1CRBA

Crystallographic studies on a family of cellular lipophilic transport proteins. refinement of p2 myelin protein and the structure determination and refinement of cellular retinol-binding protein in complex with all-trans-retinol
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
b'PVDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRAEGVTCKQVFKKVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR RETINOL BINDING PROTEIN
publication title Crystallographic studies on a family of cellular lipophilic transport proteins. Refinement of P2 myelin protein and the structure determination and refinement of cellular retinol-binding protein in complex with all-trans-retinol.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Cellular lipophilic transport protein
total genus 39
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 1993-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1crbA00
1MX7A 1YP6A 4A60A 5CE4A 1LICA 1A57A 5DG4A 5F7GA 4HPDA 4R0BA 2PY1A 3VG4A 2NNQA 4I9SA 4TJZA 2AL0X 4YFPA 3P6EA 2FS6A 4HPBA 3C78X 1LF7A 3KFIA 4RUNA 1KT5A 3UEXA 3FLLA 1LPJA 2CZUA 4LZUA 3FW4A 1U0XA 1DZKA 4YDAA 1EQDA 1GX8A 3P6DA 4MVKA 5F6BA 2AT0X 1XCAA 2WR6A 1A2DA 3BSZE 1N0SA 1HN2A 1MVGA 1BM5A 1VYGA 3C77X 4A1YA 4BVMA 1SXXA 2JU8A 3B2HA 1ZNKA 2Q2PA 1ML7A 4Y0PA 2JU7A 5LJCA 4ORXA 1GKAA 3VG7A 1YWDA 5HTEA 1IIUA 5LJBA 2W2FA 1O1UA 2WUTA 1HMTA 4IB7A 3G7XA 4NNTA 1QY1A 5AQ6A 4QZUA 1ALBA 1PM1X 3BS2A 1FTPA 1LIDA 1MUPA 4ZR2A 1D2UA 5LJGA 3U03A 1JYJA 3FA8A 1HQPA 4AZNA 1QABE 4PSQA 3PEDA 4EEJA 5FFHA 5IO7A 5EDCA 4QYPA 3WVMA 2L67A 1KT7A 1KXOA 3RZYA 4YGZA 2A3FX 4AW8A 3BX8A 3FA6A 3FR2A 2X46A 1ERXA 3DTQA 5LJEA 1I04A 3FIQA 2WWPA 3FW5A 3WJBA 5HAEA 2G7BA 2QO4A 3JSQA 4YH0A 3NADA 3BU1A 2XKLA 4ZJ0A 1QG5A 5IO5A 4XMEA 2AKQA 3K3LA 1ZNEA 1HMRA 2QM9A 3NR3A 1SY1A 2G78A 2OVDA 2A0AA 4QGXA 3U0DA 4LKPA 3BU9A 2AH7X 1EPAA 4O9SA 2RQ0A 1KQXA 1A3YA 2OZQA 3O2YA 1GKAB 3P6GA 4TNNA 2Q39A 4ZFXA 1OEJA 1GT1A 3TZSA 1BRPA 1X8UA 4ZHCA 2R73A 2A2UA 1U18A 1E02A 1B56A 1I4UA 1LIEA 2ALLX 4ORYA 5B29A 1LIBA 3NPOA 1OBUA 5HZQA 1G7NA 5L8IA 2F73A 1EIIA 1YWAA 5LJKA 3NX1A 1EUOA 1PMPA 2AMMX 1BWYA 1GXAA 1RBPA 4QYNA 2LBVA 1KT4A 2FS7A 5C0NA 4AYHA 1E5PA 3PH6A 3TF6A 3VG5A 3EBKA 4GNWA 1JZUA 3PECA 2NNEA 3IFBA 5BVSA 1FELA 1R0UA 4YDBA 1DZMA 4CK4A 5LKFA 3BRNA 4QGVA 1TXLA 1GT5A 4D6AA 2HYSA 3FR5A 2XSTA 2AT6X 2E4JA 5HCDC 4AZOA 3BLGA 1A18A 2HZQA 1KOIA 3U9PC 1ZNHA 3WJFA 2K62A 4GNYA 4KIIA 3KZAA 4AZMA 3CMPA 4YGHA 3AKNA 2L68A 1JBHA 4NYRA 1LIFA 4HPCA 2CZTA 2K23A 1EPBA 1T0VA 3NQ9A 5KICA 3L4RA 1RLBE 1ICNA 1OEKA 1GM6A 2A13A 1IW2A 3PP6A 1GX9A 4IBAA 4DQ3A 4QZTA 5D4AA 1YP7A 2OFMX 5F1EA 4I9RA 1BSQA 4N7CA 3ZUOA 5LJDA 5D48A 1FDQA 1T68X 1JJXA 1SY2A 3NX2A 3VG6A 1FE3A 4ARHA 3B2JA 1P6PA 4GRJA 4MVLA 4AZPA 1E00A 1PBOA 1LKEA 2FR3A 2HLVA 4OMWA 1QQSA 2HMBA 1KZWA 4QGWA 3EM0A 3FEKA 4OS0A 4IB6A 3FA7A 3STMX 3VG2A 5BVTA 4YMYA 1ZRYA 2W2BA 3UEVA 2WQ9A 4ORSA 2JU3A 4XMDA 1FEMA 1VYFA 3P6HA 4A8ZA 1QFVA 4I3BA 3PPTA 2OFRX 1IFCA 5H9LA 4UU3A 5K06A 5H9AA 3UEWA 3HWFA 1I06A 3PH5A 1QFTA 2R74A 4ODDA 3UEUA 2L5PA 1GT3A 3I0AA 2Q2MA 4EXZA 4ORWA 1E06A 4LKTA 3JS1A 5KHPA 1JV4A 1O8VA 5D8JA 2FLJA 1YWCA 1ZNGA 5KIDA 3BDRA 5HZ6A 2CM9A 3D95A 1CBIA 5HWZA 2OVAA 3ELZA 2OVEA 1X8PA 4YBUA 5LKEA 3HK1A 1O1VA 1OEEA 3FEPA 1Z24A 5D45A 4ORUA 3D97A 4YBPA 3IA8A 1MX8A 2FR2A 4ES7A 1X8OA 3CBSA 1YWBA 1S44A 2KT4B 3KFHA 4EDEA 2BLGA 1OPAA 2QO6A 1AELA 2WQAE 3ZUIA 3O22A 3TGBA 5HCCC 2QOSC 2L9CA 1HBPA 4OMXA 3APUA 1AQBA 5LJHA 2RCTA 1JYDA 1LNMA 4IB8A 3HWGA 4OS3A 1SXYA 1DZJA 3ZQ3A 1EIOA 1QWDA 1CRBA 2ANSA 2CBSA 5IO6A 5EDBA 4UU2A 4ZHHA 1CBSA 2LBAA 3C76X 4IAWA 2MO5A 1ZNLA 1YIVA 4TLJA 1NGLA 2JN3A 4ZHFA 1U17A 2NP1A 2LFOA 2Q9SA 4IMNA 1B0OA 2CBRA 5F6ZA 3B2IA 1X71A 4AZRA 3ELXA 1T8VA 1EALA 4HFOA 1ACDA 3BX7A 2G79A 2RD7C 3TGCA 1TOWA 2X45A 4M7MA 4ZGUA 1KZXA 2ACPX 1UREA 5HBSA 5DPQA 1BSYA 2R56A 1OBPA 4WBKA 1IFBA 1ZNDA 1CBRA 1LFOA 1TW4A 5EZ2A 1D3SA 2W2AA 2FWVA 5F58A 1GT4A 4NYQA 5HZ5A 1SXUA 1MDCA 3EBWA 2MJIA 4YCEA 2JOZA 3D96A 2P8GA 4XMHA 3MVFA 1G5WA 4TKHA 3CQRA 1OPBA 1UZ2X 1DF3A 3WJDA 1CBQA 4D6BA 4YGGA 5HZ9A 3P6FA 4IAXA 3AKMA 5H8TA 1SY3A 1ICMA 2HNXA 2GTFX 4YKOA 5HZ8A 5HCEC 3I17A 4Y0SA 4NLIA 1HBQA 2FRSA 1QY2A 1KT3A 1ADLA 1VPRA 1BEBA 3OJYC 3WJGA 5HTDA 2EU7X 1X89A 2O62A 3CR6A 3S26A 3KFFA 3KFGA 4RUUA 4GE1A 4LZVA 3GAQA 2LKKA 2DM5A 1IKJA 2N93A 3P6CA 2RA6A 4EFGA 2YG2A 3Q6LA 5JR8A 1NP1A 1AVGI 2WEXA 3NP1A 1KT6A 4OS8A 3WBGA 4XMGA 3WJEA 3SAOA 4BOEA 3STNA 3F8AA 3HWEA 4A1HA 5HA1A 1G85A 1OBQA 2ACOA 3BY0A 4TKJA 2WSJA 1YUPA 4GETA 1ERBA 3O19A 4NNSA 1G74A 1GGLA 1I05A 3EYCA 4Y0QA 4DQ4A 4K19A 3APXA 5H9KA 4YFRA 1NP4A 3WXQA 4M6SA 1JJJA 1FENA 1S7DA 3APVA 3RSWA 1TVQA 2AT3X 2FTBA 3FENA 1KGLA 3FA9A 3EMMA 2POAA 1XKIA 1TOUA 1BLRA 2CM4A 4YFQA 1BBPA 5BVQA 2IFBA 3APWA 4IMOA 1B4MA 4WFVA 1BJ7A 1B8EA 4I3CA 1DFVA 4TQ2A 1SY0A 3T1DA 4ALBA 3NQ3A 4N7DA 1AB0A 3MBTA 1EXSA 3QKGA 1HMSA 4YCHA 1BRQA 3TGAA 3FMZA 4ZH6A 5FENA 2NNDA 5D47A 1S2PA 1SA8A 1SXWA 2WEWA 4BQUA 4AZQA 3CBCA 3CWKA 2RCQA 3B2LA 4ZHGA 2GC9A 2A2GA 2MM3A 3FELA 2AT5X 3B2KA 4ALOA 4GKCA 4Y0RA 2ASNX 2LB6A 3CQNA 2QO5A 5EPQA 1DV9A 1CJ5A 3HWDA 1X8QA 1DC9A 4ORRA 4TKBA 5HA0A 5EEDA 5B27A 4XMFA 4NP1A 5FAZA 4IB9A 3STKA 5H9NA 2FT9A 4YKMA 2HZRA 4XMCA 4WFUA 3WJCA 2KTDA 4QAEA 1BSOA 1PEEA 3DSZA 5L8NA 4I3DA 1L6MA 3KQ0A 1IKEA 1X8NA 4NLJA 1QY0A 2Q4NA 2GJ5A 4ZCBA 4HPAA 5L8OA 1H91A 1EW3A 4ZH9A 1DZPA 3F9DA 2AT8X 3FR4A 4GH7A 4MVIA 5EEEA 3VG3A 4ZHDA 1KQWA
chains in the Genus database with same CATH superfamily
1MK5A 4CPHA 4Y59A 1MX7A 1YP6A 3PQSA 4A60A 5CE4A 1LICA 1A57A 3RDXA 5DG4A 5F7GA 1Y0GA 4HPDA 1LCVA 4R0BA 1KFFA 2PY1A 3VG4A 2NNQA 4I9SA 2M4LA 4TJZA 4U3QA 2AL0X 4YFPA 3P6EA 2FS6A 4HPBA 4NV7A 3C78X 3VU1A 1LF7A 2IZKA 2Y3EA 3KFIA 4RUNA 1VWOB 4KT5A 1KT5A 4O3ZA 3UEXA 3FLLA 1LPJA 2CZUA 4LZUA 4FBVA 3FW4A 1U0XA 1DZKA 3AEHA 1EQDA 2QMIA 4YDAA 1GX8A 3P6DA 4MVKA 5F6BA 1SWRA 2AT0X 1XCAA 2WR6A 5FQ6E 1A2DA 1VWIB 3BSZE 4CV7A 1N0SA 1HN2A 1MVGA 1BM5A 1VYGA 3C77X 2IZBA 4A1YA 1JMXA 4BVMA 1SXXA 3RY2A 2JU8A 3B2HA 4GGZA 2RTJA 1ZNKA 2Q2PA 1SWLA 1SWSA 1ML7A 4Y0PA 2JU7A 4WHIA 5LJCA 4BX7A 1NQNA 2PI3O 2IZGB 2UYWA 3KVNA 4ORXA 1GKAA 2AF5A 4IRWA 3VG7A 4IABA 1YWDA 5HTEA 1IIUA 5LJBA 2W2FA 1O1UA 1RXJA 2BSZA 2WUTA 1HMTA 4IB7A 3G7XA 4NNTA 1QY1A 5AQ6A 4QZUA 3MG5A 1ALBA 1PM1X 3BS2A 1VWBB 3JQOA 1FTPA 1LIDA 4CPHB 1MUPA 4ZR2A 1D2UA 2HKDA 5LJGA 3RKGA 3V8UA 3U03A 1JYJA 2X34A 3FA8A 4Z28A 1HQPA 4AZNA 1QABE 4GGTA 4PSQA 5JD2A 3PEDA 4EEJA 1SRGA 5FFHA 5IO7A 5EDCA 4QYPA 3WVMA 2L67A 1KT7A 1KXOA 4OELA 3RZYA 4YGZA 4C5PA 2A3FX 3ZWEA 4AW8A 3BX8A 3FA6A 3FR2A 2X46A 1ERXA 3DTQA 5LJEA 1I04A 2CAMA 4INNA 3FIQA 2WWPA 3FW5A 1RAVA 3WJBA 5HAEA 4GD9A 2G7BA 2QO4A 3JSQA 4YH0A 4DCBA 3NQKA 3NADA 4JHQA 3BU1A 2XKLA 2OFAA 4ZJ0A 1QG5A 1SLEB 5B2AO 4XMEA 5IO5A 2AKQA 3K3LA 1ZNEA 1HMRA 1Y52X 2QM9A 3NR3A 1K3BA 1SY1A 1Y53X 2G78A 2OVDA 3RDSA 2YMSA 4KC8A 2A0AA 4QGXA 3U0DA 4LKPA 1SWEA 3BU9A 2AH7X 3OBLA 4YVBA 1EPAA 1LUQA 1VWRB 4O9SA 3VGWA 2RQ0A 3WZPA 4Z2VA 1KQXA 1A3YA 2OZQA 3O2YA 3P02A 1GKAB 5FQ8E 4CPIA 3P6GA 4TNNA 2Q39A 4ZFXA 1OEJA 1VWGB 1GT1A 1K24A 4LQZA 3TZSA 1VWLB 1BRPA 1N43A 1VWJB 1X8UA 1JMZA 4ZHCA 2R73A 2RTCB 2FGSA 3D4RA 2OVSA 1SWPA 2A2UA 1U18A 1SRHA 1E02A 4KH8A 4BX6A 4O4SA 1B56A 1I4UA 1N9YA 1LIEA 2KW1A 1SWNA 2ALLX 4ORYA 5B29A 1LIBA 3NPOA 2OFBA 1OBUA 5HZQA 1G7NA 3HOLA 5L8IA 4I95A 2F73A 2X8FA 1EIIA 1YWAA 5LJKA 4GGRA 1GX3A 3NX1A 1EUOA 1UYNX 1PMPA 2DJGA 2AMMX 1BWYA 1GXAA 1RBPA 4QYNA 5AEOA 2LBVA 5B10O 1KT4A 1SWHA 2FS7A 5C0NA 3F6ZB 4AYHA 1E5PA 4NV8A 3PH6A 3TF6A 3WZQA 3VG5A 3EBKA 1STRB 4GNWA 1JZUA 2VFBA 4MVEA 3PECA 2NNEA 3IFBA 1SWQA 2C1QA 5BVSA 2JW1A 3ZW2A 1FELA 1HXZA 1R0UA 1DZMA 4YDBA 4CK4A 5LKFA 3BRNA 2IZLB 4QGVA 4O4XA 1TXLA 2RTMA 1VWPB 2OY1O 4O4UA 5CYBA 1GT5A 4D6AA 1SWGA 2JGSA 3SLTA 2HYSA 5FENA 3FR5A 2XSTA 4CDDA 2AT6X 2E4JA 5HCDC 4AZOA 3BLGA 1A18A 1KOIA 2HZQA 3U9PC 1ZNHA 5IRWA 4GJVA 2K62A 4MIRA 3WJFA 1W6FA 4BX6B 4GNYA 4KIIA 1DF8A 1SWDA 3KZAA 4AZMA 3T6FA 2BHVA 4Y5DA 3CMPA 4YGHA 3AKNA 2L68A 4CSBA 1JBHA 2OF9A 4NYRA 3VHIA 1MOYA 1LIFA 4HPCA 2CZTA 2K23A 1EPBA 1T0VA 3NQ9A 1SWCA 3SLOA 5KICA 3L4RA 3S5XA 1RLBE 1ICNA 1OEKA 1GM6A 2A13A 1IW2A 3PP6A 1GX9A 4IBAA 4DQ3A 4QZTA 5D4AA 1YP7A 2KTSA 1WBIA 2C1SA 2OFMX 5F1EA 2G5LA 4I9RA 1BSQA 4N7CA 3ZUOA 5LJDA 5D48A 1FDQA 1T68X 1SRIA 1JJXA 1KL5A 3RBYA 1SY2A 3T6LA 3FDCA 3NX2A 3VG6A 1FE3A 1E2TA 4ARHA 3B2JA 1P6PA 4GRJA 4MVLA 3N91A 1E00A 1PBOA 4PJ2A 4AZPA 1LKEA 1SWOA 2BS6A 2FR3A 2HLVA 1QQSA 4OMWA 2HMBA 1KZWA 1VWAB 4QGWA 3EM0A 3FEKA 4OS0A 4IB6A 3FA7A 3STMX 3VG2A 4GUZA 5BVTA 2Z4HA 4YMYA 2RTEB 1ZRYA 1JQPA 5IXGA 2I5ZO 2W2BA 2OL7A 1RXKA 2RTQB 1UYOX 2WQ9A 3UEVA 4ORSA 2JU3A 1VWEB 4XMDA 1FEMA 1VYFA 4Z27A 2BC3A 3P6HA 3Q34A 1QFVA 4A8ZA 4I3BA 3PPTA 1STPA 2GTLN 4KCAA 2OFRX 1IFCA 5H9LA 4ID2A 4JNJA 1VWHB 4UU3A 5K06A 4ML7B 5H9AA 3UEWA 3HWFA 1I06A 3PH5A 1QFTA 2R74A 4ODDA 3UEUA 2L5PA 1GT3A 2BS5A 2AVIA 1RSTB 2Q2MA 3I0AA 4EXZA 4GDZA 4ORWA 1VWMB 1E06A 3OD9A 4LKTA 3JS1A 4FGIB 4MEEA 5KHPA 4CPEA 1JV4A 1O8VA 4U8UN 5D8JA 2FLJA 1YWCA 1ZNGA 4COTA 1AVDA 1SLDB 1STSB 5KIDA 1OSPO 4EKVA 3BDRA 5HZ6A 3HPEA 2CM9A 3FYFA 3D95A 3RDMA 2LA7A 3EW2A 2RTDB 1CBIA 5HWZA 2OVAA 3ELZA 1VYOA 2OVEA 1NDJA 1X8PA 4YBUA 5LKEA 3HK1A 2FKGA 1O1VA 4Z2OA 1DV9A 3SZIA 1N4JA 2F09A 1OEEA 4GZVA 2FHNX 3FEPA 1Z24A 5D45A 4ORUA 3D97A 4YBPA 3IA8A 3EC5A 1MX8A 2FR2A 4ES7A 1HY2A 1X8OA 5IRAA 1MEPA 1SRJA 1SLGB 3CBSA 1YWBA 2A5BA 1S44A 2OYBO 2KT4B 2ZSCA 3KFHA 1RSUB 3LTWA 2BLGA 4EDEA 3OE3A 1SMPI 1OPAA 2QO6A 2X8SA 2IZCB 3PQUA 2X56A 1AELA 1Y9TA 2WQAE 3O22A 2IZIA 5CHKA 3ZUIA 3SZJA 5HCCC 3TGBA 2QOSC 2L9CA 1HBPA 2RTRB 4OMXA 3APUA 1AQBA 2KD2A 5LJHA 2RCTA 1JYDA 1LNMA 4IB8A 3RDOA 3HWGA 2RTNB 4OS3A 1SXYA 1DZJA 4HWMA 3ZQ3A 1N9MA 1EIOA 3ZW1B 1WUBA 3CKGA 1QWDA 1CRBA 2ANSA 2C4IA 2CBSA 4CDCA 5EDBA 4UU2A 5IO6A 4U46A 3RY1A 4ZHHA 2Z4IA 1CBSA 5AJBA 2LBAA 1LCZA 3C76X 2MO5A 1ZNLA 1YIVA 4IAWA 4TLJA 3ZZVA 2X8TA 3X00A 2RTFB 3EW1A 4BBOA 3ZW0A 1NGLA 2JN3A 4ZGFA 4ZHFA 4DNEA 2Y3FA 1U17A 4ALOA 3SLJA 2LFOA 2NP1A 2Q9SA 2ZAIA 1B0OA 2CBRA 4IMNA 5F6ZA 3B2IA 1X71A 4AZRA 3ELXA 1T8VA 1EALA 4HFOA 1ACDA 3BX7A 2G79A 2RD7C 4QRLA 5B5GA 3SZHA 3LHNA 3TGCA 1TOWA 2X45A 3CKFA 4M7MA 4ZGUA 3MM0A 4ON1A 5F2BA 1KZXA 5K67A 2RTAA 1W4TA 3PDFA 2VDFA 2ACPX 1UREA 5AJCA 5HBSA 1N7YA 5DPQA 3WZOA 2RTGB 4BX5B 1BSYA 2R56A 5K68A 1OBPA 4WBKA 2FHLA 4O3WA 3NBXX 4OKAA 3WZNA 1IFBA 1ZNDA 4GJSA 1CBRA 2RTIB 1LFOA 1TW4A 1VWFB 1D3SA 2W2AA 2FWVA 5EZ2A 1GT4A 4NYQA 5F58A 5HZ5A 1SXUA 4Z2PA 1MDCA 4GK9A 3EBWA 2MJIA 1AVEA 5B11O 3HOEA 4O49A 3S60A 2IZHB 4QNIA 4YCEA 2JOZA 3D96A 2P8GA 4XMHA 3MVFA 1G5WA 4TKHA 3CQRA 1OPBA 1UZ2X 2MF6A 1DF3A 1JIWI 3WJDA 1SREA 1CBQA 4D6BA 4YGGA 5HZ9A 3P6FA 4CDFA 2X4MA 4BX7B 1LDOA 2X55A 4IAXA 3ZW0B 3AKMA 2JMBA 5H8TA 1SY3A 2DJFA 1SWBA 1ICMA 2HNXA 2GTFX 2X32A 4YKOA 5HZ8A 1RXHA 4L3RA 4O3YA 5HCEC 2RTKA 3I17A 4Y0SA 4NLIA 2IZFB 1HBQA 1EI5A 1QY2A 1VPRA 1KT3A 1ADLA 2FRSA 1BEBA 3OJYC 3VE2A 3WJGA 1VWNB 2FKJA 5HTDA 2EU7X 1X89A 2O62A 3CR6A 2OY8A 1I9HA 3S26A 3KFFA 1HXLA 3KFGA 4RUUA 4GE1A 4LZVA 3GAQA 3T2WA 2I5VO 2IZJA 3QQ2A 1VWDB 2F01A 1SWJA 2LKKA 2QOMA 4MISA 2DM5A 1IKJA 2QCBA 2N93A 1Y55X 3P6CA 2RA6A 4A1HA 4EFGA 2YG2A 3Q6LA 5JR8A 4NW4A 3VE1A 1NP1A 2GTLO 1AVGI 3VHMA 1FJ1E 2MHDA 3AUMO 2WEXA 3NP1A 1KT6A 4OS8A 3ZW1A 3WBGA 4XMGA 3WJEA 3S5VA 3SAOA 2Y32A 4BOEA 3STNA 3F8AA 2WPUA 3HWEA 5HA1A 1G85A 5IRUA 1OBQA 5B3MO 2ACOA 1IJ8A 3BY0A 4FBOA 4TKJA 2WSJA 1YUPA 4O4OA 1SWUA 4GETA 1ERBA 3O19A 4U8UO 2RN4A 5B5FA 4NNSA 1G74A 1GGLA 1I05A 3VHHA 1SWKA 3EYCA 4Y0QA 4DQ4A 4K19A 3APXA 3RDUA 5H9KA 4GU8A 4YFRA 1NP4A 3RDQA 3WXQA 4M6SA 1SRFA 1JJJA 2RTPB 1FENA 1PBYA 4U9CA 1S7DA 4QQ1A 2GH7A 3APVA 3RSWA 2BT9A 1NBXA 1TVQA 2AT3X 2FTBA 3FENA 2MWHA 1SWTA 3P24A 3FA9A 3EMMA 3GE2A 2POAA 1KGLA 1XKIA 1TOUA 2OF8A 1HQQA 1KL3A 4I60A 2CM4A 4YFQA 1BLRA 3LV4A 1BBPA 5BVQA 2IFBA 1JJUA 3APWA 4I6SA 4IMOA 4WFVA 4O3XB 4BX5A 4GDAA 1BJ7A 1B4MA 1B8EA 4I3CA 1PTSA 1DFVA 4TQ2A 1SY0A 2A5CA 2IZAA 3T1DA 4ALBA 3NQ3A 1SWFA 4BGFA 4N7DA 1AB0A 2IZDB 3MBTA 1EXSA 1SWAA 3QKGA 1HMSA 2VFCA 1VWKB 1BRQA 4YCHA 3TGAA 1NQMA 3FMZA 4ZH6A 3SOTA 4B55A 2ZAGA 4BJ8A 2NNDA 3E3CA 5D47A 1S2PA 4JO6A 2OY7A 2OL8O 1SA8A 1SXWA 2WEWA 4BQUA 4AZQA 2RTLA 3CBCA 5FQ7E 3CWKA 2RCQA 3B2LA 2GTLM 3UAQA 4BCSA 2GC9A 3D9WA 4FBRA 4ZHGA 2A2GA 2MM3A 2OL6O 3FELA 3H3IA 2AT5X 3B2KA 1I78A 1MM9A 4GKCA 4Y0RA 1VWCB 2ASNX 2LB6A 2RTHB 2IZEB 2QO5A 3CQNA 3MX7A 3HTYA 4OEMA 5EPQA 3HWDA 1X8QA 1DC9A 4FQBB 4ORRA 4CPFA 4TKBA 1CJ5A 5HA0A 5EEDA 5B27A 1LCWA 4XMFA 4L1NA 2A8GA 3ZI8A 1W5RA 4NP1A 5FAZA 1VWQB 4Z6JA 4IB9A 3STKA 4U8UM 5H9NA 2FT9A 3FIDA 4YKMA 2HZRA 5CSEA 3T2XA 3VPJE 4XMCA 1LELA 4WFUA 3WJCA 2KTDA 4QAEA 1BSOA 5L3YA 1LDQA 1PEEA 3DSZA 5L8NA 2OY5O 4I3DA 4JGLA 1KL4A 1Y9LA 4CDEA 1L6MA 3KQ0A 2RTBB 2G8CO 1IKEA 1X8NA 3PK2A 1QY0A 1NC9A 4NLJA 3WOVA 2Q4NA 2GJ5A 3WYQA 4ZCBA 1SLFB 4HPAA 5L8OA 1EW3A 1H91A 2UZ2A 4ZH9A 1DZPA 3RE5A 3F9DA 2AT8X 3RWXA 3FR4A 4GH7A 5BYPA 4MVIA 5EEEA 3RE6A 4EQAC 3VG3A 3WYPA 4ZHDA 1KQWA 2RTOB 4KC7A
chains in the Genus database with same CATH topology
1MX7A 1YP6A 3PQSA 4A60A 5CE4A 1LICA 1A57A 5DG4A 5F7GA 4HPDA 4R0BA 2PY1A 3VG4A 2NNQA 4I9SA 2M4LA 4TJZA 4U3QA 2AL0X 4YFPA 3P6EA 2FS6A 4HPBA 3C78X 3VU1A 1LF7A 3KFIA 4RUNA 4KT5A 4O3ZA 1KT5A 3UEXA 3FLLA 1LPJA 2CZUA 4LZUA 4FBVA 3FW4A 1U0XA 1DZKA 4YDAA 1EQDA 2QMIA 1GX8A 3P6DA 4MVKA 5F6BA 2AT0X 1XCAA 2WR6A 5FQ6E 1A2DA 3BSZE 4CV7A 1N0SA 1HN2A 1MVGA 1BM5A 1VYGA 3C77X 4A1YA 4BVMA 1SXXA 2JU8A 3B2HA 1ZNKA 2Q2PA 1ML7A 4Y0PA 2JU7A 4WHIA 5LJCA 4ORXA 1GKAA 3VG7A 4IABA 1YWDA 5HTEA 1IIUA 5LJBA 2W2FA 1O1UA 2WUTA 1HMTA 4IB7A 3G7XA 4NNTA 1QY1A 5AQ6A 4QZUA 1ALBA 1PM1X 3BS2A 3JQOA 1FTPA 1LIDA 1MUPA 4ZR2A 1D2UA 5LJGA 3RKGA 3U03A 1JYJA 3FA8A 1HQPA 4AZNA 1QABE 4PSQA 3PEDA 4EEJA 5FFHA 5IO7A 5EDCA 4QYPA 3WVMA 2L67A 1KT7A 1KXOA 3RZYA 4YGZA 2A3FX 3ZWEA 4AW8A 3BX8A 3FA6A 3FR2A 2X46A 1ERXA 3DTQA 5LJEA 1I04A 4INNA 3FIQA 2WWPA 3FW5A 3WJBA 5HAEA 2G7BA 2QO4A 3JSQA 4YH0A 3NQKA 3NADA 3BU1A 2XKLA 4ZJ0A 1QG5A 5IO5A 4XMEA 2AKQA 3K3LA 1ZNEA 1HMRA 2QM9A 3NR3A 1SY1A 2G78A 2OVDA 2YMSA 4KC8A 2A0AA 4QGXA 3U0DA 4LKPA 3BU9A 2AH7X 3OBLA 1EPAA 4O9SA 2RQ0A 1KQXA 1A3YA 2OZQA 3O2YA 3P02A 1GKAB 5FQ8E 3P6GA 4TNNA 2Q39A 4ZFXA 1OEJA 1GT1A 4LQZA 3TZSA 1BRPA 1X8UA 4ZHCA 2R73A 3D4RA 2OVSA 2A2UA 1U18A 4KH8A 1E02A 4O4SA 1B56A 1I4UA 1LIEA 2KW1A 2ALLX 4ORYA 5B29A 1LIBA 3NPOA 1OBUA 5HZQA 1G7NA 3HOLA 5L8IA 4I95A 2F73A 2X8FA 1EIIA 1YWAA 5LJKA 3NX1A 1EUOA 1PMPA 2AMMX 1BWYA 1GXAA 1RBPA 4QYNA 5AEOA 2LBVA 1KT4A 2FS7A 5C0NA 3F6ZB 4AYHA 1E5PA 3PH6A 3TF6A 3VG5A 3EBKA 4GNWA 1JZUA 4MVEA 3PECA 2NNEA 3IFBA 5BVSA 3ZW2A 2JW1A 1FELA 1R0UA 4YDBA 1DZMA 4CK4A 5LKFA 3BRNA 4QGVA 4O4XA 1TXLA 4O4UA 5CYBA 1GT5A 4D6AA 2HYSA 3FR5A 2XSTA 2AT6X 2E4JA 5HCDC 4AZOA 3BLGA 1A18A 2HZQA 1KOIA 3U9PC 1ZNHA 4MIRA 2K62A 3WJFA 4GNYA 4KIIA 3KZAA 4AZMA 2BHVA 3CMPA 4YGHA 3AKNA 2L68A 4CSBA 1JBHA 4NYRA 1LIFA 4HPCA 2CZTA 2K23A 1EPBA 1T0VA 3NQ9A 5KICA 3L4RA 3S5XA 1RLBE 1ICNA 1OEKA 1GM6A 2A13A 1IW2A 3PP6A 1GX9A 4IBAA 4DQ3A 4QZTA 5D4AA 1YP7A 2KTSA 2OFMX 5F1EA 4I9RA 1BSQA 4N7CA 3ZUOA 5LJDA 5D48A 1FDQA 1T68X 1JJXA 3RBYA 1SY2A 3NX2A 3VG6A 1FE3A 4ARHA 3B2JA 1P6PA 4GRJA 4MVLA 3N91A 1E00A 1PBOA 4PJ2A 4AZPA 1LKEA 2BS6A 2FR3A 2HLVA 4OMWA 1QQSA 2HMBA 1KZWA 4QGWA 3EM0A 3FEKA 4OS0A 4IB6A 3FA7A 3STMX 3VG2A 5BVTA 2Z4HA 4YMYA 1ZRYA 2W2BA 3UEVA 2WQ9A 4ORSA 2JU3A 4XMDA 1FEMA 1VYFA 3P6HA 4A8ZA 1QFVA 4I3BA 3PPTA 2GTLN 4KCAA 2OFRX 1IFCA 5H9LA 4ID2A 4UU3A 5K06A 4ML7B 5H9AA 3UEWA 3HWFA 1I06A 3PH5A 1QFTA 2R74A 4ODDA 3UEUA 2L5PA 1GT3A 2BS5A 2Q2MA 3I0AA 4EXZA 4GDZA 4ORWA 1E06A 3OD9A 4LKTA 3JS1A 4FGIB 5KHPA 1JV4A 1O8VA 4U8UN 5D8JA 2FLJA 1YWCA 1ZNGA 4COTA 5KIDA 3BDRA 5HZ6A 2CM9A 3FYFA 3D95A 2LA7A 1CBIA 5HWZA 2OVAA 3ELZA 2OVEA 1X8PA 4YBUA 5LKEA 3HK1A 1O1VA 2F09A 1OEEA 4GZVA 3FEPA 1Z24A 5D45A 4ORUA 3D97A 4YBPA 3IA8A 1MX8A 2FR2A 4ES7A 1X8OA 3CBSA 1YWBA 1S44A 2KT4B 3KFHA 4EDEA 2BLGA 3OE3A 1SMPI 1OPAA 2QO6A 2X8SA 3PQUA 1AELA 1Y9TA 2WQAE 3O22A 3ZUIA 3TGBA 5HCCC 2QOSC 2L9CA 1HBPA 4OMXA 3APUA 1AQBA 2KD2A 5LJHA 2RCTA 1JYDA 1LNMA 4IB8A 3HWGA 4OS3A 1SXYA 1DZJA 4HWMA 3ZQ3A 1EIOA 3ZW1B 1QWDA 1CRBA 2ANSA 2CBSA 5IO6A 5EDBA 4UU2A 4ZHHA 2Z4IA 1CBSA 5AJBA 2LBAA 3C76X 4IAWA 2MO5A 1ZNLA 1YIVA 4TLJA 3ZZVA 2X8TA 3ZW0A 1NGLA 2JN3A 4ZGFA 4ZHFA 1U17A 2NP1A 2LFOA 2Q9SA 2ZAIA 1B0OA 2CBRA 4IMNA 5F6ZA 3B2IA 1X71A 4AZRA 3ELXA 1T8VA 1EALA 4HFOA 1ACDA 3BX7A 2G79A 2RD7C 4QRLA 3LHNA 3TGCA 1TOWA 2X45A 4M7MA 4ZGUA 4ON1A 1KZXA 2ACPX 1UREA 5AJCA 5HBSA 5DPQA 1BSYA 2R56A 1OBPA 4WBKA 4O3WA 3NBXX 1IFBA 1ZNDA 1CBRA 1LFOA 1TW4A 5EZ2A 1D3SA 2W2AA 2FWVA 5F58A 1GT4A 4NYQA 5HZ5A 1SXUA 1MDCA 4GK9A 3EBWA 2MJIA 3HOEA 4O49A 3S60A 4QNIA 4YCEA 2JOZA 3D96A 2P8GA 4XMHA 3MVFA 1G5WA 4TKHA 3CQRA 1OPBA 1UZ2X 1DF3A 1JIWI 3WJDA 1CBQA 4D6BA 4YGGA 5HZ9A 3P6FA 4IAXA 3ZW0B 3AKMA 2JMBA 5H8TA 1SY3A 1ICMA 2HNXA 2GTFX 4YKOA 5HZ8A 4L3RA 4O3YA 5HCEC 3I17A 4Y0SA 4NLIA 1HBQA 1EI5A 2FRSA 1QY2A 1KT3A 1ADLA 1VPRA 1BEBA 3OJYC 3VE2A 3WJGA 5HTDA 2EU7X 1X89A 2O62A 3CR6A 3S26A 3KFFA 3KFGA 4RUUA 4GE1A 4LZVA 3GAQA 2LKKA 4MISA 2DM5A 1IKJA 2N93A 3P6CA 2RA6A 4EFGA 2YG2A 3Q6LA 5JR8A 4NW4A 3VE1A 1NP1A 2GTLO 1AVGI 2MHDA 2WEXA 3NP1A 1KT6A 4OS8A 3ZW1A 3WBGA 4XMGA 3WJEA 3S5VA 3SAOA 4BOEA 3STNA 3F8AA 3HWEA 3V8UA 5HA1A 1G85A 4A1HA 1OBQA 2ACOA 3BY0A 4FBOA 4TKJA 2WSJA 1YUPA 4O4OA 4GETA 1ERBA 3O19A 4U8UO 2RN4A 4NNSA 1G74A 1GGLA 1I05A 3EYCA 4Y0QA 4DQ4A 4K19A 3APXA 5H9KA 4GU8A 4YFRA 1NP4A 3WXQA 4M6SA 1JJJA 1FENA 4U9CA 1S7DA 4QQ1A 3APVA 3RSWA 2BT9A 1TVQA 2AT3X 2FTBA 3FENA 2MWHA 1KGLA 3P24A 3FA9A 3EMMA 3GE2A 2POAA 1XKIA 1TOUA 1BLRA 2CM4A 4YFQA 3LV4A 1BBPA 5BVQA 2IFBA 3APWA 4I6SA 4IMOA 4WFVA 1B4MA 4O3XB 1BJ7A 1B8EA 4I3CA 1DFVA 4TQ2A 1SY0A 3T1DA 4ALBA 3NQ3A 4N7DA 1AB0A 3MBTA 1EXSA 3QKGA 1HMSA 4YCHA 1BRQA 3TGAA 3FMZA 4ZH6A 3SOTA 5FENA 2ZAGA 2NNDA 3E3CA 5D47A 1S2PA 1SA8A 1SXWA 2WEWA 4BQUA 4AZQA 3CBCA 5FQ7E 3CWKA 2RCQA 3B2LA 2GTLM 3UAQA 4FBRA 2GC9A 4ZHGA 2A2GA 2MM3A 3FELA 3H3IA 2AT5X 3B2KA 4ALOA 4GKCA 4Y0RA 2ASNX 2LB6A 3CQNA 2QO5A 3MX7A 5EPQA 1DV9A 3HTYA 1CJ5A 3HWDA 1X8QA 1DC9A 4FQBB 4ORRA 4TKBA 5HA0A 5EEDA 5B27A 4XMFA 4L1NA 3ZI8A 4NP1A 5FAZA 4IB9A 3STKA 4U8UM 5H9NA 2FT9A 4YKMA 2HZRA 3VPJE 4XMCA 4WFUA 3WJCA 2KTDA 4QAEA 1BSOA 1PEEA 3DSZA 5L8NA 4I3DA 4JGLA 1Y9LA 1L6MA 3KQ0A 1IKEA 1X8NA 4NLJA 1QY0A 3WOVA 2Q4NA 2GJ5A 4ZCBA 4HPAA 5L8OA 1H91A 1EW3A 4ZH9A 1DZPA 3F9DA 2AT8X 3RWXA 3FR4A 4GH7A 5BYPA 4MVIA 5EEEA 4EQAC 3VG3A 4ZHDA 1KQWA 4KC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MX7 A;  1YP6 A;  4A60 A;  5CE4 A;  1LIC A;  1A57 A;  5DG4 A;  5F7G A;  4HPD A;  4R0B A;  2PY1 A;  3VG4 A;  2NNQ A;  4I9S A;  4TJZ A;  2AL0 X;  4YFP A;  3P6E A;  2FS6 A;  4HPB A;  3C78 X;  1LF7 A;  3KFI A;  4RUN A;  1KT5 A;  3UEX A;  3FLL A;  1LPJ A;  2CZU A;  4LZU A;  3FW4 A;  1U0X A;  1DZK A;  4YDA A;  1EQD A;  1GX8 A;  3P6D A;  4MVK A;  5F6B A;  2AT0 X;  1XCA A;  2WR6 A;  1A2D A;  3BSZ E;  1N0S A;  1HN2 A;  1MVG A;  1BM5 A;  1VYG A;  3C77 X;  4A1Y A;  4BVM A;  1SXX A;  2JU8 A;  3B2H A;  1ZNK A;  2Q2P A;  1ML7 A;  4Y0P A;  2JU7 A;  5LJC A;  4ORX A;  1GKA A;  3VG7 A;  1YWD A;  5HTE A;  1IIU A;  5LJB A;  2W2F A;  1O1U A;  2WUT A;  1HMT A;  4IB7 A;  3G7X A;  4NNT A;  1QY1 A;  5AQ6 A;  4QZU A;  1ALB A;  1PM1 X;  3BS2 A;  1FTP A;  1LID A;  1MUP A;  4ZR2 A;  1D2U A;  5LJG A;  3U03 A;  1JYJ A;  3FA8 A;  1HQP A;  4AZN A;  1QAB E;  4PSQ A;  3PED A;  4EEJ A;  5FFH A;  5IO7 A;  5EDC A;  4QYP A;  3WVM A;  2L67 A;  1KT7 A;  1KXO A;  3RZY A;  4YGZ A;  2A3F X;  4AW8 A;  3BX8 A;  3FA6 A;  3FR2 A;  2X46 A;  1ERX A;  3DTQ A;  5LJE A;  1I04 A;  3FIQ A;  2WWP A;  3FW5 A;  3WJB A;  5HAE A;  2G7B A;  2QO4 A;  3JSQ A;  4YH0 A;  3NAD A;  3BU1 A;  2XKL A;  4ZJ0 A;  1QG5 A;  5IO5 A;  4XME A;  2AKQ A;  3K3L A;  1ZNE A;  1HMR A;  2QM9 A;  3NR3 A;  1SY1 A;  2G78 A;  2OVD A;  2A0A A;  4QGX A;  3U0D A;  4LKP A;  3BU9 A;  2AH7 X;  1EPA A;  4O9S A;  2RQ0 A;  1KQX A;  1A3Y A;  2OZQ A;  3O2Y A;  1GKA B;  3P6G A;  4TNN A;  2Q39 A;  4ZFX A;  1OEJ A;  1GT1 A;  3TZS A;  1BRP A;  1X8U A;  4ZHC A;  2R73 A;  2A2U A;  1U18 A;  1E02 A;  1B56 A;  1I4U A;  1LIE A;  2ALL X;  4ORY A;  5B29 A;  1LIB A;  3NPO A;  1OBU A;  5HZQ A;  1G7N A;  5L8I A;  2F73 A;  1EII A;  1YWA A;  5LJK A;  3NX1 A;  1EUO A;  1PMP A;  2AMM X;  1BWY A;  1GXA A;  1RBP A;  4QYN A;  2LBV A;  1KT4 A;  2FS7 A;  5C0N A;  4AYH A;  1E5P A;  3PH6 A;  3TF6 A;  3VG5 A;  3EBK A;  4GNW A;  1JZU A;  3PEC A;  2NNE A;  3IFB A;  5BVS A;  1FEL A;  1R0U A;  4YDB A;  1DZM A;  4CK4 A;  5LKF A;  3BRN A;  4QGV A;  1TXL A;  1GT5 A;  4D6A A;  2HYS A;  3FR5 A;  2XST A;  2AT6 X;  2E4J A;  5HCD C;  4AZO A;  3BLG A;  1A18 A;  2HZQ A;  1KOI A;  3U9P C;  1ZNH A;  3WJF A;  2K62 A;  4GNY A;  4KII A;  3KZA A;  4AZM A;  3CMP A;  4YGH A;  3AKN A;  2L68 A;  1JBH A;  4NYR A;  1LIF A;  4HPC A;  2CZT A;  2K23 A;  1EPB A;  1T0V A;  3NQ9 A;  5KIC A;  3L4R A;  1RLB E;  1ICN A;  1OEK A;  1GM6 A;  2A13 A;  1IW2 A;  3PP6 A;  1GX9 A;  4IBA A;  4DQ3 A;  4QZT A;  5D4A A;  1YP7 A;  2OFM X;  5F1E A;  4I9R A;  1BSQ A;  4N7C A;  3ZUO A;  5LJD A;  5D48 A;  1FDQ A;  1T68 X;  1JJX A;  1SY2 A;  3NX2 A;  3VG6 A;  1FE3 A;  4ARH A;  3B2J A;  1P6P A;  4GRJ A;  4MVL A;  4AZP A;  1E00 A;  1PBO A;  1LKE A;  2FR3 A;  2HLV A;  4OMW A;  1QQS A;  2HMB A;  1KZW A;  4QGW A;  3EM0 A;  3FEK A;  4OS0 A;  4IB6 A;  3FA7 A;  3STM X;  3VG2 A;  5BVT A;  4YMY A;  1ZRY A;  2W2B A;  3UEV A;  2WQ9 A;  4ORS A;  2JU3 A;  4XMD A;  1FEM A;  1VYF A;  3P6H A;  4A8Z A;  1QFV A;  4I3B A;  3PPT A;  2OFR X;  1IFC A;  5H9L A;  4UU3 A;  5K06 A;  5H9A A;  3UEW A;  3HWF A;  1I06 A;  3PH5 A;  1QFT A;  2R74 A;  4ODD A;  3UEU A;  2L5P A;  1GT3 A;  3I0A A;  2Q2M A;  4EXZ A;  4ORW A;  1E06 A;  4LKT A;  3JS1 A;  5KHP A;  1JV4 A;  1O8V A;  5D8J A;  2FLJ A;  1YWC A;  1ZNG A;  5KID A;  3BDR A;  5HZ6 A;  2CM9 A;  3D95 A;  1CBI A;  5HWZ A;  2OVA A;  3ELZ A;  2OVE A;  1X8P A;  4YBU A;  5LKE A;  3HK1 A;  1O1V A;  1OEE A;  3FEP A;  1Z24 A;  5D45 A;  4ORU A;  3D97 A;  4YBP A;  3IA8 A;  1MX8 A;  2FR2 A;  4ES7 A;  1X8O A;  3CBS A;  1YWB A;  1S44 A;  2KT4 B;  3KFH A;  4EDE A;  2BLG A;  1OPA A;  2QO6 A;  1AEL A;  2WQA E;  3ZUI A;  3O22 A;  3TGB A;  5HCC C;  2QOS C;  2L9C A;  1HBP A;  4OMX A;  3APU A;  1AQB A;  5LJH A;  2RCT A;  1JYD A;  1LNM A;  4IB8 A;  3HWG A;  4OS3 A;  1SXY A;  1DZJ A;  3ZQ3 A;  1EIO A;  1QWD A;  1CRB A;  2ANS A;  2CBS A;  5IO6 A;  5EDB A;  4UU2 A;  4ZHH A;  1CBS A;  2LBA A;  3C76 X;  4IAW A;  2MO5 A;  1ZNL A;  1YIV A;  4TLJ A;  1NGL A;  2JN3 A;  4ZHF A;  1U17 A;  2NP1 A;  2LFO A;  2Q9S A;  4IMN A;  1B0O A;  2CBR A;  5F6Z A;  3B2I A;  1X71 A;  4AZR A;  3ELX A;  1T8V A;  1EAL A;  4HFO A;  1ACD A;  3BX7 A;  2G79 A;  2RD7 C;  3TGC A;  1TOW A;  2X45 A;  4M7M A;  4ZGU A;  1KZX A;  2ACP X;  1URE A;  5HBS A;  5DPQ A;  1BSY A;  2R56 A;  1OBP A;  4WBK A;  1IFB A;  1ZND A;  1CBR A;  1LFO A;  1TW4 A;  5EZ2 A;  1D3S A;  2W2A A;  2FWV A;  5F58 A;  1GT4 A;  4NYQ A;  5HZ5 A;  1SXU A;  1MDC A;  3EBW A;  2MJI A;  4YCE A;  2JOZ A;  3D96 A;  2P8G A;  4XMH A;  3MVF A;  1G5W A;  4TKH A;  3CQR A;  1OPB A;  1UZ2 X;  1DF3 A;  3WJD A;  1CBQ A;  4D6B A;  4YGG A;  5HZ9 A;  3P6F A;  4IAX A;  3AKM A;  5H8T A;  1SY3 A;  1ICM A;  2HNX A;  2GTF X;  4YKO A;  5HZ8 A;  5HCE C;  3I17 A;  4Y0S A;  4NLI A;  1HBQ A;  2FRS A;  1QY2 A;  1KT3 A;  1ADL A;  1VPR A;  1BEB A;  3OJY C;  3WJG A;  5HTD A;  2EU7 X;  1X89 A;  2O62 A;  3CR6 A;  3S26 A;  3KFF A;  3KFG A;  4RUU A;  4GE1 A;  4LZV A;  3GAQ A;  2LKK A;  2DM5 A;  1IKJ A;  2N93 A;  3P6C A;  2RA6 A;  4EFG A;  2YG2 A;  3Q6L A;  5JR8 A;  1NP1 A;  1AVG I;  2WEX A;  3NP1 A;  1KT6 A;  4OS8 A;  3WBG A;  4XMG A;  3WJE A;  3SAO A;  4BOE A;  3STN A;  3F8A A;  3HWE A;  4A1H A;  5HA1 A;  1G85 A;  1OBQ A;  2ACO A;  3BY0 A;  4TKJ A;  2WSJ A;  1YUP A;  4GET A;  1ERB A;  3O19 A;  4NNS A;  1G74 A;  1GGL A;  1I05 A;  3EYC A;  4Y0Q A;  4DQ4 A;  4K19 A;  3APX A;  5H9K A;  4YFR A;  1NP4 A;  3WXQ A;  4M6S A;  1JJJ A;  1FEN A;  1S7D A;  3APV A;  3RSW A;  1TVQ A;  2AT3 X;  2FTB A;  3FEN A;  1KGL A;  3FA9 A;  3EMM A;  2POA A;  1XKI A;  1TOU A;  1BLR A;  2CM4 A;  4YFQ A;  1BBP A;  5BVQ A;  2IFB A;  3APW A;  4IMO A;  1B4M A;  4WFV A;  1BJ7 A;  1B8E A;  4I3C A;  1DFV A;  4TQ2 A;  1SY0 A;  3T1D A;  4ALB A;  3NQ3 A;  4N7D A;  1AB0 A;  3MBT A;  1EXS A;  3QKG A;  1HMS A;  4YCH A;  1BRQ A;  3TGA A;  3FMZ A;  4ZH6 A;  5FEN A;  2NND A;  5D47 A;  1S2P A;  1SA8 A;  1SXW A;  2WEW A;  4BQU A;  4AZQ A;  3CBC A;  3CWK A;  2RCQ A;  3B2L A;  4ZHG A;  2GC9 A;  2A2G A;  2MM3 A;  3FEL A;  2AT5 X;  3B2K A;  4ALO A;  4GKC A;  4Y0R A;  2ASN X;  2LB6 A;  3CQN A;  2QO5 A;  5EPQ A;  1DV9 A;  1CJ5 A;  3HWD A;  1X8Q A;  1DC9 A;  4ORR A;  4TKB A;  5HA0 A;  5EED A;  5B27 A;  4XMF A;  4NP1 A;  5FAZ A;  4IB9 A;  3STK A;  5H9N A;  2FT9 A;  4YKM A;  2HZR A;  4XMC A;  4WFU A;  3WJC A;  2KTD A;  4QAE A;  1BSO A;  1PEE A;  3DSZ A;  5L8N A;  4I3D A;  1L6M A;  3KQ0 A;  1IKE A;  1X8N A;  4NLJ A;  1QY0 A;  2Q4N A;  2GJ5 A;  4ZCB A;  4HPA A;  5L8O A;  1H91 A;  1EW3 A;  4ZH9 A;  1DZP A;  3F9D A;  2AT8 X;  3FR4 A;  4GH7 A;  4MVI A;  5EEE A;  3VG3 A;  4ZHD A;  1KQW A; 
#chains in the Genus database with same CATH topology
 1MK5 A;  4CPH A;  4Y59 A;  1MX7 A;  1YP6 A;  3PQS A;  4A60 A;  5CE4 A;  1LIC A;  1A57 A;  3RDX A;  5DG4 A;  5F7G A;  1Y0G A;  4HPD A;  1LCV A;  4R0B A;  1KFF A;  2PY1 A;  3VG4 A;  2NNQ A;  4I9S A;  2M4L A;  4TJZ A;  4U3Q A;  2AL0 X;  4YFP A;  3P6E A;  2FS6 A;  4HPB A;  4NV7 A;  3C78 X;  3VU1 A;  1LF7 A;  2IZK A;  2Y3E A;  3KFI A;  4RUN A;  1VWO B;  4KT5 A;  1KT5 A;  4O3Z A;  3UEX A;  3FLL A;  1LPJ A;  2CZU A;  4LZU A;  4FBV A;  3FW4 A;  1U0X A;  1DZK A;  3AEH A;  1EQD A;  2QMI A;  4YDA A;  1GX8 A;  3P6D A;  4MVK A;  5F6B A;  1SWR A;  2AT0 X;  1XCA A;  2WR6 A;  5FQ6 E;  1A2D A;  1VWI B;  3BSZ E;  4CV7 A;  1N0S A;  1HN2 A;  1MVG A;  1BM5 A;  1VYG A;  3C77 X;  2IZB A;  4A1Y A;  1JMX A;  4BVM A;  1SXX A;  3RY2 A;  2JU8 A;  3B2H A;  4GGZ A;  2RTJ A;  1ZNK A;  2Q2P A;  1SWL A;  1SWS A;  1ML7 A;  4Y0P A;  2JU7 A;  4WHI A;  5LJC A;  4BX7 A;  1NQN A;  2PI3 O;  2IZG B;  2UYW A;  3KVN A;  4ORX A;  1GKA A;  2AF5 A;  4IRW A;  3VG7 A;  4IAB A;  1YWD A;  5HTE A;  1IIU A;  5LJB A;  2W2F A;  1O1U A;  1RXJ A;  2BSZ A;  2WUT A;  1HMT A;  4IB7 A;  3G7X A;  4NNT A;  1QY1 A;  5AQ6 A;  4QZU A;  3MG5 A;  1ALB A;  1PM1 X;  3BS2 A;  1VWB B;  3JQO A;  1FTP A;  1LID A;  4CPH B;  1MUP A;  4ZR2 A;  1D2U A;  2HKD A;  5LJG A;  3RKG A;  3V8U A;  3U03 A;  1JYJ A;  2X34 A;  3FA8 A;  4Z28 A;  1HQP A;  4AZN A;  1QAB E;  4GGT A;  4PSQ A;  5JD2 A;  3PED A;  4EEJ A;  1SRG A;  5FFH A;  5IO7 A;  5EDC A;  4QYP A;  3WVM A;  2L67 A;  1KT7 A;  1KXO A;  4OEL A;  3RZY A;  4YGZ A;  4C5P A;  2A3F X;  3ZWE A;  4AW8 A;  3BX8 A;  3FA6 A;  3FR2 A;  2X46 A;  1ERX A;  3DTQ A;  5LJE A;  1I04 A;  2CAM A;  4INN A;  3FIQ A;  2WWP A;  3FW5 A;  1RAV A;  3WJB A;  5HAE A;  4GD9 A;  2G7B A;  2QO4 A;  3JSQ A;  4YH0 A;  4DCB A;  3NQK A;  3NAD A;  4JHQ A;  3BU1 A;  2XKL A;  2OFA A;  4ZJ0 A;  1QG5 A;  1SLE B;  5B2A O;  4XME A;  5IO5 A;  2AKQ A;  3K3L A;  1ZNE A;  1HMR A;  1Y52 X;  2QM9 A;  3NR3 A;  1K3B A;  1SY1 A;  1Y53 X;  2G78 A;  2OVD A;  3RDS A;  2YMS A;  4KC8 A;  2A0A A;  4QGX A;  3U0D A;  4LKP A;  1SWE A;  3BU9 A;  2AH7 X;  3OBL A;  4YVB A;  1EPA A;  1LUQ A;  1VWR B;  4O9S A;  3VGW A;  2RQ0 A;  3WZP A;  4Z2V A;  1KQX A;  1A3Y A;  2OZQ A;  3O2Y A;  3P02 A;  1GKA B;  5FQ8 E;  4CPI A;  3P6G A;  4TNN A;  2Q39 A;  4ZFX A;  1OEJ A;  1VWG B;  1GT1 A;  1K24 A;  4LQZ A;  3TZS A;  1VWL B;  1BRP A;  1N43 A;  1VWJ B;  1X8U A;  1JMZ A;  4ZHC A;  2R73 A;  2RTC B;  2FGS A;  3D4R A;  2OVS A;  1SWP A;  2A2U A;  1U18 A;  1SRH A;  1E02 A;  4KH8 A;  4BX6 A;  4O4S A;  1B56 A;  1I4U A;  1N9Y A;  1LIE A;  2KW1 A;  1SWN A;  2ALL X;  4ORY A;  5B29 A;  1LIB A;  3NPO A;  2OFB A;  1OBU A;  5HZQ A;  1G7N A;  3HOL A;  5L8I A;  4I95 A;  2F73 A;  2X8F A;  1EII A;  1YWA A;  5LJK A;  4GGR A;  1GX3 A;  3NX1 A;  1EUO A;  1UYN X;  1PMP A;  2DJG A;  2AMM X;  1BWY A;  1GXA A;  1RBP A;  4QYN A;  5AEO A;  2LBV A;  5B10 O;  1KT4 A;  1SWH A;  2FS7 A;  5C0N A;  3F6Z B;  4AYH A;  1E5P A;  4NV8 A;  3PH6 A;  3TF6 A;  3WZQ A;  3VG5 A;  3EBK A;  1STR B;  4GNW A;  1JZU A;  2VFB A;  4MVE A;  3PEC A;  2NNE A;  3IFB A;  1SWQ A;  2C1Q A;  5BVS A;  2JW1 A;  3ZW2 A;  1FEL A;  1HXZ A;  1R0U A;  1DZM A;  4YDB A;  4CK4 A;  5LKF A;  3BRN A;  2IZL B;  4QGV A;  4O4X A;  1TXL A;  2RTM A;  1VWP B;  2OY1 O;  4O4U A;  5CYB A;  1GT5 A;  4D6A A;  1SWG A;  2JGS A;  3SLT A;  2HYS A;  5FEN A;  3FR5 A;  2XST A;  4CDD A;  2AT6 X;  2E4J A;  5HCD C;  4AZO A;  3BLG A;  1A18 A;  1KOI A;  2HZQ A;  3U9P C;  1ZNH A;  5IRW A;  4GJV A;  2K62 A;  4MIR A;  3WJF A;  1W6F A;  4BX6 B;  4GNY A;  4KII A;  1DF8 A;  1SWD A;  3KZA A;  4AZM A;  3T6F A;  2BHV A;  4Y5D A;  3CMP A;  4YGH A;  3AKN A;  2L68 A;  4CSB A;  1JBH A;  2OF9 A;  4NYR A;  3VHI A;  1MOY A;  1LIF A;  4HPC A;  2CZT A;  2K23 A;  1EPB A;  1T0V A;  3NQ9 A;  1SWC A;  3SLO A;  5KIC A;  3L4R A;  3S5X A;  1RLB E;  1ICN A;  1OEK A;  1GM6 A;  2A13 A;  1IW2 A;  3PP6 A;  1GX9 A;  4IBA A;  4DQ3 A;  4QZT A;  5D4A A;  1YP7 A;  2KTS A;  1WBI A;  2C1S A;  2OFM X;  5F1E A;  2G5L A;  4I9R A;  1BSQ A;  4N7C A;  3ZUO A;  5LJD A;  5D48 A;  1FDQ A;  1T68 X;  1SRI A;  1JJX A;  1KL5 A;  3RBY A;  1SY2 A;  3T6L A;  3FDC A;  3NX2 A;  3VG6 A;  1FE3 A;  1E2T A;  4ARH A;  3B2J A;  1P6P A;  4GRJ A;  4MVL A;  3N91 A;  1E00 A;  1PBO A;  4PJ2 A;  4AZP A;  1LKE A;  1SWO A;  2BS6 A;  2FR3 A;  2HLV A;  1QQS A;  4OMW A;  2HMB A;  1KZW A;  1VWA B;  4QGW A;  3EM0 A;  3FEK A;  4OS0 A;  4IB6 A;  3FA7 A;  3STM X;  3VG2 A;  4GUZ A;  5BVT A;  2Z4H A;  4YMY A;  2RTE B;  1ZRY A;  1JQP A;  5IXG A;  2I5Z O;  2W2B A;  2OL7 A;  1RXK A;  2RTQ B;  1UYO X;  2WQ9 A;  3UEV A;  4ORS A;  2JU3 A;  1VWE B;  4XMD A;  1FEM A;  1VYF A;  4Z27 A;  2BC3 A;  3P6H A;  3Q34 A;  1QFV A;  4A8Z A;  4I3B A;  3PPT A;  1STP A;  2GTL N;  4KCA A;  2OFR X;  1IFC A;  5H9L A;  4ID2 A;  4JNJ A;  1VWH B;  4UU3 A;  5K06 A;  4ML7 B;  5H9A A;  3UEW A;  3HWF A;  1I06 A;  3PH5 A;  1QFT A;  2R74 A;  4ODD A;  3UEU A;  2L5P A;  1GT3 A;  2BS5 A;  2AVI A;  1RST B;  2Q2M A;  3I0A A;  4EXZ A;  4GDZ A;  4ORW A;  1VWM B;  1E06 A;  3OD9 A;  4LKT A;  3JS1 A;  4FGI B;  4MEE A;  5KHP A;  4CPE A;  1JV4 A;  1O8V A;  4U8U N;  5D8J A;  2FLJ A;  1YWC A;  1ZNG A;  4COT A;  1AVD A;  1SLD B;  1STS B;  5KID A;  1OSP O;  4EKV A;  3BDR A;  5HZ6 A;  3HPE A;  2CM9 A;  3FYF A;  3D95 A;  3RDM A;  2LA7 A;  3EW2 A;  2RTD B;  1CBI A;  5HWZ A;  2OVA A;  3ELZ A;  1VYO A;  2OVE A;  1NDJ A;  1X8P A;  4YBU A;  5LKE A;  3HK1 A;  2FKG A;  1O1V A;  4Z2O A;  1DV9 A;  3SZI A;  1N4J A;  2F09 A;  1OEE A;  4GZV A;  2FHN X;  3FEP A;  1Z24 A;  5D45 A;  4ORU A;  3D97 A;  4YBP A;  3IA8 A;  3EC5 A;  1MX8 A;  2FR2 A;  4ES7 A;  1HY2 A;  1X8O A;  5IRA A;  1MEP A;  1SRJ A;  1SLG B;  3CBS A;  1YWB A;  2A5B A;  1S44 A;  2OYB O;  2KT4 B;  2ZSC A;  3KFH A;  1RSU B;  3LTW A;  2BLG A;  4EDE A;  3OE3 A;  1SMP I;  1OPA A;  2QO6 A;  2X8S A;  2IZC B;  3PQU A;  2X56 A;  1AEL A;  1Y9T A;  2WQA E;  3O22 A;  2IZI A;  5CHK A;  3ZUI A;  3SZJ A;  5HCC C;  3TGB A;  2QOS C;  2L9C A;  1HBP A;  2RTR B;  4OMX A;  3APU A;  1AQB A;  2KD2 A;  5LJH A;  2RCT A;  1JYD A;  1LNM A;  4IB8 A;  3RDO A;  3HWG A;  2RTN B;  4OS3 A;  1SXY A;  1DZJ A;  4HWM A;  3ZQ3 A;  1N9M A;  1EIO A;  3ZW1 B;  1WUB A;  3CKG A;  1QWD A;  1CRB A;  2ANS A;  2C4I A;  2CBS A;  4CDC A;  5EDB A;  4UU2 A;  5IO6 A;  4U46 A;  3RY1 A;  4ZHH A;  2Z4I A;  1CBS A;  5AJB A;  2LBA A;  1LCZ A;  3C76 X;  2MO5 A;  1ZNL A;  1YIV A;  4IAW A;  4TLJ A;  3ZZV A;  2X8T A;  3X00 A;  2RTF B;  3EW1 A;  4BBO A;  3ZW0 A;  1NGL A;  2JN3 A;  4ZGF A;  4ZHF A;  4DNE A;  2Y3F A;  1U17 A;  4ALO A;  3SLJ A;  2LFO A;  2NP1 A;  2Q9S A;  2ZAI A;  1B0O A;  2CBR A;  4IMN A;  5F6Z A;  3B2I A;  1X71 A;  4AZR A;  3ELX A;  1T8V A;  1EAL A;  4HFO A;  1ACD A;  3BX7 A;  2G79 A;  2RD7 C;  4QRL A;  5B5G A;  3SZH A;  3LHN A;  3TGC A;  1TOW A;  2X45 A;  3CKF A;  4M7M A;  4ZGU A;  3MM0 A;  4ON1 A;  5F2B A;  1KZX A;  5K67 A;  2RTA A;  1W4T A;  3PDF A;  2VDF A;  2ACP X;  1URE A;  5AJC A;  5HBS A;  1N7Y A;  5DPQ A;  3WZO A;  2RTG B;  4BX5 B;  1BSY A;  2R56 A;  5K68 A;  1OBP A;  4WBK A;  2FHL A;  4O3W A;  3NBX X;  4OKA A;  3WZN A;  1IFB A;  1ZND A;  4GJS A;  1CBR A;  2RTI B;  1LFO A;  1TW4 A;  1VWF B;  1D3S A;  2W2A A;  2FWV A;  5EZ2 A;  1GT4 A;  4NYQ A;  5F58 A;  5HZ5 A;  1SXU A;  4Z2P A;  1MDC A;  4GK9 A;  3EBW A;  2MJI A;  1AVE A;  5B11 O;  3HOE A;  4O49 A;  3S60 A;  2IZH B;  4QNI A;  4YCE A;  2JOZ A;  3D96 A;  2P8G A;  4XMH A;  3MVF A;  1G5W A;  4TKH A;  3CQR A;  1OPB A;  1UZ2 X;  2MF6 A;  1DF3 A;  1JIW I;  3WJD A;  1SRE A;  1CBQ A;  4D6B A;  4YGG A;  5HZ9 A;  3P6F A;  4CDF A;  2X4M A;  4BX7 B;  1LDO A;  2X55 A;  4IAX A;  3ZW0 B;  3AKM A;  2JMB A;  5H8T A;  1SY3 A;  2DJF A;  1SWB A;  1ICM A;  2HNX A;  2GTF X;  2X32 A;  4YKO A;  5HZ8 A;  1RXH A;  4L3R A;  4O3Y A;  5HCE C;  2RTK A;  3I17 A;  4Y0S A;  4NLI A;  2IZF B;  1HBQ A;  1EI5 A;  1QY2 A;  1VPR A;  1KT3 A;  1ADL A;  2FRS A;  1BEB A;  3OJY C;  3VE2 A;  3WJG A;  1VWN B;  2FKJ A;  5HTD A;  2EU7 X;  1X89 A;  2O62 A;  3CR6 A;  2OY8 A;  1I9H A;  3S26 A;  3KFF A;  1HXL A;  3KFG A;  4RUU A;  4GE1 A;  4LZV A;  3GAQ A;  3T2W A;  2I5V O;  2IZJ A;  3QQ2 A;  1VWD B;  2F01 A;  1SWJ A;  2LKK A;  2QOM A;  4MIS A;  2DM5 A;  1IKJ A;  2QCB A;  2N93 A;  1Y55 X;  3P6C A;  2RA6 A;  4A1H A;  4EFG A;  2YG2 A;  3Q6L A;  5JR8 A;  4NW4 A;  3VE1 A;  1NP1 A;  2GTL O;  1AVG I;  3VHM A;  1FJ1 E;  2MHD A;  3AUM O;  2WEX A;  3NP1 A;  1KT6 A;  4OS8 A;  3ZW1 A;  3WBG A;  4XMG A;  3WJE A;  3S5V A;  3SAO A;  2Y32 A;  4BOE A;  3STN A;  3F8A A;  2WPU A;  3HWE A;  5HA1 A;  1G85 A;  5IRU A;  1OBQ A;  5B3M O;  2ACO A;  1IJ8 A;  3BY0 A;  4FBO A;  4TKJ A;  2WSJ A;  1YUP A;  4O4O A;  1SWU A;  4GET A;  1ERB A;  3O19 A;  4U8U O;  2RN4 A;  5B5F A;  4NNS A;  1G74 A;  1GGL A;  1I05 A;  3VHH A;  1SWK A;  3EYC A;  4Y0Q A;  4DQ4 A;  4K19 A;  3APX A;  3RDU A;  5H9K A;  4GU8 A;  4YFR A;  1NP4 A;  3RDQ A;  3WXQ A;  4M6S A;  1SRF A;  1JJJ A;  2RTP B;  1FEN A;  1PBY A;  4U9C A;  1S7D A;  4QQ1 A;  2GH7 A;  3APV A;  3RSW A;  2BT9 A;  1NBX A;  1TVQ A;  2AT3 X;  2FTB A;  3FEN A;  2MWH A;  1SWT A;  3P24 A;  3FA9 A;  3EMM A;  3GE2 A;  2POA A;  1KGL A;  1XKI A;  1TOU A;  2OF8 A;  1HQQ A;  1KL3 A;  4I60 A;  2CM4 A;  4YFQ A;  1BLR A;  3LV4 A;  1BBP A;  5BVQ A;  2IFB A;  1JJU A;  3APW A;  4I6S A;  4IMO A;  4WFV A;  4O3X B;  4BX5 A;  4GDA A;  1BJ7 A;  1B4M A;  1B8E A;  4I3C A;  1PTS A;  1DFV A;  4TQ2 A;  1SY0 A;  2A5C A;  2IZA A;  3T1D A;  4ALB A;  3NQ3 A;  1SWF A;  4BGF A;  4N7D A;  1AB0 A;  2IZD B;  3MBT A;  1EXS A;  1SWA A;  3QKG A;  1HMS A;  2VFC A;  1VWK B;  1BRQ A;  4YCH A;  3TGA A;  1NQM A;  3FMZ A;  4ZH6 A;  3SOT A;  4B55 A;  2ZAG A;  4BJ8 A;  2NND A;  3E3C A;  5D47 A;  1S2P A;  4JO6 A;  2OY7 A;  2OL8 O;  1SA8 A;  1SXW A;  2WEW A;  4BQU A;  4AZQ A;  2RTL A;  3CBC A;  5FQ7 E;  3CWK A;  2RCQ A;  3B2L A;  2GTL M;  3UAQ A;  4BCS A;  2GC9 A;  3D9W A;  4FBR A;  4ZHG A;  2A2G A;  2MM3 A;  2OL6 O;  3FEL A;  3H3I A;  2AT5 X;  3B2K A;  1I78 A;  1MM9 A;  4GKC A;  4Y0R A;  1VWC B;  2ASN X;  2LB6 A;  2RTH B;  2IZE B;  2QO5 A;  3CQN A;  3MX7 A;  3HTY A;  4OEM A;  5EPQ A;  3HWD A;  1X8Q A;  1DC9 A;  4FQB B;  4ORR A;  4CPF A;  4TKB A;  1CJ5 A;  5HA0 A;  5EED A;  5B27 A;  1LCW A;  4XMF A;  4L1N A;  2A8G A;  3ZI8 A;  1W5R A;  4NP1 A;  5FAZ A;  1VWQ B;  4Z6J A;  4IB9 A;  3STK A;  4U8U M;  5H9N A;  2FT9 A;  3FID A;  4YKM A;  2HZR A;  5CSE A;  3T2X A;  3VPJ E;  4XMC A;  1LEL A;  4WFU A;  3WJC A;  2KTD A;  4QAE A;  1BSO A;  5L3Y A;  1LDQ A;  1PEE A;  3DSZ A;  5L8N A;  2OY5 O;  4I3D A;  4JGL A;  1KL4 A;  1Y9L A;  4CDE A;  1L6M A;  3KQ0 A;  2RTB B;  2G8C O;  1IKE A;  1X8N A;  3PK2 A;  1QY0 A;  1NC9 A;  4NLJ A;  3WOV A;  2Q4N A;  2GJ5 A;  3WYQ A;  4ZCB A;  1SLF B;  4HPA A;  5L8O A;  1EW3 A;  1H91 A;  2UZ2 A;  4ZH9 A;  1DZP A;  3RE5 A;  3F9D A;  2AT8 X;  3RWX A;  3FR4 A;  4GH7 A;  5BYP A;  4MVI A;  5EEE A;  3RE6 A;  4EQA C;  3VG3 A;  3WYP A;  4ZHD A;  1KQW A;  2RTO B;  4KC7 A; 
#chains in the Genus database with same CATH homology
 1MX7 A;  1YP6 A;  3PQS A;  4A60 A;  5CE4 A;  1LIC A;  1A57 A;  5DG4 A;  5F7G A;  4HPD A;  4R0B A;  2PY1 A;  3VG4 A;  2NNQ A;  4I9S A;  2M4L A;  4TJZ A;  4U3Q A;  2AL0 X;  4YFP A;  3P6E A;  2FS6 A;  4HPB A;  3C78 X;  3VU1 A;  1LF7 A;  3KFI A;  4RUN A;  4KT5 A;  4O3Z A;  1KT5 A;  3UEX A;  3FLL A;  1LPJ A;  2CZU A;  4LZU A;  4FBV A;  3FW4 A;  1U0X A;  1DZK A;  4YDA A;  1EQD A;  2QMI A;  1GX8 A;  3P6D A;  4MVK A;  5F6B A;  2AT0 X;  1XCA A;  2WR6 A;  5FQ6 E;  1A2D A;  3BSZ E;  4CV7 A;  1N0S A;  1HN2 A;  1MVG A;  1BM5 A;  1VYG A;  3C77 X;  4A1Y A;  4BVM A;  1SXX A;  2JU8 A;  3B2H A;  1ZNK A;  2Q2P A;  1ML7 A;  4Y0P A;  2JU7 A;  4WHI A;  5LJC A;  4ORX A;  1GKA A;  3VG7 A;  4IAB A;  1YWD A;  5HTE A;  1IIU A;  5LJB A;  2W2F A;  1O1U A;  2WUT A;  1HMT A;  4IB7 A;  3G7X A;  4NNT A;  1QY1 A;  5AQ6 A;  4QZU A;  1ALB A;  1PM1 X;  3BS2 A;  3JQO A;  1FTP A;  1LID A;  1MUP A;  4ZR2 A;  1D2U A;  5LJG A;  3RKG A;  3U03 A;  1JYJ A;  3FA8 A;  1HQP A;  4AZN A;  1QAB E;  4PSQ A;  3PED A;  4EEJ A;  5FFH A;  5IO7 A;  5EDC A;  4QYP A;  3WVM A;  2L67 A;  1KT7 A;  1KXO A;  3RZY A;  4YGZ A;  2A3F X;  3ZWE A;  4AW8 A;  3BX8 A;  3FA6 A;  3FR2 A;  2X46 A;  1ERX A;  3DTQ A;  5LJE A;  1I04 A;  4INN A;  3FIQ A;  2WWP A;  3FW5 A;  3WJB A;  5HAE A;  2G7B A;  2QO4 A;  3JSQ A;  4YH0 A;  3NQK A;  3NAD A;  3BU1 A;  2XKL A;  4ZJ0 A;  1QG5 A;  5IO5 A;  4XME A;  2AKQ A;  3K3L A;  1ZNE A;  1HMR A;  2QM9 A;  3NR3 A;  1SY1 A;  2G78 A;  2OVD A;  2YMS A;  4KC8 A;  2A0A A;  4QGX A;  3U0D A;  4LKP A;  3BU9 A;  2AH7 X;  3OBL A;  1EPA A;  4O9S A;  2RQ0 A;  1KQX A;  1A3Y A;  2OZQ A;  3O2Y A;  3P02 A;  1GKA B;  5FQ8 E;  3P6G A;  4TNN A;  2Q39 A;  4ZFX A;  1OEJ A;  1GT1 A;  4LQZ A;  3TZS A;  1BRP A;  1X8U A;  4ZHC A;  2R73 A;  3D4R A;  2OVS A;  2A2U A;  1U18 A;  4KH8 A;  1E02 A;  4O4S A;  1B56 A;  1I4U A;  1LIE A;  2KW1 A;  2ALL X;  4ORY A;  5B29 A;  1LIB A;  3NPO A;  1OBU A;  5HZQ A;  1G7N A;  3HOL A;  5L8I A;  4I95 A;  2F73 A;  2X8F A;  1EII A;  1YWA A;  5LJK A;  3NX1 A;  1EUO A;  1PMP A;  2AMM X;  1BWY A;  1GXA A;  1RBP A;  4QYN A;  5AEO A;  2LBV A;  1KT4 A;  2FS7 A;  5C0N A;  3F6Z B;  4AYH A;  1E5P A;  3PH6 A;  3TF6 A;  3VG5 A;  3EBK A;  4GNW A;  1JZU A;  4MVE A;  3PEC A;  2NNE A;  3IFB A;  5BVS A;  3ZW2 A;  2JW1 A;  1FEL A;  1R0U A;  4YDB A;  1DZM A;  4CK4 A;  5LKF A;  3BRN A;  4QGV A;  4O4X A;  1TXL A;  4O4U A;  5CYB A;  1GT5 A;  4D6A A;  2HYS A;  3FR5 A;  2XST A;  2AT6 X;  2E4J A;  5HCD C;  4AZO A;  3BLG A;  1A18 A;  2HZQ A;  1KOI A;  3U9P C;  1ZNH A;  4MIR A;  2K62 A;  3WJF A;  4GNY A;  4KII A;  3KZA A;  4AZM A;  2BHV A;  3CMP A;  4YGH A;  3AKN A;  2L68 A;  4CSB A;  1JBH A;  4NYR A;  1LIF A;  4HPC A;  2CZT A;  2K23 A;  1EPB A;  1T0V A;  3NQ9 A;  5KIC A;  3L4R A;  3S5X A;  1RLB E;  1ICN A;  1OEK A;  1GM6 A;  2A13 A;  1IW2 A;  3PP6 A;  1GX9 A;  4IBA A;  4DQ3 A;  4QZT A;  5D4A A;  1YP7 A;  2KTS A;  2OFM X;  5F1E A;  4I9R A;  1BSQ A;  4N7C A;  3ZUO A;  5LJD A;  5D48 A;  1FDQ A;  1T68 X;  1JJX A;  3RBY A;  1SY2 A;  3NX2 A;  3VG6 A;  1FE3 A;  4ARH A;  3B2J A;  1P6P A;  4GRJ A;  4MVL A;  3N91 A;  1E00 A;  1PBO A;  4PJ2 A;  4AZP A;  1LKE A;  2BS6 A;  2FR3 A;  2HLV A;  4OMW A;  1QQS A;  2HMB A;  1KZW A;  4QGW A;  3EM0 A;  3FEK A;  4OS0 A;  4IB6 A;  3FA7 A;  3STM X;  3VG2 A;  5BVT A;  2Z4H A;  4YMY A;  1ZRY A;  2W2B A;  3UEV A;  2WQ9 A;  4ORS A;  2JU3 A;  4XMD A;  1FEM A;  1VYF A;  3P6H A;  4A8Z A;  1QFV A;  4I3B A;  3PPT A;  2GTL N;  4KCA A;  2OFR X;  1IFC A;  5H9L A;  4ID2 A;  4UU3 A;  5K06 A;  4ML7 B;  5H9A A;  3UEW A;  3HWF A;  1I06 A;  3PH5 A;  1QFT A;  2R74 A;  4ODD A;  3UEU A;  2L5P A;  1GT3 A;  2BS5 A;  2Q2M A;  3I0A A;  4EXZ A;  4GDZ A;  4ORW A;  1E06 A;  3OD9 A;  4LKT A;  3JS1 A;  4FGI B;  5KHP A;  1JV4 A;  1O8V A;  4U8U N;  5D8J A;  2FLJ A;  1YWC A;  1ZNG A;  4COT A;  5KID A;  3BDR A;  5HZ6 A;  2CM9 A;  3FYF A;  3D95 A;  2LA7 A;  1CBI A;  5HWZ A;  2OVA A;  3ELZ A;  2OVE A;  1X8P A;  4YBU A;  5LKE A;  3HK1 A;  1O1V A;  2F09 A;  1OEE A;  4GZV A;  3FEP A;  1Z24 A;  5D45 A;  4ORU A;  3D97 A;  4YBP A;  3IA8 A;  1MX8 A;  2FR2 A;  4ES7 A;  1X8O A;  3CBS A;  1YWB A;  1S44 A;  2KT4 B;  3KFH A;  4EDE A;  2BLG A;  3OE3 A;  1SMP I;  1OPA A;  2QO6 A;  2X8S A;  3PQU A;  1AEL A;  1Y9T A;  2WQA E;  3O22 A;  3ZUI A;  3TGB A;  5HCC C;  2QOS C;  2L9C A;  1HBP A;  4OMX A;  3APU A;  1AQB A;  2KD2 A;  5LJH A;  2RCT A;  1JYD A;  1LNM A;  4IB8 A;  3HWG A;  4OS3 A;  1SXY A;  1DZJ A;  4HWM A;  3ZQ3 A;  1EIO A;  3ZW1 B;  1QWD A;  1CRB A;  2ANS A;  2CBS A;  5IO6 A;  5EDB A;  4UU2 A;  4ZHH A;  2Z4I A;  1CBS A;  5AJB A;  2LBA A;  3C76 X;  4IAW A;  2MO5 A;  1ZNL A;  1YIV A;  4TLJ A;  3ZZV A;  2X8T A;  3ZW0 A;  1NGL A;  2JN3 A;  4ZGF A;  4ZHF A;  1U17 A;  2NP1 A;  2LFO A;  2Q9S A;  2ZAI A;  1B0O A;  2CBR A;  4IMN A;  5F6Z A;  3B2I A;  1X71 A;  4AZR A;  3ELX A;  1T8V A;  1EAL A;  4HFO A;  1ACD A;  3BX7 A;  2G79 A;  2RD7 C;  4QRL A;  3LHN A;  3TGC A;  1TOW A;  2X45 A;  4M7M A;  4ZGU A;  4ON1 A;  1KZX A;  2ACP X;  1URE A;  5AJC A;  5HBS A;  5DPQ A;  1BSY A;  2R56 A;  1OBP A;  4WBK A;  4O3W A;  3NBX X;  1IFB A;  1ZND A;  1CBR A;  1LFO A;  1TW4 A;  5EZ2 A;  1D3S A;  2W2A A;  2FWV A;  5F58 A;  1GT4 A;  4NYQ A;  5HZ5 A;  1SXU A;  1MDC A;  4GK9 A;  3EBW A;  2MJI A;  3HOE A;  4O49 A;  3S60 A;  4QNI A;  4YCE A;  2JOZ A;  3D96 A;  2P8G A;  4XMH A;  3MVF A;  1G5W A;  4TKH A;  3CQR A;  1OPB A;  1UZ2 X;  1DF3 A;  1JIW I;  3WJD A;  1CBQ A;  4D6B A;  4YGG A;  5HZ9 A;  3P6F A;  4IAX A;  3ZW0 B;  3AKM A;  2JMB A;  5H8T A;  1SY3 A;  1ICM A;  2HNX A;  2GTF X;  4YKO A;  5HZ8 A;  4L3R A;  4O3Y A;  5HCE C;  3I17 A;  4Y0S A;  4NLI A;  1HBQ A;  1EI5 A;  2FRS A;  1QY2 A;  1KT3 A;  1ADL A;  1VPR A;  1BEB A;  3OJY C;  3VE2 A;  3WJG A;  5HTD A;  2EU7 X;  1X89 A;  2O62 A;  3CR6 A;  3S26 A;  3KFF A;  3KFG A;  4RUU A;  4GE1 A;  4LZV A;  3GAQ A;  2LKK A;  4MIS A;  2DM5 A;  1IKJ A;  2N93 A;  3P6C A;  2RA6 A;  4EFG A;  2YG2 A;  3Q6L A;  5JR8 A;  4NW4 A;  3VE1 A;  1NP1 A;  2GTL O;  1AVG I;  2MHD A;  2WEX A;  3NP1 A;  1KT6 A;  4OS8 A;  3ZW1 A;  3WBG A;  4XMG A;  3WJE A;  3S5V A;  3SAO A;  4BOE A;  3STN A;  3F8A A;  3HWE A;  3V8U A;  5HA1 A;  1G85 A;  4A1H A;  1OBQ A;  2ACO A;  3BY0 A;  4FBO A;  4TKJ A;  2WSJ A;  1YUP A;  4O4O A;  4GET A;  1ERB A;  3O19 A;  4U8U O;  2RN4 A;  4NNS A;  1G74 A;  1GGL A;  1I05 A;  3EYC A;  4Y0Q A;  4DQ4 A;  4K19 A;  3APX A;  5H9K A;  4GU8 A;  4YFR A;  1NP4 A;  3WXQ A;  4M6S A;  1JJJ A;  1FEN A;  4U9C A;  1S7D A;  4QQ1 A;  3APV A;  3RSW A;  2BT9 A;  1TVQ A;  2AT3 X;  2FTB A;  3FEN A;  2MWH A;  1KGL A;  3P24 A;  3FA9 A;  3EMM A;  3GE2 A;  2POA A;  1XKI A;  1TOU A;  1BLR A;  2CM4 A;  4YFQ A;  3LV4 A;  1BBP A;  5BVQ A;  2IFB A;  3APW A;  4I6S A;  4IMO A;  4WFV A;  1B4M A;  4O3X B;  1BJ7 A;  1B8E A;  4I3C A;  1DFV A;  4TQ2 A;  1SY0 A;  3T1D A;  4ALB A;  3NQ3 A;  4N7D A;  1AB0 A;  3MBT A;  1EXS A;  3QKG A;  1HMS A;  4YCH A;  1BRQ A;  3TGA A;  3FMZ A;  4ZH6 A;  3SOT A;  5FEN A;  2ZAG A;  2NND A;  3E3C A;  5D47 A;  1S2P A;  1SA8 A;  1SXW A;  2WEW A;  4BQU A;  4AZQ A;  3CBC A;  5FQ7 E;  3CWK A;  2RCQ A;  3B2L A;  2GTL M;  3UAQ A;  4FBR A;  2GC9 A;  4ZHG A;  2A2G A;  2MM3 A;  3FEL A;  3H3I A;  2AT5 X;  3B2K A;  4ALO A;  4GKC A;  4Y0R A;  2ASN X;  2LB6 A;  3CQN A;  2QO5 A;  3MX7 A;  5EPQ A;  1DV9 A;  3HTY A;  1CJ5 A;  3HWD A;  1X8Q A;  1DC9 A;  4FQB B;  4ORR A;  4TKB A;  5HA0 A;  5EED A;  5B27 A;  4XMF A;  4L1N A;  3ZI8 A;  4NP1 A;  5FAZ A;  4IB9 A;  3STK A;  4U8U M;  5H9N A;  2FT9 A;  4YKM A;  2HZR A;  3VPJ E;  4XMC A;  4WFU A;  3WJC A;  2KTD A;  4QAE A;  1BSO A;  1PEE A;  3DSZ A;  5L8N A;  4I3D A;  4JGL A;  1Y9L A;  1L6M A;  3KQ0 A;  1IKE A;  1X8N A;  4NLJ A;  1QY0 A;  3WOV A;  2Q4N A;  2GJ5 A;  4ZCB A;  4HPA A;  5L8O A;  1H91 A;  1EW3 A;  4ZH9 A;  1DZP A;  3F9D A;  2AT8 X;  3RWX A;  3FR4 A;  4GH7 A;  5BYP A;  4MVI A;  5EEE A;  4EQA C;  3VG3 A;  4ZHD A;  1KQW A;  4KC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...