O8CA 1DAIA 1GIAA 1F2UB 2OUKA 2ZRPA 1FOEB 3UWKA 4TZ6A 1OH7A 2OXCA 5FBWB 1S4QA 5TARA 2AD5A 1DAGA 4MKHA 1ZYUA 2DCUA 4MKFA 3B85A 4I81A 3AGPA 3PCRB 4KO8A 5DN6D 2ZM5A 2V7QA 1KDRA 4KBFA 4LV8B 1N6PA 4QBGB 4P0TA 2DPXA 4ARZB 4PX9A 5CM8B 1FNMA 2ZE8A 1MRNA 3ADKA 3U3KA 3IHWA 3K1JA 5EXTA 4QM7A 3EIHA 3P27A 4CT5A 4ZDKA 4WBSA 4HB3A 1EESA 1MOZA 1SQ5A 2XJ9A 4A0RA 1EFRD 1EFRA 2X2EA 4C0BA 2REXB 4AKHA 3B60A 2HXSA 3SS8A 1U2RA 1E0AA 2J0SA 1Q3TA 4QBFA 4RVCA 2GF9A 1R2QA 1UF9A 1S9HA 1CJMA 1AGPA 2VHJA 4IVRA 3SJAA 4DWJA 3K70C 1YZTA 4PO1A 5GVSA 2O8EA 4AKGA 3QXXA 4RD2A 1A82A 4RD1A 2RH5A 4I1OA 2C99A 3NBXX 5HE9A 1ZUHA 1OKKA 4O3MA 3QPWA 2NZ8A 2MSEB 3DKVA 2ZJBA 1VDZA 4B3DA 3GEEA 5EE9A 2V9PA 1UADA 3AVOA 2GEUA 2GF0A 4M9SA 2JAQA 2J0UB 2QTHA 1G20E 4NHOA 2C98A 2ZRCA 3VR3A 1XD2B 1JJ7A 1T3LA 1ZC3A 3AKDA 3HJNA 4LUCA 4TYYA 2UKDA 2CXXA 1OIXA 4M53A 4MUAA 4C7OB 3RWOA 4AWXA 4BFZA 4B6EA 2C04A 2GXUA 2O52A 3E2IA 3ZYCA 1KI7A 1QHYA 1SHZA 2OXRA 1Z07A 2WWGA 4RD4A 1RC8A 4AK9A 2ZE5A 3GJ8A 3J81k 1GITA 2GWHA 2GXAA 3BE4A 3U3JA 2W58A 2EFDB 1TUEA 4RKFA 4URUR 2Z83A 1AKEA 2R2AA 3PEVA 4JLKA 3U6KA 1J8MF 5LDDC 3BS4A 1LV7A 4PZLA 4V02A 3S1AA 4TN1A 4BFUA 2WWIA 3SQXA 3VR1A 2PMKA 4GPTA 1N5KA 4LGMA 3KQNA 1XEXA 3FTQA 1NBMD 2WM9B 3M6AA 5JI2E 5KDDA 3M4YA 3JZAA 2VEDA 1FTSA 1XMJA 1G3RA 1MKYA 1G41A 1EFHA 2YYZA 4BFTA 3A4MA 3U2QA 2J1LA 2LCFA 3RDPA 3GJ0A 1KI2A 2FX3A 5TMPA 1G5TA 2BBWA 1Z8FA 3GLFE 3I1FA 1HQCA 1EFTA 1XCPA 1YKSA 2PBRA 3AKCA 1OH8A 1IY0A 4EJSC 1SXJB 1KSGA 3H86A 4JT4A 4PANA 1HT2E 2FE4A 5JBQA 1TX4B 3B13B 2QEQA 2OLKA 1NG1A 4FIDA 4N3NA 3QSYA 1E94E 2EQBA 2ZVPX 4PPGA 2ZS7A 1YZLA 1NL3A 3VU9B 4LJYA 2PZGA 2V4ZA 2BM0A 1W2HA 3RABA 5L3QA 4GDFA 5FTLA 4BRWA 3OFNA 4OI0A 1DELA 1NJGA 1BIFA 1W0JD 1TADA 2JLSA 4URXR 3QQ5A 2BC9A 2QPTA 2PJRA 3X1XA 3CF6R 4V0OA 2G1KA 3KZ1E 3W6OA 3L82B 4O25A 4YONB 2WWXA 2AN9A 3TRFA 1NKTA 2HYIC 3GQBA 3TUJC 5BYJA 4H1UA 3PUXA 5EXSA 3TSWA 2O8CA 4I1SA 1E0KA 4HLUA 1JEDA 1NSFA 1H65A 2DWQA 2IYQA 4HAZA 5KO2A 2GTPA 2DYKA 4P31A 3TBKA 2OAP1 3ZQ6A 2IX3A 1ZM2A 1JQJC 3P32A 4A82A 4V0ME 1ZM4A 5B2ZA 1OPXA 4Q1DA 2JDID 3N2IA 2RGEA 4Q5IA 3RRMA 4CF7A 1CR4A 2KE5A 3EC1A 2XOKD 3Q7QA 1X1RA 4B43A 1LF5A 1KTVA 1E0JA 4M21A 3BJIC 2PEZA 4TQUS 4K81B 4PFSA 5BN5A 4UXJA 4BLTA 2R62A 2Q0HA 1YR8A 2EFEB 2PT5A 3AP3A 1GZSA 1P6XA 1SVWA 3EA0A 5AUNB 2CMKA 4MRRA 2OILA 5JI3E 6Q21A 1XDBA 5DYIA 2V1UA 4BECA 5FUVA 4B3BA 2A30A 4GSYA 4HAVA 1UBGA 3V4RA 3I5XA 3UG6A 1E79A 3K53A 1GNPA 3KFVA 3VAAA 4DDUA 1CF4A 3P26A 2FWRA 3BK7A 2IUSA 5H8WA 1SGWA 1G3MA 4DXAA 1E9SA 4MYTA 4L4UA 3U7EB 4M2LA 3CRW1 4XWOA 2AD1A 3NHBA 1I4LD 3CRRA 2DFLA 2R8RA 1LS1A 1PVOA 2P2LA 3IHLA 1BMFA 3KKNA 4TMXA 3VX4A 1ZCBA 4UXHA 2G77B 4L5BA 1R0YA 3CBQA 5KSPA 1Z6YA 3CZPA 1XJ0A 1RYHA 3B78A 2VSFA 1OYYA 5A0FA 2WJVA 3JZMA 4Q4AA 2RAPA 2SHKA 1N3BA 3KDSE 1IQPA 3HPRA 3AF0A 2AFHE 1XCMA 4YMWA 2H7VA 5BN4A 2W6ID 1G6OA 2YOHA 2DBYA 1NIJA 3UMFA 3O8BA 4B76A 1FW6A 1R5OA 4LJ8A 5TXGA 3KB2A 3WHKA 3LA6A 4Q19A 4GOXA 3T35A 4EFMA 1KY3A 1G5RA 4JVSB 4IOLA 2ZI5A 5JCZA 4FINA 1AIPA 3PITA 4FCWA 2HCJB 2YINC 1W36C 1NVVR 3SBDA 3I32A 3C41J 4QGFA 4J0QA 1QBKC 3ONWA 4HDOB 4AYXA 2IW3A 5CLLA 1YZQA 1G8PA 1P9RA 1US8A 4OJKA 4LDJA 2J41A 3ZVRA 4II7A 2BDTA 1Q12A 4ACBA 3C7KA 2X8AA 4LJ9A 2QQ0A 4CEJA 1GOTA 2WWWA 3I4LA 2OT3B 3LW7A 2GVDC 3V9PA 4RFSB 3H4MA 1F48A 1QHHB 3VR6A 4JSTA 2ZU0C 3MJHA 4US1R 4JLBA 5JECA 1JALA 4PPFA 4HAXA 3WNBA 3LXRA 4GI7A 1UJ2A 2LKDA 4O2LA 3AVPA
chains in the Genus database with same CATH superfamily
2SKCA 3N2EA 2FRXA 3EDRA 1GNTA 3LXXA 1S8NA 2C57A 3L40A 1WVMA 2PANA 4YJFA 4M1ZA 3OT4A 3VO8A 1XLTC 4JT8A 4JP8A 5ES4B 4ID3A 4MYSA 4BLVA 4RV9A 2FGKA 3BILA 4DQXA 2OCAA 1JDBB 1M6VA 2Q7XA 2ZBFA 3O8DA 4PC6A 4PQFA 5EAIA 3ILYA 3TL6A 2Z2XA 2F3UA 4W5OA 5ALKA 5JC1A 4BN5A 1D4OA 3T3IA 4B3XA 3N8DA 4CMKA 5L7TA 1I0LA 3KQYA 3TVTA 3C74A 4RL6A 3UUWA 2AW3A 3C5VA 3QTLA 4ZC8A 4Z6KA 3OFND 2WJIA 4BQEA 3GARA 3COZA 3L8DA 4Q01A 2QUZA 1ZU4A 4OUKX 5EIXA 4QAQA 1EE1A 4YI5A 2P67A 3P0IA 3MRXA 3VH3A 2YN2A 3P7MA 4E31A 2OM2A 4D4JA 3LCJA 3NEYA 4FWBA 1PEKE 4FFOA 3RSQA 5DEIA 1CX9B 4NMMA 4HFJA 1RPNA 3MJCA 4G9EA 5FTMA 3WBBA 1UFOA 2QTWB 4G81A 3OBIA 2X19A 2RJOA 1YL6A 4I6EA 4RVNA 1GVNB 3OTWA 2V7EA 4QOJA 2JIDA 2WJAA 3P9ZA 5H9VA 4C7MA 3NKVA 2XUOA 4FSXA 1XEFA 3F46A 3TZQA 1WV1A 5I9SA 2JEOA 3IAS1 3K73O 4IXTA 4MQ4A 5L40A 3ER9A 5J4VA 2D7DA 1M2VB 2RHDA 2Q2NA 4QGSA 4FOSA 1E9VA 3DEZA 4JA2A 2NXEA 2ZR9A 5A04A 1W5SA 2ZBQA 4PPNA 1E2NA 4K6KA 3SY8A 1JB9A 2PSHA 4QYWA 5HNKA 1OWNA 2OV3A 1YCDA 3R2JA 4O02B 3WGLA 5B55A 1IUKA 3H11B 1G9SA 1I2ZA 1PGOA 1N6IA 3RK1A 3N2NA 3HWX1 3PGVA 1X19A 4MUNA 2DWPA 1VMAA 2H1FA 4C7OA 1VG1A 4CM4B 3JY6A 1LLDA 2MHCA 2JD2A 4RIHA 4PQEA 4EHLA 3JVDA 4P93A 5THXA 2N0SA 1TA9A 3PUYA 1T5IA 2PPVA 3BDAA 1ZAYA 2OHGA 3KKLA 3KOYA 4M0UA 2JK0A 4JUDX 1OLUB 3Q5DA 1UJ5A 5IVPA 1TW2A 1W25A 2ZI9A 3GYGA 3V1KA 3THWB 1Z37A 3PXDA 1E2DA 3QPUA 2RGXA 4GF5A 5J2TB 1EM8B 3WFIA 2YFQA 1ADBA 1B8UA 3FGNA 4BNMA 3J7AC 4F60A 4PLHA 2J4FA 3IULA 3OFVA 3QU2A 2PUJA 2PH3A 4O4IA 2YMPA 1P1CA 5ESWA 2C9OA 5KX5A 1SQ6A 2G1PA 3IRUA 4LRTB 4QOSA 4QWWA 3ROFA 3ZC3A 1XA0A 5G53C 4EJ0A 4XLLA 2Q99A 3TYXA 4F92B 5MN4A 4PLFA 4X97A 2OYRA 4PC7A 2JJ1D 2FYTA 2YYYA 1DJQA 3KVOA 2OVFA 3K6JA 3RYIB 1HYGA 3ZXIA 2QN9A 1VJRA 2CVOA 2AWOA 3K5IA 5IASA 4Z9FA 3HWRA 3W90A 2ZJYA 2CLDX 1UM9A 1N6HA 3U7GA 2I2XB 2JIOA 3EGIA 4XIGS 2Q6VA 3GLTA 3PUVA 2VWHA 4FNMA 1E98A 2H07A 1IM8A 1B74A 2KJQA 3AP1A 2WFMA 3EG5A 1MB9A 3C3CA 4KGVA 1J25A 1OI7A 2LRHA 4MJLA 4WERA 4MVJF 4DQVA 2HK9A 3ZCUA 4ZPXA 1Z7GA 1LW7A 2VHQA 2Q5OA 3AFOA 1IJKA 2Q27A 2DF8A 2Y6UA 4JA0A 3SHQA 2HUPA 1BE1A 1X70A 3M33A 3RS9A 1GILA 2OE2A 5BT8A 3RGGA 2WJ3A 3LLCA 2Q1TA 4R2KA 4G1BA 5DM2A 3MGCA 4PF1A 3OX4A 1BEZA 1C30B 1SMKA 1YIAA 3MT9A 4QATA 2AWNA 3O4IA 2QZJA 2IPAB 4HYEA 4RDCA 3LNTA 3UW1A 2JZNA 2QB5A 5TT1A 1J99A 5HKAA 3FTEA 4D98A 1B42A 4CJXA 3LZCA 1JVBA 2W8BA 3JQ7B 4CLOB 5IKMA 2P3QA 3NX4A 1P33A 3KKZA 5BUQA 3ND8A 1FFHA 3M6WA 1DEAA 1SELA 3ZDAA 2JIRA 1W5FA 3AESB 1U2DA 2V6IA 3U80A 1H8ED 3AI1A 1M6EX 2C83A 2TRSB 3O38A 4WZ6A 4WN9B 4FW9A 2DB3A 2R1TB 2UAGA 2SICE 2P2NA 4KI0A 5FTJA 1S9DA 1SXJD 3Q3GE 1DAPA 3HWSA 2B1QA 3RVOA 1J2JA 2ZSEA 4ZEMA 1BCSA 2PGIA 4M3NA 2DPHA 2WU8A 4LC1A 3CW2A 1B73A 1WXFA 4K0RA 2DH6A 3W5JA 3USZA 1OT5A 4YUAA 3KR9A 1DO2A 4C30A 5AW2A 1GSAA 1YMVA 4RPJA 2Q5IA 3G5UA 5GPBA 1NG9A 4KC0A 1BQ4A 3AMVA 3KLOA 1XF9A 3P2MA 4JD5A 1R4AA 4MRAA 5FUWA 3V4LA 4BEVA 4G0MA 1HE3A 2OWDA 3NTVA 1ZH8A 1QO0D 1A04A 3NETA 3BHIA 1MQSA 4NCJA 4DL9A 5IAOA 3D6FA 1L1QA 1SULA 1AUPA 2E4YA 4FR2A 3V4VB 3O82A 2OO5C 2NZWA 4CRWB 4H1WA 2W2KB 4L85A 3NBUA 1YB5A 2C54A 2O5RA 4IGKA 4B3JA 2IUUA 3D3NA 5DIZA 1SKMA 1QORA 3KTFA 2DFDA 2J8ZA 4OPMA 3LUPA 1YJQA 3OZEA 3QPAA 4JU8A 1BXGA 4PW0A 5BPHA 1E5TA 1J5PA 1E2GA 4BNTA 1HEIA 5KTMA 3LY8A 2IA5A 3F98A 2RGGA 2XI4A 2KI5A 2C9YA 3AKYA 4BASA 3JCZA 5ADVA 1AN9A 4UVEA 3TOSA 1OF1A 3HRHA 1E1YA 2ZTLA 3BZBA 4UJ3A 3U3ZA 5L4NA 1EK2A 4QUJA 4ALLA 4XJVA 2IHBA 3HA3A 3THWA 1RZ3A 1ANKA 1R0LA 4BO2A 5IC6A 1L5NA 3N74A 3GB9A 2CNDA 1RJDA 1JG4A 3K6KA 4K9NA 3SR3A 1YASA 3RBAA 3Q41A 2QR5A 3HDYA 3WO1A 3G9UA 4D0LB 3JU3A 3OIDA 2NUTA 2JIZA 2WMOB 3PDWA 3Q72A 3HKEB 4X1KB 5JCJD 2P2SA 3U37A 3IOYA 5KSYA 5IT9A 2BKEA 3JD2A 3C3YA 2PD4A 3LBNA 3BC1A 1SIUA 2GPYA 4P08A 5JSQA 3DAOA 1XAIA 2GFQA 3PXEA 1CR2A 3DMRA 2O23A 4NJEA 1T3ZA 4KH0A 2CHFA 4R98A 1II9A 1LZKA 4GVPA 5DYTA 2CZGA 4QELA 1BDMA 2LKCA 2X7JA 1V6SA 4RIEA 2O8BB 1CNEA 1MV5A 2Y2UA 1RS0A 4WEOA 3SLGA 3AL2A 3TRDA 1GM5A 1GSHA 2ZUVA 1Z25A 2UYGA 5AHRA 3TK1A 1C0PA 4OQEA 4AJIA 3WLSA 6NULA 5HP4A 4JC4A 2C1ZA 1Z0JA 2OO5A 5KYNA 3ENQA 5AVTA 4ASUA 4BMNA 1EU1A 3HA5A 2R00C 2Y71A 3R75A 3U5TA 2VPYA 5DYNA 4PZZA 4C3VA 4B73A 3SC3A 2DR0A 4PYJA 1L4LA 4WADA 2GPWA 5KOJA 3EDMA 5JWOA 2NPOA 2KPOA 2NYRA 4R2HA 1AS0A 3RAGA 5FUMA 1Q77A 3OKFA 1CT9A 1NSTA 3PFBA 4FFPA 1X74A 3WLNA 3ZWQA 3LQYA 2IYEA 1N2EA 3EVNA 5JHHB 5DNCA 5B5SA 1K9VF 2XCTB 3M49A 5I6DA 3DMNA 4IDOA 2VYQA 5FI5A 4L8VA 2GASA 1C9JA 1MFZA 1M0SA 1XXHA 2I4TA 4K6FA 4YRKA 3FNBA 4Z4FA 5TQVA 1GYQA 5L6LB 3AKZA 4JLUA 2XGJA 1ODKA 3IODA 4WN9A 2FWAA 3VNBA 3TR0A 2AN3A 2HWKA 2GD1O 4A6XA 4QEZA 4RPKA 1DP4A 5HOEA 5HF6A 4LZJA 2DQ4A 2PT6A 3WB0A 4C0XA 1DHRA 2QZ4A 1SXPA 1I7DA 2G0NA 4LWPA 2ZYWX 2VT7A 3G02A 3LP8A 4HAIA 1MJGM 2JZOA 4W7IA 3OLYA 3V5NA 2X8WA 1H85A 5AVYA 3S5UA 5KB3A 2DHQA 1J8YF 4X92A 4TS1A 4JI3B 3S2EA 4PEVA 3TI7A 2FEMA 2UVPA 1HSOA 4Z1MD 5DP1A 2D3WA 4JNCA 3N0WA 1HQKA 5JH7A 2X5JO 1FYXA 3BDIA 1GR1A 5EMLA 4OLBA 2H85A 2ISCA 2F00A 1LA2A 2ORIA 1Z6XA 2R87A 4PLCA 1GL9B 5LL6P 3JTEA 5JROA 3ND5A 5JV5A 1JHMA 2FW6A 3SXJA 3EUFA 3KR2A 2WHPA 5HIIA 1ODSA 5G02A 1OMOA 4JQYA 2XJ4A 3ENVA 1AMUA 5KS2A 1G8JA 1AKNA 1YB7A 5BVGB 2O5EA 3KHTA 2HMSA 4MA4A 1QKKA 3K9BA 3Q2KA 2H31A 3QTBA 4CLRA 4MQFA 2KHZA 1F5NA 4UU7A 2XODA 8OHMA 1OFVA 3SHVA 1E1CB 1TCCA 3SICE 3IFSA 1FXWA 3EARA 1UOPA 3EJWA 1JU9A 3A9SA 3SQLA 2B6HA 1NJ5A 3QA9A 2HJVA 4HSEA 3R7WB 4M4SA 1HDEA 4YPVA 5JEDA 3HCEA 1X2BA 4N0MA 4OJNA 2CYCA 2IYRA 3BB4A 5JCJA 3QK7A 1M33A 4OYYA 4UVDA 4QTXA 1UDAA 1QRDA 1PR1A 1B6RA 2NO7A 2YC2C 3IAUA 1U5CA 3O93A 5CRIA 4Z2YA 1RBZA 2UZ1A 3DOFA 1BQ3A 4EW3A 4Z1MA 1NN1A 4KRYA 1YBVA 2C8JA 4I7EA 4RF4A 1NOKA 4B79A 2QD3A 1BCSB 4IO0A 4QDJA 4P2BA 1WUKS 3H75A 5IN4A 4XCXA 4ZKEA 1K66A 1P2TA 1Z5ZA 2BCEA 1VCIA 4O0LA 2E49A 3VAZA 4KIJA 2QSJA 1Y9AA 3MLBA 3I23A 3W79A 2A1IA 1D0VA 1Q20A 2JDIA 3PDUA 4BCCA 4X90A 1ZI9A 4EY4A 4DARA 3NWPA 3QKSB 4GBGA 4Y6QA 1K92A 3DQQA 3M82A 5JJ5A 1A8HA 3IEPA 2UU9B 5KQMA 2HWXA 1R4ZA 3OOYA 2JFBA 1N8KA 1V8DA 3FFWA 2I4LA 1FRNA 2XNHA 1JEJA 1ZCFA 2PRKA 2R5WA 5EJFA 1I4DD 5ESDA 2QTFA 5LB4A 3TSZA 3EXG2 4R3NA 3I9FA 2QRNA 3A2NA 3WYGA 1QGUA 1GNRA 3FCSB 3SC4A 1AZWA 4ZZ1A 3FCOA 4F9TA 1WQ4A 4YP6A 4IHQA 1BX1A 4UREA 3RS8A 2EX4A 3SC2B 1BD3A 2WWYA 1GY8A 2JCYA 1RFLA 2BFCB 1DXQA 3OOJA 4M1WA 4NONA 1WLSA 1AV7A 2PZMA 3ZI7A 2HHJA 1BGWA 3F6RA 4M6WB 1JIXA 4D46A 4JMPA 3X2EA 4AJOA 1L5SA 3E3AA 1FRZA 1JSCA 3KPJA 1UEJA 3PNOA 3GOQA 5CLQA 1QGAA 5EFZA 5EWLA 3CPSA 1EVQA 4F3CA 1QMPA 3DAFA 3L0OA 2OQIA 2R6CA 1KHTA 4WN3A 4YS6A 5E95A 1VXRA 2BHNA 1FYEA 1E2UA 1YGPA 1IBCA 3MW8A 4IDGA 3N2GB 4TWIA 2FMHA 3DBRB 2QVBA 3WK8A 4DC0A 4YT8A 2WYUA 3EX7C 1QU3A 4L51A 1XZMA 3H6HA 3IVRA 1P75A 3Q8KA 2HO5A 4BXOA 4OQLA 3SI7A 1EX6A 2FRDC 1M1ZA 4MKXA 1JZTA 3QWHA 1PL7A 3L0ZA 4NU6A 1KKUA 1YQDA 4O4HA 2BMEA 4XFKA 3RYCB 3KJZA 3Q40A 5HPYB 4XI9A 4ZQIA 3TIFA 5I45A 1ENOA 5FI3A 3CXUA 3D5TA 1OASA 1IDN1 3FVTA 4DDHA 3K2QA 3F5FA 1P5ZB 4AVYA 2X8BA 4JUAA 4GG1A 1WXXA 4X6YA 3EG9A 2DHCA 3IHKA 4HC4A 2G8NA 4AY5A 4CUJA 2XTAA 3KG2A 2AZTA 1MVOA 1TTQB 1HT0A 1D1QA 4OU4A 2ZREA 1QIEA 1MB3A 1LWNA 1T0PA 2GFIA 4LK3A 5LP1A 2I54A 4LYFA 4NS1A 2PN1A 4E7PA 1XRNA 5KU7A 1XFDA 2Z08A 2EQAA 4OHBA 4QVGA 1EFPB 1RAGA 1M75A 2XMZA 3VKWA 4Y1RA 1O8CA 2BUAA 2NSJA 2AS0A 3Q88A 3Q0IA 2M6LA 4DV6B 1WO8A 2LW7A 4TROA 3REFA 2FDRA 3CR8A 3MWEA 2KMLA 2C0CA 2GNAA 2ICAA 2ZJ7A 1QUFA 4KBGA 1G16A 1H2EA 5I5EA 3E9EA 5I01A 3SOPA 1BU8A 2HU5A 3AF4A 4B6SA 2VPTA 4KWEA 1ARZA 3ZCPA 1BZYA 5JU6A 1WXEA 4MYUA 3G2JA 1HA3A 4ARVA 3R0JA 1G2IA 1F12A 3ELWA 1KDYA 3GDWA 1UC8A 4YWJA 1JHPA 4OYLA 5FP0A 5C1PA 1VP9A 4I4IA 1XSEA 3R0XA 3A9RA 3MSCA 1IWPB 2CWDA 4TWJA 3S27A 4FUQA 2IU4A 1NP7A 4LRXA 1KC3A 1CETA 3JZFA 1DJLA 2AFIA 4URFA 2J67A 3HB0A 1BN7A 4WSOA 5A9RA 1MX1A 1Q22A 4KWCA 2WBLC 4WV3A 4U5QA 4DJFC 3AL3A 4KRGA 3DTYA 4FDTA 1E4YA 1RYNA 4L27A 1N2BA 4MV3A 3RREA 1UXJA 4CLRB 4D9CA 1QOQB 4B6FA 1S8FA 8GPBA 4BX8A 5JMTA 4LNHA 1NQWA 4B32A 1GADO 1E1CA 1ZG3A 2JEZA 3BH6A 5B1DA 3V7WA 3PPWA 1RXUA 1S3SA 2H57A 3R0VA 4GMDA 4JROA 3EBOA 2ZP1A 4PFQA 2BSAA 1Q15A 2G7ZA 2E1RA 5AVQA 5CB0A 3PUIA 1DAMA 3NEAA 5INTA 2GYYA 4LRSB 2JNWA 4P92A 3S7TA 4Q7MB 1RP1A 2W6PA 1PR3A 2WP0A 4NG5A 4NESA 5ALTA 3KV1A 4PAOA 1KXZA 1HLDA 3QVJA 5DTQA 2CHGA 3H1TA 4BB0A 4X65B 4PRKA 5FOTA 3RUFA 3VZBA 3WIUA 3MJ4A 1RRFA 2HQRA 4ROSA 1Q19A 1M1UA 4WLUA 2O14A 3ZI0A 2CF5A 2REBA 3ELBA 3FD8A 5KSWB 5IF3A 5JT1A 1F9AA 3TLGB 4ITRC 3DM9B 2Q07A 2X6QA 1M74A 1ORDA 1FVHA 3SMVA 1K98A 4ETIA 4PSUA 1HPLA 2XOKA 2PL3A 4ZU6X 2XD4A 4UAJA 1UR5A 2XLCA 2XMPA 4UCXA 4KIWA 4RPHA 1SU7A 3F5DA 1P9NA 4O4HB 1KK3A 1UKVY 1YMUA 5ALEA 4OY3A 4YRAA 1C7JA 2CMDA 5TPWB 4QRDA 3WXMA 4O2BF 1WF3A 4ED9A 3ED1A 3TLCA 4B4DA 3IQEA 1KORA 1P7YA 1CP2A 1OU0A 2WM2A 4FPXA 4KVGA 4LSZA 4CL2A 4IW3B 1M10A 2JJ1A 1NMXA 3DZDA 4H3VA 4PNZA 4MW1A 2HSJA 9MHTA 2YJ3A 2DPYA 4TSFD 3KWMA 4FDUA 5FDFA 3MT0A 4XOUA 2AF4C 2OCPA 2EGGA 4A2PA 1I3OA 1K7CA 4HGRA 2FHSA 5DW3A 2XMSA 1C3JA 1JN0A 2FMKA 3GZTB 3CH5A 4ZHQF 2GNOA 3WMGA 3IESA 3JQ9C 1EFPA 2QN6A 4ZI5A 4M6WA 4ZDWA 4H1TA 1KEEA 3MUOA 1OA0A 1E9AA 1FX0A 4DIDA 2IHUA 2NO0A 4HF7A 4RD3A 3MWDA 2LIVA 1QVWA 5LLDA 1P2GA 3F4KA 1SIWA 2MIIA 4B48A 4QDKA 4Y3UA 3KSBC 4W5NA 2XF8A 4WT7A 1UH5A 2VAVA 4L5CA 2YBDA 5TQJA 4BHTA 4DM3A 2BKLA 4HNTA 3E8MA 1DZ3A 1P1HA 1IOVA 1UMDB 1UIRA 5CH3A 4CTKA 2ATVA 4LGVA 3U7RA 1DLIA 4MPDA 2IBSA 2GN2A 3IDQA 2HXYA 2XNKA 5C0OE 3AZQA 2I4NA 3PJEA 4FMBB 3B53X 1G4HA 4TKZA 1FTYA 4BMCA 1NMYA 3CEPB 1U2ZA 2GK6A 2VATA 1J5EB 2JIMA 5J1SB 2FW8A 2D2XA 2V9ZA 4Q1FA 1JBEA 4TLLB 3GJZA 5G4KA 4NG4A 3R5XA 5FWYB 1R15A 1T8PA 2G0AA 1YHYA 4JUBA 2PCLA 1PJLA 1HYHA 4MWGA 5C53B 3IEXA 3WTBA 3PWKA 4GE3A 4DLUA 1C3LA 4F4UA 3EOZA 2XRFA 4EHKA 1QJCA 2AX3A 2GN8A 2ZJFA 4HXYA 3V55A 3AQIA 5EXXA 5BSUA 3H5VA 4MGIR 3MQFA 4UCQA 2JLZA 5CJPA 5HGJA 3A32A 1A5TA 1Z5GA 1I4EB 5E7JA 2BFMA 3NBQA 1QZUA 5JSYA 4ENTA 3LVRE 1OWOA 1PIWA 1CY8A 2Y05A 5BV1A 2HJSA 1SVOA 3FWYA 2QTVA 3HL0A 4Q7EA 3L7IA 4MH0R 1TJ5A 4PRZA 3FF1A 4HAWA 5EMJA 4MR8B 2YS7A 3K31A 1J1UA 4BO6A 3E5NA 5CG2A 4HRVA 3D6TB 2R60A 3F67A 3OM0A 2H8KA 2LR0A 4WJKB 3PE6A 4LMRA 4UM5A 1A9XA 2DH5A 2ZK7A 1EGAA 4R16A 2IWHA 1XMXA 1U80A 4RH0A 2RHCA 1OB5A 2QQEA 3OX1A 2A3RA 3QWAA 3I37X 5G0SA 4Y6RA 1ISSA 1P0MA 1XTRA 1JQLB 4BMOB 3U6BA 5EP3A 5B37A 3WRXA 1EAMA 4E3ZA 2QVCA 2I6XA 2QENA 2VH2A 3GFSA 4IDQA 1L5GB 4LPKA 1ODJA 3N28A 1T2AA 1QFMA 3VBEA 1OAAA 4NP6A 1NXPA 2PSEA 3GEPA 5GONA 4EPRA 4RMNA 2H2HA 1E6KA 2VHWA 3JWGA 4W5WA 4G9GA 4OUDB 1VDMA 1Q5PA 3DMHA 3QEMA 4MCIA 4MLCA 4H6WA 4BQIA 2ZKLA 1F06A 1RQRA 2O1SA 3RS2A 1DKOA 2IYUA 2A57A 3KYDB 4A1FA 3DO5A 2QAIA 5CDFE 5I3ZA 4NBNA 7YASA 5EE5B 1X15A 4JBNA 5I4KA 1LSSA 3R3SA 4ER6A 1KEPA 2ZRBA 1Z06A 2HF2A 4OKSA 4EFKA 4NDZA 4DBVO 2VTVA 4Q4JA 3E8XA 4BRUA 4FXPA 4U6SA 1MO4A 1KIAA 1JFSA 1TL7C 4IH4A 3V00A 2EZTA 3A4VA 1JIQA 4LYYA 2XVAA 4H6VA 3QNUA 2FQXA 4IV0A 1K5DA 1V4BA 4J3FA 2MWMA 4LQLA 2H29A 3OY2A 2R5FA 4N0PA 4PQRA 5BSMA 1GV0A 1UOQA 2DWUA 3FFBA 1H2WA 2HWUA 1DAOA 2I2CA 3C5WP 4FZVA 4J7XA 2AJ8A 4R8RA 4TV9A 2XZOA 5EWMB 4RY0A 3VNUA 2KBEA 3MNFA 4XDZA 2H2AA 1DTEA 4GLBA 2FMUA 1MT3A 3PUJA 2ZRQA 3KKKA 3KT6A 5AHOA 4EK9A 3FLMA 4V1CA 5F7XA 5HKKA 3L7AA 4JX8A 2NT3A 2WTXA 1YRHA 5K51A 2NUAA 1DBWA 2V74B 1QYCA 3ZXXA 3I34X 4AC9A 1OIWA 1FSFA 2R97A 2JFHA 2YWXA 5KVAA 3CHYA 3ZHBA 1BXRB 3RC2A 5EMHA 3BKXA 2WMDA 5JNLA 2GM9A 1H4VB 2HPHA 2G1JA 2YJ6A 3B36A 3EUEA 5AXCA 2M6KA 5BUCA 2A1TS 5FNVF 4HWSA 5JPIA 4XXHA 5A0TA 1KY5A 2HA6A 3OZCA 5CFNA 4A4DA 4MA0A 1U9YA 3MCZA 1QRUA 5G3ZA 2X5KO 2ZE6A 4BFLA 1U3DA 5FWYA 4P33A 3HZRA 4CODB 1U0RA 2AI1A 4R83A 1ZNZA 3W4IA 4ETMA 2LDBA 1GGMA 3G5AA 4HO1X 5DNAA 4K9SA 4UTNA 2Y1EA 3NYWA 2AG6A 3THXB 1RJ9A 4GI2A 2JD1A 3ASUA 3URMA 2X4DA 5FLKA 3SJCA 4MTLA 3AIOA 3ONEA 4PHHA 4UCWA 1UK6A 2R1VA 5E1BA 1JKFA 2JLRA 2QOEA 1GQOA 4FQ8A 3OZRA 5T4BA 2NMVA 4YJFB 1AA6A 3KU4A 4V38A 1CVRA 1LEHA 1X7DA 3PC4A 3WL8A 1QHHA 2JLBA 3L8ZA 5KKNB 5FLYA 4F9FA 4F1KA 2WTUA 1PNQA 3HBLA 3VGJA 4LA4A 3VISA 4MR9B 1CPYA 4PYRA 3U5ZB 1YF3A 2PUBA 2QMUA 4FS3A 3SBEA 1W44A 3QMVA 2ZT8A 2QT0A 1PNVA 1RHKA 2CEAA 3CPJB 3CA8A 3H99A 4LBVA 5DM4A 3ZNPA 4JYAB 1TAUA 1GYRA 5B7QA 2BFEB 2C9ZA 5H4GA 1W1WA 4M8NE 5DTMA 2GRUA 3UANA 5L6MB 3W3AD 3VNVA 3R5KA 1CRQA 4GPAA 4LHVA 2K2QB 4W1QA 3SJZA 3I04M 3QYJA 1KI6B 4JQCA 1VRCA 3L7NA 1HV8A 2QQ5A 4KFUA 1U3TA 2AIRA 2CMFA 4LXTA 4Z4QA 4RZ2A 3HJAA 3QGMA 4XM2A 4CEIA 4MWEA 1ID1A 1K6XA 4MDEA 1RQ2A 1I9GA 1ZUNA 2R7MA 3QMWA 2MSKA 2BMFA 2QE7D 3NKLA 2AMFA 3OD5A 3A6FA 2G09A 4Y2QA 3H9QA 1HTWA 1JHOA 3IBTA 2VYNA 3K05A 4PAWA 3E53A 3A28A 1KI1A 1VSUA 4KQ2A 2PBFA 1BVHA 1JT2A 2VWPA 5E4TA 2XZLA 1SVKA 2QLLA 2XITA 1QLWA 1PL6A 2VHTA 3QJGA 3GJ7A 4JT2A 5BN3A 2IT1A 1X77A 4L50A 5F2NA 1NR7A 5IJ0A 3EH1A 2W7TA 3RVDA 3BWYA 1CW2B 2W6NA 3A10A 4Q4JB 1MDFA 3UFBA 1UM8A 3DOEA 3H9JA 1T5TA 2J09A 2QTLA 4GKVA 3N58A 3SFTA 3CLRD 4E2FA 2QLFA 4JWTA 3EZFA 4EHDA 3OQ1A 1H6DA 3PQ4A 1FZTA 1CDEA 1TVMA 2YWGA 4EGQA 1ISRA 4UU8A 4XWTA 1JILA 1NW9B 1A8SA 3OQJA 4LWQA 4RXUA 1ZA1A 1JBQA 3MINA 1E7QA 1SXHA 10MHA 1V4NA 5EQTA 4BBJA 1H4QA 2IYNA 4LYJA 2Q3JA 1MEEA 1WZNA 3RRXA 1GPAA 3IBFA 3L3BA 3R09A 4H17A 4LWZA 1G3QA 4M0MA 4DA7A 2Q6OA 3AI2A 3NM6B 4ZOAA 5JG7A 1MO2A 2QLMA 3UOWA 4FFMA 1IAQA 3A1FA 5TPZA 2RGDA 2PMBA 4C1BA 1FP7A 5DULA 4UNNA 4BNUA 1P7WA 2FJ0A 3ZGLA 4X85A 4Q4HA 3QJ5A 1C8VB 1SU4A 4GQIA 5K20A 1GUBA 3ICVA 2YYSA 2XVZA 1X3SA 1PG0A 2YY6A 4JJKA 5IU6A 2F1HA 3ZU6A 2AVDA 3HBAA 1RE0A 1P8AA 1NW7A 4MV9A 5IP5A 2IYZA 3ZHYA 2ZT7A 4H9GA 1E99A 3PXXA 5CTAA 2GCEA 1XTPA 2BP7B 2YVQA 3OOEA 3QFSA 2ZUUA 4GMFA 6ABPA 1CEXA 2X9LA 1X39A 4CKBB 2IXGA 1TUGA 3DAYA 2BGIA 1OGYA 4KQXA 4Q1EA 5LNK6 2XB4A 4UVIA 1IMJA 5E6SB 4A0SA 1E3QA 1FU7A 2P3LA 2VTDA 4RQTA 4E5VA 3W7VA 5EZQA 4CIBA 4GT1A 1Z6TA 4L8WB 4ND7A 3UA4A 3H2JA 2QRPA 4RQAA 5ILOA 3EZ6A 4OFXA 1JKXA 3TOZA 3OM8A 4CHTA 3RKRA 1Q0TA 1VKHA 4IIJB 4IM7A 4F9EA 1NF8A 1RQNA 3LRXA 1K63A 1Z2NX 4JJIA 1NLFA 1T2UA 1P19A 3I5UA 1NRXA 1LVHA 2NAFA 5EJ8A 1JR6A 3E2MA 2ATIA 4KODA 2CLKB 3FKSA 2PL5A 4HNGA 2Q3BA 5BMOA 3IV6A 4ZD6A 3GXBA 1FFXA 5ERXA 5CDUA 3FOFC 1PV1A 1R18A 5F2KA 1QB8A 3EEOA 2O2HA 1Z18A 3K0HA 1CY2A 1L4UA 3BHNA 2ENUA 3G2IA 3H97A 1E1RD 3ITKA 5IVIA 2FOXA 2M9MA 3IQHX 1O6CA 1UFQA 3ZWOA 4WOBA 4CR8A 1JWLA 5DK6A 3DPSA 6GPBA 5CT6A 5DW0A 1OZGA 1YQ9A 1HFKA 2ZBDA 2PX8A 1EFLA 1ILEA 3BEDA 4Y2XA 3AU8A 1S2OA 1HK7A 5IW8A 3PJGA 2J0UA 3JD3A 3X1DA 5JQGA 1B15A 4YP7A 2QVLA 4ZJYA 2O8FB 3H9GA 5T6BA 3Q8XB 1DO8A 3ANXA 5E4FA 3FPSA 4GOOD 4NCXA 2ZDQA 4Q3KA 2AK2A 3L8FA 4NL4H 1SKQA 3U40A 4EUFA 1DQZA 5HRCA 3UA3A 4JC0A 2Q3LA 3V1NA 3K1AB 1Z4IA 1JAHA 1V47A 2C2MA 4C07A 4AKIA 1YHZA 5BUZA 3MWFA 1U9IA 4IGFA 2WE8A 3LJKA 2IYSA 4PG4A 3HSYA 4LJKA 1L7EA 1F17A 4I2VA 3U4CA 4Z0PA 1A9SA 2IDKA 2ZI3A 2W42A 2YUTA 3SYKA 2J87A 4N5NA 3M4JA 1U1CA 2Q2QA 3RQIA 1E2HA 1SD2A 3DBLA 3LF2A 1CUGA 2PWZA 3MCVA 2GN1A 3ZU3A 1E5LA 3DZHA 3K30A 4BAZA 2YH2A 2QRGA 4NV0A 1QKIA 4CM5A 5J2UA 2JVIA 2C94A 5KU1A 2RKBA 4I5GA 3GGPA 2D74A 3HZHA 2R00A 3GC6A 4HAOA 4MW6A 1MC4A 5CVDA 3O2NA 3E0QA 3OZWA 3TCNA 1J00A 2QSYA 4BVKA 1L8QA 1S4MA 3GGCA 5K3SA 1YS6A 2V5UA 5I9BA 3AFMA 1QE3A 1P91A 3DUFB 4NAVA 4UM7A 1KAQA 2PTGA 5ICEA 4OOEA 2TMGA 3R7LA 1NYLA 2ZZNA 2EW1A 4P4UA 1TOAA 2UYHA 3KOZA 3ZUPA 1W6RA 4DA6A 1Z12A 3BA1A 1PJ2A 3A05A 4N82A 4CR7A 1PNOA 2WJWA 1PO7A 4WX2B 5EERA 3VV2A 2YFHA 4M0LA 2PG3A 3HFGA 4P4LA 4ZVOA 1E2IA 1SBTA 2PFKA 5IUJC 5JWRA 5EIAA 4UPDA 2BFBB 3O4FA 4K88A 1ZWLA 2VKQA 3ZWPA 3UHFA 2HDWA 3FOCA 5J5VA 1BRTA 1E3DA 1OZHA 1W2WB 3KQVA 2O20A 1A8IA 2EEPA 4K26A 1LF0A 3DDNA 3OEHA 4EI7A 3D8HA 1A1VA 1ZNYA 2ZBGA 3FRJA 4BKMA 1N33B 2XW6A 4WUVA 5IM4F 2AVNA 3A11A 1LY1A 3IKVA 2WT4A 2VHYA 4NULA 2WSYB 4EWLA 1ZH6A 4BUZA 2WTBA 4RLQA 3FFTA 3V1MA 2NSHA 5BWCA 5AOAA 4EA9A 1Y4UA 4M89A 3CONA 5CFZA 1AHIA 1VL6A 3SKYA 5KYYB 4OM8A 1PFYA 3OJLA 3VPCA 4F2DA 4N7RA 3X0DA 2VNHA 4R2WA 3CLRC 4DNPA 1JA0A 1VECA 1ZK3A 3ONFA 3PENA 3SFVA 4PN3A 2RAUA 3TNYA 3NTOA 4J0FA 3PQDA 3RT9A 4RZXA 1GUAA 2QLTA 1E1QA 4BU0A 3PNPA 1NBHA 4MDHA 1T8UA 4IH9A 1BXZA 4KL8S 4ZIRB 5AXBA 1BKDR 3BICA 2A33A 5CB4A 4BP1A 3CUVA 2HRZA 2HKIA 4PBTA 5D1NA 4B6JA 1ADJA 4FN5A 3QELB 4Q3AA 5F23A 2VTBB 5JW6A 1I5RA 1GTL1 5HZMA 1NVKA 1B2LA 2EARA 1PT7A 5DCWA 1ODFA 2EWMA 4FFBA 2X5XA 5E38A 5LM3A 1F60A 1FK8A 3EIOA 3MPUA 5FWAA 1I33A 1I30A 4FR5A 3OJWA 4EG7A 1JEYA 5K8IA 2V7XA 3RRYA 4UTRA 2X9QA 1RR6A 1MIOA 2EP7A 1CJCA 3VQTA 3TGWA 1YQUA 2ZZMA 3BMXA 2YNMC 2IOFA 1OU4A 3D4BA 1UMKA 4S12A 4UBKA 4UEWA 2KLHA 1R27A 2CCJA 4KWIA 3OUZA 2NSDA 4MQ6A 4IPTA 1OLSA 2YDXA 1BKYA 1M83A 4RS3A 3UG7A 4UC0A 1PF7E 2VDRB 1AKVA 3E7FA 3KDAA 2FLWA 2EW8A 2R68A 4N7JA 5DLDA 1E1DA 2PH5A 1S01A 1SVIA 2VNIA 3HXOA 3B3AA 4F5DA 4UQPA 5T3UA 1SCDA 1TZJA 2NV0A 3U6KA 2IZ0A 1QS0B 4UCFA 5BNZA 4BKQA 5K99A 2GEVA 2FZCA 2NQ2C 3N59A 4G8JA 2VI5A 4BVHA 2C2WA 5F77A 1KMMA 4M36A 4ZZIA 1JPVA 1ZN8A 3EFHA 5AM5A 5GJBA 5JCXA 1GR0A 4F9GA 5KYGA 1UMCB 3OPYA 4JUIA 1TZCA 3PKZA 4A3SA 3NDBB 2C2GA 2F4NA 1GFWA 3LQ1A 1KPHA 4KWTA 5JJIA 2BM9A 4PG7A 2QRMA 3ZK9A 2PKQP 3CEAA 4AMZA 3K0BA 3KIPA 1G64A 4XM0A 1QZZA 1JYSA 1ZXLA 3GOHA 3Q3HA 3KQLA 4HGYA 3SXPA 3QKIA 1EWKA 3C7TA 1EP3B 2DFTA 2QQFA 5EXEA 2I4OA 1YFJA 4DLPA 1HDYA 1E79D 3CX3A 3V80A 1ULZA 3O74A 1X1QA 4UDYX 5GINE 2QF7A 3NBMA 5FO1A 4AW9A 1W5EA 5LMNB 4GI5A 3LCRA 5FL3A 2QP3A 2ZUDA 5CX4A 4LRWA 1M2GA 2FSSA 2ZTMA 1R6AA 1YK0A 3P9QA 3TJZA 4TV8A 2FI1A 2BEWB 3IP5A 3M34A 4MEBA 4YJ3F 5F4ZA 1XQVA 4NCBA 3ZK8A 1Y80A 3RU2A 2QRQA 4DMGA 4ZYLA 4MDFA 1VCNA 2AOWA 1YJBA 2B2CA 1KAMA 1OQAA 2VDWB 3OZSA 3QSGA 5C1DA 3U09A 2HCFA 1EGHA 3AJ9A 5EHXA 1E77A 3ACBA 2H4HA 3IRVA 3CKMA 2F8SA 2UYYA 3W2HA 3FUCA 2P6PA 3O7MA 4ZU3A 3NWJA 1ATZA 5IHXA 1S1MA 1DUIA 3AVVA 4YNBA 4N03A 2HF9A 3W7BA 1QCYA 1YACA 1TO2E 1GQQA 3CG0A 2WHPB 2CDAA 4S1OA 4CCYA 2ZIXB 4PYIA 5EZ6B 1QUEA 3S3TA 4C1NA 3L77A 1E2MA 3LUFA 1DVRA 4MKGA 2Q0QA 4AJKA 4XX0B 2GEJA 3N05A 3DF7A 2XKKA 5IRCD 4MVJA 2P2DA 4BVEA 1NV8A 1ZR4A 2HPVA 1NP6A 1PJBA 1TLTA 4IOJA 5H7XA 3GLHA 1OA1A 1CUSA 2HX1A 5HA5A 3VTFA 5BSWA 1XELA 3B5JA 1RWXA 3K9HA 4I4TB 2VF8A 4JI6B 3IBGA 2QRVB 4DCCA 1IXYA 2H5IA 3GJYA 4KK3A 1HYBA 4L16A 4TYWA 4XM1A 1CUZA 1QG6A 4HUQB 1KYIA 2E1PA 1E6WA 3HP1A 1Y33E 3D1JA 4BGVA 4BZQA 1QYIA 3ZDCA 1GG2A