1CR2A

Crystal structure of the helicase domain of the gene 4 protein of bacteriophage t7: complex with datp
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
277
structure length
239
Chain Sequence
MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKSGALRQLSDTIIALERNNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the helicase domain from the replicative helicase-primase of bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase
molecule keywords DNA PRIMASE/HELICASE
total genus 75
structure length 239
sequence length 277
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cr2A00
3O8CA 4QBHA 2GAOA 4XD7D 2IEZA 5J4KA 1AGPA 4X8OA 4Q1BA 4WZAE 5FL7A 2VF7A 4PHFA 4HDQB 3KTAA 1JI0A 1TF7A 5F9HA 2LKDA 4DT1A 4DB2A 1HH4A 2WAXA 2R2AA 2O52A 4EDHA 1DPFA 1GZSA 2DCUA 2IYSA 4G5SA 4HATA 1KSHA 1KSFX 4JJKA 4W5JA 4ZO4A 1QHSA 4HAYA 4IOMA 4AURA 3VR1A 2WIBA 1FP7A 5GVRA 1AKYA 4LDJA 4ITRC 4E22A 4LSGA 5ANRB 5FUYA 1SVMA 1IJFA 4A2QA 1ZW6A 4B3DA 3GLIE 5M04A 2WVJA 2VP9A 3QXXA 4B3BA 2QE7A 5EE9A 2UZIR 4GMXA 2O8DA 3FFAA 2ZUBA 2LCFA 3R20A 4L16A 5FBWB 4S35A 4HZUA 4RJLA 3JZAA 1IHUA 1X1RA 3T34A 3SFZA 1NY6A 3VX4A 1N6HA 1SHZA 2B8WA 1JR3D 2QORA 2W2XA 4LJAA 3E1SA 1UKZA 2YYZA 2HLDA 1ZBDA 3KXKA 2QAGC 3I62A 3GJ8A 3U6KA 1G7CA 1HT1E 4V0ME 1SXJB 3L43A 4UXHA 3SDZA 1DVRA 1EFRA 4LV8B 4H1UA 2XXAA 2DYKA 3MSXA 4YLGA 3U3OA 5HKKA 3GMTA 2A3RA 3NG1A 1II8B 3QSYA 1VHLA 2V55B 4DLUA 4Q4HA 4ARZA 4OQXA 4A92A 2IYVA 2ZRBA 4OHWA 2WBLC 4OHVA 4HB3A 5FTLA 4HAVA 3AUXA 4KI0A 2EVWX 1FZQA 3R7WA 1RC8A 1LF5A 2WIAA 4CEJA 3RRNA 4JBXA 1VCNA 1DAHA 4DLSA 2NZJA 4EJSA 3B1XA 3OESA 1ZC4A 3OIWA 3BFVA 4BQSA 3L2OB 3D31A 2IS6A 2ASEA 2R62A 3ZVRA 3CUEF 5B2ZA 4AY2A 3G82C 2N1BA 4AG6A 2FF7A 3Q7PA 2IWHA 3VR2A 4ACAA 3ZH9B 3SEAA 2QQ0A 2QSYA 1Z28A 3LO5A 2A7QA 2GHIA 4OBEA 3U3JA 2IYQA 3B13B 3TK1A 3B9PA 1V5WA 4DDTA 2C04A 1N3BA 1SZPA 1LY1A 2JEOA 3UMFA 4JVLA 1YKSA 4M1KA 1XWIA 2P6NA 2CCJA 3B85A 3PITA 3E2IA 1E2HA 3H0KA 4YMSA 5JJIA 1YZKA 1WXQA 2OSBA 4I81A 4LHZA 3WYGA 1Z3IX 1Q20A 2WMNB 2IHYA 1G64A 4Q4JA 4QGHA 1NN3A 2ZSFA 4QFMA 2C9CA 4ASUD 4DUGD 3U44A 3C16C 4LJ7A 2R65A 4OI0A 2RGXA 1EGAA 2E9SA 5FPSA 4R98A 1PUJA 1QG2A 3NH9A 5AUOB 5SZIA 5K8UA 4PHHA 3KKPA 3RS7A 5FBVB 2C96A 3MWKA 1Z47A 5L3QB 5JCZA 5KUTA 2OBLA 2D2FA 3W5IA 1OH6A 4OHZA 2PX3A 1BYUA 4V0OA 1RYFA 5JS8A 2RGEA 2A5FA 4TLAA 3OIUA 2WJGA 5EXPA 3GLGE 4A15A 3QENA 1P4SA 1GRRA 4LJ9A 2YWGA 5DI3A 3TAHA 1KI6A 2GTPA 3NWJA 2BJVA 3O8DA 5HE9A 3VKGA 1W0JA 3MWLA 3NHAA 5JSZA 1JQLB 4JLBA 4RD0A 3ZZUA 2IXFA 1M7BA 3B8HA 3P26A 2C8VA 2F1RA 4WZBE 121PA 2NO7A 4BPBA 2FOLA 5FTJA 5LD2B 1G8PA 1S9HA 2OXCA 5HE8A 2NQ2C 3BH0A 1CJKC 4DIEA 4HZUB 2GJ9A 3W5JA 4AYWA 3EZ7A 4MRPA 4GRAA 5K8LA 2RGAA 3K0AB 4HLUC 4TYPA 2CMKA 2W6JA 4HAWA 2ZR9A 1LVGA 4M1OA 1T3HA 4FWIB 4UJ5A 1UAAA 3TNFA 2KBEA 1TQ4A 3A1SA 2AWNA 2CL6X 2ZRAA 2QPTA 3CNLA 1SXJD 1Z83A 2TMKA 1SQ5A 3RANA 1YZLA 4ZDIA 2NPFA 3DKPA 4Q9KA 4XWOA 4B3XA 3ZIAD 2EWVA 2H1LA 3PUVA 5HCIA 5BYJA 1FTNA 1YU9A 4FINA 1DADA 3QG5A 1C1YA 2V1XA 3KQUA 1W46A 2ZITA 2OBMA 1J8YF 3O8BA 3U3MA 1QRAA 1Z0AA 2WWXA 3QF4B 2JLZA 4DCVA 1KDTA 3AKDA 4WBSA 1NMYA 4X8MA 3AV0B 4M21A 2JLXA 3A1WA 2QEQA 1KSGA 4NYJR 4KU4A 3ND9A 4B75A 4JL8A 2Z4SA 4XSHA 4O25A 2VA8A 1GDDA 1GL9B 1TUEA 2EFHB 2FZLA 2QPAA 2QTHA 1IN7A 3AVUA 3IPYA 4JJZA 5C46F 4Q47A 4D0NA 5CB8A 3AVWA 5KNDA 1EXMA 2P65A 4H1VA 2R9VA 4Q1CA 4XTCS 4B6FA 4CEHA 2YZ2A 1E32A 3B60A 2F3RA 4RCZA 3NIBA 3RLFA 3T15A 4FWTA 5GJWC 2DFKB 1NIJA 4CZ2A 4LBZA 4JYCA 1VYVA 1Q1EA 3UMSA 3WY9A 4CT5A 4BLRA 2G83A 4V0NA 1OYYA 4EQ6A 4YMVA 2F1JA 4FCWA 1LTQA 3SNHA 2WWGA 4IVQA 4JBYA 4ZCMA 3U7FB 1H8HD 3GLFA 5SZKB 1U8AA 1VKJA 1W5SA 1LB1B 3W8NA 5KDLA 2Q21A 4US0R 1KK0A 2J0SA 3E70C 4URUR 1R5NA 2DBYA 3SJZA 2ZRGA 1DEKA 4PXAA 4RZ3A 4TL8A 4BFTA 4DT1B 3EXAA 1G9XA 4MUAA 4ERNA 2H92A 2QT1A 2C9YA 1YR9A 4MRSA 3HWSA 5FPKA 1ZUIA 2OILA 3BIFA 3FKSA 3K8YA 3ZVMA 3OIYA 4B43A 2JLUA 4LX0A 4PQRA 1E96A 4DKXA 3OEHD 4EPYA 4EFNA 2QTVB 2DFLA 5KSZA 1KAOA 3LNCA 4URZR 1MV5A 4A2PA 1NG9A 1UDXA 3AVXA 3WNBA 5H1YA 5DI9A 5DSZA 2KBFA 1EFTA 4F38A 1I2DA 2G0NA 4NCNA 1UM8A 3MGCA 3AGPA 3CPHA 4RD3A 3R7WB 3NDBB 4G3XA 1E9SA 3CRRA 2VSOA 4M9QA 4OQLA 5TDHA 1BIFA 4UNSA 4DJTA 4G5RA 4TLDA 3B7GA 4B73A 4OKSA 2O8BB 4FW9A 1E9RA 1PLKA 2CEAA 3QI2A 4M4SA 5E7JA 4ZKEA 2ZRKA 4RZ2A 4HAUA 1S96A 3OFND 4DCSA 1G3IA 2NO1A 1CU1A 4BGDA 3DL0A 2F9MA 4JL5A 3IHWA 3DHWC 5C2JB 5TB5A 1T91A 4RKEA 3GLGB 4NKRA 3N70A 1WMSA 4DSTA 3UG7A 2O5VA 2GJKA 1E2NA 2IL1A 3K9GA 3I1FA 4R7ZA 5J4LA 1QHYA 2GZDA 3AF2A 4GP6A 2L0XA 1UDWA 3OIVA 4ZCIA 1VCIA 2P6UA 3KFVA 4D4JA 3UK6A 1QHHB 1S1CA 4URYR 4HUQB 3A4MA 4Q7MB 1V43A 2R6FA 1RJ9A 1P9NA 3BORA 4TYWA 1VG9B 5BN5A 3LW7A 1E9DA 4V0MA 5DHAA 2XB4A 2W6JD 3WHKA 2FFHA 4W9MC 4LJ8A 3SJAA 1G1MA 5TV2A 4E07A 2OEPA 5L3SA 1DAGA 1U0HC 5SZJA 2NO0A 1NKSA 2WWIA 1DE0A 1TNDA 4LJYA 2GDJA 4RD1A 3CONA 4LJ4A 4TMTA 4QBGB 4QBIA 3F0TA 3GCGA 2H5EA 3I4LA 1XMJA 2FSGA 1F2UB 2QMHA 4Q9HA 3VMFA 2ZTSA 4AKEA 1ZUHA 3DZDA 3FWYA 4D6PA 4CGZA 4F92B 4PQFA 3SI7A 3AUYA 3QNUA 3CX6A 2EFEB 3EG5A 3IQXA 1T5IA 3C4JA 2HJGA 2XTMA 3K0CC 4IEEA 4ZDKA 3EW9A 3FOZA 1KAGA 4O2LA 1J7KA 5H70A 4OQMA 2ORVA 4JVMA 1W0KA 5AUNB 1E9CA 2QMEA 2I1VB 2OZEA 4OHXA 2ZRCA 1JAHA 1EFHA 3HR7A 3K53A 4W5HA 3ADDA 2G6BA 2ZJOA 4R9UC 1QHHA 1US8B 1UFQA 2HJVA 1W36B 1MT0A 2GKSA 4RD6A 1KNXA 5J5CA 4C9BA 2IC5A 2AD1A 1BS1A 4FMDF 4BWYA 2CNWA 5FL3A 3PIRA 3UWKA 2GILA 3GFTA 5CM9C 1G7TA 4TWZA 2ZU6A 4MDEA 4OK3A 4BFUA 4G01B 1P2VA 2IWRA 1Q12A 3NBFA 3SU8A 4FMBB 1FW6A 3RAPR 4JLMA 1UKYA 1KI6B 1Z06A 1E2DA 3SQWA 5L3RA 1DBSA 1OHHA 1COWD 2RB4A 721PA 4BLOA 1G8YA 4PZZA 3I8SA 3TH5A 5C18A 2FSHA 1HYQA 4EUNA 3BH7A 3Q8XB 5G40A 1DAKA 1IN6A 1CBUA 4TYYA 5JZVA 2BEJA 2ZRIA 4YMWA 1N5KA 2GESA 2RCNA 2D62A 3UIEA 3W3ZB 2IXGA 1Z6YA 1KIMA 2V7QA 1U0LA 1KDPA 2CDNA 4N0EA 1VYUA 4URXR 4OQNA 2G0TA 2V6JA 1GVNB 1E2KA 2QNRA 2OCYC 2QY9A 3B5JA 4MKFA 2VRWA 3HPQA 2CL7X 1PVOA 1PJRA 1XFAA 5AUPB 1AJEA 3GJ5A 1GFIA 2J46A 4AC9A 2REOA 1A7JA 2GCNA 1OB5A 2WJVA 2BMJA 1LF0A 1XMVA 1NSFA 5JJLA 2WWHA 3IKJA 221PA 5L3VA 1X8LA 1NN1A 2IW3A 1F6BA 2FEOA 2YJTD 3K0AA 4KYIB 4RCYA 4UQOA 4A8JA 2WV9A 2DWQA 4DIDA 5EQTA 2WWYA 2R44A 1FPMA 2HDNB 5CYPA 3CB4A 1DAEA 4B2LA 1GRQA 5CLLA 1QHIA 3A36A 1VIYA 4F93B 3THWB 1E2PA 3ICEA 4AKIA 1M7HA 5JWHA 4GFDA 4KITB 2XZOA 1NJGA 5EXXA 1IN8A 4WAUA 3ZVLA 1DAIA 3MWJA 4JZKA 2ZYUX 4Q9LA 1M2OB 1NLFA 1E2MA 4GI7A 4EQ6B 3R9WA 1XEXA 1FTSA 3A6PC 1ZM3A 3VR6A 3QKRA 1E94E 4HB0A 4EJSB 4GBMA 2DR3A 2XJ4A 1II9A 1NF3A 4LC1A 2RGNC 1JEEA 3AP3A 821PA 5KPJA 4L5BA 1XPOA 4Q18A 1HV8A 2GF9A 5AK0A 1LNZA 3B1ZA 2G3YA 1PLLA 4NHOA 4B2PA 4CEHB 5DLQC 2VQSA 1YHNA 2A5JA 2DWPA 4KV9A 1RVDA 2CLDX 2ZIAA 2QM7A 5GJBA 2PLRA 1IXRC 3HR8A 4NCJA 1OH5A 2V8OA 1FNMA 2OFWA 3BBPA 4NMMA 1KO1A 2V3CC 3TRFA 3GFOA 5DN6A 2ZSBA 5HCNA 2ODNA 1OFUX 4FMDB 1M1YE 3MAAC 1Z08A 2WJYA 4NBSA 4OL0A 1E3MA 3WYFA 4MKGA 1XTIA 2UZ3A 4ZDWA 5HPYB 3T1QA 2YWEA 2IA5A 4W5WA 2WJIA 3P20A 3CWZA 5CJ2A 4L9SA 3C41J 1KO8A 2DB3A 4ZI3A 5FTNA 3IIJA 2MSDB 1E2LA 2XNSA 1HA3A 4KLZA 1MO5A 2P3SA 4FN5A 2DPXA 3PR1A 2JLWA 1LV7A 1XXHE 4XOIA 1KKMA 4ZKDA 1KSJA 1AM4D 1XTRA 1KJZA 2ZJYA 1VYTA 4LJ5A 3V4RA 4UKDA 4QJ5A 4IKEA 2J0QA 3FTQA 3N2EA 4RZUA 3ZJYA 4KSBA 5DE3A 3AQ4A 2OT3B 3OZXA 1Z0FA 2PT7A 2VLIA 2G1KA 2OUKA 1OIWA 2WKRA 1BH2A 2ZJ5A 3QIAA 1ZYUA 5EP3A 4TMKA 1U9IA 3WMEA 1O3YA 4YXWA 2A5DA 1JAIA 1NSTA 1IQPA 2FDCA 3FHTA 1MKYA 3ETLA 2YWFA 3REGA 1K5DA 2PLFA 3L8YA 5FOTA 1VPLA 3SC3A 3TSZA 1WBDA 3GPLA 1G8HA 4M53A 2ZRNA 4EPTA 4B3CA 2Q9CA 4JMPA 1NMZA 4RVCA 1G5PA 3AF1A 3K09A 5J4YA 3CLVA 3IBYA 4Q1DA 1G7RA 1QZXA 2QAGB 3NVAA 5DGXA 2NGRA 3H2YA 3VHLB 2NPIA 4OQFA 4IFBA 5HR5A 1NG1A 4BZQA 1DO0A 1YZUA 5AUQA 1W36D 3LWNA 4E09A 4C0AC 5DN6D 1G5RA 2Z0MA 1A2KC 1P2SA 2BKUA 4BE7B 1YQTA 4D81A 3K0FA 3NBXX 4LWZA 3RS2A 4IOLA 3FHCB 1M34E 4U00A 2OAP1 4I99A 1F2TA 4N3NA 2BOVA 3DZ8A 4O2RA 4Q00A 3T1OA 4CRWB 3V00A 2HYDA 4QJ3A 4PPGA 1Q0UA 2WOJA 3QXJA 4IVPA 2F43B 4OHYA 2ZRJA 2REXB 4TTPA 3D8BA 3NXSA 5HZKA 1ELOA 4LZZA 2QP9X 5FPHA 1WB9A 1W0KD 5J40A 3CNNA 3ASYA 2IX3A 1W4AA 3DMDA 5CLQA 2BM0A 1VECA 2CXXA 2DFTA 2HCBA 2W6ID 4BZPA 4CF7A 3H84A 1QHNA 2JLVA 2AWOA 1Z8FA 4L4UA 1EG7A 1MO6A 5J4VA 1U9IC 1ZD1A 1D5CA 2J45A 4NCHA 1OH8A 1NVWQ 1GKUB 4XWKA 4EFMA 3HPRA 4XVUA 2FMXA 1RE0A 2QAGA 4PQYA 2RHDA 1ZIOA 5KDDA 3T1TA 4NYMQ 1SULA 1F60A 4YXWD 3TGPA 5FOUA 4LRWA 1OXTA 4A0FA 3QJYA 2QT0A 2VTKA 4ABYA 1JEDA 2OFOA 3VHXA 4B3FX 2QP3A 1NVVR 4X8HA 3NC1C 4M1SA 1ZRHA 1XJCA 2FSIA 2BM1A 1YR6A 2F1HA 1NN0A 1WDTA 4QRHA 4DVGA 4Z1MD 1W1WA 2ZXUA 3Q72A 4RSGA 1P2UA 5EP2A 2ZSEA 3LBNA 2J5XA 3B1VA 4ESVA 4JT2A 4Q1AA 3AF4A 1JALA 1QVRA 2FPLA 2FZ4A 3PCRB 5K8IA 4Q4AB 2XAUA 4P33A 5FPTA 3SR0A 1CJTC 2YVUA 3LX8A 1U94A 3THYB 2AR7A 1PLJA 1NBME 4V0KA 3HDTA 2GEVA 5FL7D 4G1UC 3NKVA 4TLBA 2WWFA 1AN0A 1PZNA 3VFDA 2AKAB 1BMFD 4DEXA 3NC0C 1ZM2A 4GPTA 4HZIA 4LV5B 3A1UA 3NEYA 3NHBA 5EXSA 5IT5A 5A4JA 3QXSA 1EFRD 1KO7A 4LOAA 2Q3FA 2ZQ5A 1CRQA 2ZROA 3EWAA 1OPXA 1WQ1R 4C7OA 2JLSA 2VIIA 3EZ2A 1ANKA 3B2EA 4KCGA 3TKLA 1OFHA 1AS3A 2Q9AA 3I3SR 3RSLA 4II7A 1JB1A 1SXJA 2PZGA 3PVSA 3V4FA 4NYJQ 4QOSA 1BO6A 1R0YA 5BYKA 5HKKD 1CTQA 1BYIA 2RGBA 3F8TA 4IXMA 1JJVA 1G6HA 3KDSE 2NG1A 2BCGY 3AM1A 5D3MA 1Z6GA 2G1JA 1JXOA 3CPJB 1LS6A 3X1ZA 2VO1A 4A6PA 1IY2A 2YOGA 4Q4JB 3T61A 4BFSA 5KYKA 5EE3A 3NDPA 2ZPTX 2W00A 3CRW1 3QF4A 3I72A 4Q21A 4JVSB 1HT2E 2D7CA 4I1SA 4MGZR 5E7MA 1P7CA 1IJEA 4E03A 1T8UA 4KYUA 2WZQA 1S3SA 2FPKA 3AF0A 1QVAA 4HB4A 3HU3A 3EASA 5E4FA 1KI1A 5CIWA 4H9GA 3TLXA 1A4RA 3K0SA 4TL7A 3W6NA 4P4SA 3RC8A 5H68A 4M1WA 1KK2A 3M0EA 1GTVA 1TU4A 2KJQA 1UEJA 5FTKA 2G88A 3W3AA 3T12A 1N25A 2I4IA 521PA 5JECA 4UXIA 3C14C 2Q3MA 2EU8A 2GK6A 2WICA 1OH7A 3TAUA 1XX6A 4MKIA 2REBA 2CHVA 3SFVA 1X6VA 1JR3E 1XTJA 3BERA 1T6NA 3VAAA 1S9DA 4TL6A 2QRNA 3BWDD 4QC2A 1UADA 1XF9A 1OLOA 3SJCA 2QTFA 4LHYA 4UNQA 3RDPA 3S1AB 5FOXA 4B74A 1JBKA 2WM9B 2GVDC 3QVUA 3ONWA 3M1IA 2ZJ8A 2JJ1D 2KSQA 3X1YA 1WRBA 8OHMA 2FA9A 2JIZD 3KJHA 1TMKA 4PAQA 1JJ7A 1R6BX 3CX7A 2EFGA 4JKYA 2XZLA 4DLYA 3SHFA 2WTUA 5CDFA 3CW2A 2EW1A 4B47A 1TEVA 3A1TA 2ERYA 1R7RA 3VQTA 4NCIA 3T5DA 2WSSD 2KI5A 2OBNA 3B82A 1KDRA 3OFNA 3RS0A 3TUJC 1OXSC 3LX5A 3PEYA 4PPQA 1CR0A 1G5TA 1AZSC 5TVKA 4ZV4A 1Z6AA 3LRPA 4NPHA 1AS2A 1GNQA 1S4QA 1KI8A 5TARA 1FFHA 3LLUA 3OEEA 1E9EA 3TW8B 1GAJA 3VX3A 1Q1QA 2WJHA 3UATA 2AN9A 1UPTA 4B33A 2AK2A 4TYQA 4BFZA 1C4OA 4HDOB 2BIFA 2ZI3A 2CNWD 1EX7A 1IXSB 2GXQA 4ZPXA 2H16A 1TF2A 2FJUA 1HE8B 2ZS8A 3ADKA 2V7QD 3CX8A 1U8ZA 4OI1A 4NTZA 5DH9A 2V54A 4LJ6A 1WCV1 2C95A 5P21A 5G3ZA 1AK2A 1R0WA 3VTKA 1DARA 2BBOA 3A4LA 4WXPA 3SE0A 5AJYA 4CDGA 2J1LA 5IRCD 1MO4A 4AKGA 4HDCA 5E3HA 2RGNA 4DCUA 2GCOA 3GLIA 3ZYCA 3GQBA 5TXGA 4TQ9A 3CZQA 3THOA 4KO8A 1QHGA 2GK7A 4TMWA 4RD4A 2Z6VA 1J99A 1JR3A 1E79A 4EPWA 3I61A 3MLEA 3N5CA 2O8EB 4NYIR 2GXAA 4QKQA 3GLGA 1XMIA 1Q22A 4WXRA 3CM0A 1IAQA 3TSOA 3KJIA 3K0EA 4Q4HB 4ARZB 2JDID 2YWHA 3DPUA 1C9KA 4PC3A 1RJ9B 3L82B 4PO9A 3T35A 1G18A 1WBBA 3RYTC 4A0HA 2QUZA 2ZANA 2IF0A 2JAQA 2VL7A 1LS1A 3QVVA 2B7CA 4PC6A 1ZM7A 2VP6A 3K0FB 5JCPA 3C7KA 3O47A 5JI3E 3EZFA 5AJZA 2XTZA 1VG0B 5AR1A 4LYHA 1T0JB 2VHCA 3DM9B 3RRYA 1FUUA 3D7MA 1BKDR 1MO3A 2FFAA 4E5UA 3LBIA 1SVKA 2YINC 3AEZA 4QGFA 2OFXA 5CK4A 3K09C 5FI1B 1EESA 2P0EA 1RPZA 2GBLA 2I1QA 1N6PA 2OM2A 2D06A 2FEMA 1G6OA 1OFTA 2H18A 2ZREA 5F9FA 3LBHA 1Y63A 1J8MF 1KK1A 2C5LA 3SBEA 1KI2A 4Z8YA 3CO5A 1CULC 1GNPA 2WJJA 3TSWA 2JCSA 1Z0JA 3EIQA 2XNDD 1OV4A 3KJEA 3CH4B 2BMEA 3IO3A 3GEEA 3OAAD 1A2BA 1E4YA 4GNKA 4LI0A 1F3OA 3W9YA 1TX4B 2C78A 2HF9A 3NBYC 3Q9LA 1JR6A 3OEHA 5L8VA 1XXHB 1OIXA 3DMNA 4IDQA 4Q66C 1W44A 4WOPA 3SOPA 2N46A 3KXLA 5L3SB 1IN4A 4EJSC 4MH0R 1EX6A 2PEZA 4A1FA 4S2EA 4WIAA 2JLYA 5FI0B 5AJVB 3KKQA 2CLCX 4AG5A 2AK3A 2GXSA 1VHTA 1VDZA 4Q5IA 5FOSA 4KVGA 1ONBA 2JJ1A 4KHZA 2J3EA 2XTNA 3A1VA 4M1MA 4PSVA 1DELA 4DDVA 3DM5A 3LD9A 5G41A 2NO6A 4QM7A 3BAFA 3GLHA 3PXGA 1XU4A 1Z2CA 1G291 1S0UA 1XRJA 1QG4A 1DAFA 3SN6A 1E1RA 1KMHB 1II8A 5E95A 3DEFA 3LV8A 2C2HA 5KDOA 1KGDA 2JDIA 4LBVA 3W90A 5JRZA 2ZUCA 2ZRDA 3C5CA 3IGFA 1AKEA 4OJKA 3X1WA 2J41A 1RZ3A 4PSKA 2A5GA 3I5XA 3GJXC 2O8CB 2GBLC 4K46A 4QG7A 4M1TA 4EPXA 3KXIA 1P6XA 4A8JC 1P9WA 4Z8XA 1KHTA 5C4MA 4P4TA 2CVHA 1SVIA 2ONKA 1GKYA 2RAPA 5AWFC 2Q3HA 1EFUA 2QBYA 2R6CA 1G21E 4QXAA 1Z29A 3KQHA 1KZ7B 1VCOA 3QKSA 2QI9C 2GETA 2B7BA 4D80A 1A5TA 4G5GA 1P60A 2FFQA 2GAAA 2JATA 4A6XA 2DY1A 2BVNA 1KI9A 3IEVA 1G7SA 2BWJA 4KBGA 3WP1B 4ZIRB 1NMXA 1E98A 3FHOA 5CB6A 3MCAA 2BMFA 1P62B 5FOWA 3UANA 2DFNA 3QPUA 4AIIA 1OF1A 4OK6A 2RKOA 4A4DA 2P5TB 5FOVA 2XB2A 4DSNA 2QMUA 3UWOA 4M1YA 1M8PA 3WNCA 4DDWA 3QBVA 1CR4A 1X86B 3MWYW 3EPJA 1A1VA 4FMCB 4M2LA 5K8TA 2ANBA 1Q3HA 1NN5A 4KFRA 4IHQA 3CNOA 2WWWA 4RY2A 3WHLA 1KO4A 2VPPA 3KUDA 4DZZA 2AXNA 4TMXA 2J0VA 4EKDA 4ESHA 4GOJA 4X8LA 3ZIAA 2ZJBA 2ZM5A 3OEED 2H7VA 1U2RA 4YC7A 1F48A 2CK3D 2J59A 3OAAA 1GM5A 2P2LA 1Z6TA 2BC9A 4PX9A 1YZQA 2ZJZA 4PSAA 2FG5A 2F7SA 2UKDA 4CEIB 2CBZA 1UF9A 2F1IA 3U7EB 5FFMA 4DLRA 2HCJB 4MUBA 1CR1A 2K5UA 1LW7A 4QBFA 4IW3B 4LPKA 2IS1A 2OCBA 3DOEA 2KB0A 3TMKA 4M9ZA 1JPNA 4FIDA 5BW8A 3W6OA 1NL3A 4V03A 4QGAA 2PEYA 2GXUA 2PZFA 2H57A 1YRBA 1CP2A 1W2HA 2WMOB 3ZQJA 4C2TA 2KE5A 3BC1A 3IQWA 5G3YA 1XD2A 3X1XA 1TUIA 5F98A 2AL7A 4OYHA 4AD8A 4LYAA 4MQBA 4DLZA 3KL4A 5KOYA 2WPDD 5B57C 4IDPA 1MH1A 5KO2A 4Y0AA 3SJBA 1G3RA 2NMVA 2R6GA 1BOFA 3OF5A 4TSFA 4BFWA 1G41A 1XNJA 2ERXA 3QKUA 3T1VA 2ZSAA 3UG6A 3TBKA 2JGNA 4DLVA 4C0HA 1NBMD 4G5OA 2HT6A 4C3ZA 4EPRA 2IYZA 3ADCA 1ZVQA 3SYNA 3PQCA 4JYBA 3GJ3A 2QGNA 1OJLA 1TADA 2HV8A 5JMTA 3VNUA 2FGKA 1P61B 1FP6A 1AS0A 1X1SA 2PMKA 5A5GA 1GSIA 3BGWA 5B30A 3CF6R 4AYXA 3BB3A 1KKLA 3P1JA 4URVR 3RRZA 3ZLJA 1CXZA 2ZVQX 1NVXQ 2ECKA 1N5JA 1SVOA 4U02A 3WBKA 4A0RA 3ASZA 3AVYA 1RIFA 4B6EA 1FX0A 2Z4RA 2OCAA 2BCJQ 1U81A 1FL9A 5JSZB 3NEJA 1NNEA 4ZI2A 1TQ6A 3KQNA 3R8FA 2V4ZA 4NYIQ 4D0GA 1E2EA 1YRAA 2JJ8A 3BK7A 3HJNA 2ZR7A 4D26A 3LVRE 1S8FA 1Z0DA 1U99A 2HUPA 2FPMA 2ZJAA 2W2TA 2XGJA 4BFXA 1Z07A 2QBYB 5FUWA 1XMSA 4PC1A 4F4IA 5LDDC 3QKSB 1TL7C 2Q6TA 1N5IA 2ZETA 2ONJA 1RRCA 1AA9A 2NTYC 1K8RA 2JASA 1K6MA 5F3WB 2V9PA 1MABA 3M6AA 1EWQA 3LDAA 2O8EA 1DG3A 3AVPA 1R8SA 3MD0A 5IHPA 1XJ0A 2F55A 2QU8A 4M8NE 1G4UR 3TQFA 3PUZA 4BLQA 2HYIC 1YZTA 1E1QD 3CRMA 4XTRA 5FBQB 3OE7D 1ZD9A 4GT1A 5KSOA 2Z43A 1D2NA 1XD8A 1MOZA 2MMGA 2IYRA 2BHRA 2J7KA 3H86A 4G5QA 5JWRA 2BBTA 2GZAA 1MRSA 3VU9A 3IO5A 1NKTA 5FBLB 5EE1A 1E2IA 4RFVA 1UJ2A 3K70C 1Y3AA 4IDOA 2MSCB 3EZ6A 2EYQA 2IYYA 4JLPA 2AFHE 2ZYWX 4JS0A 5G53C 1AIPA 1W4BA 2YV5A 3ZQ6A 4A9AA 3LQQA 4HB2A 2AHOA 1ZNZA 2NO9A 3RS3A 2LWIA 2ZS7A 2W58A 4UNNA 3VR3A 1XBTA 1D2MA 4C0KA 4HAZA 4PTLA 3AP2A 3ZS9A 4Z1MA 2CCKA 1M6NA 1N5LA 4BFVA 3MMPA 2R6AA 4UXJA 2MMCA 2GNOA 2EFCB 1YVDA 2QGZA 1IBRA 2CE7A 3B1WA 4IJMA 1KY2A 4IXNA 5JBQA 1IONA 2RMKA 4B3GA 3FPAA 4BFYA 1P3JA 3TW4A 2QE7D 1IXZA 3MRSA 1N6KA 1WA5A 4PZLA 3U3KA 1XEWY 4GDFA 1EWRA 3CZPA 4C4PA 4AYTA 1G4AE 1T4GA 2JLRA 3MG9A 4TTRA 3THXA 4YMTA 3JZMA 1F5NA 2PJZA 2XOKD 3I8XA 4JLAA 4RFSB 2XSZA 1SXJE 1PV4A 1UKEA 3U61B 4CYMA 4TL9A 2GWHA 4D0LB 1N6LA 3EAQA 3TUZC 3KKNA 5BXQC 1E9FA 4LCBA 3GFPA 4PAOA 2ZU0C 3FVQA 4IOKA 3GP8A 3U7HB 2ZAOA 4DB4A 4UNPA 1G3UA 2SHKA 5GJVC 3GLHB 3BH6A 1KJWA 1GP2A 1LFDB 4V02A 3RABA 1D8TA 2FN4A 3K1JA 2ODEA 4P31A 2EFDB 4Q9IA 1IN5A 1ZAKA 2KWIA 2QZ4A 5DO9A 2PJRA 2E87A 3IDQA 4JVNA 4HI0E 3RRMA 1WP9A 3K9NA 4LUCA 3THYA 3K0CA 2ZEJA 3QBTA 1XEXB 4C0JA 1UBEA 3IHLA 5FH9A 5JWOA 2WHXA 3LQRA 4L9WA 2RGCA 5KHOC 4IVRA 1OXUA 2EWWA 2J0UB 1Z6XA 3UMRA 3ZZTA 4JLJA 4W7SA 1L2TA 2GJ8A 2QPOA 2QROA 3AVQA 2FNAA 4CIDA 4P4SB 3Q5EA 5KPDA 3AKEA 3U4QB 2XOKA 5FPYA 4C0LA 2O8CA 1S3GA 2VHJA 1VG1A 4IDNA 3JVVA 1ESNA 3BFKA 4BLTA 4RFSA 3TR0A 2W0SA 1KJYA 5LD2C 3RNLA 3WP0A 5SZHB 4DDUA 1SVWA 1UKVY 2CL0X 2IUUA 4BLPA 2QA5A 2A5YB 3RHFA 4OI2A 2XX3A 2R8RA 2HT1A 4IEIA 2ZI9A 4LYFA 4GL2A 3W34A 3RWMB 1K5GA 1FNNA 1G16A 2ZE6A 4LK2A 3AVVA 1GOTA 5JHHB 2YC2C 2ZJ2A 4F91B 5KNBA 1CLUA 1P9RA 2P5SA 3E5HA 1Z63A 1R5BA 1E4VA 2GRJA 1E0SA 4LYJA 3PUXA 1ZMXA 5KTYA 4Y0VA 3OE7A 2Q0HA 1SHKA 4QJ4A 2YKGA 2O8FB 3QXHA 2W6IA 3NBZC 4C0SA 4IRUB 4QNRA 1E0JA 1UBFA 1TQDA 3QF7A 2FH5B 3EC1A 4FD2A 4BRUA 4EFLA 1CEEA 4JT4A 3PV0A 3WXMA 3DKVA 3KB1A 2LKCA 1U0JA 1Q44A 1CF4A 4DRZA 3QPVA 1DAMA 3O8RA 4YMUA 1YE8A 2VSXA 1DO2A 5E7IA 1W36C 2WAYA 2J9RA 1AGRA 1VTKA 1ZNYA 1J2JA 1E0AA 4XH9B 4B44A 4PC2A 1R0XA 1T9HA 3BS4A 3NH6A 3X2SA 3FMOB 4Q48A 3KUCA 2D4HA 3AKCA 3EPHA 1OE0A 1GG2A 1X8JA 2GCPA 4RD2A 3W8RA 2QG6A 3HYRA 3TR5A 3TIFA 3FKQA 1H8EA 2OHFA 2YHSA 5B64A 2GZHA 5FR1A 5AJWA 4BZXA 4D4LA 3AF3A 3ZGXA 3DVLA 1Q21A 3C8UA 5C1BA 4MGKR 5CIQA 5KU1A 3QY0A 4JKIA 1KMQA 2OLJA 3WBJA 4DWJA 5JI2E 3MJHA 5CK5A 1SVSA 1NRJB 1ZNXA 5BQ5A 5EUMA 4YDHB 5JS7A 5IK2D 1TQ2A 4TYNA 2IYTA 5DIFA 1O87A 1R2QA 1L4YA 1KI4A 4LBWA 4QHTA 2VHTA 4WA7A 1KY3A 4K8OA 4GZLA 2RGDA 3EARA 5BN4A 3BXZA 2J87A 1SGWA 4ZIRA 4KLNA 5JFGA 1IM2A 4NU0A 4PAMA 4AK9A 1XXHA 2ZYVX 4M22A 3U44B 1E9BA 4HAXA 4UNRA 1E99A 1T3SA 2QL6A 2QP4A 1B23P 3KTAB 2B92A 2IK8A 3KZ1E 2QMOA 2P67A 1HE1C 3CPEA 3PFIA 3ZD6A 3ICQB 4Q9JA 1XPUA 4XJXA 2DWOA 3EX7C 5DYGA 1BMFA 5GVSA 1FMJA 1RRPA 2NOAA 2B21A 5BWMA 3A8TA 2VEDA 4Q7JB 2CJWA 4XSGA 2E1RA 1SXJC 3FDIA 2BBWA 1W48A 4N1AA 4Q19A 2F9LA 1G19A 1KK3A 1R8QA 2P6RA 1ODFA 1XDBA 2PH1A 3BRWD 3QUSA 1Q1ZA 3GLHE 2G9NA 1OXVA 1XCMA 4FCVA 2PCJA 1ETUA 4C0BA 1XCPA 3CWQA 1OSNA 1J70A 5IF9A 5GADl 1VMAA 2XEXA 3KFXA 3JVUA 1M7GA 2NZ8A 3ECCA 1XPRA 1N6OA 1NP6A 2YNMA 1KNQA 3MJRA 1XD2B 5JEEA 2OESA 2W83A 2CK3A 5KSYA 3HP1A 1L7VC 4HUTA 4P0TA 1TU3A 3LY5A 4B35A 4D25A 4GMDA 2IUTA 2W0MA 2OAQ1 4JLDA 1EFCA 2FSFA 2ZI5A 4YDSA 1R10A 1J90A 3IBGA 2ZAMA 3PUYA 4CT4B 3BB4A 4TQAA 2HXYA 4B34A 1E2QA 2IF2A 3IIKA 4QGGA 3BOSA 1IY1A 5CDFE 3KJGA 1X8KA 1OFIA 2ANCA 3QKTA 1NY5A 2IUSA 2ZR0A 1OIVA 3Q5DA 3S1AA 3THWA 4PO8A 2OCPA 4PHGA 1KOFA 1SKYE 2CHQA 3M4YA 1JQJC 2O0HA 1RRGA 4A2WA 3IILA 4HUQA 4TT3D 1ZIPA 1D2EA 4TN1A 1S2MA 1R5OA 1I4LD 4WZ6A 3WYAA 5HTKA 2RHMA 4LBYA 1SKQA 1D9XA 4GSYA 1ESMA 3VKHA 3UXMA 2D7DA 1XCGB 4DLTA 1YZGA 3CR8A 5TMPA 5EUQB 4PR0A 5D3MB 1H8HA 1OXXK 1P2TA 1UEIA 4V0LA 4AI6A 2HEIA 5DYIA 4DC9A 2CLSA 1ZP6A 3K9HA 421PA 1Z22A 4HSEA 1WF3A 2AKYA 2JA1A 2C9OA 2IYWA 4TTQA 4ILEA 3V9PA 1FOEB 4PO1A 3NTUA 4ASUA 1N6RA 4M0LA 3L0SA 4XD7A 4CW7A 1N0VC 2DHRA 1FUKA 2WOOA 3GJ6A 2D3WA 2WKPA 2XNDA 1IY0A 1KTVA 1FX0B 1RYHA 2XITA 4B76A 4FMCF 1CRPA 2VP5A 1NBMA 2N42A 1G20E 5AJXA 3I73A 1RRFA 3IUYA 1RFLA 1JNYA 2CCGA 1E6CA 1G8GA 1OHHD 1P75A 5KSPA 1GIAA 3UPUA 3IEUA 4JLVA 3A37A 3EWSA 4PANA 3P27A 4MDFA 3TVTA 4DSOA 2XZPA 1OKKA 3RSOA 2FE4A 1HY3A 5LBIA 1NVVQ 4R2HA 4F4JA 2GJSA 3F5FA 6Q21A 5JRJA 3T06B 2IS2A 3LXXA 4OK5A 2O0JA 4NYMR 5DI3B 1GITA 2Q9BA 1GL7A 1ZM9A 3CF0A 3HYTA 3SQXA 2PMDA 1KMHA 3P4YA 4Q01A 2ZE5A 5FUXA 1E0KA 2BKEA 1KO5A 2ZSDA 1TF5A 2WSMA 3CRVA 3W6PA 3GLFE 5JEDA 4IDHA 3TUIC 4WVFA 4MYUA 2B6HA 3QE0A 2IEYA 3B6EA 3BD9A 3RS4A 4OJQA 4RZXA 4DEYA 4DXAA 5EJEA 1YZNA 5LPNA 1KZGB 1ZD8A 4TZ0A 2ZRHA 5UKDA 3FFBA 4MRRA 4US2R 5CJPA 2CE2X 2IBMA 3FB4A 3VR4A 2O8BA 3KKOA 2ZE7A 4FI3C 4CVNA 4P32A 4BLSA 2ORIA 4L8GA 3VKWA 4CEJB 4DCNA 4C30A 1XP8A 2A2ZA 5D3QA 1CIPA 3DDCA 2ZRMA 1ZM4A 2ZRLA 3DOFA 1Z0KA 3LAWA 4PFSA 2UVQA 2BMDA 4D4MA 3EPKA 2HLDD 5C4GB 1F2TB 2MSEB 4Z54A 2ZI6A 4EIWA 4FCTA 5H8WA 4YONB 2F3TA 2PCLA 3QPWA 3U5ZB 2F6RA 1P5ZB 1MR3F 1SKYB 3EIHA 2ZE8A 1OT3A 3FGNA 3TJZA 2YOFA 1E2FA 3CF2A 1OW3B 1ZCBA 4R71A 2AD5A 2VHUA 4DLWA 1L4UA 3G0HA 2OO7A 4POAA 3TQCA 3X1DA 3FMFA 1HQCA 1ZJ6A 4MITA 1E1RD 4I1VA 4PHTA 4MRNA 4US1R 1L8QA 1VG8A 3CBQA 3LVQE 3VR5A 3B1YA 1GL6A 4O3MA 4JLOA 3KB2A 1E79D 5FTMA 3U2QA 1CJVC 4LPSA 4LHXA 4KXFB 1XD9A 5FR2A 2EQBA 2ATVA 4NDZA 3ZS8A 3LA6A 4IFEA 3QEJA 4LGMA 2C77A 4QHYA 1CR2A 4HEJA 1HEIA 3RVBA 2GEUA 1TTTA 1MRNA 2FV8A 2IYXA 2RGGA 4TMZA 5FUVA 2XXAB 2PL3A 2IXEA 3PENA 2VSFA 4U5XA 1XZPA 3B78A 4DUGA 3EIEA 4JSYA 4KVAA 4KAXA 3LLMA 3TE6A 1I2MA 4BASA 3CKLA 2CHGA 2FU5C 2OXRA 4LHWA 5CITA 3KQKA 4QL3A 5EE5B 3F3YA 1XZQA 4Q4AA 4TMVA 1D9ZA 4FXPA 4J0QA 4C0QC 4JBWA 4DLXA 3AVTA 1WE2A 3LW8A 1E2GA 3ZVNA 3H1TA 5CM8B 1FQKA 1UBGA 3AGQA 3Q7QA 3FMPB 4JSTA 3THXB 2ODBA 2PT5A 1P73A 2VP0A 4Q1FA 1CJUC 1COWA 2IT1A 3QEOA 4MRVA 4B71A 4B2IA 3U7GA 3ADBA 2FWRA 3SHWA 2EYUA 4D2IA 2O8DB 1R0ZA 2BJWA 1UBCA 4LHVA 3OHMA 1OYWA 2AFIE 3VNVA 3AB3A 2G77B 2B8TA 5DHFA 4NP6A 4NH0A 2NIPA 2AXPA 4DHEA 1CJMA 2ODWA 3I5YA 1GKIA 1T5LA 4KSCA 4O0MA 3GLFB 3Q85A 4Q02A 1E1QA 3CIOA 1ZNWA 3PEWA 1HQYE 2J7PD 4TLCA 2ZRPA 3PEVA 4HLCA 4JL6A 5EZ5A 1QF9A 3GJ0A 2BEKA 4NE2A 3T5GA 4DSUA 3P32A 4Q03A 1CS4C 1I4DD 2CVFA 2W2VA 3H4MA 4JLNA 1W0JD 1EK0A 4TT3A 1S1MA 4DCTA 1FMLA 4I4LA 3QG1A 1HUQA 1DTSA 4GOKA 4UJ3A 1W4RA 3QXCA 4M9XA 2OG2A 2A9KA 3VU9B 1XB2A 4LC0A 2ZUDA 1HURA 1YJ5A 2JJ2D 3SBDA 4QM6A 1B0UA 4L15A 2IYLD 2BV3A 2JJ2A 4KJZA 4MA4A 1W4CA 2IS4A 1JECA 1AQYA 1HTWA 1N2CE 2X2FA 1XJQA 4HLUA 3R8CA 3EA0A 1W47A 1PUIA 3U3RA 4Q4LA 3FMIA 3BE4A 1DS6A 5DISB 4G0NA 1G17A 1G3QA 4HYYA 4I1OA 2A30A 4Q7KA 4A8JB 4KFUA 3WMGA 4YQFA 1NVUQ 1QBKC 1MABB 1US8A 2X8AA 3ZD7A 1N6NA 3SYKA 3R9XA 2R6DA 4QNMA 3A4NA 4MYCA 4QHSA 1VCMA 1ZCAA 1N0WA 1W49A 3LXRA 1NLZA 2O0KA 3CR7A 2XJ9A 3D3QA 2C99A 2FGJA 1GILA 4MKHA 2HXSA 1TEXA 5CYOA 1X3SA 5ELXA 4ZCLA 4NL4H 3WMFA 4XVRA 1NJFA 4LY6A 3QOFA 3IPXA 4NZYA 1A82A 1ZU5A 3C15C 1XTQA 2WPDA 4MYTA 2A78A 1JPJA 2V6IA 3AVOA 3L8ZA 3QKRB 2ZI7A 4URWR 4KFTA 4IOJA 3I32A 2YC4C 3J81k 1W2GA 1OKKD 5EP4A 4BEJA 4KODA 1E2JA 3PUWA 2H17A 4TQUS 5EXTA 3RS5A 4F7WA 1N0UA 3HU2A 1JXMA 3BFXA 3GD7A 2X2EA 5F2EA 2VF8A 3GEHA 4BRWA 4C2UA 4P3YA 2WKQA 2Y8EA 4Z51A 2C98A 1YR8A 4D4KA 2FX3A 2QAJA 2H8KA 1E69A 1XTKA 3U6BA 4DBLC 3EC2A 3AKYA 4M9SA 1AZTA 3WNDA 5JHGB 3EPLA 1GUAA 2AX4A 2ORWA 4K81B 2VBCA 2QM8A 2YOHA 5EE0A 5EZ6B 2GJAA 3N2IA 1FQJA 4KFSA 5JLJA 1T3LA 2HF8A 2QN6A 4JLKA 3U4QA 2I3BA 4Q7LA 2Z5FA 1QHXA 4ZDJA 3D6TB 2ZRFA 2ATXA 1KYIA 1ZUNB 3AH8A 1D6JA 3UKDA 2VYFA 5BN3A 5KNCA 3HU1A 3AP1A 2QRZA 3LFUA 4KBFA 4LV6A 5EP1A 4A82A 3RC3A 1KDOA 4N0DA 3C5HA 4PC7A 3EA5A 4U7DA 1SVLA 4PPFA 621PA 1XTSA 2JIZA 3CRQA 3L0IB 2ZS9A 3B9QA 3G5UA 3DO6A 5IK2A 3RWOA 4BEBA 4CEIA 1RW4A 1Z0IA 2ZI4A 2X77A 1KI7A 1R4AA 3P4XA 4JIMA 4PZYA 4ACBA 3K70D 4XIGS 2QSZA 1Z2AA 3LH5A 4TLEA 1U8YA 5L3QA 4B32A 5B58C 3FKSD 3Q3JB 3GLIB 1G8FA 5JJKA 1Q3TA 4MGIR 1Q1BA 2O8FA 4MGYR 3PJRA 3K70B 1U98A 5GJCA 5TY0A 1H8ED 1E9AA 1TPZA 2VH5R 1XEFA 5DNYB 4AWXA 1IOZA 3SS8A 4EAQA 1ZC3A 2PX0A 4EPVA 1GWNA 3IIMA 3MFYA 1Z5ZA 2FFBA 4D82A 1QDEA 3BJIC 4TZ6A 1Q57A 2OLKA 3BB1A 1CKEA 3SYLA 2IHBA 3SZRA 1N6IA 3PEUA 1GRNA 3L0PA 1P72A 2GF0A 3L0OA 4HLQB 2BBSA 2CJWB 2PBRA 2ZVPX 3TVDA 2VP4A 3WRXC 2VHQA 3ND8A 4GZMA 3A58B 4R2IA 3REFA 4GOXA 4I1UA 1XEWX 3KX2A 4NCKA 3WRYC 2VP2A 3U60B 3GJ7A 4HLDA 1T8TA 3KQLA 1W7AA 1U90A 1DG1G 2J0UA 2GA8A 1RKBA 2OE2A 1OB2A 2IYUA 2XSZD 4OI4A 1F2UA 4PPNA 2PZEA 3FE2A 3CH5A 2C03A 2J7PA 2JLQA 2GEDA 2GVZC 2D2EA 3I92A 2WSSA 3KKMA 4B48A 4TSFD 2X19A 1T0HB 1AQUA 4BUJA 4XWAA 1NI3A 1DOAA 4P4UA 3EZ9A 1I4TD 3R9IA 4MYHA 4GP7A 5HZHA 2Z83A 3K9LA 2RH5A 4NONA 2D74A 3ZZ0A 1ZU4A 5A0FA 2V1UA 1YR7A 2F43A 1VIAA 2ZYTX 5J47A 4F4CA 2QQEA 4BECA 1NLYA 1KI3A 5FBRB 1G3MA 2BDTA 2X1VA 4AKHA 3ZDQA 1ZINA 4A36A 4Q1EA 3GEIA 3GJ4A 1W5TA 1M74A 1H65A 4A0GA 1TAGA 3PG5A 4ON9A 4XVQA 3FYHA 5IDVA 5LB4A 5LB2A 4C7OB 2OV2A 1II0A 1NIPA 3QQ5A 4RKFA 2QENA 3MUFA 4WW0A 5J4HA 2GCOB 1GNRA
chains in the Genus database with same CATH superfamily
4X3CA 4FI3F 4Q7QA 1B2RA 1C3VA 3V32A 2GAOA 4IIHA 4HDNB 3CHYA 1FBTA 3EGDA 2VF7A 1UC9A 3SSMA 2Y0EA 2Q0XA 1JI0A 1TF7A 2QNBA 4DT1A 4DB2A 4MW2A 1HH4A 2R2AA 3WK5A 1EDEA 3FHJA 3OFKA 2HPVA 4BNDA 1A5AB 5SV2A 3PDWA 1WXEA 1GZSA 4HATA 1MGOA 2A57A 1MJHA 3LUPA 2XNCA 1V35A 2J3KA 5T3UA 3MUOA 2FHPA 3UJBA 1RCTE 1N1EA 2MSKA 4JOBA 1H0SA 1Q95A 3LY9A 4LDJA 4ZHSA 1K4MA 3LQYA 4MMZB 3SZUA 5M29A 2YXPX 3EVEA 5FUYA 4A2QA 4M8IA 1EEHA 5JS1A 4G65A 1IBKB 3OE5A 4XGQA 3HBMA 3LK7A 4CR7A 4B3BA 2UZIR 4GMXA 2GN4A 1AUXA 2XCLA 2XNKA 2FETA 3FFAA 5ERXA 1XQWA 1MA0A 2ZUBA 4GX0A 5KVVA 5KJ1A 2W6OA 1F4LA 4L16A 2G9VA 1W1UA 2HO5A 4HZUA 1LK5A 4UD6A 3U3DA 2QLNA 1NZDA 3EGOA 3OJ0A 3RU7A 2ZRQA 3L6CA 4MR7B 4EWLA 4W5QA 1UDCA 1AKQA 1SHZA 1S7CA 1WQ3A 4ZP1A 4ZHQF 4TRNA 4BO8A 3OEWA 1EPUA 4ZOLB 1GV1A 4BNUA 2WR8A 4GNRA 2HLDA 3KXKA 2QAGC 3L05A 1WNFA 4CODB 4JJFA 3HCNA 4E1VA 4E14A 2XMDA 3FNEA 1EE1A 1HT1E 5D3ZA 5ISMA 3G5AA 3L43A 4GWGA 4UXHA 3NALA 4WXEA 5ESRA 2Z8XA 2WIGA 4B87A 1MJ5A 4YJHB 3I9V6 3IT0A 4Q6BA 3ESQA 2UAGA 5HKKA 5JBNA 1WEHA 3AZQA 4Q16A 2GPWA 2JS7A 4LMBA 2A3RA 5FKJA 1O54A 1II8B 4ZQHA 1N57A 5KNCD 1PKEA 3QSYA 4OFZA 4R0VA 3VOAA 4WKCA 4A92A 5IYZB 1TAHA 2IYVA 4KQGA 2XOEA 4OPMA 5FULA 1PTJC 3WHIA 4ZEMA 4HAVA 3AUXA 4KI0A 3T95A 2EVWX 2J08A 3NAGA 1YKFA 1BVUA 4KQ1A 4DV3B 1UEXC 2DTDA 3IR6A 3OLWA 5A7HA 4JBXA 3ND6A 1Z6PA 4BWFB 1NJ1A 4JI7B 4EJSA 3VPDA 2QX6A 3WAKA 2GBIA 3IVAA 1OWOA 1XZKA 2JHPA 4Z4CA 3D02A 3PPXA 4BQSA 2CZGA 3L2OB 3D31A 2OAEA 4BP1A 1NUAA 2ASEA 4QTYA 2R62A 5FA8A 1FUEA 2R6ZA 2WAMA 3H5LA 1I94B 1HE3A 5B2ZA 4EKGA 1HFWA 1CUDA 4R1UA 2HBRA 3ZI4A 2XUDA 2AJTA 4AG6A 2PRYA 2YY5A 1U2DC 3SZLA 4R1TA 1NKVA 1PSWA 2VA9A 3VR2A 4ACAA 4LHEA 2JKVA 2QQ0A 2QSYA 1Z28A 2A7QA 4G0MA 1SXPA 1Z75A 3B13B 1VPWA 1XRQA 5EI5A 3TCNA 1UDRA 3TK1A 1SCUB 2C04A 4IF4A 2VXYA 1RLUA 2JEOA 2ACKA 5DU2A 1YKSA 3DVSX 2KQUA 2X5KO 1IBMB 3C5VA 5DSXA 3ZWMA 2OCIA 3E2IA 5E1OA 4B4VA 3LIPA 1X94A 2PQ6A 2R25B 1KQFA 1HZZC 1WXQA 2PVCA 3EVTA 4AROA 1Z3IX 1R9JA 2D1QA 2F8TA 3BCSA 4YJDA 3EXG2 3DLIA 2XVXA 1G64A 3LBAA 1CUJA 2JW5A 4IRXA 3FY4A 2IPOA 5CPFA 4ASUD 2X5OA 2J6BA 4N47A 2MYPA 2GEBA 3H9QA 4PZUA 1G60A 1X2BA 2RJ3A 4RW0A 2R65A 4EZBA 1X7DA 1DINA 5JXIA 1LJLA 5FPSA 1PUJA 1QG2A 5AUOB 2BZ0A 1ESCA 4PHHA 5K8UA 2VSQA 2VPQA 2GYUA 1H2ZA 2FWJA 1Z47A 2VDVE 3KKPA 3KB6A 3IODA 3V6MA 5ADWA 2IGTA 5ALFA 4PW0A 4E3ZA 4K5QA 4A3SA 4ZZIA 1OH6A 1PG2A 1ZNQO 3QWHA 1KEUA 5B3AA 3BF7A 1CDEA 2EQ5A 2VDKB 3ECSA 3IUPA 4A8HA 5JS8A 2RGEA 4W6ZA 2UYHA 3ZHQA 2CMGA 4AL4A 1Y3CE 2B36A 4LJ9A 4OOEA 5E9AA 4N6GA 4MQFB 4AZWA 5C1IA 2ENWA 4BNVA 4KWTA 4MQ5A 3TAXA 3NWJA 4OFBA 5CDSA 3T54A 1FFSA 3U4IA 2AZTA 1PUXA 3MK31 5K3BA 3DXFA 4RMNA 3E1KA 1EDZA 3UEOA 1RAEA 1M0WA 2I1WA 2O2DA 2X9NA 2XMGA 2YW2A 3PXAA 5CA0F 3H11A 4RD0A 1IVNA 3ZZUA 4EBBA 3O3CA 1U2ZA 3P26A 1JDVA 3RGWS 3T3MB 4W1SA 2VTVA 4WZBE 2HA7A 121PA 2H11A 4LF7B 5FTJA 3GA0A 2ZT6A 1U7ZA 1J23A 2M6LA 1S9HA 3ITEA 3VUEA 1WUJS 2OXCA 5HE8A 3LPLA 1J0XO 3TG8A 3K05A 5L40A 2RBEA 1CJKC 3WS7A 4L8VA 4GXQA 4BVKA 3JAWB 2QTAA 2WZCA 4GRAA 2W8ZA 5K8LA 2RGAA 1GO2A 1EG2A 1SURA 2V7GA 3LT0A 3CTMA 2FSSA 4FWIB 2E6UX 2IBSA 1FLDA 4IEFB 3TNFA 1K1EA 1UAAA 1W0CA 3A1SA 3S7TA 4U5QA 3CT6A 2QPTA 1YQUA 2PK3A 1SXJD 2TMKA 3PNPA 5ARDA 3RANA 3SXUB 3FDZB 4Q9KA 4DWOA 1QMPA 4HTAA 3RH0A 5AVZA 4OHOA 4B3XA 3GA5A 4YACA 3PUVA 3B6KA 4UMVA 3GFFA 2QTMA 3GRYA 5HCIA 5HDQA 4TZTA 3EMVA 4OGKA 1ZGGA 4HP8A 4ZAZA 1TZBA 1YU9A 2C58A 3N86A 3AF6A 5AW8A 1C1YA 2WF9A 3FOCA 1W46A 4HDMB 2OBMA 1J8YF 3U3MA 1MXFA 4C4RA 4PX2A 4ZI3A 4I3GA 3QF4B 5KCZA 1RM3A 2QF7A 3D2AA 2C7BA 3R5TA 5FA5A 3ZCSA 2VUUA 2ZUSA 5DLPA 4B31A 1AQJA 1Z4LA 4YRJA 5GZ1A 4OX9Y 1NMYA 1TA9A 2ZB7A 2JLXA 1SC9A 5JD4A 3EDRA 4KU4A 3ANXA 1ORHA 1MF7A 3A7EA 3RUHA 5EA2A 3DAGA 4P7BA 5ESWA 4F60A 5J1TB 3WKEA 4RQBA 4JL8A 1U7UA 4HGNA 4XSHA 1QP7A 3ZBTA 1GDDA 4WLVA 2WWVD 4N41A 1P4HA 2EFHB 2PKXA 4QFBA 1MLDA 2QTHA 2I7DA 5BQFA 2YL2A 1JH9A 3DSRA 3IPYA 2JI9A 4IQ8A 1FJXA 1ZVKA 5CB8A 2HA0A 1GZHB 4QYXA 3UPDA 5KNDA 5CGQB 4Q1CA 3I8OA 3WVNA 4CCYA 1HOTA 4JI0B 4GYKA 2RHCA 4GL4A 1P7VA 4UU8A 3DTVA 1A7AA 4RCZA 2R6JA 3T15A 4G8CA 2C83A 4PE5B 3QFFA 1Y37A 3DBVO 5MHTA 4D9CA 4WNAB 1QU3A 3U19A 1M8JA 2FW0A 4LBZA 1M0EA 3CYFA 2X3FA 1MIHA 1WPRA 1GPUA 3MEQA 1PZXA 3P4UA 4CT5A 1LA2A 1N8TA 1WZCA 1ULTA 4YGXB 3B48A 1ZDMA 2IRWA 2OGUA 3GOHA 1S2NA 3SHTA 3OIGA 4V0NA 5IEBA 2AEJA 1QLHA 2F1JA 4C04A 1GRVA 2YHBA 3THSA 3TZBA 2WWGA 4IVQA 2OSVA 3UHPA 5H3CA 4ZCMA 1W9MA 1E1KA 4AM8A 1YC2A 1RPJA 3IOEA 1CZLA 4UHJA 4EEXA 3GLFA 3U7FB 1VKJA 3DNFA 5BOSA 2XBUA 1HLFA 1SQFA 2VG8A 2Q21A 2EL7A 3ENNA 4C88A 2J0SA 4OF4A 1ZGAA 2C7QA 1J8FA 3E70C 3HUFA 3QV2A 2AV6A 2DBYA 3R24A 2EC5A 4PZAA 3F6CA 3PFGA 4PXAA 4RZ3A 2IDKA 4BKPA 3EXAA 3WSTA 1MC1A 2H92A 3C3MA 3RR2A 2HGSA 2AX3A 2QT1A 3SEZA 4LYGA 1ZUIA 3BIFA 1BROA 2BFDB 2O23A 3OIYA 2JLUA 1VMEA 4JA2A 4LX0A 4LZPA 2PWBA 2EATA 1UMDA 4EPYA 1RQNA 2QTVB 1VJCA 2Y0CA 1IQRA 1QOQB 2E21A 4IWNA 5T64A 4URZR 5KSZA 1N2EA 1R6DA 5C31A 3I83A 4LNUB 3W77A 4WFQA 5DSZA 2KBFA 2CFTA 1EFTA 4RAOA 1DRKA 2HLPA 1SCNE 1I2DA 2VJLA 2C5EA 3BXHA 5FQOA 4DKJA 4R7GA 1DRVA 4MQEB 4ENTA 4JELA 2Z6QA 2I0FA 2RJNA 3EYWA 3A1EA 3IIEA 2Y76A 1WVMA 3AY7A 2BH9A 1T34A 2PFKA 4RD3A 3O0DA 3SC2B 3RAGA 3G17A 5CDTA 1NJ5A 2VSOA 4UNSA 4YY3B 2VAMA 2YWDA 4MB2A 2AFHA 2O8BB 1Z7BA 4Q3CA 3MB5A 4UHEA 1PLKA 2CEAA 4D44A 5JXGA 2XQGA 1Y9EA 1E4EB 2ZRKA 1LU9A 9MHTA 4QZVA 1DQNA 1T9DA 2FP4A 2NAPA 4HAUA 3RAEC 1YMQA 1D7AA 3CVOA 3UK7A 3I76A 1WMBA 2NO1A 5TQ2A 3RLIA 2DHCA 2H7XA 4BGDA 3DL0A 2NSHA 2O8NA 4N12A 1VSQA 1NMSA 1CYDA 2E48A 3DHWC 3HXKA 5DBHX 5C2JB 3GLGB 4DV0B 4DLPA 3O82A 4YI3A 3D6JA 3G49A 3N70A 1L9XA 2O5VA 4Q15A 1E2NA 1JFRA 2BL4A 3DUFA 1FYXA 3K9GA 3KE9A 2WIKA 3M83A 3I1FA 3ST7A 1M2JA 1K7CA 2G9RA 2OHGA 2P1DA 5D7BA 3AF2A 4BWGA 4MIYA 4D79A 5GIPE 1AHIA 2L0XA 3OIVA 2BFEB 2FFJA 3KK0A 5ALKA 3SHVA 2C7VA 2XLBA 4LY0A 2DXIA 5U1PA 1Q19A 2WVGA 4YB8A 4XW2A 4URYR 5B1SA 4CR6A 4C1BA 4B3RB 4HUQB 4WWHA 3EGIA 4EO9A 3L4EA 1UK6A 3VAYA 1H69A 3LUCA 3JWJA 5BN5A 4OQYA 3AFOA 1X1EA 3OQNA 3WHKA 2XHEA 2FFHA 4W9MC 2HIMA 5LMZA 2I4OA 2OV8A 3OX3A 3C0KA 2OEPA 3EH1A 3GA7A 5DEIA 5IVIA 1NVMB 4U2FA 4AY5A 1U0HC 5SZJA 3OM1A 2PHZA 1NKSA 1SCDA 5T67A 4FYHA 3QVXA 5J2UA 1R1DA 9LDBA 1OA1A 3CONA 2KX7A 3OKCA 4HNAB 2H5EA 2O2EA 1F2UB 2OCGA 1YL7A 1EHCA 3KTOA 1MNQA 1ZUHA 2DVMA 3DZDA 1A4XA 4J1SA 4D6PA 1H2FA 3QLVA 5K3SA 3AUYA 3QNUA 4B6SA 4LDRA 3EG5A 1OASA 3SNKA 3EF3A 4RH0A 3K0CC 2HJGA 2QDKA 3KZXA 3EW9A 3FOZA 3AW8A 3OUUA 2PUFA 3KXDA 1J7KA 1LTHR 2JGJA 4HLNA 4Y1FA 3TXYA 2QMEA 5CBKA 3AUFA 5DM0A 2OZEA 3OM9A 3RRXA 1MENA 1ZBQA 3PL5A 2P9JA 4ZO9A 1EFHA 3K53A 1TJYA 2OHIA 2V3WA 3A6GA 4W5HA 3TM5A 5CLGA 1QHHA 4H4CA 4XGKA 4EB6B 1UFQA 2CXOA 4YJ3B 3EN0A 4PNZA 3RC1A 3WAJA 4J6FA 4RD6A 4K8RB 3L4KA 5BSVA 4JBIA 3EAGA 4C9BA 4L95C 3GVXA 4EHHA 2AVDA 2PYIA 3KYCB 3OLZA 2Q6KA 1NVEA 1V47A 3NYWA 1U80A 2GF2A 4IJWA 4KW7A 1EM8B 1KS2A 5IBRA 4CKZA 4DIOA 2QLLA 1Q12A 3NBFA 3SU8A 3SYTA 4J7UA 5KNLA 2IP1A 1KIAA 3NCHA 4JLMA 4PFJA 2Q2WA 4KUHA 3SQWA 2ZGVA 1XCLA 2BFBB 4P82A 5TQ0B 1BEUB 3P2KA 1XTVA 2RB4A 3HXMA 5LKRA 4BLOA 4MXDA 5GMOA 3I8SA 2E4ZA 1J2EA 3TH5A 3VSBA 3PKZA 3K8ZA 3DXYA 1CY2A 3Q8XB 4AS2A 4XQ0A 1IN6A 1FU7A 1I1OA 3BCHA 3FCYA 3KLBA 2WDZA 3FLEA 1SUIA 4INOA 5DM60 4YMWA 4CLEA 2I6QA 3UIEA 2D62A 1F17A 3WGVA 2IXGA 1KIMA 3VO1A 4HCJA 1U0LA 3BULA 4N0EA 3TOCA 1KVQA 3KLOA 3UY4A 4NVRA 4IHJB 4X0EA 3WLOA 2V6JA 1E2KA 3BM5A 5IJ0B 1H6BA 4JEIA 4PWZA 2QY9A 2Z95A 4ZCSA 1DMRA 3B5JA 5T7BA 1IXYA 2VRWA 3RS7A 5BWCA 3NOVA 1RABA 3IPCA 3DC7A 3LT2A 4UCWA 4FOTA 2V7WA 1GZ6A 3A70A 4NG5A 3RPEA 3VPXA 5IAKA 2Z1MA 4UBOA 3OG9A 4GICA 3IAS6 1A04A 1Y3HA 1B0PA 2D1FA 1E7RA 3G9ZA 4NBRA 2H08A 2CLOB 3EDOA 4MWTA 3R7AA 3IKJA 1GNTA 4Q4CA 4UDXX 2IW3A 2YZGA 4YJ2B 3RFFA 1TB4A 2CJPA 1K86A 3BT7A 5LOVA 2EF1A 4Q82A 4DIDA 3VZQA 2HDNB 5CYPA 3GRAA 4IXTA 4DA0A 3CB4A 3KJFA 2WM2A 4LISA 1U0RA 1GR0A 4QX6A 5DT2A 1GRQA 3PDCA 3U1BA 1KARA 4J0IA 1D5WA 1V96A 1ZLXA 4HF7A 1SOAA 4KPGA 2IXDA 1K7SN 3ZLUA 3T4EA 1Z82A 1LTKA 2F00A 2PR7A 2Q4TA 3L01A 4LQ4A 3ICEA 1FFGA 3RKRA 4GFDA 4U2EA 5BN1A 3A6JA 4LKRA 4X24A 1IN8A 1CQXA 1PW7A 2FR1A 3ZVLA 2DWCA 4I55A 5IFLA 4XDHA 3MWJA 4JZKA 4P53A 2W70A 3FUVA 4MDHA 2ZZKA 2K7ZA 1M2OB 1ZEJA 1DUIA 1FVXA 2EJUA 2Q1XA 4B40A 1XVAA 3LYHA 4HFRA 4RABA 4CTOA 1OMOA 4HB0A 3FR8A 3WL3A 1WW8A 2Z2KA 3UW3A 1QH1A 3RRJA 4OQZA 3R0ZA 4U0JA 3OU6A 4CHGA 2B5VA 4ITUA 1DKQA 3PLAE 3BXEA 5F12A 4YAIA 4L5BA 4LCEA 1J9ZA 4DL9A 1VLLA 3ER6A 4XLLA 1HV8A 2FPRA 3CUWA 5ELMA 3IBTA 5EQFA 5LC1A 1KEVA 5JAOA 1YASA 2PS1A 1RJFA 3DBHB 2AYZA 4GWKA 3SSAA 4CEHB 3FH0A 1YUMA 3IAUA 4ZI7B 3W79A 2QM7A 3U4CA 2YCLA 1TJPB 3DDWA 3EJWA 2PLRA 3PGJA 4KE6A 3HR8A 1BX3A 3DOUA 1FNMA 4YJ3F 3WLSA 1EDBA 4P5PA 4QDKA 3ZDYB 3ZZMA 3LUAA 5LXTB 5ALDA 1FFXA 2ZSBA 3LWBA 3KBOA 2HCRA 1V7PC 5FJIA 4FMDB 2WJAA 4IIJB 3MAAC 3IHKA 3S6JA 5J5VA 4MKGA 4NOLA 3WYFA 2OHHA 2UZ3A 3KRTA 1ONPA 1UXGA 4QE3A 3T1QA 5JJ5A 2QJOA 2YWEA 4F5EA 2CFRA 3UAXA 1T13A 3RSQA 1JTVA 3GWGA 3HYNA 3O3OB 3SM3A 1BXKA 2F8SA 4HXFB 1JHQA 5DM70 4RVFA 2ZKLA 3IIJA 5BQ3A 6REQA 3DUWA 1K6EA 4PGGA 3I6IA 1TYBE 1BE8A 3HA2A 4A16A 1PK7A 2EEZA 1LV7A 2E5WA 1GGKA 4ADSG 4MV1A 2A8YA 1KKMA 1SJ9A 4XOIA 1KSJA 3LCCA 4F5DA 1FB5A 4KO4S 4O63O 2ZJYA 5DK4A 3VGPA 3HB7A 4WEQA 4UKDA 1GPKA 3RHTA 5LN1A 1HZJA 3M9XA 3FOBA 3N2EA 2AZMA 3ZJYA 5HVNA 5DE3A 3OZXA 2WB2A 1GQSA 2PT7A 2G1KA 2OUKA 1J24A 2Z5LA 1QQ6A 1NV8A 3LZCA 3QIAA 5T6MA 3S81A 1XZ8A 1RBYA 2DPMA 1CC1S 2O3QA 2VDOB 4FKZA 4MDYA 3SZOA 2POCA 4YCNA 1FSZA 3RBXA 2OCLA 1JAIA 1NSTA 2Y9PB 4YAGA 3REGA 6NULA 1K5DA 2PLFA 3PYMA 1VPLA 5C8YA 1G8HA 1Z74A 4HZGA 4EPTA 1C1DA 1A0OA 1TA0A 1I9CA 1PR6A 3F7TA 5H7XA 4PICA 4RVCA 3AETB 2X0IA 3AF1A 3WJ7A 1QWSA 3H13A 1AQ6A 3L0CA 1BFDA 3K0BA 4OJMX 5HR5A 4Z86A 2NPIA 5LZ5A 1H6DA 2VTDA 1U2DA 5DXFA 3RBVA 3HKCA 3BVPA 3IPRA 4Y6OA 3H3XA 3ANTA 4M9RA 3LWZA 5AK6A 3TJMA 2NXEA 1YTUA 3TBFA 2BP7B 1I9GA 2Z0MA 5L4SA 2ZIUB 3ZCXA 2JIDA 2Q5LA 2YCBA 2BFFB 2EBHX 3M33A 3ZHOA 3MMXA 3PC8C 3RS2A 1UBMS 1HDRA 3V4ZA 4AP9A 1UKBA 4OBXA 4O29A 2BOVA 4O2RA 1YD7A 2HYDA 1S3FA 5KYYB 4PPGA 2WOJA 2P4EA 3QXJA 2F43B 2ZBEA 4IVPA 1ZVMA 2REXB 4FHEA 1ELOA 2H1VA 1RS0A 2Y1OA 4O8ZA 1GAEO 2ZJ6A 3ORFA 1NBOA 2FQYA 3G8DA 3DMDA 5CLQA 1XI2A 5JCJA 2HCBA 5E0OA 3VI3B 3H84A 1JIXA 4S1NA 2AWOA 2VJCA 4QXMA 2C4TA 5BW4A 3ICCA 5ITVA 3SLGA 1JI3A 2O54A 1VIDA 1QK5A 1U9IC 4NE9A 1ZD1A 1XALA 1H3NA 1X14A 4IMJB 1JU3A 2J45A 3VJRA 2DLDA 1B74A 3RYHB 1OH8A 3GUVA 5H4HA 2AN4A 3MS4A 2E3JA 4WSOA 3HPRA 2FMXA 2QAGA 3RUDA 4EF5A 4XWWA 2Q5QA 4ZYZA 4YXWD 2PSFA 2YY7A 1GFWA 4W4TA 2FWIA 4R51A 3QJYA 2VTKA 4DE5A 1JEDA 5CJJA 1OROA 2UUPA 5FV4A 1CUFA 1WAMA 2V03A 4RENA 4M1SA 1T2NA 1Q1AA 4RJJA 5E4JA 2BM1A 4Q3DA 3U26A 2F1HA 1NN0A 3VYVA 1WDTA 4ZOLF 4B85A 3N58A 2W6QA 1OZAA 4M9UA 2O1SA 3CA8A 3E3OA 3KP1A 3QLUA 4BKOA 3DTYA 3OCXA 4DVGA 1W1WA 1UR5A 5BVGA 2CVQA 3LYUA 4J3FA 5BNTA 3PQDA 4ESVA 1NU8A 4ZI7A 1W19A 4JT2A 4Q1AA 3TW8A 3AF4A 3TNLA 2YYSA 5AVUA 2FZ4A 4KNVA 4UM8B 5B6IA 5K8IA 2XAUA 1CJTC 2CXNA 3LX8A 2NUTA 2SICE 4QOFA 1KVUA 3I01A 1UT8A 5FL7D 5LLSA 1EBBA 4C14A 4TLBA 3VFDA 1AN0A 3OKAA 1BMFD 3QYJA 5CCDA 3IOYA 3WE7A 1ZM2A 4FGZA 4YUWA 1GV0A 2R7AA 2PH5A 4HZIA 4HH4A 4LV5B 1JQEA 3C24A 3DPIA 3K6SA 2ECQA 3I6MA 3ZY2A 5A6VA 3UJAA 6REQB 4CMIB 3N8HA 2Q7DA 1M33A 1ND6A 1U2EA 1F8XA 2I6TA 2J32A 1WSBA 2XECA 1Y6GA 1HC7A 2CY0A 3QFTA 1CVRA 1WQ1R 3EWAA 3FTNA 4R7TA 1ANKA 3B2EA 2ZULA 3JALB 4XPZA 1XMOB 1HKHA 3OZWA 2EKBA 2HN9A 4QEZA 1T36A 1EK1A 3CEJA 3UT5B 3N2ZB 5EYPB 1P33A 2Q9AA 1X74A 4II7A 2NU9A 4DCMA 1SXJA 3UXHA 5KQMA 3PVSA 4YROA 4QDJA 3O75A 4Z3DA 3L7CA 2PVSA 3HFJA 5CCXA 1ZICA 2I2FA 3OTGA 2RGBA 3OCZA 1JJVA 4IIEA 3HJUA 2BCGY 1J1UA 1ADJA 4WDRA 4NPAA 4P7GA 1WSAA 5DLYA 1JXOA 3CPJB 3TLGB 2ZYHA 3T9EA 4K05A 2VDLB 2YOGA 4BFSA 5CLHA 1RLJA 4QPDA 2YVQA 4WK2B 1CPYA 3NDPA 1NE2A 3CRW1 3QF4A 4YCCA 1FFEA 5C8YB 1GG9A 1HT2E 2JAUA 1JIJA 3AJ9A 4JVSB 5AVOA 5B36A 3MNFA 4KYUA 2H52A 2FPKA 3D7LA 1QVAA 1EVKA 3DDHA 5F7XA 3BXGA 4H7HA 4KPYA 1UIRA 4P36A 1KI1A 1T1GA 4H9GA 3WDMA 3W6NA 1M6VB 5CFPA 1BAPA 4N7RA 4XVHA 3AK4A 5H68A 2PQ2A 1P0QA 1XU7A 5A9SB 1HR0B 3ZU2A 3M0EA 2H6EA 1W85B 2FLKA 4PCVA 3RV4A 3GROA 4C7XA 3ZV3A 2P8SA 1UEJA 4KBYA 3UMVA 4YV0A 1F51E 5FTKA 1XV5A 2CXSA 3W3AA 1O5OA 2PSDA 3D4BA 3QW2A 521PA 2QM3A 3HDGA 1LLDA 3BILA 2JFWA 2I78A 1Y5RA 2WG0A 2FPXA 3C14C 2TECE 3H6HA 1G5QA 1Z5NA 1M3SA 2TYSB 4KMMA 2IHTA 3GEMA 3M5DA 4ZVRA 1T2CA 1YMUA 2I54A 2P68A 2REBA 3LCVB 3RAJA 5AVVA 5C37A 2GCGA 4GUAA 1BFKA 2CHVA 1HF3A 4ISBA 5J63A 3TQTA 3U1TA 5I4IA 1XTJA 2I62A 4M86A 4BRZA 4DXHA 2GAFA 5JCOC 1S9DA 3EULA 2PLNA 4Q39A 3EOZA 1ZN8A 2YYYA 1Z4OA 3SJCA 1JYFA 1ZIDA 4YRCA 3ETEA 2X4GA 3DEAA 3DO5A 2NXWA 3MB8A 5FTWA 3VTZA 5DM4A 1HORA 3D8UA 4IJUA 2WM9B 4GI2A 1O1YA 1Y9ZA 2ZJ8A 2JJ1D 1UBLS 2FJ0A 2FA9A 4PIPA 4UPEA 1VL8A 4RMJA 2JIZD 1G9SA 4PLVA 2CUTA 4PAQA 3SKXA 4CMHA 3H6GA 3ZW9A 5ALGA 2W93A 3CX7A 3H2BA 4MJ7A 3SPXA 2XZLA 1ISFA 1E3LA 1C8VB 2G76A 4UE2A 4OB8A 3NHFA 1R7RA 3OSUA 4OM8A 3W4JA 2O3UA 3B82A 3RS0A 1JXAA 1KDRA 4RMHA 2PAAA 3LX5A 3JU3A 4I4TA 2VRBA 4EFKA 2ILTA 4I2NA 4CV0A 1D1PA 5IDWA 4UBNA 1AZSC 4KO2S 3RVNA 2AG0A 3AY3A 1EIWA 5TMDA 1GNQA 3BSSA 3TZKA 4CF6A 1KI8A 1C2YA 1FFHA 3TW8B 2I55A 2VI5A 3KAQA 2H1FA 3IT1A 4N8EA 3C97A 2AK2A 4M1EA 4I5IA 5KNBH 1QZ3A 4HDOB 1UP6A 5CW1A 4N8SA 1YBHA 1EX7A 2ODPA 2GXQA 1U2PA 1UFOA 2DECA 3BGSA 1Z38A 4ZPXA 1DI0A 1ZSVA 1BCRB 4IFTA 4CKCA 2DR0A 5EMJA 2QRLA 3IS3A 3CX8A 5DH9A 2PDAA 2V54A 3BZBA 1LJ8A 3NP9A 5G4LA 3VJLA 2EIXA 2C95A 2OD9A 3N2GA 3OPMA 1Y1RA 5G3ZA 3VTKA 1WB5A 3OZVA 1GT91 2QUBA 2R00C 4N5MA 4MOWA 3FPFA 3MN1A 1VHDA 2Q46A 5DN9A 4HWRA 4QQFA 4P93A 3KKLA 5H59A 2PRSA 2YRFA 4EKYA 3MWDB 4RSRA 4X41A 2XYQA 4OMDA 3GLIA 2G4CA 5BORA 4N7JA 2YXLA 3NEPX 3N75A 2FCRA 2NNWB 3GQBA 5TXGA 1UBSB 4J0DA 4UNIA 5KCMA 5DNWA 1FRQA 1MC5A 1GZDA 4RD4A 2Z6VA 1FYVA 1A3CA 3AF5A 4I4CA 2ZCUA 4FDVA 1VI2A 2XV1A 4BMYA 3TSOA 3ZLTA 4DG9A 5I7EA 1WD7A 4HH1A 1IOLA 1LH0A 2A4KA 1GTG1 1T29A 2YWHA 5F2KA 5T3YA 1XKTA 1GLVA 3TL6A 3VNAA 1JA9A 1WB4A 3PDIB 4FUQA 5JASA 2B5WA 2C2KA 4PC3A 1H0KA 4FNOA 1MG0A 3IXQA 1GLNA 1NXSA 4MARA 5E9WA 4ZYTA 4XIIA 2YFYA 2XUAA 1L7DA 2VDNB 4P38A 4ZTBA 1BU5A 4ZK2A 3OBIA 4RTRA 2JAOA 2JAQA 3A4VA 4QOGA 1E6KA 3AR3A 4F2DA 4PC6A 2VP6A 3K0FB 3RSZA 4YCBA 4EA8A 3A6DA 4MPJA 2XTZA 1GTZA 1VG0B 4NBNA 1I3MA 2E82A 1USIA 3BXFA 4RV9A 2VHCA 4S1OA 2JBHA 1TFRA 4RA9A 3RRYA 2ZBGA 1VIVA 1DG9A 3WLKX 5ALHA 3ZHYA 3WGUA 1Z2DA 1SVKA 2WHPA 5DB4A 1EAYA 1GSOA 2HRDA 4RVOA 1D2HA 2V3VA 1C7FA 2OFXA 3FTDA 3JAKB 4J1TC 1L8OA 1EESA 2IODA 3D2BA 3FGPA 2C3YA 3VAZA 1RPZA 4GLFA 4BQOA 2GBLA 1UBJS 3GGPA 2FEMA 3AJAA 3GI1A 3ANNA 2ZREA 3WGIA 3KR1A 4IJVA 2Q4BA 1GFZA 1RI2A 1Y63A 4MPRA 1J8MF 3TE7A 3ZYZA 3SBEA 1THGA 4QDOA 3FCCA 4KXWA 4M37A 5DTJA 1R12A 3BMOA 3TIXB 1GNPA 4MUXA 4NMWA 3K8OE 1Z0JA 1XP5A 5A9TA 2BKAA 1OV4A 1ZKDA 3ZN2A 1T1JA 4HPWA 5CUQA 3CH4B 4JU9A 3GEEA 3LI2A 2HWXA 5EEGA 2FMIA 1MEOA 2XF2A 3OQIB 2E4YA 2JLCA 2X4IA 1TX4B 3EF1A 2VAPA 1E6LA 3E84A 3GY0A 4LI0A 3ZI7A 1X77A 4OGGA 1ONNA 4ZQGA 1Z4PX 1EJ6A 3OEHA 5TEVA 4N5DA 3DMNA 3VVLA 1LBSA 4J75A 2P9GA 3CPSA 4WOPA 3M6LA 5CP8A 1TVCA 3PPYA 4ZALA 3ZUPA 4DR1B 3ASUA 5C7LO 1T2UA 4MH0R 3ZWCA 2JLYA 3ANMA 4WL0A 1LK0A 3VHRA 2CLCX 4M8KA 5TQ0A 1SKUA 3DZJA 3I1IA 5AKJA 2AK3A 2GXSA 4GHWA 1VHTA 4F72A 3R7SA 4QQRA 1CERA 2JJ1A 3PTLA 2IZ6A 4REOA 3A1VA 4M1MA 1YSCA 2FUG1 3LFTA 3TLZA 1Y9AA 4FBLA 2C3OA 3OU7A 3PXGA 1XU4A 1Z2CA 1XRJA 3SN6A 4BIMA 1QG4A 1DAFA 2BFNA 3R4VA 1II8A 1EFPA 5IKXA 1KGDA 2JDIA 1V48A 4LBVA 3W1VA 3W90A 2VQDA 4EGJA 2ZRDA 2V6GA 2XNHA 2WG2A 4DM4A 1JSZA 3A3NA 1FYWA 2M32A 4PSKA 4Q7EA 1DEXA 3LUGA 2A5GA 4AF7A 2BI8A 2IYEA 3GJXC 4YO7A 3SF8B 3PQ6A 3L7YA 3WGNA 4C7BA 4EHDA 3CGWA 4U7TB 5EWMB 1P6XA 4B6QA 4Z8XA 4D4IA 5AWFC 2Q3HA 4IS3A 3OF3A 3MD9A 3NNNA 1PR1A 1RMYA 2O3SA 4R9VA 3ZTWA 1Z29A 1IK6A 2IYPA 3DNPA 2P90A 3KQHA 3GNLA 1KZ7B 1VCOA 5BYBA 3HCBA 2GETA 3I2JA 4M49A 3Q3IA 1A5TA 3K20A 4IV8A 1NVDA 5DYNA 3VPGA 1JG3A 1M66A 3WLRA 1BDJA 5ALSA 3NHWA 3GRZA 4G84A 4JJAA 2MYNA 2DY1A 2GNAA 2BUBA 4LZNA 1JFSA 4CI9A 1LC3A 2ZXEA 2AJ8A 4LS3A 1W2WB 3WP1B 5M34A 5EMNA 1Z5UA 4IJ6A 1X15A 5CB6A 1M75A 3MCAA 3H5OA 4G9GA 1P62B 2WUGA 1OF1A 4OK6A 1RFGE 5FOVA 1QJ4A 2A9JA 2XZTA 3DB2A 1PQ4A 1JKXA 3TS1A 1XZCA 2BJHA 1FTYA 3G2QA 4XOUA 3HM2A 2Q2QA 3GT7A 4QUGA 5IN5A 4MR9A 3IX7A 3QBVA 2RCYA 4B8YA 4DDWA 4FMCB 3GLRA 5I9SA 5CDGA 2VOEA 4KFRA 4IHQA 3CNOA 3TLAA 2VPPA 1WKCA 2VC2B 3KUDA 4GLOA 4HWSA 2D5LA 2WHYA 3E3AA 4RHEA 4A7PA 4X8LA 2ZM5A 2I67A 3OEED 1B4DA 1K08A 4YPFA 4J2HA 4ND8B 1IB6A 1RXIA 4IQ0A 4CMKA 1Q0SA 5BSRA 3MSCA 1M6YA 1VP3A 3FYUA 4MWEA 4TUYB 3KTDA 5KTNA 3ZWWA 4LNHA 1GQRA 2BR4A 1XJWA 2ZJZA 4PSAA 4PX9A 2PUTA 3FRHA 4CUJA 3ZE9A 1UODA 1YZFA 2WU3A 4MWGA 3ROKA 1U3DA 4P83A 3KJQA 1UF9A 3BDAA 3P0EA 1JR2A 4GE3A 4UPDA 5FFMA 2GHQA 4MTCA 3ZU5A 4I4TB 1LDBA 5T5QA 1LW7A 1J2TA 4NWIA 4MA5A 7YASA 2PA3A 2YS6A 4IW3B 3TSAA 4KPEC 2DEUA 2AOWA 2OCBA 2XODA 3SVZA 4NXNB 1L9KA 2EL9A 2FW6A 2KB0A 1HMPA 3ET5A 3M6XA 1JPNA 3TMKA 5BSWA 4OJYA 1PJ3A 1F38A 3V2HA 1J0AA 1NL3A 2WI8A 5FEUA 3V8NA 3GD5A 1OI3A 2SCUB 4RVHA 1OFVA 2VAXA 2GXUA 2IOFA 1CEXA 2H57A 2PZFA 2JGDA 3I3OA 5DWQA 1NRIA 4O2BA 1DPGA 2C4HA 1SEVA 3UJDA 3F7OA 2WMOB 3O73A 2AE2A 3RVRA 4F9TA 3IQWA 5G3YA 1MC8A 5FJJA 3D3WA 3LGXA 4QTUB 3X1XA 3WL4A 4CN9A 2TMDA 3QBEA 4H7FA 3R0VA 2YDXA 1S4MA 5FNVA 4YRKA 2NMVA 3SLRA 1KAQA 1XOIA 3T52A 2G72A 2H9AA 3CTPA 5WRFA 4BFWA 4R6XA 1XZBA 4BRSA 3QKUA 1FYDA 3EDCA 3S2IA 5JO9A 1YS2X 1N2GA 4UUBA 4DLVA 1IEVA 4QU0A 1NBMD 3CJQA 2YMQA 1PFKA 4WCFA 2HT6A 4C3ZA 4EPRA 3ADCA 5C1DA 3SYNA 4JYBA 4MB6A 4NQRA 2J9FA 1IZYA 1OJLA 2CD7A 4GSLA 2RI6A 3B6MA 1DL5A 2X7XA 4MV0A 1FUYB 4U2DA 4X90A 1ABFA 2PMKA 1AS0A 1X1SA 4GR5A 4MMXB 1E59A 1NXOA 4AZSA 1N5DA 3PDHA 2BPOA 3TR6A 1IN1A 4O4LF 2AA3A 3BB3A 4EH1A 4URVR 3GAMA 4LG1A 1BA2A 1GGJA 2GLXA 3WGZA 3GZNB 1CXZA 2ZB8A 1NVXQ 1EBFA 1ICEA 2ECKA 3SKYA 2IOYA 4B7XA 1SVUA 5HMMA 1CF9A 4K9KA 4B6EA 1ENPA 2CMDA 2Z4RA 5IKOA 5JJCA 1FPQA 2JFOA 1AB6A 1TKRA 1U81A 2NU7A 4QO8A 5JSZB 4YJFB 1NNEA 1TQ6A 2XD9A 1M2EA 5KJFA 4YRQA 3PEEA 3R8FA 3AFIA 2V4ZA 2XCIA 1WVGA 1E2EA 1YRAA 2XQKA 1YJQA 3VISA 3NHUA 2AUNA 1S8FA 5B6JA 3CRNA 1Z0DA 2BGKA 3ND5A 4E11A 3LPAA