1CR2A

Crystal structure of the helicase domain of the gene 4 protein of bacteriophage t7: complex with datp
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
277
structure length
239
Chain Sequence
MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKSGALRQLSDTIIALERNNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA PRIMASE/HELICASE
publication title Crystal structure of the helicase domain from the replicative helicase-primase of bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase
total genus 75
structure length 239
sequence length 277
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cr2A00
1LS6A 2J41A 3CH5A 3OZXA 4EFMA 3SQWA 4ERNA 1CXZA 4IVQA 1E79D 2JLRA 1N6OA 3BB3A 4DCUA 1RW4A 1KO4A 3N70A 3EXAA 4M1OA 1MABA 3PUXA 1UKYA 4MRSA 5JI3E 2J0QA 5E7IA 2QBYB 1HE1C 2IEYA 4B47A 3DHWC 4M1KA 4HLDA 2VO1A 1G3RA 3ZIAD 4PPNA 4GL2A 5KNCA 3AF0A 1P60A 2HUPA 2WHXA 2WWHA 3PUZA 5JS7A 1NY5A 4WXRA 4ACBA 5KPJA 1SKYB 4FI3C 3U44B 1XJ0A 1SULA 1J7KA 4PFSA 1PLLA 2ZU0C 3TSZA 3SFZA 1D2NA 2DCUA 1XZPA 3QE0A 2JAQA 5IT5A 1Z47A 2ZS8A 3OEHA 4QG7A 3GJ8A 3LLUA 2R9VA 1MT0A 2VP2A 4LV5B 2NZ8A 3W9YA 5CB8A 4DCSA 1R2QA 3FKSA 5FI1B 4CZ2A 5F98A 1EFTA 2OXRA 4BFTA 3KKNA 4P32A 4O3MA 2QEQA 1XJCA 4LJ4A 5J4HA 1GFIA 3Q3JB 4AI6A 3T1OA 1VG8A 1JR3A 2VA8A 4NONA 4Q4LA 2G83A 5HE8A 4HI0E 3RSOA 4UXHA 1U2RA 3NVAA 3A6PC 1E9FA 3TIFA 1W4CA 3GCGA 5UKDA 2QAGA 1YZNA 5KOYA 3LXRA 3EARA 4RY2A 1L4YA 4HUQB 1L7VC 1YR8A 1JECA 3DMDA 4IXNA 1MO6A 3KJGA 2GWHA 4XVQA 2J45A 2NOAA 2VL7A 2ZRPA 1AQUA 4Q21A 4WXPA 3KKQA 4W5HA 2QUZA 1H8HA 1DE0A 1GAJA 3I5XA 1WB9A 3ECCA 4DLZA 2W6JD 1KDOA 4QBGB 3H1TA 4EPRA 1IXSB 2ZPTX 1M2OB 3KUDA 1KI9A 3SE0A 3MUFA 1FX0A 4NYMQ 3SFVA 3EAQA 4PX9A 1YR9A 2E87A 3EPLA 2GXQA 2HXSA 3GLHE 3WY9A 1ESNA 1G9XA 3F0TA 4BLOA 4HAWA 4PAOA 2F9MA 4N1AA 4YLGA 1J8YF 4AIIA 4EKDA 1KI1A 1ZCAA 2IXGA 2WJIA 2ONJA 3THWB 3T1VA 4OBEA 3U4QB 1J99A 1G3IA 1HA3A 1KJWA 2FJUA 1IJFA 2OO7A 4RFSB 4Z1MD 3AVWA 3KFXA 2NMVA 1AKEA 1ZNZA 2H7VA 4M21A 4F91B 5EXPA 3P32A 1QRAA 2Q9BA 4G5OA 3RNLA 4UNRA 5GJWC 4MUBA 1HQYE 3EZ6A 2EW1A 4LJ8A 2O8FB 5AJWA 5FPKA 3QNUA 5FOUA 2GNOA 2J87A 2XTNA 1E2EA 4AC9A 2ZYWX 3SI7A 3AKDA 3KXLA 821PA 3QVVA 4Q1FA 2W0MA 5BN4A 5LD2C 2AKYA 3LAWA 2RGNA 1D2EA 3QXXA 2YJTD 1XD2B 3MSXA 4ZDJA 4PHFA 2ODEA 4DWJA 3D31A 3K1JA 3P1JA 3EWAA 2GK7A 4A0FA 5CJPA 1Z2AA 1E98A 2J0SA 1OXTA 4LBWA 4NYMR 2X1VA 3WBJA 1XX6A 3GLFE 2C5LA 2JJ2D 1GM5A 1YJ5A 4DLVA 1S4QA 1Y63A 2F7SA 1KK2A 1QHHA 4CT4B 4PQYA 3HPQA 4EIWA 2IUTA 621PA 1T91A 3UMFA 1VCOA 3FDIA 2QGZA 4U00A 2P3SA 3K9NA 1KK0A 2CJWA 5FBRB 5L3QB 2KI5A 3BRWD 3B1WA 2I4IA 4QC2A 1E79A 2J5XA 4OYHA 1UBFA 3AVOA 5LB2A 4EJSA 3WBKA 3QEJA 1DELA 2YOGA 3GMTA 2IYRA 2IUUA 1I4LD 1S3SA 4MGKR 4KI0A 4JLMA 4IOJA 3CKLA 3GJXC 2WAXA 3ZIAA 4HYYA 4JS0A 1Z0FA 4QGHA 1T3LA 4QJ5A 2KE5A 1W44A 2OLKA 5AWFC 3ASZA 5LDDC 2QPAA 3Q9LA 4RD6A 1O87A 1G7CA 4Q47A 3WNCA 3KQKA 4PO9A 1XTQA 2HEIA 2QQEA 1XCMA 4C0BA 3AGPA 2FSIA 3BJIC 2LKCA 4AK9A 1YRBA 1CBUA 2AD5A 2FSGA 4ITRC 4Y0AA 3FTQA 4PSVA 5ELXA 2F1HA 3TW8B 4KU4A 2RGBA 1NBME 1NJFA 3OEED 3P26A 1HV8A 4IFEA 5AJXA 1AS3A 4GSYA 5EE5B 4PC7A 3U6KA 1R5OA 2BCJQ 1MRSA 5B2ZA 3K70C 4ON9A 5F9FA 4BLRA 4LI0A 4JJKA 5FOXA 1CEEA 2MSDB 1BO6A 4DB4A 3AF1A 4QOSA 3CX6A 2KB0A 3EPJA 1NMYA 3DZ8A 3K70D 1XMVA 1TUIA 2QENA 2ZJAA 3FHTA 2UZ3A 5K8IA 4LYHA 2AX4A 4DJTA 1ANKA 2BM0A 2BM1A 3MFYA 1JR3E 2CL7X 2NO7A 2C9OA 4B3CA 2CE2X 2W6JA 3NXSA 1MV5A 2J0VA 4YMSA 2CK3D 2BBWA 2P6NA 2ZRIA 4PPGA 2V9PA 1NKSA 3B2EA 4C9BA 1NVWQ 1G8YA 4G5SA 1AQYA 1XRJA 3SZRA 1TF2A 4JYBA 5AK0A 5L3SA 1PZNA 3EW9A 5CIWA 3AF2A 4OQLA 3K9GA 2Y8EA 3FKQA 3FHCB 1TQDA 2ZJZA 4XWKA 1XFAA 3HPRA 3T1QA 1G4UR 5KDDA 3BH7A 3AVPA 3TE6A 4F38A 1EESA 2NG1A 1A2KC 2WVJA 1IBRA 2W0SA 2A2ZA 2F6RA 3F5FA 4M53A 2JLWA 4K46A 2HJGA 3QKTA 4X8OA 3E5HA 1XZQA 2HCJB 5AR1A 4Z1MA 1JJ7A 1NNEA 4O25A 4NBSA 4JBYA 3RWOA 1NMXA 4V0OA 4IOKA 5EP1A 3T06B 1IONA 4IKEA 5DGXA 4OL0A 1U0LA 4E09A 4LJ7A 1CULC 1B23P 1AIPA 3AVVA 1TF7A 3C16C 3KQNA 3TMKA 5GADl 2IYYA 2GJ9A 2ZUBA 5KSYA 1BOFA 1DARA 1JXMA 2IF2A 4HLQB 5JJKA 3AM1A 2VIIA 1VG0B 4US1R 5H1YA 3V9PA 2FZ4A 1T6NA 3LY5A 4JLDA 4TMWA 2FFHA 1NKTA 4Q48A 1OW3B 5DI3A 4PAQA 2VSXA 4LGMA 4TQAA 1H8EA 4FINA 4QGAA 1C1YA 4DXAA 4YMTA 5F3WB 2GJKA 1RVDA 1CS4C 1DEKA 2QPOA 1BH2A 3KXIA 3MLEA 4G1UC 3W3ZB 1G64A 4DT1B 3J81k 2V6JA 2JJ2A 3RLFA 3UATA 1MRNA 3GJ4A 4B34A 3WHKA 4A8JA 1QHNA 1KZ7B 2CDNA 3QQ5A 5LPNA 4TL6A 4W9MC 3K0SA 4L4UA 2G88A 1S1CA 4PHGA 2O8BB 1QDEA 1BKDR 1G8GA 2VP6A 2P2LA 1T5LA 2DPXA 1XEXA 4KV9A 1W36B 1ZMXA 2R65A 3G82C 3AKEA 3RSLA 3CR7A 1E2IA 3RS7A 1VYTA 1Z8FA 1PJRA 2WAYA 2ZJYA 2DR3A 2NO0A 3FPAA 3HWSA 1N5KA 4KYUA 3AKYA 4QNMA 3RHFA 2IS2A 2GVZC 2C95A 2PBRA 1Z6AA 3FMPB 4PHHA 4LDJA 4BLSA 1QVAA 3L0IB 5J4LA 3EZ7A 4IDOA 3VX4A 2UZIR 4TQ9A 2A5FA 2WJJA 2CLDX 2ZRDA 5TV2A 4XSGA 1O3YA 1ESMA 4YMWA 4EPTA 2ZR0A 3IDQA 4BFUA 2GAAA 421PA 1G19A 5AUPB 1KMHA 2JLXA 2DWOA 1E6CA 2VP5A 4BFXA 2VP9A 4Y0VA 1GKYA 1BYIA 1HE8B 3WP1B 2QMOA 3PVSA 2H18A 1JNYA 1ZUNB 1VG9B 2VHJA 4RD4A 4ZCLA 2W2XA 3FGNA 4HAZA 1DAKA 2OM2A 1T4GA 3OEEA 3HYRA 1Z6GA 2ZRMA 1K6MA 2KSQA 4QRHA 4F7WA 2WJHA 2XTMA 2ANBA 4D4KA 1LV7A 1M7BA 5L3VA 1ZNWA 3GJ5A 4V02A 2ZRBA 3NDBB 2YNMA 2B92A 1U9IC 2ZRHA 5JI2E 3LQQA 4GPTA 4NCHA 1G6HA 1SVMA 2F55A 1K8RA 3IEUA 2Q6TA 1GNPA 2VLIA 1E9DA 2PH1A 4MGZR 3OESA 3W8RA 4BECA 4IDPA 5FTKA 3FB4A 2PZEA 1P75A 3B5JA 4XIGS 5FL7D 1W48A 3X1ZA 4DDVA 3I61A 2O8EA 3BB4A 4RCYA 4JVNA 2WWWA 2F43B 1KSHA 2CK3A 2WWXA 1ZAKA 2OE2A 4OK3A 1AKYA 2ERYA 4GBMA 3VNVA 1UBCA 2IS4A 3RRYA 4BEJA 1G4AE 1TEXA 1OYYA 1M74A 2JLQA 1W2GA 2CEAA 2DWQA 2X8AA 1W5TA 4ABYA 1JAIA 2WOJA 4Q9KA 4X8LA 1P3JA 1IXZA 2CCKA 2BBTA 3A4NA 4R9UC 4BLQA 2GCPA 1KO1A 3TNFA 3CRRA 4S35A 1I2DA 2J46A 2ZUCA 2EWWA 2K5UA 1OH8A 4D0NA 1E2LA 3LA6A 1VTKA 3RS3A 3KJHA 1YZKA 5ANRB 2NZJA 3IIMA 3HU2A 1ODFA 1OIWA 4KFSA 5FOSA 4AD8A 5EZ5A 2PX3A 1G41A 1ZD1A 1ZC3A 2J1LA 2RB4A 4P31A 2PEZA 4PHTA 1XTSA 4TLEA 3T12A 2QI9C 4U5XA 3ZQJA 4BZQA 1KDTA 1X1SA 3CZQA 4BFZA 4O2LA 5GJVC 5HCNA 1ZUHA 1E9RA 1LS1A 2WPDD 4RJLA 1OXSC 3RAPR 1J90A 3ZS8A 2CVFA 2OCAA 3LVRE 1G6OA 2DFTA 3O8CA 4Q03A 1JEEA 3RC8A 1OF1A 1JR6A 4LJAA 1MABB 4TL8A 1KHTA 5SZHB 3R20A 2I1QA 4P33A 3T5GA 1LF0A 1NLZA 1M6NA 3VAAA 4DLYA 1NG1A 1SVIA 5JCPA 1ZIPA 2WV9A 5BXQC 3TGPA 2BV3A 3UIEA 3LBHA 1P61B 1Z0KA 4DLXA 4A0HA 2ZSBA 1ZVQA 1R8QA 3CX8A 1NIPA 1N25A 5TXGA 4YQFA 1JJVA 4ESHA 2ZE7A 2FX3A 1YU9A 1WBDA 4CW7A 3ZLJA 2NO9A 4R7ZA 3AUYA 4B71A 1NMZA 4D4LA 1VHLA 4PC3A 5J40A 3T15A 2FN4A 4ZV4A 3K09C 2MSCB 1RPZA 1KO8A 1TL7C 4DZZA 3QG1A 3W6OA 5C46F 1V43A 5J4VA 4JLOA 3ZJYA 1EX6A 1NBMD 4TLCA 2OCBA 3K0AA 2QORA 3QBVA 2IWHA 4CEJB 3NBYC 1S9DA 2G77B 2YHSA 1GNQA 3OAAD 2AL7A 3B60A 2QAGB 4TLAA 2H57A 4TMXA 4GZMA 4CF7A 1E9BA 4KXFB 1A82A 3IIJA 2OXCA 1UKVY 2QA5A 4BFWA 3DL0A 3Q85A 5E95A 5JCZA 2VSFA 3GPLA 3VKWA 4BEBA 1AS2A 2H17A 3NIBA 4WBSA 4ZCMA 3GLIA 3G0HA 4AKEA 1DAHA 2QRNA 3BFVA 1JALA 4E03A 121PA 5FUYA 3RS4A 4ARZA 2ZITA 1Q3HA 2VYFA 1FX0B 1ELOA 2QTHA 1JPNA 2ECKA 4NCJA 4I1OA 4W5JA 1R7RA 4A1FA 2ZANA 1DTSA 5EUMA 3RS0A 5AUNB 4QBIA 4RZXA 3EIEA 2C04A 5CIQA 3PQCA 4F4IA 4RKEA 1NVVQ 1CJMA 4TMVA 2RH5A 2WWIA 5FL7A 1U9IA 5DE3A 3C41J 2NPFA 4HB2A 4DLSA 5AUQA 4ZDIA 1NIJA 3AP3A 3F8TA 1G291 1PUJA 1W49A 4LHZA 4V0KA 3V4FA 1AZSC 1U0HC 2JGNA 3GLGA 1Z06A 3I3SR 3TKLA 4H1UA 2Z0MA 1NRJB 2AN9A 1G1MA 1W5SA 2ZRLA 4HAXA 4S2EA 4FMCB 3KB1A 5C2JB 2REOA 1LTQA 5HR5A 4B2IA 4GOXA 1EG7A 1AN0A 2FSFA 3FFAA 4NE2A 4A92A 3NC0C 1TX4B 3U3KA 2X77A 3R7WA 4Z54A 4XVUA 4GDFA 5TVKA 2RGDA 3CZPA 5BN3A 1UAAA 3DM5A 3PENA 5BWMA 2CLSA 1ZM7A 2PLRA 1OFIA 2FSHA 4GOKA 5IDVA 4BLPA 5CITA 1LFDB 3BS4A 1E99A 2ZS7A 4JLBA 4M1SA 2NIPA 1F3OA 2DBYA 2QY9A 3C5HA 4V0LA 4Q4AB 4TL9A 2GBLA 3B78A 3RS2A 1YZLA 3Q7QA 2FH5B 1ZNYA 1P2TA 3N2IA 4KBGA 4LYFA 4NCIA 2IYXA 4HZIA 3U7EB 1NVXQ 1QHHB 4D0LB 4JT2A 3S1AB 4QGGA 2ZE6A 2GZAA 4ZKEA 2CJWB 4JMPA 1KK3A 3VX3A 2JLSA 2HT1A 2JJ1A 1UF9A 2UVQA 2WPDA 1QHXA 3JVVA 4RSGA 4M4SA 4YDHB 5FBQB 4AURA 3R9WA 3ADBA 4EJSB 2OBNA 1SGWA 1FOEB 1MR3F 3QKRB 4DSNA 3QJYA 1N2CE 5JBQA 3QXCA 1Z2CA 2PLFA 5FI0B 4CEHB 3O8RA 3FHOA 4UNNA 1AM4D 1XU4A 2ONKA 3PEVA 1ETUA 3DDCA 2BWJA 2BHRA 2D3WA 3CF6R 1E9EA 2EWVA 1XBTA 2IWRA 2PX0A 2G9NA 1HUQA 4DCVA 4I4LA 3A37A 4B74A 1PLJA 1ZP6A 4HDCA 1E69A 3VHXA 3TJZA 3E2IA 1OLOA 3LNCA 1SVSA 2Z4SA 4M9ZA 5HPYB 4OQNA 5FTLA 1E3MA 2ZJ5A 1E2GA 2IF0A 2CXXA 4CEIA 4PQFA 2OT3B 5HKKA 5GJCA 2Q3MA 2IXFA 5CM8B 1NBMA 3QIAA 1WRBA 3LWNA 2XTZA 1QG2A 3A1TA 4Q7MB 4I1UA 3KKOA 4MYUA 5LBIA 1W7AA 3OAAA 4YMVA 3K09A 4K81B 5FUWA 4QL3A 1YZTA 2REBA 1XPUA 2MMCA 4PO8A 1Z0DA 3C7KA 2PCLA 5J4YA 3OE7D 2FA9A 521PA 1XMSA 3LO5A 2AWOA 4L9WA 1XCPA 1TMKA 3TUJC 1U8YA 3RYTC 1DAIA 4UJ5A 1KDRA 5DISB 2XB4A 2V55B 2OZEA 3ZDQA 4KFRA 1E0JA 2AR7A 4D4MA 4PR0A 3U2QA 3W34A 4D2IA 4QM6A 5IF9A 3TLXA 1OE0A 4TYWA 2Z4RA 3ZZUA 4LBZA 1FP7A 1GL6A 4DSUA 3D7MA 2AKAB 2C8VA 2ZJBA 4LJ9A 2B6HA 3E1SA 4DHEA 2GKSA 3CRMA 4IRUB 1CIPA 3GLIE 2IHYA 5KPDA 4KLZA 2O8DA 3CIOA 1ZM9A 3JZMA 3K53A 5JS8A 1CJVC 3DMNA 4FMDB 4URZR 1KY2A 1W46A 2BBOA 1SXJC 1KZGB 2D7CA 4LYJA 5L8VA 4WOPA 4B3XA 5BN5A 3KKMA 4C0HA 4E07A 1XEWX 3CW2A 3IHLA 1OFUX 5SZJA 2JASA 1I2MA 1ZINA 4KCGA 2V7QD 3GJ3A 3GJ7A 3AB3A 5DHFA 3R8CA 1SXJD 3MWYW 4FD2A 3AVQA 4F92B 1DAEA 2VRWA 2V4ZA 4MKHA 1JI0A 2AWNA 1T0HB 1N0VC 4L9SA 4PQRA 1II0A 2W6ID 3WNBA 1A5TA 4NCNA 3TH5A 1VDZA 2DFLA 3IIKA 2NGRA 1P72A 3BB1A 4IOLA 4MITA 3PITA 3GLGE 5DI3B 1L4UA 2E1RA 2FWRA 1NN5A 1TQ2A 4P0TA 3UWKA 1EGAA 3DVLA 3H86A 5FOTA 3C4JA 5LD2B 1RE0A 3IPYA 4JKYA 3HJNA 4MUAA 1MO5A 1KO7A 2QZ4A 1P6XA 5C18A 5J4KA 2HXYA 1DOAA 1MO4A 2ZI4A 3CF0A 1OFTA 2R2AA 2P65A 4C30A 1UDWA 4AG6A 2VBCA 2PJRA 1XXHA 1XEXB 4XTCS 3THYA 2BCGY 3NG1A 1U8ZA 3GEHA 4L5BA 3BFKA 4WAUA 1Q57A 5B58C 3TUZC 1GDDA 4A8JC 1H8ED 4C0KA 4NYJQ 2IT1A 5JECA 1E9AA 3PJRA 1T9HA 4B33A 4AYXA 4O0MA 3MG9A 3ZVNA 2PCJA 2ZREA 1XMIA 3ADKA 2A78A 1ZM3A 3Q5DA 3RRMA 4JSTA 4KO8A 3KQHA 2RHDA 2YKGA 2HCBA 1E1QD 3B1XA 5G41A 1RIFA 1IHUA 2FOLA 4IFBA 3E70C 5DO9A 2ZSFA 1P2SA 4KFTA 2YWGA 1R10A 4TMTA 3THXA 5JSZA 1IM2A 3FVQA 5P21A 3PCRB 3V00A 4DIDA 1TNDA 2XZPA 3CB4A 3CRW1 4M9SA 4QXAA 1Q1BA 2A5GA 4R71A 2YOHA 1OJLA 3U3JA 2CL0X 1EFRD 2W83A 2J7PD 2KJQA 4XH9B 3DM9B 1KI4A 2Q3FA 1CU1A 1WDTA 1FTNA 1XJQA 4QFMA 3QSYA 3PEYA 2O52A 3AF3A 2NTYC 2FE4A 2XOKD 5FOVA 5KDOA 2A3RA 1Z28A 2XGJA 2XX3A 3AH8A 4LRWA 1RJ9A 4M0LA 4MQBA 5HCIA 5CJ2A 4CGZA 2D62A 2N42A 2YWHA 3C14C 1US8A 3FMOB 4LPKA 4E5UA 2VF8A 4DUGD 3U3RA 4DC9A 1Z29A 5EZ6B 3TSOA 2VHQA 4NYJR 1IN6A 2VP4A 1TQ4A 4WA7A 2GAOA 1E1RD 4NP6A 3K70B 3OE7A 2XXAA 4MH0R 1RZ3A 1T8UA 3GFTA 3FFBA 3U6BA 2O8CB 1XTRA 4OK5A 2AK3A 1NN1A 3EG5A 3I4LA 3U3MA 1D2MA 2ZI9A 3QXSA 4ACAA 5KHOC 5KU1A 4FWTA 2ANCA 2Q9AA 4IDHA 2FF7A 3MCAA 3CRVA 1R0YA 3MWLA 5JEDA 5JLJA 2OEPA 2CBZA 5CB6A 2GCOA 3TK1A 1XTIA 1KKMA 2D4HA 4FMCF 4W5WA 2GESA 2X19A 3DPUA 3C8UA 3GEIA 1CKEA 3CM0A 3U44A 2V54A 3CPHA 1QG4A 5FOWA 3VMFA 1WMSA 3BGWA 4ILEA 4F4CA 5EE0A 4DIEA 4B6FA 4NU0A 1T0JB 1U0JA 4RCZA 3QUSA 3IO5A 1U98A 3LVQE 4IJMA 1IXRC 1EWQA 4Q9HA 4TMKA 1VPLA 4A0RA 2V7QA 5EE3A 5CLLA 1G3QA 1SXJA 1UJ2A 4ZI3A 4W7SA 3SNHA 5DNYB 2A5JA 3KJIA 4JVSB 4OQMA 1G3MA 2LKDA 1D5CA 5F2EA 5JWHA 3QVUA 4NYIQ 2W6IA 5C4GB 3KTAB 4I99A 4HZUA 4RKFA 1ZBDA 3EC2A 4NKRA 3EA5A 3ZGXA 1EX7A 3AGQA 4URUR 1G18A 2FGKA 4X8HA 2P6RA 4Q4HA 1GOTA 4HUQA 5FTNA 3T5DA 2ZS9A 1WF3A 4XOIA 3TRFA 1WXQA 4A6PA 1G17A 1CP2A 3DO6A 5AJVB 4ZI2A 4JZKA 5KSOA 3TQCA 3KL4A 4JBXA 1ZIOA 2P5TB 3VU9B 3U61B 3B1VA 2IA5A 2B21A 3AF4A 3ICQB 3AVTA 2HYIC 1EFHA 1KOFA 3B85A 2XB2A 1ZU5A 2DHRA 1Q21A 3MWKA 5JWOA 2D06A 2QP3A 3A8TA 1FQJA 4FCTA 4PXAA 1DO2A 3TVDA 4LJ6A 1TTTA 4DLRA 2YWEA 1A2BA 5DN6D 1W4BA 3G5UA 2ODBA 3K0EA 4KBFA 1DAMA 1NY6A 2FFQA 1RYHA 1HURA 5EP4A 5BYJA 1KAOA 4A15A 2H8KA 1JQJC 3MD0A 1SHKA 1P62B 1E2NA 2GF0A 3Q8XB 2C99A 1E1QA 3MJRA 1QF9A 4ZPXA 4D26A 1GZSA 4A0GA 4M9XA 3W6PA 1XXHE 2MMGA 1BYUA 3L8YA 1Z0IA 5TY0A 2JIZD 1KNXA 4ZKDA 4RFSA 2QSYA 5FPHA 4NYIR 3O8DA 4A2PA 3SQXA 1GTVA 3FWYA 1U8AA 721PA 1EK0A 2R6CA 3IQWA 3KX2A 3WYGA 1KI2A 1N5JA 1E2PA 1EFRA 5IK2D 2J7PA 4DDUA 2QSZA 1ZYUA 3IO3A 2EQBA 4OI2A 5K8UA 5H70A 3QKSB 4RD3A 3ONWA 3Q72A 5FH9A 1KSGA 4ZIRA 4YDSA 2XOKA 2JA1A 4UNQA 1UKZA 1KNQA 1FPMA 5FL3A 1E32A 1XD2A 2A5DA 2ZAOA 3UMRA 6Q21A 1KI6B 3GLIB 1KI7A 4UXJA 3HU3A 5GVRA 4FCWA 3H84A 3VR2A 4B2PA 1SQ5A 2GTPA 1E2QA 5DHAA 4FCVA 2ZRGA 2J0UB 3W5IA 4D82A 4DUGA 4ESVA 1R4AA 1OPXA 4WIAA 3MWJA 3GLHB 2ZETA 3KQUA 1XPOA 1E2FA 4LC0A 1E1RA 3I32A 4BRWA 3NEYA 4B32A 4DEYA 3PFIA 2FZLA 4NZYA 4OHZA 2C03A 5EJEA 4LYAA 2QG6A 3OIUA 2QMEA 2WKRA 5D3QA 3WMFA 4BGDA 5L3QA 1XDBA 4EPVA 2QGNA 4BZPA 2HLDD 4JLJA 2H1LA 4FMDF 4TYQA 2XITA 1DS6A 1AGPA 3K9LA 4QGFA 3U5ZB 1G3UA 3GLGB 3T34A 4LPSA 4OI4A 4CDGA 1HH4A 1Z6YA 4MKGA 3L0OA 1KMQA 1H65A 2J7KA 4KSCA 2FPKA 3GJ0A 3I8XA 3NKVA 1VECA 2IYWA 4MKIA 2GDJA 2JATA 3N2EA 3W5JA 2IHBA 4DSOA 2ZXUA 1N5LA 2QM8A 2R6AA 3M6AA 2TMKA 3B6EA 1XEFA 4NMMA 2AFIE 2RMKA 5KYKA 1GRQA 2GA8A 5FUVA 2IYVA 2OBLA 2R8RA 4TMZA 4DCNA 3CNLA 1Q20A 1SKYE 4GFDA 1DVRA 2IYSA 1GRRA 3FE2A 3GLFB 2OFWA 2VEDA 1UBGA 2OAP1 4M22A 4N3NA 2GF9A 4Q01A 4QHSA 4FN5A 1HEIA 1ZM4A 3DOFA 1E2HA 4B3FX 2BMFA 2W00A 3K9HA 4WVFA 2OCPA 2YC4C 2NO6A 2GBLC 2KWIA 3UWOA 2ORWA 2IS6A 3H4MA 4M1TA 3VFDA 3UXMA 3GFOA 1T3HA 3LDAA 1SXJE 3VR5A 3QBTA 1FFHA 2WMNB 5F9HA 4H9GA 4A4DA 4AWXA 1S1MA 3LW7A 4L15A 3K0CC 1UDXA 4D0GA 3NWJA 2OSBA 4BFVA 3UG7A 1FZQA 1F2TA 1YR7A 1V5WA 1Z22A 1X3SA 4GZLA 4XVRA 4GP6A 4EAQA 3ZS9A 1Z5ZA 4HAVA 3OIWA 1BS1A 5DN6A 3I8SA 4R98A 2JJ1D 4MGIR 4LX0A 2BMEA 2O0HA 2VP0A 1QVRA 3HP1A 4KAXA 3H0KA 3AEZA 1F5NA 1G8FA 3KXKA 4TWZA 2QE7D 5GVSA 2CNWD 4C4PA 3QF7A 4RZUA 2QN6A 1COWD 1XD8A 1E2KA 1G7TA 2Z6VA 3A58B 4N0EA 1IY0A 2FPMA 4CEIB 3OIVA 1NP6A 3L2OB 2JIZA 1JPJA 2DY1A 5E3HA 5KSPA 2VHUA 2I3BA 4OK6A 3CR8A 3BXZA 1CRPA 1XD9A 3X2SA 1NL3A 1UPTA 5FTMA 1AA9A 1G5RA 2JLVA 1N6LA 4OHVA 2FMXA 5IK2A 2BMDA 4NTZA 3PR1A 3TQFA 1MO3A 3BH6A 2OUKA 2W2TA 4PC2A 4DVGA 2QTVB 3CUEF 1R0WA 2HYDA 4GMDA 5HKKD 4DCTA 4LV6A 2CVHA 1P4SA 1JAHA 3OIYA 4LHWA 3VR6A 4DDWA 3CPEA 3CF2A 2MSEB 3I5YA 4OQXA 2EFGA 4EDHA 4BFSA 4LJYA 2ZI5A 1CRQA 2ZU6A 3GEEA 4HAUA 1DG3A 2GJ8A 1T5IA 2DYKA 2A30A 1YZUA 4JT4A 1OH6A 4ZO4A 2X2EA 4KODA 1K5GA 1IN7A 2PMDA 5DYIA 3CWQA 5JRJA 1UM8A 4IEIA 1ZJ6A 2O8DB 1RKBA 2HLDA 2V8OA 1C4OA 1RFLA 3L0SA 1F6BA 2QP4A 4BFYA 1LVGA 4TTPA 3KUCA 4CYMA 3IPXA 4URVR 2ASEA 4FIDA 1OKKD 1R8SA 5CYPA 5CDFA 2H92A 3ICEA 4U7DA 4V0ME 2XZOA 1DAFA 2Q21A 4B44A 1IAQA 4LJ5A 2WSSA 2H5EA 2YOFA 4C0QC 3HR8A 1XMJA 3FYHA 1UKEA 2ZTSA 2P0EA 2JDID 3IQXA 2O5VA 4U02A 4B3BA 5D3MA 3IBYA 1E4YA 4BRUA 2HJVA 2FGJA 2VF7A 3QI2A 3HYTA 1YE8A 3RABA 2DB3A 4Q4JA 3T61A 1CR0A 1OXUA 1ZU4A 4FMBB 2OFXA 3V4RA 3QG5A 2DFKB 1EXMA 3CPJB 1Z0JA 4A82A 4AYWA 1FNNA 2XZLA 3NBXX 5G40A 4GOJA 1A4RA 4LWZA 5JWRA 3BFXA 2ZSAA 5A5GA 1P9WA 1XXHB 5EP2A 1JEDA 1IN4A 1NLYA 1VHTA 4NDZA 3AVYA 2AFHE 3AKCA 4DEXA 2GEDA 4C7OA 5E7JA 1R5BA 1A1VA 4CRWB 1OIXA 1EFUA 1PUIA 5CK5A 1XNJA 3FMFA 3ND9A 5JJLA 3A4LA 2EFHB 4Q1CA 1G8HA 3BWDD 2FPLA 4LCBA 4RD1A 2FDCA 1XP8A 3NEJA 3TAUA 1II8A 1SKQA 2JLYA 2PEYA 3KQLA 4J0QA 4M1WA 5A0FA 1NVVR 2QQ0A 1IOZA 2F9LA 4GRAA 3R8FA 5JSZB 4KFUA 3K0CA 2PZGA 3I62A 4LUCA 4KHZA 1VIAA 1Z08A 2JJ8A 2BEKA 5L3RA 1E9CA 4NCKA 2C78A 1XEWY 2QE7A 1GWNA 2CNWA 4P3YA 5EQTA 2ZVQX 4OHYA 4HEJA 1Q1ZA 3BBPA 3B82A 1SVLA 2C98A 4C3ZA 2JCSA 5H8WA 1COWA 3D8BA 3QEOA 4KVGA 4PC6A 4AY2A 4D6PA 1XTKA 5EXSA 3NTUA 3PIRA 1XCGB 2ZQ5A 3LW8A 4BQSA 2P67A 4PZZA 3NDPA 2REXB 3DKPA 4AG5A 2ZE8A 1RJ9B 2WKPA 4MKFA 1Q1EA 1KJYA 3I92A 4I1SA 4A9AA 2EFEB 2GEUA 2XAUA 2ZYTX 4DB2A 4RZ3A 3EWSA 3EA0A 4HSEA 3SDZA 4C0JA 3A1UA 4TLBA 4DBLC 4Q5IA 2IYZA 3SJZA 2ZI3A 1EFCA 2WICA 1NN3A 1E94E 2ZRCA 3P27A 4HB3A 2YVUA 5DH9A 4US2R 2X2FA 4KVAA 1MH1A 3BE4A 4A2QA 1ZW6A 3GQBA 3K0FA 1IQPA 3X1WA 3WHLA 1Q3TA 2QU8A 2ZR7A 1N0WA 2F3TA 2ZJOA 3LBIA 1Z83A 3VR3A 1U99A 1Z0AA 1EWRA 5JRZA 1CR4A 1W0KD 1X86B 1OV4A 3PG5A 1P9RA 1YR6A 5HTKA 3RDPA 2GCOB 2NQ2C 2GK6A 4MRVA 4UXIA 1F2UA 2GJSA 3EASA 2GEVA 5CK4A 3ZVLA 2Q9CA 3WMGA 3OF5A 2IBMA 1ZRHA 3LFUA 1G21E 3A1VA 2ZYUX 3A1SA 2ZRJA 1FMJA 3QF4A 4IXMA 2GRJA 2WWFA 4QM7A 4LZZA 3L8ZA 4X8MA 221PA 2IYUA 1WE2A 3L82B 4D81A 3C15C 4EPXA 4V0NA 2QAJA 3LBNA 1G7SA 3B8HA 3RWMB 1D6JA 4EUNA 5K8TA 1OKKA 2VHCA 1BMFD 1LNZA 2QMUA 2R6GA 3CBQA 3N5CA 5G53C 1P2VA 5BQ5A 4G5GA 4BE7B 2D74A 5L3SB 2W2VA 4EFLA 4BPBA 4HAYA 4NHOA 1SXJB 4IW3B 2KBEA 1OSNA 2JDIA 3NH6A 2V3CC 3IEVA 1GKIA 3FOZA 3PV0A 1E2JA 1FMLA 1NLFA 2YZ2A 2ZRFA 3TW4A 3WYFA 3X1XA 4HZUB 2FFBA 5FPYA 4CEJA 4CVNA 1KO5A 1SZPA 1KY3A 1UADA 3IBGA 3U7HB 1PV4A 1XTJA 1AJEA 2D2EA 4G5RA 4PZLA 3IUYA 1RRCA 4JLAA 5CDFE 5B64A 1KYIA 4Q4HB 4Q1BA 1KKLA 5EXXA 2KBFA 1YKSA 4A36A 2B8TA 2GXUA 1U90A 2F3RA 2ZI7A 3I1FA 3DEFA 2AHOA 2YINC 4WW0A 2H16A 3M1IA 5C1BA 4GT1A 1CJKC 1OT3A 3MGCA 4P4SA 2G1JA 2OESA 2HF9A 2G6BA 1L8QA 2IYLD 3ZH9B 3LLMA 2Q3HA 4I81A 4POAA 5CM9C 1FUUA 3SHFA 4LV8B 3WRYC 3B1ZA 5EUQB 2BEJA 1A7JA 2ZEJA 2HV8A 4PAMA 4G5QA 2Z43A 5C4MA 2ORIA 2WTUA 1OYWA 3LV8A 3TR0A 4FW9A 2ZUDA 1W47A 4MGYR 3CX7A 4A8JB 1ZD8A 2G3YA 4JKIA 4CIDA 4Q9LA 2OILA 1WCV1 3U60B 1GP2A 2YWFA 2QP9X 2ERXA 2WJVA 1UEJA 2XNSA 3VR1A 2ODNA 2EYUA 4TYPA 1ZM2A 2B7CA 1OHHD 4Q02A 2VSOA 1G20E 2CL6X 2RHMA 1P5ZB 4Z8XA 4YXWD 3ADCA 2IC5A 1BIFA 3T1TA 1X8LA 1QHYA 4Q00A 3QPUA 1HQCA 3EC1A 3SN6A 3SYKA 1FQKA 4L8GA 1KI8A 1IJEA 4II7A 4ZIRB 4JVMA 3EIHA 1TU3A 4PPQA 2QMHA 4NPHA 2ZR9A 4TSFD 2BIFA 1S8FA 4B2LA 4D25A 3H2YA 5IRCD 4OQFA 3QENA 2JEOA 1GILA 1ONBA 2OG2A 1CJUC 1VCNA 4Q4AA 4P4UA 5JHGB 1KMHB 1ZC4A 5B57C 1OIVA 4QJ3A 5DSZA 5LB4A 3IKJA 2PL3A 1P2UA 3GFPA 2P6UA 3WNDA 3Q5EA 4N0DA 3KZ1E 2RAPA 2G0TA 5FR1A 1MKYA 1E9SA 3S1AA 5BW8A 3REGA 2HF8A 2VQSA 3HDTA 5TB5A 5AJYA 4WZAE 5EXTA 1JXOA 4LC1A 2BOVA 2FFAA 1FNMA 1UBEA 3L43A 2XEXA 1TUEA 2PT7A 3OHMA 4PANA 4WZBE 4D4JA 1NN0A 1WBBA 3AV0B 3RRNA 2ODWA 1W0KA 5KDLA 3QKRA 2LWIA 1M7GA 3GJ6A 4TLDA 1GG2A 2R6DA 4Q7KA 2OFOA 2ZI6A 4US0R 4CEHA 4EQ6A 4LHXA 4M1YA 2YYZA 3T35A 1E2MA 1HY3A 1P7CA 1CTQA 2O8EB 2XJ9A 5JEEA 4CT5A 2QNRA 3TVTA 2RGAA 3PUYA 1QBKC 1FUKA 2BDTA 2C96A 1PVOA 5KUTA 1CR2A 5A4JA 2NPIA 4LBVA 1J2JA 1BMFA 1N6RA 1E0SA 5TMPA 3U3OA 2JLUA 1KTVA 2QT0A 2QBYA 5EE9A 5B30A 2AXPA 1Q0UA 3DOEA 3WP0A 2O0KA 4PC1A 1WP9A 1CR1A 1GRNA 1YHNA 2VHTA 3TUIC 1IY2A 2XSZD 4BUJA 3CNOA 2ZJ2A 1FP6A 1WA5A 1X8KA 2FEOA 3RANA 1RC8A 2BC9A 2IW3A 3B9QA 2ZRAA 1N6NA 4JIMA 2WBLC 1RRGA 4KITB 2ZAMA 3NBFA 2RKOA 1N6KA 4BZXA 3NHAA 1TEVA 3ZD6A 2V6IA 4OJKA 3REFA 2ZYVX 4EPYA 2D7DA 4BASA 1R0XA 1K5DA 3AQ4A 1QZXA 3VHLB 4XWAA 3PXGA 1VKJA 2WOOA 3BORA 3MAAC 4P4TA 4Z8YA 1U94A 4NL4H 4Q9IA 2IYTA 3R9XA 3ZZTA 4RZ2A 4QHTA 3ZVMA 4AKIA 2ATXA 3QXHA 1F2TB 4Q1AA 2WKQA 3MRSA 3ZQ6A 1Q1QA 3AP2A 2PMKA 1DAGA 1LY1A 1NJGA 3ASYA 5JMTA 4Q1DA 1JBKA 1I4DD 3LD9A 1G5TA 3D3QA 2ZIAA 2BJWA 4TTRA 2W58A 1Q44A 5G3YA 2V1UA 4TN1A 3RRZA 2Z83A 1G5PA 1HT1E 1U81A 3VNUA 3UKDA 4TQUS 4WZ6A 4HUTA 4KLNA 4HDQB 4Q66C 1OH7A 1NVUQ 1R0ZA 2FU5C 5CYOA 1KDPA 1VMAA 4JL5A 3PEWA 1GSIA 3UK6A 2PT5A 1TQ6A 1CLUA 1N0UA 2B7BA 1XB2A 1YVDA 2J3EA 1GITA 1MOZA 3U7FB 3EZFA 1OHHA 1YQTA 2ZSEA 1E96A 4H1VA 1NF3A 2WZQA 1DADA 2RCNA 3K8YA 1IN5A 4KSBA 4YXWA 5GJBA 1N6PA 4URWR 1SHZA 2WMOB 3W6NA 3THWA 1OXXK 3U4QA 2CE7A 2ZE5A 4ZCIA 1NSTA 1OB2A 4GP7A 3AVUA 2BKEA 2QTFA 2VPPA 2AD1A 3QY0A 5BYKA 4TZ6A 1GL9B 1SVKA 3K0AB 3ND8A 4TSFA 2AK2A 4QBHA 4OJQA 2C2HA 1WQ1R 2R6FA 2WJYA 3OFND 3PEUA 3EIQA 4DRZA 4C0AC 2ZRNA 5J47A 2UKDA 4Q7LA 1SVWA 5SZIA 4IVRA 2QT1A 4TYNA 1L2TA 5FBLB 2N1BA 4HDOB 3SR0A 2O8FA 4XWOA 1P9NA 2ZROA 1KJZA 1TAGA 1NG9A 4OKSA 4YONB 1M1YE 3PUVA 4FWIB 4XTRA 1X6VA 3CONA 4HLUC 4QNRA 4UKDA 5G3ZA 4YC7A 5JZVA 2VH5R 3JZAA 4JL8A 1HT2E 2LCFA 3WXMA 1S2MA 4RD2A 3BC1A 3GD7A 4JJZA 1N5IA 4QBFA 4ARZB 4MYTA 4DDTA 4B48A 1RYFA 4TL7A 2Z5FA 4F4JA 4ASUD 1W36C 1VYUA 1P73A 3SEAA 3EPKA 2I1VB 4V0MA 3SBDA 1E0AA 4TYYA 4I1VA 1ZD9A 1J8MF 1X1RA 2A7QA 4TT3D 4HATA 4JSYA 4PTLA 1T3SA 5JHHB 1IY1A 3CH4B 1GKUB 2HT6A 4BLTA 2WJGA 1W36D 1X8JA 3ETLA 4D80A 5D3MB 3DKVA 4ZDWA 2GJAA 4A6XA 3A1WA 1T8TA 4DKXA 1Q22A 3UANA 1YZQA 1JB1A 1VG1A 3DZDA 4UJ3A 4OHWA 2WIAA 3RS5A 4EFNA 3BD9A 3EZ2A 4Q4JB 3B13B 2XJ4A 3VR4A 4ZDKA 1W0JD 2WSSD 3BERA 3KFVA 4Q1EA 2F1IA 1KGDA 4LY6A 4PO1A 4DSTA 3EPHA 2IS1A 1KI3A 1Z63A 3W3AA 1HTWA 2XSZA 4KYIB 4V03A 5AJZA 1JQLB 5H68A 3R7WB 1C9KA 3NBZC 4IEEA 1OXVA 4MRPA 1DBSA 3LQRA 4B3DA 4DLWA 3B1YA 2G1KA 2J59A 3W90A 2GZDA 1W1WA 4XD7D 5HE9A 3B7GA 4QKQA 4PPFA 1ZCBA 1VCIA 1Q12A 4C7OB 2NO1A 3AP1A 3WYAA 3SHWA 1TPZA 1UEIA 4G01B 2ATVA 2O8CA 2RGCA 4XJXA 5E4FA 2ZM5A 2RGEA 1DPFA 1LF5A 3Q7PA 4URXR 4M1MA 3NHBA 4TTQA 2R62A 1II8B 3ZYCA 1W2HA 4RD0A 2CCGA 4JL6A 1ZUIA 2RGGA 4RFVA 3QXJA 4C2UA 1Z6XA 2XNDD 4BWYA 2ZSDA 4JLKA 2WIBA 5K8LA 4RVCA 4MRNA 1IN8A 4UQOA 1VYVA 4FXPA 1OH5A 2VTKA 3CRQA 4HB0A 4PSKA 3MMPA 4IOMA 2QM7A 2WSMA 4UNPA 4MYHA 3TR5A 1N6IA 3LH5A 2F1JA 2OAQ1 2WWGA 3O47A 3W8NA 2WWYA 4IVPA 4XSHA 5M04A 3KKPA 4EPWA 3VKGA 3R9IA 4HB4A 2JLZA 1M34E 2CLCX 5E7MA 1D9XA 4OHXA 3SS8A 3C5CA 4LK2A 1FTSA 4JYCA 2IEZA 1QHIA 3THOA 3X1DA 2OV2A 2V1XA 2Q0HA 4MA4A 4K8OA 1GL7A 1KIMA 1D9ZA 5KNBA 2BBSA 1CF4A 4LBYA 3SYNA 2GVDC 3CWZA 2IXEA 3VQTA 2BMJA 3ZZ0A 3KTAA 2A5YB 2HDNB 4E22A 1I4TD 2FEMA 3FMIA 3WMEA 3SU8A 3WRXC 3K0FB 2ZVPX 5KNDA 3AUXA 2IYQA 2PJZA 3QOFA 3ZD7A 3F3YA 2L0XA 4LOAA 2OLJA 2ZRKA 3O8BA 3LX5A 2A9KA 2C9YA 2FNAA 3OFNA 4JLNA 5FR2A 2OBMA 4M2LA 5FBWB 3VU9A 1S0UA 4B3GA 1YRAA 1KSFX 3B9PA 1F2UB 5J5CA 3SJCA 4Z51A 3IGFA 3UG6A 4QJ4A 3QKUA 5HZKA 8OHMA 1ZNXA 4IDQA 2EYQA 1RRFA 3QF4B 4MYCA 4A2WA 1SVOA 4JLPA 3CO5A 2B8WA 2CCJA 2GHIA 5DI9A 1OFHA 4HLUA 4IHQA 3EX7C 4B35A 1RRPA 1GIAA 5JFGA 4ASUA 2IK8A 1E4VA 4DT1A 3LX8A 5EE1A 1VIYA 3CLVA 4TT3A 2G0NA 1UFQA 1Z07A 2O8BA 2ORVA 3LRPA 4KJZA 4LSGA 1QHGA 3P4YA 2GZHA 3D6TB 2EVWX 2J9RA 2SHKA 2WM9B 1XPRA 4AYTA 4Q9JA 2P5SA 2GXSA 1J70A 3NH9A 3OEHD 3VKHA 3SJAA 2QROA 4MRRA 2DWPA 4LHYA 4B6EA 3EZ9A 1W0JA 1GUAA 3QKSA 3FKSD 4UNSA 3L0PA 1M7HA 3MJHA 1PLKA 1AK2A 2EU8A 2QAGC 1W4AA 1HYQA 2N46A 3NC1C 1JR3D 3KDSE 3M4YA 5FFMA 3JVUA 1KI6A 4P4SB 5TARA 1XWIA 2ZJ8A 3RC3A 1S3GA 1TF5A 3BAFA 4B76A 3UMSA 5DIFA 2DFNA 3HU1A 3I73A 3UPUA 5KSZA 4XD7A 1VCMA 2BJVA 1YZGA 4R2HA 1Y3AA 2J0UA 3P4XA 3X1YA 1FW6A 5CLQA 1GVNB 2CHQA 2YV5A 3GLHA 3QPVA 4JLVA 3CNNA 4Q7JB 1FL9A 4B75A 1XF9A 4JVLA 5TDHA 4HLCA 4YMUA 2C77A 1F48A 1AS0A 5FPTA 1H8HD 2D2FA 2F1RA 2QPTA 1E2DA 4GNKA 2BVNA 5DLQC 3AVXA 4DLUA 2IL1A 5FPSA 1E0KA 2YC2C 4G3XA 2GILA 3KB2A 3QPWA 3THYB 2XNDA 1R6BX 2R44A 2QRZA 4AKHA 4F93B 1KK1A 1R5NA 5AUOB 4C2TA 5SZKB 3A36A 3SJBA 5KTYA 2AXNA 3BH0A 3IILA 4R2IA 4MDFA 3BIFA 4MDEA 1CJTC 1II9A 5FUXA 3ADDA 1N6HA 3HR7A 2IX3A 4GI7A 4O2RA 2FG5A 3P20A 4OI0A 1G7RA 1TADA 2CHVA 1NSFA 4PZYA 2F43A 3IHWA 1LW7A 2IUSA 5EP3A 2O0JA 5DYGA 4PSAA 1GNRA 4NH0A 2E9SA 3U7GA 2BKUA 5FTJA 1TU4A 3THXB 3TAHA 3A4MA 1D8TA 3BOSA 2GXAA 1S9HA 5JJIA 1DO0A 1S96A 1AZTA 4QHYA 1QHSA 1G8PA 2RGXA 1Z3IX 3LXXA 2RGNC 3SYLA 4M9QA 3GLFA 1LB1B 4L16A 3I72A 1KSJA 3SBEA 2OCYC 2GETA 4IDNA 3KJEA 3VTKA 3TSWA 3GP8A 3TBKA 4Q18A 5IHPA 1DG1G 1OB5A 2C9CA 4M8NE 2CHGA 2EFCB 4URYR 1G16A 5FBVB 3ZVRA 4LHVA 2FV8A 4B43A 1AGRA 1M8PA 4B73A 4C0LA 4JBWA 1US8B 3SOPA 3SC3A 4TZ0A 1NI3A 1KAGA 4DLTA 2PZFA 2CMKA 2QL6A 5KO2A 1F60A 1N3BA 4G0NA 4Q19A 5HZHA 3RVBA 1Z6TA 3PUWA 4GMXA 4C0SA 1W4RA 2GCNA 2EFDB 1B0UA 3BK7A 2XXAB 4EJSC 2OHFA 4AKGA 4EQ6B 3M0EA 4OI1A
chains in the Genus database with same CATH superfamily
3OZXA 2CVQA 3PFHA 5J5VA 4CF3A 3I0NA 4I4TA 4ERNA 1CXZA 4ECEA 3WGKA 2XUFA 5CRIA 3CA8A 4YCLA 2GD1O 3BB3A 4DCUA 5C8VA 3FUXA 1HFKA 5K5EA 1IULA 4EM6A 4QREA 3EXAA 2A9QA 1SQ6A 3D7NA 4G63A 4MRSA 5B4TA 4Q16A 3RODA 2O3TA 4B47A 1BRMA 3DHWC 2HWKA 3FGOA 1PK9A 4XJTA 3WGZA 1O95D 5BUQA 2I4OA 4DHWA 2Q0QA 5IFKA 4GL2A 5ELMA 2HUPA 2WHXA 3PUZA 1QV9A 5FDFA 3ZDCA 1P9LA 1PS0A 3EMDA 1SKYB 3HN6A 5AHKA 2JBAB 4HEA1 3H05A 1PT5A 2OV1A 2E49A 4XQCA 1PLLA 4JYMA 3TSZA 4BNDA 4BFLA 3SFZA 3GRYA 2WSLA 1BVYF 1ZESA 3GH1A 1VGVA 3UGTA 1CFJA 4RWZA 3Q3IA 4N3GA 5DX0A 2WJWA 3M3PA 2PPLA 2GPYA 3GJ8A 3I30X 4U9HS 4UVIA 5JAQA 5LA6B 5EZSA 1MT0A 3ROKA 1TUBB 1YS7A 3GAMA 3I37X 4BN5A 3W9YA 4M46A 4DCSA 1P3Y1 1YI0A 3FKSA 5FI1B 1V1MA 5F98A 1Y9DA 1EFTA 1BW9B 4IIVA 2PQ0A 4EFDA 4YAOA 4DCPA 4LJ4A 1YRLA 2YHIB 1FVHA 5HE8A 2VA8A 4NONA 1QU3A 3U80A 2ASVA 3KLNA 5FQNA 3AJ9A 3UAZA 5EMMA 2I33A 3ANNA 4II2A 3A6PC 4IGAA 2NV2B 3C3YA 3NGMA 4I50A 1QO0A 2R6ZA 1FUEA 1JA0A 3OKPA 4IY1A 2QAGA 4TV9A 4ZARA 3U3DA 2PUHA 2D3TA 6LDHA 1MC8A 4Q93A 2IHTA 1V0JA 1NTRA 1RKQA 2GM5A 1GNLA 2PM8A 2NOAA 2YFYA 2Q49A 4CG1A 4M8IA 1A8UA 3D6MA 3KYIB 2EBUA 4NZPA 3RYIB 1ZGHA 3KKQA 3NM5A 2ODAA 4W5HA 2BFAA 1H8HA 4E14A 3OO0A 3I5XA 1PWZA 4QPCA 5DW3A 1K6XA 5H5JA 1PWYE 2OYRA 1IL0A 2W6JD 4LRYA 4Z4QA 4QBGB 2AC7A 1BFUA 2AOVA 4XCVA 2VJYA 2ZPTX 4ND3A 4EG8A 2OGSA 1GRCA 3M9WA 3FBGA 3TQOA 1IZ9A 2XH8A 4BTVA 4MR7A 1HDYA 4EUFA 3KTOA 3INRA 1IDOA 2E87A 5LNK1 4DC0A 1F12A 3EF0A 1ILEA 2A0UA 5EZYF 5GGXA 5A05A 3F0TA 4HQ0A 4E4RA 1YVUA 1P7YA 4K6HA 4N1AA 4YLGA 2QV0A 3H0EA 1KI1A 1MPTA 1ZCAA 2JIRA 3D3EA 3LT4A 2XKAA 4NBTA 3NOVA 5JSQA 1E3TA 3D7KA 1G3IA 4L5AA 4DWOA 3FZGA 3TXAA 1ZSVA 1PT7A 2AR0A 4L4RA 3D8TA 4YROA 2PMEA 2VH2A 1MCZA 3ETCA 5KUTA 1D2AA 2D0DA 1YA8A 1YHZA 3AHGA 1FJHA 3KFXA 4RE5A 1BHJA 3QV2A 4HN9A 1ZNZA 3D4LA 4AJJA 2R00A 4JKOA 3I2JA 5TQJA 3CFYA 5ALSA 1XZBA 3PPYA 5DWVA 1EFPB 2YIJA 3RNLA 1B8VA 3N0XA 4FGJA 4C5CA 1DLJA 1K06A 1P91A 2EW1A 2O8FB 3ZCVA 4KXLA 1EUQA 2JANA 2CFCA 5ALUA 3O4HA 3ZLVA 3GFQA 2PZJA 4JJIA 1X0VA 1CZUA 4AC9A 4D42A 4F97A 5C8ZA 1RXVA 2DEUA 5LD2C 2E1PA 3LAWA 2DVMA 2PQ6A 5K99A 3KE9A 1D2EA 3JQGA 3OJCA 3QXXA 3PQ7A 1NXSA 3MSXA 4XFKA 1OZHA 3AC0A 3O4GA 4PHFA 1YE3A 2GCEA 3R09A 3HLKA 2QUHA 2GYWA 4RBNA 1CHDA 4PVDA 1J5EB 4K2HA 2J0SA 3VV3A 4LWQA 1QB7A 2P90A 2Q4TA 4ZCRA 3GLFE 2C5LA 3I9MA 2AHRA 3NHRA 4BXOB 4YAIA 3VVMA 2R85A 1Y63A 4MS3A 1V8DA 3DTNA 1K4KA 3HPQA 2I6SA 4LHEA 1U28C 2DRIA 5F3RA 2OZPA 1EUDB 1JU3A 4FOSA 3QYPA 2I3DA 5CT4A 5IJAA 5L3QB 4YWHA 4BB0A 2KI5A 2ZTHA 3W5HA 1YC5A 3O5AA 4QIHA 4QC2A 4FYYA 5JPIA 5TVGA 2PBFA 4ZT4A 5JCXA 4GI1A 3AVOA 4EJSA 3WBKA 1GR1A 4WE3A 2VK8A 2W93A 2PRSA 5B3LA 3L1KA 1MPXA 4LQDA 5FBHA 2PWZA 3QEMB 1TIPA 3NYRA 1I4LD 2HK6A 2PLNA 3LXMA 1E8NA 5AM3A 4LXUA 2X8LA 2MSWA 3GJXC 3IP7A 3NP7A 5JY1A 4TV8A 5HCUA 3STXA 1CRZA 1OX6A 1PZXA 4NAVA 1OVMA 1T3LA 4UAUA 5TPZD 3VI3B 2DPGA 3TNLA 2KE5A 4DTIA 1W44A 1E1KA 2OLKA 4MPPA 5J23A 4LKOA 4B85A 1E3WB 1O5OA 3T99A 4HYTA 5CD9A 4I9UA 1DAPA 3UPDA 2OK7A 3NHLA 1RXIA 3EUAA 3UT6A 5JNVA 4FFWA 4KMOA 4O4JA 2TRSB 2H5LA 3CZ4A 5A3RA 3GMSA 3SHVA 2AFHB 2NO4A 3GJSA 1Y1PA 4B17A 4L0CA 5GP1A 3G7NA 1U5AA 1XKLA 2OZKA 2FSIA 2RHCA 3DXFA 5JLAA 1YRBA 1CBUA 4GF5A 3I9JA 3CLRC 3H2JA 5SYMA 3NKLA 4Q0MA 2FWBA 4QU8A 4DN6A 4COKA 4KU4A 4IF6A 3MS7A 3DFFA 1HV8A 3GNQA 2A0KA 3NNSA 3P26A 3QPDA 1R9MA 4ALIA 5DNWA 1W76A 4WJZA 4C7KA 4PC7A 2JVIA 4Y9UA 2H7CA 2BCJQ 4RUKA 1MRSA 3B3AA 4TTAA 1XLWA 5KYUB 1VA5A 1M0TA 3DQPA 3EIFA 3FNHA 4OATA 1HNZB 3A28A 3IVGA 3RVQA 2YNMD 1CEEA 3EA4A 4MRMB 1Q50A 2BKAA 3VOTA 4L95C 1V3TA 1T29A 2QRKA 3ORYA 4JK3A 2Q3CA 3F7TA 3LFTA 4XOUA 5FEMA 4K2AA 3ZY2A 3QMVA 3TFWA 3ZV5A 1XMVA 2UVPB 2ZJAA 3BIWA 4K0KB 1KTIA 3H9BA 1FFXB 2DPYA 2AX4A 5KAMA 3MFYA 3BHIA 2BM1A 5F9MA 3RV4A 2DZDA 4AMYA 2ADFA 4GVXA 2NO7A 4B3CA 3DT8A 1PU2A 1AD2A 3DAHA 3LZCA 1EP2B 2JAHA 1MV5A 3OCVA 1SHLA 2D5CA 3NP9A 3KSZO 3EY4A 4FILA 4ETIA 2ZRIA 4H7FA 1UPAA 4F8JA 2V9PA 1KQGA 4MP8A 1NKSA 3ETJA 1M34A 5I6DA 1YZFA 3B2EA 4F4HA 2VAMA 5DK4A 1NVWQ 1X1CA 3CINA 2PY6A 2FUG6 2Q7OE 3NV9A 1YS2X 5DBFA 4ZCQA 1G8YA 5L3SA 3AB8A 1PZNA 1Q0RA 3EW9A 4ZXFA 4FLFA 3IBFA 1LW6E 3EIWA 3IAFA 2Y8EA 3PYMA 1YE5A 3WGQA 2IZ5A 2Y4OA 3O8OA 1TQDA 1PS8A 1UFKA 2CLEB 4IG4A 4UQPA 3WL4A 3TMAA 4JUAA 4XWKA 2XBLA 2B30A 3NBAA 3T94A 4DV1B 1X70A 5ITSA 1A2KC 3TW6A 1IBRA 3F5FA 1UJNA 1U0SY 3GBVA 3DBLB 2OENG 1A9SA 3GG2A 3FN4A 2XUDA 4KSYA 4O25A 4NBSA 4CTJA 1NNEA 5K2MA 4L76A 1HDRA 4AB1A 3VH4A 1PTJA 4E09A 5DGXA 4OL0A 1U0LA 5LZ8A 1NNSA 3H5LA 3HZRA 4NZ9A 5ALRA 3DJFA 3HB9A 3C16C 3VR5H 1ISFA 1M2VA 3RG8A 4OIFA 4R1LA 4B40A 5GADl 1NYTA 3O8LA 3WLHA 2ZUBA 2EV9A 1DARA 1JXMA 1SCNE 3GZTB 4XR9A 3UOAB 3BSWA 4O8CA 3D2LA 2DAPA 3V9PA 1YONA 2FZ4A 3CNQS 5CCBA 2I6QA 4IVNA 4D8UA 4TMWA 1L5HB 3I9LA 3ZNNA 5C53B 1FUIA 1OW3B 1Z5WA 2H85A 3F6YA 1Y8CA 4FYKA 1QDUA 4QGAA 1AKWA 2PIAA 3HO1A 2G04A 3KT8A 4BNJA 1RVDA 2O20A 1OLUB 2PUTA 2X5OA 3MLEA 1OGYA 4G1UC 5GZ3A 1XEAA 3HXKA 1SVNA 1L1QA 3JALB 2PLWA 2QLFA 4JHLA 4MUEA 1T35A 4RIGA 4RIIA 2JJ2A 1R0LA 3KWJA 3U1VA 3J81k 4EG3A 5LPNA 4W9MC 3QQ5A 1BU8A 3MGKA 1QIFA 3KOXA 1JSXA 3R4VA 4IIJF 3MRXA 4OJYA 4CKBB 1D6SA 2HBQA 3SBXA 3BMNB 1QPBA 5LKAA 2Z9DA 5CBPB 4LF4B 3Q98A 1CNEA 1W36B 2C4WA 1FYFA 3BRWA 5AVZA 5CFZA 5C0OE 1E2IA 3RS7A 5JH7A 1KYZA 4QO7A 4UBKA 2X76A 2YV4A 3N53A 2DU8A 2ZPUA 1Y1QA 3AZOA 4DF3A 3VBCA 1HR0B 1OT5A 1JKFA 1TKBA 3O2NA 1LNQA 2OD9A 3EDCA 4MZDA 1LLCA 3F49S 1D7OA 1N5KA 1I0ZA 1T5HX 4GDMA 4AAYA 1YV9A 1KRXA 1TQ8A 4HYQA 2C95A 5IDYA 3FUVA 5TNXA 5BUZA 5DOZA 2PBRA 5KYXA 2IEAA 4Y6LA 3ZE8A 2Y6VA 3I6MA 3HO6A 2YVKA 4ETWA 1JWLA 4MHTA 3QSGA 4TQ9A 1BMDA 1Z5OA 3W5BA 2WJJA 3CSDA 3RAEC 1PZHA 2CLDX 3AEYA 3PNSA 1O77A 5DM1A 3RFTA 4AXBA 5A02A 4QSMA 1VXOA 1GO2A 4BJ5A 3G8BA 3P2EA 5TV2A 3D64A 1S4MA 1RI2A 1QVVA 3KYJB 2ZR0A 3OX4A 2CJXA 3ZV7A 4OHPA 4BFUA 4RK4A 1H5QA 3DB1A 2MCFA 3LCMA 4CTMA 2JLXA 3QHAA 5CMLA 1TT5A 1M8FA 3QUQA 4UM5A 1GKYA 2OQIA 3T95A 4IJ6A 3PGLA 1JDNA 1Y1LA 1TJNA 4QUEA 2VHJA 3BGSA 3T54A 1SY7A 2Z09A 1TK9A 1RBZA 3IPAA 2O50A 3H5RA 1ES9A 2BONA 1DJQA 3HYRA 2W4IA 2EZ9A 2PD3A 3SQOA 4F7WA 3DDHA 1EJ2A 3RREA 3MGAA 2XTMA 4D9IA 1M2GA 3N6RA 3PK0A 4D4KA 2VC2B 1KFKB 2NNWB 1U7HA 1ISGA 4V02A 1SUCA 2B92A 2EATA 5KJ6A 1I24A 1U9IC 2OCLA 5DTEA 4JP5A 1CJBA 4YJKA 3KXPA 3OETA 3UJ8A 4EGSA 2PYZA 2X8BA 3N7UA 4Y1FA 1M54A 2VLIA 5K03A 1M8GA 2I7CA 3VV2A 3OESA 2R1ZA 5K2OA 1KZ6A 2PZEA 3JX9A 2BGKA 4D3FA 3AONB 2FYTA 4DJJA 5CNMA 1ZVKA 3EVTA 2VYCA 3BE8A 2CK3A 4R31A 4CLEA 3U4GA 3D9QX 4FNMA 4QQFA 5J2UA 4D9HA 3VKVA 3KZOA 3TD6A 2AT1A 5LYYA 3DHEA 4PNEA 2VTBA 2WJZB 3QMPA 2BEWB 3N0TA 5LLSA 1WUKS 3V8NA 3KETA 1LD3A 1B6SA 4KC0A 3VNVA 4PTYA 1CUWA 2JW5A 4XRGA 3ZXYA 2XUOA 1P2GA 1QNLA 2EDCA 4Z6KA 2SICE 3NUZA 1P44A 1U3FA 5JD3A 2HIAA 2JLQA 2WV7A 3TWOA 1O03A 1S2DA 3L8CA 4HFRA 4EYGA 4KRFA 3LU1A 1JFLA 3ZTWA 1NF9A 5LXTF 3NYIA 2ECQA 1U0OC 4JODA 2NVUA 4X8LA 3WZMA 2WU4A 3JWEA 3DQQA 4DQDA 3RFCA 3RJ9A 1N75A 4QDXA 3TSYA 5LLTA 2WF6A 3AJ8A 4R9UC 4BLQA 2QGFA 4DNPA 1ZITA 1KO1A 1XLTC 3CRRA 4S35A 1LV8A 4ZVRA 1MORA 5KJFA 3K5PA 2QVLA 2QNBA 3RIGA 1XAHA 5GONF 3LQ4A 3RIXA 5B6IA 2VZLA 4AMZA 3KJHA 1YZKA 3DVQX 4GLOA 1VJ1A 2NZJA 2P6PA 2PGAA 3TE7A 3IIMA 5HBGA 3KQVA 4OREX 1UMDA 2MSKA 1JYFA 4KFSA 3T3NA 1G41A 1ZD1A 1ZC3A 1MMFB 1KQFA 4C89A 1IYZA 4M0DA 4PHTA 1Y3IA 2JD0A 1XTSA 2EJCA 3I9FA 3L4KA 3T12A 3OQOA 1T34A 1ZHOA 3P9SA 1YR3A 5EIHA 3VJKA 3KYCA 4OGKA 1RQNA 1W5BA 3CZQA 1CS0B 2VI5A 1J42A 2VYND 4HVTA 4BFZA 3X44A 4PZPA 1LS1A 2GYYA 3DMGA 5HF5A 3D5QA 1PNRA 2PG3A 3K9BA 2QSJA 4QPPA 3ASVA 4NE9A 3MZ0A 1XROA 3KJZA 1JEEA 4ZI7F 3EQZA 1OF1A 5I7EA 1T43A 4TL8A 4BCCA 3R20A 3IOCA 2QHXA 4OYLA 1M6NA 3QU5A 2EP7A 1UBOS 3ZE2B 1RAIA 1IM5A 2WV9A 2VNIA 2AZMA 4J91A 4UQLA 1ZWLA 5IANA 3LBHA 1SPXA 4U7DA 2HOQA 1P61B 3WWOA 1C7IA 2IHUA 4PAWA 4TKMA 1ZVQA 2X0EA 4IXWA 5KHAA 4DV5B 4YQFA 4L8VA 4EVRA 1UZAA 4J1TA 2OFFA 1YU9A 4XX0B 1DT3A 4CUKA 4K0RA 4FYMA 1XZJA 1WZIA 2XQFA 1U2SA 2O3JA 3ET5A 2FPPA 4OAQA 1NMZA 2AXQA 1ATZA 1VHLA 3M1LA 2X7XA 3RK4A 2H5IA 1KS2A 5LMZA 3C1TA 1RPZA 4B8WA 1L7RA 2I6TA 2PA3A 3K94A 3MWEB 4I5FA 4MS4A 4WHMA 3W6OA 1V43A 4TX1A 2ZT5A 3EISA 1GHTA 4R83A 1T25A 3OLCX 2QORA 3QBVA 2IWHA 3NBYC 3KPYA 4LDPA 3T5BA 4BTEA 4I66A 2YHSA 5CDSA 1OREA 4H4CA 3WDSA 1HSOA 2I76A 1Y7LA 1ISIA 2HTEA 3GVXA 4CF7A 3WLNA 2XUJA 4TM7A 3QUTA 2LRHA 2P4EA 3LHFA 2OXCA 1RBMA 4AJ2A 4BFWA 3Q85A 3H7IA 2P2GA 1EK1A 1JL3A 2VSFA 3Q8WA 5CM2Z 3HSSA 2BGUA 4OQDA 3BICA 4PWYA 4D9JA 2HIHA 4KIUA 2CXRA 4DRXA 1M0EA 3FY4A 4KEAA 4QRDA 5LN1A 1SCBA 4RVHA 3A14A 1E4EB 3HMQA 4OLFA 1UP6A 3KUKA 4GR4A 1ELOA 2ZJ0A 4P9NA 2ISCA 2QTHA 2YDYA 4X41A 1HBJA 4RTOA 1LSUA 4I1OA 2I0FA 3Q2IA 4W5JA 4A1FA 4ZMRA 5FF9A 3AOEA 5AUNB 3FTDA 4U2BA 3UFXB 4N01A 1L4NA 3Q5GA 4WNCA 4Y1EA 5T5QA 3MIZA 4OHFA 5JS2A 1BOOA 1PVVA 2K2QB 3KR0A 4M3NA 1W96A 1EWVA 1SKBA 3U4IA 4P3PA 2PO7A 1NHWA 3G3EA 2PZKA 2Z56A 4QAQA 3NJ8A 5FL7A 4EJMA 5DE3A 4HB2A 5AUQA 1G6KA 3AP3A 3F8TA 1G291 4IIEA 5IVHA 1RYZA 4HQNA 1W49A 4CFSA 3X0DA 4YP5A 4XGNA 1AZSC 1PK8A 4EELA 1B1CA 1HRKA 1KEVA 2BHSA 1JEOA 4B7XA 4BX8A 2HK9A 2Z0MA 4XUGB 2DQYA 2EZUA 2AN9A 3BBLA 5FAXA 3R4CA 1G1MA 3BHJA 3V8RA 4JU9A 2REOA 4N12A 4BVAA 2C5EA 5HSGA 1RWPA 1T24A 3C5EA 3ZE7A 4BBAA 4NE2A 4EENA 3NS7A 1TX4B 5K0ZA 5HA5A 3R7WA 2NU8A 1YQEA 3A11A 4BNFA 4EMUA 5KYNA 4GDFA 1M1YB 2EF1A 5IUJC 3DM5A 1GPWB 3DMHA 1JHYA 3HNPA 5AK5A 3PENA 4ZAXA 5K3CA 1ZM7A 2PLRA 1CG6A 3WE7A 4HRYA 1A8QA 1Y5LA 2K4MA 5CB4B 2YR0A 3N2KA 3KOOA 3IX7A 2V65A 4FQ7A 1INLA 3SLGA 3VC7A 1JLHA 1X7XA 2COUA 2BDUA 2O2ZA 5AM5A 1DIRA 4Q4AB 4TL9A 3ITEA 1YZLA 2HMYB 2FH5B 2JAXA 4KBGA 3N2IA 4LXTA 1NVXQ 1QHHB 1VLLA 3DVAA 4UARA 1GCOA 1XMQB 4ZYWA 3ETEA 3ED5A 3A6GA 4ZAYA 4QGGA 2ZE6A 4ZKEA 2WI8A 4YV2A 1MJGM 1KP3A 1KK3A 2XE4A 1A69A 1JQ5A 1UF9A 3JVVA 1QHXA 4RSGA 5FBQB 4AURA 4YCDA 2CNDA 3O2QB 3IOMA 1JUDA 4GYWA 2EJBA 2VQEB 3P9YA 5EJ2A 1CE8A 1RMQA 1SGWA 1FOEB 4U0KA 3QKRB 3JAKB 5M34A 3QPBA 1MLDA 3DGEC 1YASA 2X15A 1XVLA 2W6CX 1NC3A 3QPCA 1LQTA 3GMDA 5JBQA 1RHMA 2KLHA 1Z2CA 3QXCA 1T4CA 1TA0A 4ZYLA 3C6KA 3ROMA 1DEOA 2AMFA 3U9LA 3O8RA 4IJQA 2QLBA 4UNNA 4QDKA 1TJ3A 3GUCA 3AI2A 1QB8A 2NZWA 3JQ7B 1RYBA 3A27A 3F7OA 4X1YB 4D74A 2NTJA 1HT0A 5GGYA 1C41A 1LWNA 1U9JA 1JTEA 1JDSA 1KORA 2NV0A 3MNFA 4RV5A 4CKCA 2HQSA 3ZC3A 1SXGA 4IL5A 4O33A 1V1RB 1VP9A 3WLPA 2PX0A 3VDQA 3PNMA 3QX7A 4I4LA 4B74A 2R60A 2R8YA 4HDCA 1E69A 1WXFA 3TJZA 1YF3A 2EFYA 3B53X 4EA7A 5HPYB 4ZZ3A 1ISMA 3IPLA 4OQNA 2IUYA 3L6DA 1TC1A 1Y1SA 4X95A 3F5DA 4V0QA 4NCAA 2OGTA 3AV3A 1Z4PX 2OT3B 2PUJA 1E4OA 4L7QA 1I9CA 2Q3MA 2Y2VA 5I9TA 2BZ1A 2VHEA 1HNWB 5BNWA 3LWNA 1PFGA 5BSHA 1BQ4A 4XJSA 1QG2A 4Q7MB 4Z2YA 4I1UA 4MYUA 3HM9A 5EHNA 3OAAA 1W7AA 1RP1A 4QL3A 1YZTA 3BZWA 4LYGA 2GUWA 4KQIA 3SF8B 1XPUA 2RHBA 4DM7A 2PSDA 2BSXA 4PO8A 1P4AA 5CLGA 2FTKE 2EWMA 5IH7A 4U2FA 3ZV6A 2PCLA 3GT7A 4GBED 4ITUA 3NVKI 3PQ6A 4PGFA 2Y76A 1UAGA 3D4IA 5AVOA 1T2NA 3HWRA 2I99A 3USES 2V74B 1XCPA 2WPNA 3ANSA 5REQB 3RYTC 1U1EA 2AMJA 3TOXA 4AP9A 3R9XB 3AL0C 2Y77A 4WGFA 5AVWA 1EFVA 5DISB 5IJ9B 1WJGA 1QGUB 3PGJA 3ZDQA 4KFRA 2C7VA 2DBRA 4QQKA 3RHSA 4CMCA 4K6GA 2QM3A 7REQA 4D2IA 1TUGA 1XYVA 2G9VA 3QFSA 4PRZA 1L1FA 2WY2D 3PE4A 4DGSA 1ZR2A 1A8SA 1MJFA 2GQ0A 1PGQA 1OE0A 2Q3LA 3LPDA 1H0KA 3CGGA 2Z4RA 3M9LA 4HDRA 1TE2A 4LBZA 4DSUA 4LJ9A 2C8VA 3E1SA 4DHEA 2GN8A 2JZNA 2QW8A 4CM9A 1RTTA 1XELA 4IDCA 3CRMA 4M55A 3U4MA 5A9SB 4X60A 4L72A 4KLZA 3UCEA 4YCMA 5FV4A 2O8DA 1T6BY 3GLSA 1ZM9A 3A6HA 3PXXA 5BSVA 6NULA 4URZR 2CYAA 2IEBA 4LOIA 3EQ8A 4OB6A 4QTUB 1KY2A 4DABA 1GLGA 1GU1A 1P4RA 2BBOA 3BDAA 3MC1A 4MARA 4Y1RB 4B3XA 5K20A 1H2EA 5DHTA 5DBOA 1OAOA 2OV3A 3TRIA 2HSZA 1H0RA 2O1XA 5H7XA 3WLTA 5SZJA 1ZINA 2IU6A 2OCDA 1OZFA 2UYCA 3ZS8A 5BPFA 5DHFA 3FW1A 1KHHA 1TLLA 3AB3A 1MHPA 4BO7A 4YUXA 1DXQA 2R7MA 1YIAA 3MWYW 1RBQA 4FD2A 4G65A 4F92B 1MAAA 1FNDA 1YIDA 1JI0A 3RVLA 1SJ9A 4HYEA 5JS6A 2EX1A 1AUXA 1N0VC 1JSRA 4L9SA 4LMRA 4V24A 4FDTA 2NN3C 1A5TA 2RJNA 1H2ZA 4TQGA 5DWDA 4Q3LA 3N2GA 3WI7A 4BB5A 4ND8A 2NGRA 3STUA 4M76B 2CF5A 4E15A 2XYRA 4PZEA 1SKUA 3G02A 1NYLA 3P9QA 5DI3B 4YAUA 2RH9B 4I4TF 4P0TA 3UWKA 4D6XA 2CVOA 4KO1S 1D4ZA 3S8MA 4FOTA 3H86A 4NIMA 4BE9A 3C4JA 1DTWA 2YHAA 1AGYA 4L22A 3CN7A 4WDRA 1YJ8A 2QZ4A 1NI5A 2ABWA 3RTAA 3T41A 1M1ZA 1YDGA 1DOAA 2W6PA 1DMSA 5D85A 4G81A 1LX6A 1MDBA 3OT4A 2VBCA 2BR5A 3OT5A 3WB0A 3T3OA 1O0CA 4XTCS 3OZDA 5E9WA 1F2DA 1VL2A 2H9AA 3GEHA 3NG1A 2HZ7A 3CWCA 3HCPA 3A06A 4L5BA 4PHCA 3JQ8A 3TUZC 4JSRA 1H8ED 3D81A 4NYJQ 4GI2A 1T9HA 4B33A 2BGMA 3CMMA 3IAAA 1A9QA 5I4CA 1TZBA 1E3JA 1ZLXA 2BUCA 3ADKA 5D7NA 4RANA 2CXNA 3EZLA 4AF6A 2VHXA 3RRMA 4UATA 4JJ6A 3KQHA 4R4JA 3HKEA 1ONPA 5FCDA 2YKGA 2HCBA 1E1QD 3GU3A 3B1XA 3VU3A 2D8AA 2FOLA 2YJ3A 3E70C 4P80A 2ZSFA 4C6RA 1LU9A 2GBCA 4RV4A 2YWGA 4GPEA 1R10A 1XRQA 3B12A 1TZCA 1SWVA 3EXFB 4M49A 2E37A 4G4GA 4PYRA 2G6TA 3H8JA 3THXA 1WU8A 4NI5A 2FMTA 3NM4A 1CUIA 5CH8A 2SNIE 5A3SA 4AZ3B 1POWA 2XQGA 1VBKA 2ODQA 4L4SA 4I50F 3ESRA 1W88B 4PSDA 1TNDA 4TV9F 1U8XX 1FRFS 4QXAA 4KPUB 4R71A 1CRWG 1M1NA 2ZBGA 1OJLA 2PXAA 3ESAA 3USZA 2W83A 4B3IA 3R8XA 1R00A 2KJQA 3FTCA 5IJ0B 3DM9B 1BS9A 4G09A 4JI0B 3VYSB 5KYVA 1B8OA 1FTNA 5C31A 1N9KA 4DDKA 5IYZA 2O52A 5FOVA 4BO4A 5AJUA 2YIVX 4R2WA 3CHYA 3FF1A 2XX3A 2XGJA 2W2LD 3QK7A 1GYPA 3G68A 3I9V1 4CIYA 3EVGA 3VR2D 3U48A 2D62A 3FLBA 2DPMA 1MXFA 1M6VB 4LPKA 1US8A 3I5AA 4KE9A 4FSXA 5TPWA 3ZTYA 3IH5A 3R6TA 3A6LA 5AHWA 4RVNA 4FR2A 3RU3A 4QVIA 5DHSA 4IQFA 2JBWA 5JJCA 1NQUA 4CE6A 1Y8RA 4M87A 3OE7A 4BAGA 3FCCA 1DKMA 2GJ4A 4OH7A 4ZAFA 4OK5A 5U1PA 2FG6C 3CVJA 4RK7A 1MV8A 2C20A 3OA0A 4RTPA 4AG3A 3EG5A 3K1ZA 3CNBA 1D2MA 1D4FA 1AQIA 3HJTA 4R9RA 3ZHCA 2PN1A 5KHOC 2PANA 4BX3A 3MCAA 4REQB 1DDGA 4EFKA 2KHZA 3CEAA 1A9TA 3LHKA 5AJHA 3NTVA 4BMCA 4MEJA 4AQYB 3MWLA 1XRPA 1EVEA 4BGUA 5JV5A 4YCBA 2BFMA 3MT0A 5A4FS 4GMGA 4OQ4A 2C5FA 5I8WA 2Y1LA 2ID4A 2OKGA 1WUYA 3HJHA 4BO0A 4B0OA 4BO1A 1QKIA 2Z08A 3JRNA 1QO9A 4RL6A 3C8UA 1F3LA 1BE8A 1YAHA 3CM0A 3GFVA 1OFUA 4XPIB 3ZNPA 3QRWA 3UC5A 2V54A 3NVDA 5FWAA 5BSRA 4MQ5A 4G4SP 1XKTA 3VMFA 4KYTA 1NOJA 3P9RA 1T9BA 3C1OA 2JKZA 2DT5A 3HB1A 6ABPA 1NM5C 4WNAB 3KWMA 1KU0A 4NU0A 4B6FA 4RZQA 4R16A 4FEYA 3WSWA 2HKIA 4E2XA 2E4XA 1QZTA 4FB5A 1UJCA 3VPDA 1OROA 4KR3A 3LVQE 3RYHB 3CF4G 4CL3A 1EWQA 4PCVA 2D0PB 2RFLA 3FPEA 1XDSA 3C8DA 3OLVA 5EE3A 1G3QA 1RR6A 1UJ2A 3GYBA 4G4JA 5CTJA 3D6AA 3ICOA 1XZAA 2A5JA 4MV3A 4UDNA 3S70A 5AVXA 1NXWA 5A4KA 5K05A 5L7TA 3HXOA 2VJAA 1CZKA 1L7NA 5E9AA 1YCFA 1NNLA 3KTAB 4I99A 1V5IA 4KQ1A 1ZBDA 3F5QA 1QC5B 1L5YA 3EA5A 1EX7A 5AIAA 4URUR 3C5WP 1G18A 3AR6A 2FGKA 3GYGA 4KUGA 4LRQA 4PSCA 4D9NA 3DTVD 3FVRA 5EJ9A 3ZDZB 1MNAA 1GOTA 3RC1A 4HUQA 2IU0A 3TLCA 4YR9A 4PZ0A 4XOIA 1ZEJA 3TECE 1G17A 2X6RA 3VR5D 5F7XA 1Z16A 4FE3A 4JZKA 5AJVB 4YEDA 2I65A 4DIKA 3AF6A 3U61B 3B1VA 2IA5A 2B21A 4QJBA 1W59A 5JU6A 3RIEA 2HYIC 3B85A 5GAJA 3JQAB 1Y7HA 1HKHA 3BZUA 4TV8F 4LFBB 2ES4A 2C5SA 3F6BX 2NTNA 1BU5A 3F7NA 3M6VA 2WF7A 1DO2A 1H42A 5AXBA 1HE5A 3EMKA 4IGKA 1X15A 3OQMA 2IX9A 5KKAA 5DN6D 3G5UA 1RAGA 5C81A 1HQDA 1ZW1A 3T7IA 2NTVA 5A2QA 4ZEWA 2O3RA 2FFQA 2H65A 5G0SA 3A26A 3U37A 4NBKA 1ECBA 4O4JF 3IUNA 4WX2B 1KAOA 4X61A 4Q3EA 5JXIA 5CXUA 5KNBH 4IBOA 3ZK8A 2H8KA 1C0KA 3GEGA 4XCQA 2QYTA 1SHKA 4XUEA 2GF0A 3GRRA 3DC2A 4I2NA 2ZYGA 5FLXA 2WSBA 5DP2A 1QF9A 3N8IA 4ZPXA 5GM2A 4ES6A 4D26A 2V96A 1GZSA 2D1QA 4WESB 2FSVA 4M9XA 1XXHE 4OYRA 4RA6B 4J6FA 4WRRA 1D2CA 2H4JA 1GUZA 1KNXA 2CXHA 4A16A 1UIRA 4Y0NA 5AW9A 5ITWA 1Z4OA 4NU5A 1BG6A 5JZSA 4IHJF 5DT9A 4QPNA 1XQ9A 4WY5A 1KI2A 1N5JA 3OQJA 1FDSA 5ALDA 1TJ4A 3MWGA 4ZYVA 2ZIWB 2J7PA 3OZTA 4F2WA 4YHHB 4OMUA 3E9ZA 4ID3A 4OI2A 1S02A 4U6SA 5H70A 4F1KA 2D6FA 2YJ5A 2Z2YA 3N2LA 3ONWA 5HIJA 1ODCA 3MQFA 4X6UA 1YK1A 3RRJA 4I9NA 4XIJA 3PC4A 5AKXA 2KW5A 1E32A 1XD2A 3DF7A 3DB2A 4RJIA 4WCDA 2Z8YA 1U3TA 3H17A 6Q21A 1E3QA 1KI7A 3V4OA 5F73A 2PIDA 3PGVA 2WJPA 1SQ5A 4LRUA 4ER5A 2GTPA 3F9IA 1NQVA 4DWVA 5HTOA 4KK4A 4G23A 2FW0A 4C7BA 1RHUA 5TMPA 1CPYA 3BTOA 5KQMA 1R4AA 1EI9A 3Q4GA 2Q6LA 2G5PA 4K88A 5DHRA 3KQUA 1XPOA 4EKIA 4D9BA 1E1RA 1EFKA 4H6WA 3R7SA 3A4YA 4DEYA 3PLNA 3JPYA 3PFIA 5E1MA 2WP0A 4KV7A 3CEPB 4OHZA 4ZHSA 5EJEA 3ZWXA 1JQ3A 2QG6A 4DBLE 2WKRA 1U02A 3EXIA 1FLAA 1V96A 1XDBA 4CCSA 3AL2A 4EPVA 1C80A 1N57A 3AOEC 4BZPA 2P75A 5IC4A 4JLJA 1ESEA 4XB1A 4FMDF 3N2YA 3NEPX 2M6RA 1XRSB 2EERA 2LV8A 2POQX 1I6LA 1FFBA 1OXMA 3IHKA 4JC0A 4QGFA 1G3UA 3IS3A 4GKBA 3L9XA 2GN6A 3AY0A 3N2ZB 5DRYA 3R5HA 2XB8A 2QVCA 3PKIA 3D6UA 2F9FA 3L0OA 1KMQA 3H04A 5FHRA 3A1EA 5JAHA 2J08A 3PWKA 4KSCA 1E6WA 1N8TA 3B9RA 1FW8A 3KT6A 1A7UA 3I8XA 4ENRA 2ISQA 3LSYA 1VECA 4MKIA 4D8VA 4YJ3A 5FNVB 4KQCA 3L5OA 1IHYA 2Y1EA 4W1SA 3N2EA 1MFPA 5L4LA 4NV0A 2PTHA 2XECA 2IHBA 4DSOA 2ZXUA 4JJFA 4YT8A 2IHNA 3AESB 1N5LA 2QM8A 3EFHA 1Z7BA 2RIRA 4OAOA 4W4TA 3SZOA 4EO4A 1PG5A 2V58A 1UDBA 3B6EA 2WU0A 3K2EA 4OKIA 3NHJA 2RMKA 3LKBA 2GA8A 3GFFA 3LPAA 5FUVA 2R8RA 4TMZA 3E9NA 4RM2A 4EK9A 4E2WA 2ZW9A 4ILKA 1GPBA 3TW8A 4AMBA 2XMCA 3GEDA 4YGYA 2OFWA 2VEDA 1CJSA 1BXRB 3EZGA 3WYNA 4N3NA 3EWNA 4UTXA 4FN5A 5I5GA 1TZKA 1UWLA 1YS6A 3DOFA 5B36A 2QQ5A 3BTVA 4NBLA 2BMFA 5EIBD 4B3FX 4FDAA 2HJRA 4JCOA 1I6MA 2OCPA 4RAOA 3OZEA 4PGAA 4WVFA 4CDMA 4MQLA 2YJNA 3P9PA 1HLGA 2ORWA 3KWFA 1QH8B 3H4MA 1SCJA 4L2IA 4W8HA 5E8JA 5B58T 4UTRA 4E2YA 5JH7F 3OEWA 3VFDA 4F6RB 2R66A 3QU9A 2ZYRA 5GPBA 3TLGA 1SXJE 2G63A 1SEPA 1FFHA 3F4BA 1OILA 1PNTA 3PHGA 4ARIA 2VK4A 3ULKA 4H9GA 5KWEA 3OTIA 3RRBA 3LW7A 1CQIB 4L9RA 4ZN6A 4D0GA 2B4QA 4PYIA 4AUNA 3EK2A 3HKDB 1P6UA 3T3MB 1V5WA 1KF0A 1Z22A 4GZLA 4IR7A 3DXXA 3V1MA 4B6GA 4EAQA 4B87A 4DAOA 3AEQA 1BDJA 1Z5ZA 2DOKA 3EYAA 4GUDA 1NQOA 4R98A 3ER9A 1C30A 1ORIA 3S44A 3A1NA 2Q41A 2PRZA 3G89A 1A5SB 4KAXA 4IRMA 4K9NA 4HDKA 5DXAA 1F5NA 3S6JA 5A9RA 4J0CA 4XD2A 4MEBA 4DSAA 3F3SA 1FBNA 3UHPA 4RZUA 3USCS 3OU6A 1F8GA 3ZDAA 2Z6UA 3DEJA 4RC9A 2P78A 2WWTA 3L2OB 3UQZA 1UJMA 5KSPA 1OXKB 2VHUA 3SSMA 4EGJA 1G9SA 4CLRA 3X2SA 2PWYA 1Y6RA 3KXDA 4L8YA 5EINA 4AXXA 4LF7B 1G5RA 2ATIA 1FY2A 2C07A 2FWIA 3OWXA 4OHVA 1QYDA 4KE7A 1ZJ4A 4Q34A 1JFFA 5TT0A 3S0JA 4U4AA 2ZZMA 3RS9A 3UW3A 4F4UA 3KALA 1HTBA 4BQOA 4XKJA 2OUKA 2W2TA 3LLCA 4DVGA 2HIGA 3CUEF 3VOBA 3DWGA 2D5BA