1CSKA

The crystal structure of human csksh3: structural diversity near the rt-src and n-src loop
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
GTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-SRC SH3 DOMAIN
publication title The crystal structure of human CskSH3: structural diversity near the RT-Src and n-Src loop.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphotransferase
total genus 11
structure length 58
sequence length 58
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1cskA00
4LE9A 2DLPA 2EGEA 1BB9A 1K0SA 4CC3A 2YT6A 4J9DA 4J9BA 2G6FX 2KE9A 2RQRA 1UE9A 2HCKA 1ZLMA 2JXBA 4OMNA 1NM7A 2RN8A 2NWMA 3VS1A 1AVZC 1WI7A 2I0NA 3REBB 2C0TA 4HCKA 2D8HA 2JT4A 1QLYA 1TG0A 1T0HA 2ESWA 3ZL7C 2PZ1A 2LJ0A 2O31A 4RTZA 3QWXX 4J9IA 2VVKA 4KRTA 2LQNA 2L3PA 2SRCA 1HJDA 1BU1A 2MOXA 2H8HA 1K0XA 5GJVB 1NYFA 1S1NA 1MV3A 2L3QA 1FMKA 1ZUYA 2J06A 3M0PA 3NGPA 4HVVA 3NPFA 3EG0A 3H0FA 2K2MA 1RLPC 2LX7A 2ED1A 1Y57A 3UA7A 2JMAA 1KJWA 1OOTA 2DJQA 2X3XD 1I0CA 2FEIA 2JM8A 4AFUC 1AWWA 4J9EA 1GBRA 2L3SA 1HSQA 5IHIA 3VS2A 1VYUA 2DL8A 2O9SA 1NEBA 2GTOA 4OMPA 4ZNXA 1YWPA 2C0OA 2GNCA 3KFVA 1T0JA 1E6HA 1SHGA 1WX6A 2QDLA 1SPKA 3VS7A 1WLPB 4RTTA 4CC4B 4JJCA 3M0UA 1UDLA 5FWCA 1BBZA 1GCQA 2KRNA 4WCIA 1CSKA 4CC7A 4EIKA 1I1JA 2CT4A 1SEMA 2YSQA 1PKTA 3VRZA 3IQLA 4DEYA 1NLOC 1MV0B 1AZGB 2NUZA 1H92A 1ZUUA 1QKXA 1AD5A 2J05A 2GGRA 1SRMA 3EG2A 2K9GA 2OI3A 2A37A 2DL7A 2RF0A 4JJBA 2K3BA 5IXFA 2K6DA 1JU5C 1UUEA 1AOJA 2EVRA 1W1FA 4ORZA 4OMLA 5FW9A 2OJ2A 1PNJA 2YUPA 3NHNA 1PRMC 1ZBJA 2LMJA 4J9CA 1IO6A 2KXCA 2KBTA 2LJ3A 3M0TA 2L2PA 3H41A 1WXUA 1VYTA 2KXDA 4GLMA 2EBPA 1GFDA 1GCPA 5ECAA 3H0HA 1Z9QA 1AEYA 4K11A 2B86A 2DYBA 2HEQA 3EG1A 3R6NA 2D1XA 2L0AA 5HCKA 2DA9A 2FG0A 2JTEA 2EYXA 1GRIA 1B3QA 1NYGA 1X69A 3M0QA 1E7OA 1WXBA 4DEXA 4RTWA 3VS0A 1TUCA 2J7IA 2DL4A 2F2XA 2J6OA 2XMFA 1K76A 2PNIA 2DMOA 2DBKA 4Z88A 3VS6A 1FYNA 1NLPC 2DL5A 4ESRA 2O2OA 4JZ3A 1UFFA 1ZUKA 1RLQC 1W6XA 1M30A 1LCKA 4D8KA 2P4RA 3A98A 2K7AA 4Y92A 1BK2A 2JMCA 1GFCA 2MIOA 2BZXA 1YN8A 1ABOA 1VYVA 2EPDA 3M0RA 2FRYA 3PVLA 2M51A 1SSHA 2DNUA 1Z9ZA 2ECZA 1J3TA 1PHTA 2CH4W 3O5ZA 2O88A 2HSPA 2RQUA 3EG3A 3SHWA 2IIMA 2F2VA 3EHRA 4JJDA 3VS5A 1E6GA 5L23A 1UHFA 1X6GA 2FO0A 1XOVA 2JS0A 2ROTA 4RTUA 3UATA 1X27A 2HDAA 2EKHA 3GBQA 3I35A 2KGTA 2M0YA 2J6FA 1M27C 2LQWA 1M3AA 2KT1A 1OEBA 3TVTA 5I11A 2FPEA 1N5ZA 2SEMA 2OAWA 3EGUA 2KNBB 1YNZA 2AK5A 1KFZA 1YP5A 2KR3A 3QWYA 1M3BA 1UGVA 4AFZC 2C0IA 2YUNA 3FJ5A 2GQIA 1WIEA 2GTJA 1OV3A 4J9HA 1K9AA 2FPFA 1YWOA 1UJ0A 1UECA 2A28A 1MUZA 1T3SA 4OMOA 3VS4A 2D8JA 2RPNA 2AZVA 4RTXA 2DL3A 1G2BA 2VWFA 1GCQC 1JEGA 1B07A 1PRLC 2DX1A 3VRYA 2CREA 1PKSA 1CKAA 1UG1A 4RTVA 1X2QA 4CC2A 2DM1A 3RBBB 4F16A 2BTTA 3CQTA 1V1CA 2FRWA 4M4ZA 4LN2A 3PVQA 1WA7A 2BZYA 2YUOA 3TSZA 4X1VA 2YDLA 1U3OA 4RUGA 1AZEA 4QT7A 1QWEA 3PE0A 2A36A 3I5RA 4F17A 4E6RA 2KEAA 1M3CA 4OMQA 3REAB 2DRKA 2O9VA 3U23A 1U06A 2JS2A 4IIMA 1H8KA 1JO8A 4J9FA 2CUDA 5GJWB 1VA7A 2BZ8A 4HXJA 2DF6A 1KIKA 1UJYA 2JM9A 1KSWA 2LNHB 2AZSA 2EYZA 2LZ6B 2JW4A 2VKNA 1GL5A 2ED0A 4IIOA 1W70A 4J9GA 1H3HA 1RUWA 3JV3A 2EYYA 1PWTA 2W0ZA 4AG1C 1QKWA 4AG2C 2F2WA 2CDTA 2W10A 4F14A 2KYBA 1T3LA 1AWJA 2CUBA 4A63B 3THKA 2V1QA 1K1ZA 4AFQC 2DVJA 2LP5A 2EGCA 1ZSGA 2E5KA 1ARKA 2RQVA 4FSSA 2EYWA 1NEGA 1X6BA 3VS3A 5EC7A 2KROA 1RI9A 1NG2A 4LUEA 4RTYA 1SRLA 1U5SA 1YCSB 2AKLA 1HD3A 3TSWA 5IHNA 1M8MA 2X3WD 4R0KA 1JQQA 1JXMA 2DILA 4LNPA 2ENMA 2KYMA 1WXTA 4JZ4A 2CSIA 1G83A 2PTKA 2CSQA 2RQWA 2MCNA 1AWXA 3ULRB 2GBQA 1AWOA 2EW3A 2DRMA 2ABLA 2KT8A 1UHCA 3UA6A 1K4US 1X43A 2LJ1A 1UTIA 4Z89A 1WFWA 2RNAA 2V1RA 1OPKA 1X2KA 1OPLA 4JPBW 2CH4A 1CKBA 2KRMA 2A08A 1GBQA 5IHKA 1WDXA 1ZX6A 3UF4A 2KRSA 1QCFA 2D0NA 2RMOA 5IH2A 2FPDA 2J6KA 2DBMA 2AKKA 4HVWA 1QWFA 1TUDA 4OMMA 3H0IA 4D8DA 1SHFA 1WYXA 3EHQA 3I5SA 2DE0X 2K79A 1I07A 4AFSC 1A0NB 3RNJA 2EGAA 2CT3A 2HBWA 1Y0MA 2ROLA 2EQIA 4HVUA 3SEMA 3NMZC 1JXOA 5I22A 1ABQA 4Z8AA 2RQTA 5FWBA 3LH5A 3I9QA 3M0SA 1EFNA 2YUQA 4GBQA 3C0CA 2LCSA 5IXBA 4LUDA
chains in the Genus database with same CATH superfamily
2DLPA 2EGEA 4BI3A 5EG2A 4CC3A 2YT6A 4J9DA 2KVQG 2YLCA 2M02A 3CCLT 2HCKA 3A8OB 4CI0C 4ZN1A 1ZSZA 1X01A 1NM7A 3VS1A 2I0NA 2C0TA 2IPOB 4LDVA 3M4GA 1KQSP 1KD1C 1TG0A 4PJOA 3G6EQ 3QWXX 2P0PA 1AHJB 2VVKA 2LQNA 2K5LA 3RMQA 1HJDA 1QW1A 4DBQA 3GPLA 2VB6A 1QP2A 2D6FA 4J6WA 1NYFA 3QO3A 1S1NA 3S3OA 1ZUYA 2HBPA 1IRXA 2NUTB 4HVVA 4ELZC 4M7AF 2K2MA 3QUIA 5HK0A 1RLPC 1TWBA 4C5EA 2H3JA 3SFMA 2YHTA 3V7RA 4M78E 1Y57A 4LXCA 1NZ9A 1DJ7B 3OBYA 1KJWA 1N9SA 3OYFA 1OOTA 2DJQA 2ZPIB 4M78F 2X3XD 2COYA 2FEIA 2JM8A 4AFUC 2VXFA 1GBRA 3VS2A 3ER0A 2Z0WA 3JCMb 2LCLA 4EMGA 2DL8A 4M7DB 3CC4Q 4CRIA 1ACMB 2GTOA 5LJ5d 1SF9A 1YWPA 2C0OA 3KFVA 1V29B 1FXXA 3RKWA 2QK0A 1Q7YR 4HKEA 2OTLT 4RMOA 4M75E 4IURA 2GF7A 3JAME 4PJOG 4IUTA 4OB1B 1UDLA 4M77G 4M75F 4P5NA 3RKYA 2KRNA 1JRIA 1KC8U 1WJQA 4R55A 1TH7A 5FLXE 3RR6A 5IT9E 5LJ5j 5AYFA 3HRTA 2YSQA 5KYYA 4DEYA 2L89A 3OS0A 5LJ3g 2PUOB 1IHVA 2HKNA 1QKXA 1AD5A 1SRMA 3I55T 2K9GA 4PFOA 1NJIU 3TQ7P 2JNGA 5IXFA 5GAN5 1UUEA 5A2QE 2QA4A 1HK9A 4OMLA 1ZBJA 4N0AC 4DBHA 1IO6A 3S6WA 2KBTA 2DKGA 2L2PA 4ZGJB 2LT4A 2KY9A 1VQOA 2KXDA 4GLMA 3GLXA 4N4GA 1VQMQ 3CPFA 4KGZB 5KYWB 3JCMJ 2V8JA 3H0HA 4K11A 2LRQA 2EKOA 3EG1A 2D1XA 4LDWA 3EH2A 2DA9A 2FG0A 1X69A 2MMPA 1WXBA 1OU9A 3QG1A 4A4FA 3CCQA 2DL4A 2DJZA 2J6OA 1YJWQ 3MEVA 2XMFA 2K4YA 3VUBA 3L2ZA 2DL5A 3EGXA 3CPWP 1C0MA 1UFFA 2PVGB 4PNOA 3JCMP 3FDRA 2P4RA 4M77C 4XU0A 3JB9I 3I56T 4Y92A 2JMCA 1GFCA 3ASKA 2DTIA 2MIOA 2XHCA 2BZXA 1YN8A 1ABOA 1VYVA 3M0RA 4ZGEB 3OYAA 2DIGA 2ECZA 3X25B 4J7FA 4A4KA 4AMCA 1M1KR 2RJDA 2RQUA 2CZ1B 2DO3A 2QG9B 3A8GB 1E6GA 3X24B 3JSCA 3M4YA 2ROTA 4RTUA 2OTLA 2OTJA 1VQ6T 1YCYA 4JRQA 2KT1A 3CD6T 1YJNQ 3TREA 1YI2Q 4QKUA 5J3BA 3CCEQ 3P8DA 2CZ7B 3OYJA 3HTRA 3M56A 5DY9A 3AT1B 2A28A 1MUZA 3VS4A 3HFOA 4A54A 2RPNA 2AZVA 4QQDA 2DL3A 3G71Q 1N8RC 3TEEA 3CMAQ 1YIJQ 1VQ9T 1JEGA 1PRLC 3L2UA 1PKSA 4BE1A 3QBYA 3CCJA 1X2QA 3RBBB 2BTTA 2EQJA 2RHXA 3CMEQ 3CQTA 1V1CA 2CP6A 2FRWA 1Q81C 2P0QA 4M7DA 3KUFA 3EH1A 3TSZA 4X1VA 3PIOA 2QASA 2YDLA 5GAOl 2CP0A 4UC4A 1AZEA 5DM7R 3OMGA 2KEAA 4MDXA 3G6ET 1YJ9T 2CP5A 2WSCE 3NTIA 3U23A 3C95A 2JS2A 3JB9G 4IIMA 2HAXA 1R0CB 1WZOA 2RI2A 4J9FA 2HKQB 3TCJA 2CUDA 4FYYB 1K8AC 1VA7A 2YRCA 3OW2P 4M77D 3FC3A 2JM9A 4JLIA 5LL6S 1KD1R 2EYZA 4EMHA 2X4YA 2MK5A 4OB3B 3QSUA 1H641 3L2VA 2O4XA 3JV3A 3R6OA 3CCLQ 1LPLA 1QKWA 4AG2C 2CDTA 2M1HA 2AIRB 2X4JA 1MMDA 1AWJA 1WGSA 1K1ZA 4AFQC 1HYOA 2AT1B 2EGCA 1WQWA 2AHJB 5GAMf 1UGPB 1OQKA 1QQJA 4F7UF 4JS4A 4L5GA 2X4WA 2I2LA 4C8QG 3LWIA 2MAMA 4X34A 2DYIA 1TUGB 2V8IA 4TVRA 1RAIB 1R8OB 2RM4A 1EZZB 5IHNA 1VQ6A 2X3WD 2EFIA 2ENMA 5DLQE 1N9RA 1VQ5A 1G8XA 5LJ3h 4ZN3A 4KGVB 3L2QA 3PNWC 3GOXA 1G3YA 3BDLA 2PTKA 2CSQA 2RQWA 2RHYA 2R57A 1BCOA 5CQYA 3OMCA 3MJXA 1UEBA 1M5Q1 2EW3A 2K57A 3MHXA 3EFOA 2NUPB 1UHCA 1IREB 1TOVA 2ZGWA 4A4EA 2V1RA 1OPKA 2FYKA 1Y71A 3L42A 1OPLA 3CC2Q 2VGMA 1ZSZB 1D1CA 1ZX6A 4MZTA 2KRSA 2K5IA 5GANd 4M7AA 2QXFA 2ZAEA 4HVWA 4JJNK 1QWFA 1VQMT 3MP6A 1VQKQ 4PJOB 4OMMA 3EFRA 4M77B 1WYXA 2DE0X 1I07A 3FIFA 4FW2A 2XDDA 1M9SA 3ZFJA 2QQRA 2XDBA 1A0NB 2LX9A 2DXBA 2X4XA 2ZPEB 2COWA 3RNJA 3N5BB 3P8HA 2X35A 3HL8A 3G6EA 1LVKA 2RHIA 5GANj 1FWZA 2HMAA 1EIFA 3NMZC 3CCVQ 1TXQA 3JCMX 2RK1A 4Z8AA 4X9DA 3I9QA 3M0SA 3I55Q 3C0CA 4NL2A 4C8QC 4LE9A 4PFPA 2V8KA 4XTVA 1JJ2A 2KE9A 1TTHB 3V8LA 1UE9A 3HRUA 1M1GA 4PKCC 4OMNA 2RN8A 3UPUA 1WI7A 3REBB 3ZBDA 1K9MU 3HHTB 2XK0A 2QQAA 2MPXC 3JB9F 4M7AG 1T0HA 3ZL7C 3VU3C 3CC4A 3OBWA 2LQ8A 3A1PA 2XKOC 3PIPA 3PGGA 3E9FA 2DK3A 1M8VA 4C92C 3OS1A 3MEWA 4M78G 3PMTA 4E7SA 1VQPT 4LDUA 3URGA 3OYCA 1MV3A 2CYZB 2J06A 2B8AA 1MMGA 3VYGA 4ELYC 5HY6A 2XIDA 1VIFA 3NPFA 3C12A 3A8MB 6AT1B 1YI2T 3FJPA 1U1SA 4BY6C 1YHQT 1K73C 2DZ9A 2JMAA 4PFZA 5J39A 4BDYA 3QZ5B 2P4TA 1AWWA 5GAOr 3HSBA 4M75G 2JOYA 3JB9D 3I56Q 1VYUA 2VUBA 3LWHA 1VQLT 2EJFA 1MMNA 1I5LA 4QQ6A 1M90U 4VUBA 4ZNXA 4XTXA 3QJ6A 1I4K1 4JRKA 1SPKA 3VS7A 2V26A 3MP1A 4CC4B 1JBMA 4JJCA 2L8DA 1VQMA 5FWCA 3H9NA 4ANJA 3MPUB 1GCQA 1CSKA 5KE2A 4C92F 1N8RR 1PKTA 3VRZA 3IQLA 1NLOC 4N0AA 5LJ5f 3CD6Q 1ZUUA 2R58A 2CKKA 1WHMA 4PK4A 2J05A 4RG2A 4C8QD 3EG2A 3EGXB 4N4HA 1Q81R 2RF0A 4JJBA 4E7ZA 2K6DA 3LLRA 5GMKe 1JU5C 1YJWA 5CO7A 1N27A 5CKFA 4ORZA 4F04B 1FX7A 1Q95G 4KH1B 3NHNA 2HQXA 5KCHA 4M78C 3M0TA 2LJ3A 2LVMA 1QVPA 1VQ9Q 4C0FA 3H41A 4LD9K 1M2OA 1VYTA 1C6VX 2CP3A 1QVFS 3OYNA 2LNVA 1AEYA 4HA8A 3HKSA 1K8AR 1IB8A 2B86A 3FRNA 4FYVB 2L0AA 5HCKA 3WVDB 2JTEA 5I2SA 1QVFA 3ME9A 1EX4A 4J83A 1B3QA 3C94A 1E7OA 4DEXA 4KULA 4M75C 8AT1B 4WF2A 1YJ9Q 4M77A 4XK8E 1OX8A 2F2XA 3O8VA 1G5VA 5A0LA 4RG8A 1K76A 3LGFA 4V2SA 2PNIA 1PCXA 2DBKA 2H3EB 2X9HA 2YRVA 3SD4A 4N4IA 1FYNA 1NLPC 3OYIA 4ESRA 5L8RE 2O2OA 4JZ3A 1ZUKA 3DB4A 1W6XA 1YJNA 1YI2A 1LCKA 1IGUA 1YHQA 4JS5A 2CZ0B 4B9XA 3CCEA 5DLOA 2E6NA 4OF1A 4IUQA 3OYBA 3CCST 5GMKh 2EPDA 1Q7YU 5IAYA 2DNUA 1Z9ZA 8ATCB 1PHTA 4KUIA 3G71A 2HSPA 4O6JA 3CC2T 2IIMA 2E12A 3CMAA 1YIJA 3LGLA 3VS5A 3G4SQ 4C8QB 1X6GA 4PL6A 2JS0A 2VC8A 4DA4A 3GBQA 4HCZA 3CBPA 3CMEA 2J6FA 1M27C 2LQWA 1VQKT 3TVTA 2FPEA 2ZPHB 1KFZA 3WVEB 1YP5A 5AT1B 1M3BA 3HPWA 4M7AD 4II1A 1O9SA 1OYXA 1WIEA 2GTJA 4J9HA 3CCVT 1SKUB 1XJWB 5GAN7 3BE3A 1UJ0A 4M78D 3CCRT 1UECA 4OMOA 2ZPFB 2IVWA 3UT1A 4RTXA 1B7TA 2O4XB 1GCQC 3VRYA 1UG1A 4MMLA 2HD0A 4O5VA 2LC4A 4BY6B 1WNLA 4LN2A 4NL3A 3PVQA 2ZCFB 3CCLA 2BZYA 2KMTA 2G3RA 4BE0A 4E7KA 1C1AA 3FB9A 4M75D 4JUVA 1QWEA 3PE0A 4QT7A 5J26A 2RJFA 4OMQA 3E1SA 4A4GA 2HZYA 3QHSA 2RJCA 3CXCP 3J80E 1KG1A 4HXJA 1KIKA 3HFNA 3GNFB 4FM4B 2LNHB 3EFOB 4F7UG 3NFCA 2E65A 2JW4A 1X6OA 2VKNA 1Q86C 3MP8A 2NLUA 1R0BG 1ZQ1A 4IIOA 4D6WA 2VYTA 5FROA 4GLKA 2EYYA 1PWTA 2QTVA 1M1KU 4AG1C 4FYXB 1VQ4T 1VQ7T 1WJSA 4F14A 2KYBA 4A63B 4FSXA 3THKA 3G1JA 2CZ6B 2GFAA 5FU6C 5LJ3d 1ZSGA 2RQVA 4M7AB 4FSSA 4OP0A 2ATCB 1D1BA 2EYWA 1NEGA 3CC2A 1X6BA 2HL5C 1RI9A 3GF5A 1K73R 4RKUE 4M78B 2VGNA 3JB9H 1M8MA 1UB4A 5CAIA 3MEUA 3JCMQ 1JQQA 2DILA 5LJ3j 1VQPQ 4IUUA 1VQKA 3DLMA 5FRMA 4JZ4A 1FMWA 2CSIA 1G83A 1D09B 2D0QB 4E7LA 2FZGB 2GBQA 1AWOA 1LJOA 1YHQQ 3UA6A 4PJJA 1K4US 1X43A 2LJ1A 3V8JA 2M16A 1P92A 3CCVA 1WFWA 2RNAA 4M75B 1BIBA 4E7IA 4JPBW 1RL2A 1CKBA 2KRMA 3I55A 3BDUA 1D0XA 1Y96A 1VQLQ 1WDXA 4ZGDB 1LOJA 2D0NA 2RMOA 1I8FA 3E2UA 5IH2A 2PU9B 3VUZA 4NOYA 1BYMA 1KHCA 5CK9A 1N6AA 2DPPB 3E9GA 3CCMQ 1TS9A 1D0YA 3MO8A 3I5SA 4XU2A 4PJOE 4AFSC 4BI8B 4JLGA 4C8QA 2EGAA 1UGRB 2CP7A 2R5AA 1YBYA 2Y90A 1WHHA 1KK7A 5I22A 1KD1U 1YFNA 5GANf 3QDFA 4X9CA 2HL3A 2RQTA 2QDYB 3OYDA 1YITT 2LCSA 4C0DC 5IXBA 4LUDA 1OZ3A 4E2FB 4ATOA 1BB9A 1K0SA 1NE8A 4J6XA 2JXBA 3QKJA 2BUDA 3SWNC 2NWMA 4C92A 5KYXA 2L3RA 1AT1B 2JT4A 1U1TA 5A0DA 2QGGA 1WHJA 2XI9A 3I56A 2ESWA 2PZ1A 3LX7A 2LJ0A 1M4ZA 1JB0E 3DB3A 4RTZA 2E3IA 3EFSA 4KRTA 1NPRA 1Q82C 2L3PA 3BW1A 1BU1A 2MOXA 5D7UA 3G4ST 2H8HA 2RH2A 5GJVB 3VV0A 1BI3A 4XU3A 3M0PA 1BCMA 3NGPA 3OYGA 2P84A 3LW5E 3EG0A 3H0FA 1W2BS 1MHNA 2QQBA 2ED1A 2XG8D 4L59A 4MZPA 5CR2A 3CD6A 2COZA 5KCOA 2C06A 1U8RA 4J9EA 1W2BA 2L3SA 1HSQA 3OB9A 3NTHA 5IHIA 2EJGA 2RI3A 3KBGA 3META 3CCSQ 4C92G 2YRDA 1G3TA 1NEBA 3FLGA 3HP9A 3QYHB 5GAMg 4IUPA 1T0JA 3VKIA 1E6HA 2BE9B 1WLPB 4KH0B 4RTTA 1VQ9A 3M58A 1I5OB 3JCMf 3EGDB 4WCIA 1ZA1B 5GMKm 1S72T 3RERA 2HQEA 3V7SA 3SB2A 4PJNA 1X75C 3M57A 1MV0B 2NUZA 1SSFA 1QVGP 4M78A 1H92A 3T9NA 2GFUA 2GGRA 1BKBA 2F5TX 4R56A 2DL7A 1YJ9A 3CBMA 1W1FA 5C0MA 4FCYA 3CCRQ 5FW9A 1PNJA 2A3LA 1KQSS 2YUPA 5GAN2 3JCMW 4J9CA 4DOWA 2K3YA 1KC8C 2DAQA 1WXUA 2PVOB 2RD1A 1PSEA 3JCMg 4M75A 4Y28E 1GCPA 5ECAA 3PMIA 5GAN6 1KQSA 5CQXA 1Z9QA 3CCUT 2EQUA 2DYBA 2XDPA 2P0KA 3M5AA 1VQNT 2KQWA 4J6YA 3R6NA 1NJIC 1I81A 1XTDA 2EYXA 1GRIA 4XAXB 1IHWA 4YTLA 3M0QA 1Q86R 2DEUA 3VS0A 1TUCA 2EQKA 3G4SA 2VXEA 3UDCA 2JUFA 2DMOA 2LTOA 1VQ8Q 4IKFA 2F5KA 5CKBA 4F7UB 4QVCA 4D8KA 3A98A 5GMKj 1IXDA 1KHIA 4QVZA 4BUGA 2FRYA 3PVLA 2M51A 4MZMA 1VQ4Q 2E10A 1VQ7Q 1ZBXA 4DBRA 1J3TA 3EHRA 4JJDA 1PSFA 2MWPA 3V7CA 1UHFA 4OMFB 1N8RU 4XTYA 2Y4XA 4M7DE 2EKHA 4XU1A 2M0YA 4C8QE 1M3AA 2NYSA 3OQ5A 3CCMT 1D3BB 1N5ZA 1QCNA 3SWNB 2OAWA 3EGUA 2KNBB 1YNZA 4OVAA 3UWNA 2E4HA 3EAEA 1Q81U 3RUXA 2JTMA 1UGVA 2C0IA 2BE7D 3FJ5A 2GQIA 2DZCA 2CP2A 2A7YA 1K9AA 2CGHA 2FPFA 3M59A 9ATCB 1T3SA 3OSSC 5GAOp 4DBFA 3D7SB 3CC7Q 1G2BA 4BI4A 4Y91A 5GAMe 2DXUA 1WPYA 2DX1A 1B34B 2LDMA 4QW2A 4RCCA 1K8AU 1BI1A 4RTVA 1V76A 4EMKC 2KSSA 4M4ZA 1WA7A 3P8BB 3QDRB 1QCOA 3NTKA 4RUGA 4JDSA 2A36A 3CPWS 3M54A 2DRKA 2BIVA 4C92D 2O9VA 4PJLA 4RCBA 3PFSA 1U06A 3GP8A 2LQKA 3E19A 1WHGA 3EGDA 5LJ5g 1JO8A 3RESA 5GJWB 3CPWA 2JN0A 2DF6A 2M0OA 4NS5A 5FRNA 1UJYA 1VQOT 1VQPA 2AZSA 2LZ6B 3OYHA 1YITQ 4JRPA 1W70A 4J9GA 3JCMe 1JJ2P 1Q82R 1H3ZA 2W0ZA 4KBMB 1Y96B 5C6SA 1WHKA 5GAMh 1TSFA 2LP5A 3CCQT 4MDWA 4OGCA 1BIAA 1MNDA 3H8ZA 3MCAB 1WHLA 5EC7A 1VQLA 4ME7A 5HKCA 4M7AE 1NG2A 2EWNA 3QPHA 4RTYA 1SRLA 1U5SA 3VJPA 3SDZA 1YCSB 1NPPA 1PD0A 4C5HA 2E41A 2FL7A 1BI2A 3CCMA 1OULA 2RO0A 1WXTA 4A4HA 1RADB 5LJ3f 2E1HA 1RAFB 2RI5A 2RB6A 2MCNA 1AWXA 3ULRB 4E7HA 4HT9A 1XNIA 2DRMA 2PUKB 2ABLA 4HCBA 1G3WA 1UTIA 7AT1B 5A0GA 2IG0A 4C5GA 2FHDA 2OAUA 4F7UA 1GBQA 5IHKA 1RACB 2OTJT 4C92B 5KYXB 3JCMh 2E6ZA 2ZPGB 3UF4A 1QCFA 3X28B 2FPDA 5D6WA 2EAYA 3RDVA 2JZ2A 2AKKA 1QMCA 4BACA 4ZTFA 3EG9B 3A8LB 4D8DA 2DIQA 2K79A 5HK3A 3OYKA 2KAFA 3LH0A 3OW2S 1QP3A 2DTOA 3RKXA 1IGQA 4B6MA 2HBWA 1Y0MA 1S72Q 2ROLA 2O01E 2EQIA 4HVUA 3SEMA 1JXOA 1KC8R 2MWOA 2DFUA 1D3BA 1ABQA 1RAAB 4ZTJA 3SWNA 3OW2A 4DOVA 4C0ZA 4LDYA 1RAEB 2QQSA 1EFNA 3CCJT 1VQ8T 3ZEHA 1D1AA 5D6XA 4QVDA 5GAOq 1HXDA 1NJIR 4J9BA 2G6FX 2VASA 3C4SA 2QEXQ 2RQRA 2QYZA 1F1BB 4E7JA 1ZLMA 3GNGA 5CCAA 2K2VA 1AVZC 4BD3A 3A8HB 5KYUA 2K5FA 4FW1A 3L1AA 4HCKA 2D8HA 1K73U 3M53A 2A0FB 1B34A 1QLYA 1WQ7A 3M55A 3QIIA 1OU8A 3CCUQ 3CCSA 2O31A 4J9IA 1VQNQ 3J81E 5LJ5e 1MGQA 1ZSZC 2SRCA 1QVFP 4KGXB 2EJ9A 1M2VB 1K0XA 2VV5A 4OGEA 2L3QA 1FMKA 3CEYA 1LNXA 4EMKB 2KI7A 4PJOC 3Q1JA 5GMKl 2LX7A 4L6V5 2EYQA 1K9MC 3WXMB 4FT2A 2ZPBB 3UA7A 3AHUA 2FZKB 2DD4A 2D9TA 4OB0B 4A53A 4XQ3A 1WJRA 1I0CA 3S3NA 4Z02A 5D6YA 4C5IA 4C0GA 4B9WA 2LT1A 1G3SA 4J5YA 3CC7T 1QVGS 2O9SA 5I2MA 3CCRA 4OMPA 3GIBA 2GNCA 4GY5A 2DEQA 1RAHB 1SHGA 1WX6A 2QDLA 2Y4YA 1VQ5T 3F70A 3OSVA 3M0UA 3HRSA 4PJMA 1QVGA 1BBZA 1VOMA 4AT1B 1PC0A 4CC7A 4EIKA 1I1JA 2CT4A 1SEMA 5LJ5h 2QGFB 1VIEA 1AZGB 2NUTA 5IN1A 3BFMA 2HNIA 3S3MA 2E3HA 2JTFA 2JJ9A 4M77E 2FB7A 3DLLA 2OI3A 4PJOF 1M90C 2A37A 1PG5B 4M77F 2RK2A 2K3BA 2EVRA 1AOJA 4XTUA 2HSEB 4WTOB 2OJ2A 4BE2A 1VQ8A 1PRMC 2LMJA 4E47A 2KXCA 3BY7A 2EBPA 1GFDA 2CS7A 4EDUA 1ZA2B 2E70A 2K3XA 5LJ3e 2EIFA 5GAN3 2DXTA 3KXTA 2KK4A 2HQHA 1ZHIA 2HEQA 1RAGB 1VQ4A 2RHZA 2WACA 1VQ7A 4HCCA 1Y7XA 1NYGA 3QZ9B 2DERA 4RTWA 4PJOD 1KQ1A 3EG9A 3PTAA 2J7IA 4KT0E 2QA4Q 5GANg 4DQ2A 4XTWA 4Z88A 3VS6A 3DKMA 5GAOn 1W4SA 5FU7C 3PT9A 3MKDA 2EQMA 1RLQC 1UGSB 1M30A 1VQOQ 2E64A 2PQWA 2YWWA 3JCMV 2ZZDA 4J7IA 2PVDB 5GMKi 2K7AA 4F7UE 1BK2A 2MI6A 2QQ9A 2XD0A 3CC4T 4M7DG 1SSHA 2RA2A 1XQHA 2QAZA 3JB9J 5KYWA 4XTZA 2CH4W 3O5ZA 2O88A 3EG3A 3CC7A 3SHWA 2F2VA 3CCQQ 5I21A 5L23A 2FO0A 3OYYA 1XOVA 3UATA 1X27A 2HDAA 3I35A 4FYWB 1TU0B 2DTHA 2KGTA 3A5ZB 3V8KA 1OEBA 4FU6A 5I11A 2SEMA 3CBOA 2KDSA 1MNEA 2AK5A 2KR3A 3QWYA 4AFZC 2YUNA 1M2VA 1Q7YC 5KYNA 4JRIA 2WSFE 3G7ZA 1OV3A 1SG5A 1YWOA 5FU6B 4EMKA 1RI0A 4BDZA 2D8JA 4Q5WA 1O75A 2VWFA 2DETA 1B07A 2CREA 1CKAA 1RABB 3JRZA 3QYGB 2QEXT 4CC2A 1YITA 2OTLQ 2DM1A 4QQGA 2OTJQ 4F16A 4BB7A 2L5QA 2QTXA 1OI1A 2YUOA 2F1LA 1Q86U 5CKDA 1U3OA 2MYSA 2E5QA 3OS5A 1KQ2A 3I5RA 1JJ2S 3OA6A 1Y07A 4E6RA 4F17A 5M9OA 3OY9A 3L2WA 5CVIA 1M3CA 3REAB 4OB2B 1YJWT 4M7DC 1H8KA 4PLIA 1VUBA 2BZ8A 2LCCA 2M9UA 5GAN4 5GAMd 1KSWA 3RMSA 3CCJQ 3QXEB 1IZ6A 1GL5A 2ED0A 3INZA 1H3HA 1RUWA 2WSEE 3OYLA 2F2WA 4FIBA 2RHUA 5GAOm 2W10A 1T3LA 2GQVA 2CUBA 5GAMj 2V1QA 3X26B 2DVJA 2E5KA 2DXCA 1ARKA 2DD5A 5CIUA 4KUDK 3QJYA 3L2RA 1FMVA 1GXIE 1K9MR 3VS3A 4FT4A 2KROA 2JVVA 5KYYB 4PLLA 4LUEA 4MMKA 5GANe 4LDXA 2AKLA 1HD3A 3TSWA 4C0DB 1OZ2A 2F69A 1YJNT 4R0KA 1JXMA 4LNPA 3X20B 2KYMA 4HT8A 1BI0A 3CCET 3FEOA 1M1KC 3RIRA 3M9QA 1MMAA 4M7DF 3JCMd 5CKEA 4C8QF 1R77A 2OX7A 1PM3A 1S72A 3OYEA 3J7AF 2KT8A 1M1FA 5CKHA 3G71T 4Z89A 5KH6A 3TU4K 3CMAT 1YIJT 2FZCB 1X2KA 4LD6A 4EPCA 1W2BP 2CH4A 2RJEA 5KE3A 2A08A 2XU8A 4FL6A 3CMET 1UGQB 2R5MA 5KYUB 3LYIA 5FU7B 2DVEA 2J6KA 2QEXA 4C92E 1VQ6Q 2DBMA 2X51A 3MEAA 4IUVA 1VQ5Q 1TUDA 5GAN8 1M90R 3CXCS 2MF2A 3H0IA 1SHFA 2YLBA 3EHQA 2FVUA 4M7DD 3H6ZA 2CT3A 1NBEB 3CCUA 3OS2A 3OYMA 4M7AC 2XICA 2QI2A 1PD1A 1OX9A 3JCMc 3CXCA 5GANh 1VQNA 1D0ZA 2YXYA 2GCXA 5FWBA 3LH5A 3VYHB 2QA4T 2YUQA 4GBQA 2NUPA 4J8OA 1Q82U 2BKDN
chains in the Genus database with same CATH topology
4LE9A 2DLPA 2EGEA 1BB9A 1K0SA 4CC3A 2YT6A 4J9DA 4J9BA 2G6FX 2KE9A 2RQRA 1UE9A 2HCKA 1ZLMA 2JXBA 4OMNA 1NM7A 2RN8A 2NWMA 3VS1A 1AVZC 1WI7A 2I0NA 3REBB 2C0TA 4HCKA 2D8HA 2JT4A 1QLYA 1TG0A 1T0HA 2ESWA 3ZL7C 2PZ1A 2LJ0A 2O31A 4RTZA 3QWXX 4J9IA 2VVKA 4KRTA 2LQNA 2L3PA 2SRCA 1HJDA 1BU1A 2MOXA 2H8HA 1K0XA 5GJVB 1NYFA 1S1NA 1MV3A 2L3QA 1FMKA 1ZUYA 2J06A 3M0PA 3NGPA 4HVVA 3NPFA 3EG0A 3H0FA 2K2MA 1RLPC 2LX7A 2ED1A 1Y57A 3UA7A 2JMAA 1KJWA 1OOTA 2DJQA 2X3XD 1I0CA 2FEIA 2JM8A 4AFUC 1AWWA 4J9EA 1GBRA 2L3SA 1HSQA 5IHIA 3VS2A 1VYUA 2DL8A 2O9SA 1NEBA 2GTOA 4OMPA 4ZNXA 1YWPA 2C0OA 2GNCA 3KFVA 1T0JA 1E6HA 1SHGA 1WX6A 2QDLA 1SPKA 3VS7A 1WLPB 4RTTA 4CC4B 4JJCA 3M0UA 1UDLA 5FWCA 1BBZA 1GCQA 2KRNA 4WCIA 1CSKA 4CC7A 4EIKA 1I1JA 2CT4A 1SEMA 2YSQA 1PKTA 3VRZA 3IQLA 4DEYA 1NLOC 1MV0B 1AZGB 2NUZA 1H92A 1ZUUA 1QKXA 1AD5A 2J05A 2GGRA 1SRMA 3EG2A 2K9GA 2OI3A 2A37A 2DL7A 2RF0A 4JJBA 2K3BA 5IXFA 2K6DA 1JU5C 1UUEA 1AOJA 2EVRA 1W1FA 4ORZA 4OMLA 5FW9A 2OJ2A 1PNJA 2YUPA 3NHNA 1PRMC 1ZBJA 2LMJA 4J9CA 1IO6A 2KXCA 2KBTA 2LJ3A 3M0TA 2L2PA 3H41A 1WXUA 1VYTA 2KXDA 4GLMA 2EBPA 1GFDA 1GCPA 5ECAA 3H0HA 1Z9QA 1AEYA 4K11A 2B86A 2DYBA 2HEQA 3EG1A 3R6NA 2D1XA 2L0AA 5HCKA 2DA9A 2FG0A 2JTEA 2EYXA 1GRIA 1B3QA 1NYGA 1X69A 3M0QA 1E7OA 1WXBA 4DEXA 4RTWA 3VS0A 1TUCA 2J7IA 2DL4A 2F2XA 2J6OA 2XMFA 1K76A 2PNIA 2DMOA 2DBKA 4Z88A 3VS6A 1FYNA 1NLPC 2DL5A 4ESRA 2O2OA 4JZ3A 1UFFA 1ZUKA 1RLQC 1W6XA 1M30A 1LCKA 4D8KA 2P4RA 3A98A 2K7AA 4Y92A 1BK2A 2JMCA 1GFCA 2MIOA 2BZXA 1YN8A 1ABOA 1VYVA 2EPDA 3M0RA 2FRYA 3PVLA 2M51A 1SSHA 2DNUA 1Z9ZA 2ECZA 1J3TA 1PHTA 2CH4W 3O5ZA 2O88A 2HSPA 2RQUA 3EG3A 3SHWA 2IIMA 2F2VA 3EHRA 4JJDA 3VS5A 1E6GA 5L23A 1UHFA 1X6GA 2FO0A 1XOVA 2JS0A 2ROTA 4RTUA 3UATA 1X27A 2HDAA 2EKHA 3GBQA 3I35A 2KGTA 2M0YA 2J6FA 1M27C 2LQWA 1M3AA 2KT1A 1OEBA 3TVTA 5I11A 2FPEA 1N5ZA 2SEMA 2OAWA 3EGUA 2KNBB 1YNZA 2AK5A 1KFZA 1YP5A 2KR3A 3QWYA 1M3BA 1UGVA 4AFZC 2C0IA 2YUNA 3FJ5A 2GQIA 1WIEA 2GTJA 1OV3A 4J9HA 1K9AA 2FPFA 1YWOA 1UJ0A 1UECA 2A28A 1MUZA 1T3SA 4OMOA 3VS4A 2D8JA 2RPNA 2AZVA 4RTXA 2DL3A 1G2BA 2VWFA 1GCQC 1JEGA 1B07A 1PRLC 2DX1A 3VRYA 2CREA 1PKSA 1CKAA 1UG1A 4RTVA 1X2QA 4CC2A 2DM1A 3RBBB 4F16A 2BTTA 3CQTA 1V1CA 2FRWA 4M4ZA 4LN2A 3PVQA 1WA7A 2BZYA 2YUOA 3TSZA 4X1VA 2YDLA 1U3OA 4RUGA 1AZEA 4QT7A 1QWEA 3PE0A 2A36A 3I5RA 4F17A 4E6RA 2KEAA 1M3CA 4OMQA 3REAB 2DRKA 2O9VA 3U23A 1U06A 2JS2A 4IIMA 1H8KA 1JO8A 4J9FA 2CUDA 5GJWB 1VA7A 2BZ8A 4HXJA 2DF6A 1KIKA 1UJYA 2JM9A 1KSWA 2LNHB 2AZSA 2EYZA 2LZ6B 2JW4A 2VKNA 1GL5A 2ED0A 4IIOA 1W70A 4J9GA 1H3HA 1RUWA 3JV3A 2EYYA 1PWTA 2W0ZA 4AG1C 1QKWA 4AG2C 2F2WA 2CDTA 2W10A 4F14A 2KYBA 1T3LA 1AWJA 2CUBA 4A63B 3THKA 2V1QA 1K1ZA 4AFQC 2DVJA 2LP5A 2EGCA 1ZSGA 2E5KA 1ARKA 2RQVA 4FSSA 2EYWA 1NEGA 1X6BA 3VS3A 5EC7A 2KROA 1RI9A 1NG2A 4LUEA 4RTYA 1SRLA 1U5SA 1YCSB 2AKLA 1HD3A 3TSWA 5IHNA 1M8MA 2X3WD 4R0KA 1JQQA 1JXMA 2DILA 4LNPA 2ENMA 2KYMA 1WXTA 4JZ4A 2CSIA 1G83A 2PTKA 2CSQA 2RQWA 2MCNA 1AWXA 3ULRB 2GBQA 1AWOA 2EW3A 2DRMA 2ABLA 2KT8A 1UHCA 3UA6A 1K4US 1X43A 2LJ1A 1UTIA 4Z89A 1WFWA 2RNAA 2V1RA 1OPKA 1X2KA 1OPLA 4JPBW 2CH4A 1CKBA 2KRMA 2A08A 1GBQA 5IHKA 1WDXA 1ZX6A 3UF4A 2KRSA 1QCFA 2D0NA 2RMOA 5IH2A 2FPDA 2J6KA 2DBMA 2AKKA 4HVWA 1QWFA 1TUDA 4OMMA 3H0IA 4D8DA 1SHFA 1WYXA 3EHQA 3I5SA 2DE0X 2K79A 1I07A 4AFSC 1A0NB 3RNJA 2EGAA 2CT3A 2HBWA 1Y0MA 2ROLA 2EQIA 4HVUA 3SEMA 3NMZC 1JXOA 5I22A 1ABQA 4Z8AA 2RQTA 5FWBA 3LH5A 3I9QA 3M0SA 1EFNA 2YUQA 4GBQA 3C0CA 2LCSA 5IXBA 4LUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LE9 A;  2DLP A;  2EGE A;  1BB9 A;  1K0S A;  4CC3 A;  2YT6 A;  4J9D A;  4J9B A;  2G6F X;  2KE9 A;  2RQR A;  1UE9 A;  2HCK A;  1ZLM A;  2JXB A;  4OMN A;  1NM7 A;  2RN8 A;  2NWM A;  3VS1 A;  1AVZ C;  1WI7 A;  2I0N A;  3REB B;  2C0T A;  4HCK A;  2D8H A;  2JT4 A;  1QLY A;  1TG0 A;  1T0H A;  2ESW A;  3ZL7 C;  2PZ1 A;  2LJ0 A;  2O31 A;  4RTZ A;  3QWX X;  4J9I A;  2VVK A;  4KRT A;  2LQN A;  2L3P A;  2SRC A;  1HJD A;  1BU1 A;  2MOX A;  2H8H A;  1K0X A;  5GJV B;  1NYF A;  1S1N A;  1MV3 A;  2L3Q A;  1FMK A;  1ZUY A;  2J06 A;  3M0P A;  3NGP A;  4HVV A;  3NPF A;  3EG0 A;  3H0F A;  2K2M A;  1RLP C;  2LX7 A;  2ED1 A;  1Y57 A;  3UA7 A;  2JMA A;  1KJW A;  1OOT A;  2DJQ A;  2X3X D;  1I0C A;  2FEI A;  2JM8 A;  4AFU C;  1AWW A;  4J9E A;  1GBR A;  2L3S A;  1HSQ A;  5IHI A;  3VS2 A;  1VYU A;  2DL8 A;  2O9S A;  1NEB A;  2GTO A;  4OMP A;  4ZNX A;  1YWP A;  2C0O A;  2GNC A;  3KFV A;  1T0J A;  1E6H A;  1SHG A;  1WX6 A;  2QDL A;  1SPK A;  3VS7 A;  1WLP B;  4RTT A;  4CC4 B;  4JJC A;  3M0U A;  1UDL A;  5FWC A;  1BBZ A;  1GCQ A;  2KRN A;  4WCI A;  1CSK A;  4CC7 A;  4EIK A;  1I1J A;  2CT4 A;  1SEM A;  2YSQ A;  1PKT A;  3VRZ A;  3IQL A;  4DEY A;  1NLO C;  1MV0 B;  1AZG B;  2NUZ A;  1H92 A;  1ZUU A;  1QKX A;  1AD5 A;  2J05 A;  2GGR A;  1SRM A;  3EG2 A;  2K9G A;  2OI3 A;  2A37 A;  2DL7 A;  2RF0 A;  4JJB A;  2K3B A;  5IXF A;  2K6D A;  1JU5 C;  1UUE A;  1AOJ A;  2EVR A;  1W1F A;  4ORZ A;  4OML A;  5FW9 A;  2OJ2 A;  1PNJ A;  2YUP A;  3NHN A;  1PRM C;  1ZBJ A;  2LMJ A;  4J9C A;  1IO6 A;  2KXC A;  2KBT A;  2LJ3 A;  3M0T A;  2L2P A;  3H41 A;  1WXU A;  1VYT A;  2KXD A;  4GLM A;  2EBP A;  1GFD A;  1GCP A;  5ECA A;  3H0H A;  1Z9Q A;  1AEY A;  4K11 A;  2B86 A;  2DYB A;  2HEQ A;  3EG1 A;  3R6N A;  2D1X A;  2L0A A;  5HCK A;  2DA9 A;  2FG0 A;  2JTE A;  2EYX A;  1GRI A;  1B3Q A;  1NYG A;  1X69 A;  3M0Q A;  1E7O A;  1WXB A;  4DEX A;  4RTW A;  3VS0 A;  1TUC A;  2J7I A;  2DL4 A;  2F2X A;  2J6O A;  2XMF A;  1K76 A;  2PNI A;  2DMO A;  2DBK A;  4Z88 A;  3VS6 A;  1FYN A;  1NLP C;  2DL5 A;  4ESR A;  2O2O A;  4JZ3 A;  1UFF A;  1ZUK A;  1RLQ C;  1W6X A;  1M30 A;  1LCK A;  4D8K A;  2P4R A;  3A98 A;  2K7A A;  4Y92 A;  1BK2 A;  2JMC A;  1GFC A;  2MIO A;  2BZX A;  1YN8 A;  1ABO A;  1VYV A;  2EPD A;  3M0R A;  2FRY A;  3PVL A;  2M51 A;  1SSH A;  2DNU A;  1Z9Z A;  2ECZ A;  1J3T A;  1PHT A;  2CH4 W;  3O5Z A;  2O88 A;  2HSP A;  2RQU A;  3EG3 A;  3SHW A;  2IIM A;  2F2V A;  3EHR A;  4JJD A;  3VS5 A;  1E6G A;  5L23 A;  1UHF A;  1X6G A;  2FO0 A;  1XOV A;  2JS0 A;  2ROT A;  4RTU A;  3UAT A;  1X27 A;  2HDA A;  2EKH A;  3GBQ A;  3I35 A;  2KGT A;  2M0Y A;  2J6F A;  1M27 C;  2LQW A;  1M3A A;  2KT1 A;  1OEB A;  3TVT A;  5I11 A;  2FPE A;  1N5Z A;  2SEM A;  2OAW A;  3EGU A;  2KNB B;  1YNZ A;  2AK5 A;  1KFZ A;  1YP5 A;  2KR3 A;  3QWY A;  1M3B A;  1UGV A;  4AFZ C;  2C0I A;  2YUN A;  3FJ5 A;  2GQI A;  1WIE A;  2GTJ A;  1OV3 A;  4J9H A;  1K9A A;  2FPF A;  1YWO A;  1UJ0 A;  1UEC A;  2A28 A;  1MUZ A;  1T3S A;  4OMO A;  3VS4 A;  2D8J A;  2RPN A;  2AZV A;  4RTX A;  2DL3 A;  1G2B A;  2VWF A;  1GCQ C;  1JEG A;  1B07 A;  1PRL C;  2DX1 A;  3VRY A;  2CRE A;  1PKS A;  1CKA A;  1UG1 A;  4RTV A;  1X2Q A;  4CC2 A;  2DM1 A;  3RBB B;  4F16 A;  2BTT A;  3CQT A;  1V1C A;  2FRW A;  4M4Z A;  4LN2 A;  3PVQ A;  1WA7 A;  2BZY A;  2YUO A;  3TSZ A;  4X1V A;  2YDL A;  1U3O A;  4RUG A;  1AZE A;  4QT7 A;  1QWE A;  3PE0 A;  2A36 A;  3I5R A;  4F17 A;  4E6R A;  2KEA A;  1M3C A;  4OMQ A;  3REA B;  2DRK A;  2O9V A;  3U23 A;  1U06 A;  2JS2 A;  4IIM A;  1H8K A;  1JO8 A;  4J9F A;  2CUD A;  5GJW B;  1VA7 A;  2BZ8 A;  4HXJ A;  2DF6 A;  1KIK A;  1UJY A;  2JM9 A;  1KSW A;  2LNH B;  2AZS A;  2EYZ A;  2LZ6 B;  2JW4 A;  2VKN A;  1GL5 A;  2ED0 A;  4IIO A;  1W70 A;  4J9G A;  1H3H A;  1RUW A;  3JV3 A;  2EYY A;  1PWT A;  2W0Z A;  4AG1 C;  1QKW A;  4AG2 C;  2F2W A;  2CDT A;  2W10 A;  4F14 A;  2KYB A;  1T3L A;  1AWJ A;  2CUB A;  4A63 B;  3THK A;  2V1Q A;  1K1Z A;  4AFQ C;  2DVJ A;  2LP5 A;  2EGC A;  1ZSG A;  2E5K A;  1ARK A;  2RQV A;  4FSS A;  2EYW A;  1NEG A;  1X6B A;  3VS3 A;  5EC7 A;  2KRO A;  1RI9 A;  1NG2 A;  4LUE A;  4RTY A;  1SRL A;  1U5S A;  1YCS B;  2AKL A;  1HD3 A;  3TSW A;  5IHN A;  1M8M A;  2X3W D;  4R0K A;  1JQQ A;  1JXM A;  2DIL A;  4LNP A;  2ENM A;  2KYM A;  1WXT A;  4JZ4 A;  2CSI A;  1G83 A;  2PTK A;  2CSQ A;  2RQW A;  2MCN A;  1AWX A;  3ULR B;  2GBQ A;  1AWO A;  2EW3 A;  2DRM A;  2ABL A;  2KT8 A;  1UHC A;  3UA6 A;  1K4U S;  1X43 A;  2LJ1 A;  1UTI A;  4Z89 A;  1WFW A;  2RNA A;  2V1R A;  1OPK A;  1X2K A;  1OPL A;  4JPB W;  2CH4 A;  1CKB A;  2KRM A;  2A08 A;  1GBQ A;  5IHK A;  1WDX A;  1ZX6 A;  3UF4 A;  2KRS A;  1QCF A;  2D0N A;  2RMO A;  5IH2 A;  2FPD A;  2J6K A;  2DBM A;  2AKK A;  4HVW A;  1QWF A;  1TUD A;  4OMM A;  3H0I A;  4D8D A;  1SHF A;  1WYX A;  3EHQ A;  3I5S A;  2DE0 X;  2K79 A;  1I07 A;  4AFS C;  1A0N B;  3RNJ A;  2EGA A;  2CT3 A;  2HBW A;  1Y0M A;  2ROL A;  2EQI A;  4HVU A;  3SEM A;  3NMZ C;  1JXO A;  5I22 A;  1ABQ A;  4Z8A A;  2RQT A;  5FWB A;  3LH5 A;  3I9Q A;  3M0S A;  1EFN A;  2YUQ A;  4GBQ A;  3C0C A;  2LCS A;  5IXB A;  4LUD A; 
#chains in the Genus database with same CATH topology
 2DLP A;  2EGE A;  4BI3 A;  5EG2 A;  4CC3 A;  2YT6 A;  4J9D A;  2KVQ G;  2YLC A;  2M02 A;  3CCL T;  2HCK A;  3A8O B;  4CI0 C;  4ZN1 A;  1ZSZ A;  1X01 A;  1NM7 A;  3VS1 A;  2I0N A;  2C0T A;  2IPO B;  4LDV A;  3M4G A;  1KQS P;  1KD1 C;  1TG0 A;  4PJO A;  3G6E Q;  3QWX X;  2P0P A;  1AHJ B;  2VVK A;  2LQN A;  2K5L A;  3RMQ A;  1HJD A;  1QW1 A;  4DBQ A;  3GPL A;  2VB6 A;  1QP2 A;  2D6F A;  4J6W A;  1NYF A;  3QO3 A;  1S1N A;  3S3O A;  1ZUY A;  2HBP A;  1IRX A;  2NUT B;  4HVV A;  4ELZ C;  4M7A F;  2K2M A;  3QUI A;  5HK0 A;  1RLP C;  1TWB A;  4C5E A;  2H3J A;  3SFM A;  2YHT A;  3V7R A;  4M78 E;  1Y57 A;  4LXC A;  1NZ9 A;  1DJ7 B;  3OBY A;  1KJW A;  1N9S A;  3OYF A;  1OOT A;  2DJQ A;  2ZPI B;  4M78 F;  2X3X D;  2COY A;  2FEI A;  2JM8 A;  4AFU C;  2VXF A;  1GBR A;  3VS2 A;  3ER0 A;  2Z0W A;  3JCM b;  2LCL A;  4EMG A;  2DL8 A;  4M7D B;  3CC4 Q;  4CRI A;  1ACM B;  2GTO A;  5LJ5 d;  1SF9 A;  1YWP A;  2C0O A;  3KFV A;  1V29 B;  1FXX A;  3RKW A;  2QK0 A;  1Q7Y R;  4HKE A;  2OTL T;  4RMO A;  4M75 E;  4IUR A;  2GF7 A;  3JAM E;  4PJO G;  4IUT A;  4OB1 B;  1UDL A;  4M77 G;  4M75 F;  4P5N A;  3RKY A;  2KRN A;  1JRI A;  1KC8 U;  1WJQ A;  4R55 A;  1TH7 A;  5FLX E;  3RR6 A;  5IT9 E;  5LJ5 j;  5AYF A;  3HRT A;  2YSQ A;  5KYY A;  4DEY A;  2L89 A;  3OS0 A;  5LJ3 g;  2PUO B;  1IHV A;  2HKN A;  1QKX A;  1AD5 A;  1SRM A;  3I55 T;  2K9G A;  4PFO A;  1NJI U;  3TQ7 P;  2JNG A;  5IXF A;  5GAN 5;  1UUE A;  5A2Q E;  2QA4 A;  1HK9 A;  4OML A;  1ZBJ A;  4N0A C;  4DBH A;  1IO6 A;  3S6W A;  2KBT A;  2DKG A;  2L2P A;  4ZGJ B;  2LT4 A;  2KY9 A;  1VQO A;  2KXD A;  4GLM A;  3GLX A;  4N4G A;  1VQM Q;  3CPF A;  4KGZ B;  5KYW B;  3JCM J;  2V8J A;  3H0H A;  4K11 A;  2LRQ A;  2EKO A;  3EG1 A;  2D1X A;  4LDW A;  3EH2 A;  2DA9 A;  2FG0 A;  1X69 A;  2MMP A;  1WXB A;  1OU9 A;  3QG1 A;  4A4F A;  3CCQ A;  2DL4 A;  2DJZ A;  2J6O A;  1YJW Q;  3MEV A;  2XMF A;  2K4Y A;  3VUB A;  3L2Z A;  2DL5 A;  3EGX A;  3CPW P;  1C0M A;  1UFF A;  2PVG B;  4PNO A;  3JCM P;  3FDR A;  2P4R A;  4M77 C;  4XU0 A;  3JB9 I;  3I56 T;  4Y92 A;  2JMC A;  1GFC A;  3ASK A;  2DTI A;  2MIO A;  2XHC A;  2BZX A;  1YN8 A;  1ABO A;  1VYV A;  3M0R A;  4ZGE B;  3OYA A;  2DIG A;  2ECZ A;  3X25 B;  4J7F A;  4A4K A;  4AMC A;  1M1K R;  2RJD A;  2RQU A;  2CZ1 B;  2DO3 A;  2QG9 B;  3A8G B;  1E6G A;  3X24 B;  3JSC A;  3M4Y A;  2ROT A;  4RTU A;  2OTL A;  2OTJ A;  1VQ6 T;  1YCY A;  4JRQ A;  2KT1 A;  3CD6 T;  1YJN Q;  3TRE A;  1YI2 Q;  4QKU A;  5J3B A;  3CCE Q;  3P8D A;  2CZ7 B;  3OYJ A;  3HTR A;  3M56 A;  5DY9 A;  3AT1 B;  2A28 A;  1MUZ A;  3VS4 A;  3HFO A;  4A54 A;  2RPN A;  2AZV A;  4QQD A;  2DL3 A;  3G71 Q;  1N8R C;  3TEE A;  3CMA Q;  1YIJ Q;  1VQ9 T;  1JEG A;  1PRL C;  3L2U A;  1PKS A;  4BE1 A;  3QBY A;  3CCJ A;  1X2Q A;  3RBB B;  2BTT A;  2EQJ A;  2RHX A;  3CME Q;  3CQT A;  1V1C A;  2CP6 A;  2FRW A;  1Q81 C;  2P0Q A;  4M7D A;  3KUF A;  3EH1 A;  3TSZ A;  4X1V A;  3PIO A;  2QAS A;  2YDL A;  5GAO l;  2CP0 A;  4UC4 A;  1AZE A;  5DM7 R;  3OMG A;  2KEA A;  4MDX A;  3G6E T;  1YJ9 T;  2CP5 A;  2WSC E;  3NTI A;  3U23 A;  3C95 A;  2JS2 A;  3JB9 G;  4IIM A;  2HAX A;  1R0C B;  1WZO A;  2RI2 A;  4J9F A;  2HKQ B;  3TCJ A;  2CUD A;  4FYY B;  1K8A C;  1VA7 A;  2YRC A;  3OW2 P;  4M77 D;  3FC3 A;  2JM9 A;  4JLI A;  5LL6 S;  1KD1 R;  2EYZ A;  4EMH A;  2X4Y A;  2MK5 A;  4OB3 B;  3QSU A;  1H64 1;  3L2V A;  2O4X A;  3JV3 A;  3R6O A;  3CCL Q;  1LPL A;  1QKW A;  4AG2 C;  2CDT A;  2M1H A;  2AIR B;  2X4J A;  1MMD A;  1AWJ A;  1WGS A;  1K1Z A;  4AFQ C;  1HYO A;  2AT1 B;  2EGC A;  1WQW A;  2AHJ B;  5GAM f;  1UGP B;  1OQK A;  1QQJ A;  4F7U F;  4JS4 A;  4L5G A;  2X4W A;  2I2L A;  4C8Q G;  3LWI A;  2MAM A;  4X34 A;  2DYI A;  1TUG B;  2V8I A;  4TVR A;  1RAI B;  1R8O B;  2RM4 A;  1EZZ B;  5IHN A;  1VQ6 A;  2X3W D;  2EFI A;  2ENM A;  5DLQ E;  1N9R A;  1VQ5 A;  1G8X A;  5LJ3 h;  4ZN3 A;  4KGV B;  3L2Q A;  3PNW C;  3GOX A;  1G3Y A;  3BDL A;  2PTK A;  2CSQ A;  2RQW A;  2RHY A;  2R57 A;  1BCO A;  5CQY A;  3OMC A;  3MJX A;  1UEB A;  1M5Q 1;  2EW3 A;  2K57 A;  3MHX A;  3EFO A;  2NUP B;  1UHC A;  1IRE B;  1TOV A;  2ZGW A;  4A4E A;  2V1R A;  1OPK A;  2FYK A;  1Y71 A;  3L42 A;  1OPL A;  3CC2 Q;  2VGM A;  1ZSZ B;  1D1C A;  1ZX6 A;  4MZT A;  2KRS A;  2K5I A;  5GAN d;  4M7A A;  2QXF A;  2ZAE A;  4HVW A;  4JJN K;  1QWF A;  1VQM T;  3MP6 A;  1VQK Q;  4PJO B;  4OMM A;  3EFR A;  4M77 B;  1WYX A;  2DE0 X;  1I07 A;  3FIF A;  4FW2 A;  2XDD A;  1M9S A;  3ZFJ A;  2QQR A;  2XDB A;  1A0N B;  2LX9 A;  2DXB A;  2X4X A;  2ZPE B;  2COW A;  3RNJ A;  3N5B B;  3P8H A;  2X35 A;  3HL8 A;  3G6E A;  1LVK A;  2RHI A;  5GAN j;  1FWZ A;  2HMA A;  1EIF A;  3NMZ C;  3CCV Q;  1TXQ A;  3JCM X;  2RK1 A;  4Z8A A;  4X9D A;  3I9Q A;  3M0S A;  3I55 Q;  3C0C A;  4NL2 A;  4C8Q C;  4LE9 A;  4PFP A;  2V8K A;  4XTV A;  1JJ2 A;  2KE9 A;  1TTH B;  3V8L A;  1UE9 A;  3HRU A;  1M1G A;  4PKC C;  4OMN A;  2RN8 A;  3UPU A;  1WI7 A;  3REB B;  3ZBD A;  1K9M U;  3HHT B;  2XK0 A;  2QQA A;  2MPX C;  3JB9 F;  4M7A G;  1T0H A;  3ZL7 C;  3VU3 C;  3CC4 A;  3OBW A;  2LQ8 A;  3A1P A;  2XKO C;  3PIP A;  3PGG A;  3E9F A;  2DK3 A;  1M8V A;  4C92 C;  3OS1 A;  3MEW A;  4M78 G;  3PMT A;  4E7S A;  1VQP T;  4LDU A;  3URG A;  3OYC A;  1MV3 A;  2CYZ B;  2J06 A;  2B8A A;  1MMG A;  3VYG A;  4ELY C;  5HY6 A;  2XID A;  1VIF A;  3NPF A;  3C12 A;  3A8M B;  6AT1 B;  1YI2 T;  3FJP A;  1U1S A;  4BY6 C;  1YHQ T;  1K73 C;  2DZ9 A;  2JMA A;  4PFZ A;  5J39 A;  4BDY A;  3QZ5 B;  2P4T A;  1AWW A;  5GAO r;  3HSB A;  4M75 G;  2JOY A;  3JB9 D;  3I56 Q;  1VYU A;  2VUB A;  3LWH A;  1VQL T;  2EJF A;  1MMN A;  1I5L A;  4QQ6 A;  1M90 U;  4VUB A;  4ZNX A;  4XTX A;  3QJ6 A;  1I4K 1;  4JRK A;  1SPK A;  3VS7 A;  2V26 A;  3MP1 A;  4CC4 B;  1JBM A;  4JJC A;  2L8D A;  1VQM A;  5FWC A;  3H9N A;  4ANJ A;  3MPU B;  1GCQ A;  1CSK A;  5KE2 A;  4C92 F;  1N8R R;  1PKT A;  3VRZ A;  3IQL A;  1NLO C;  4N0A A;  5LJ5 f;  3CD6 Q;  1ZUU A;  2R58 A;  2CKK A;  1WHM A;  4PK4 A;  2J05 A;  4RG2 A;  4C8Q D;  3EG2 A;  3EGX B;  4N4H A;  1Q81 R;  2RF0 A;  4JJB A;  4E7Z A;  2K6D A;  3LLR A;  5GMK e;  1JU5 C;  1YJW A;  5CO7 A;  1N27 A;  5CKF A;  4ORZ A;  4F04 B;  1FX7 A;  1Q95 G;  4KH1 B;  3NHN A;  2HQX A;  5KCH A;  4M78 C;  3M0T A;  2LJ3 A;  2LVM A;  1QVP A;  1VQ9 Q;  4C0F A;  3H41 A;  4LD9 K;  1M2O A;  1VYT A;  1C6V X;  2CP3 A;  1QVF S;  3OYN A;  2LNV A;  1AEY A;  4HA8 A;  3HKS A;  1K8A R;  1IB8 A;  2B86 A;  3FRN A;  4FYV B;  2L0A A;  5HCK A;  3WVD B;  2JTE A;  5I2S A;  1QVF A;  3ME9 A;  1EX4 A;  4J83 A;  1B3Q A;  3C94 A;  1E7O A;  4DEX A;  4KUL A;  4M75 C;  8AT1 B;  4WF2 A;  1YJ9 Q;  4M77 A;  4XK8 E;  1OX8 A;  2F2X A;  3O8V A;  1G5V A;  5A0L A;  4RG8 A;  1K76 A;  3LGF A;  4V2S A;  2PNI A;  1PCX A;  2DBK A;  2H3E B;  2X9H A;  2YRV A;  3SD4 A;  4N4I A;  1FYN A;  1NLP C;  3OYI A;  4ESR A;  5L8R E;  2O2O A;  4JZ3 A;  1ZUK A;  3DB4 A;  1W6X A;  1YJN A;  1YI2 A;  1LCK A;  1IGU A;  1YHQ A;  4JS5 A;  2CZ0 B;  4B9X A;  3CCE A;  5DLO A;  2E6N A;  4OF1 A;  4IUQ A;  3OYB A;  3CCS T;  5GMK h;  2EPD A;  1Q7Y U;  5IAY A;  2DNU A;  1Z9Z A;  8ATC B;  1PHT A;  4KUI A;  3G71 A;  2HSP A;  4O6J A;  3CC2 T;  2IIM A;  2E12 A;  3CMA A;  1YIJ A;  3LGL A;  3VS5 A;  3G4S Q;  4C8Q B;  1X6G A;  4PL6 A;  2JS0 A;  2VC8 A;  4DA4 A;  3GBQ A;  4HCZ A;  3CBP A;  3CME A;  2J6F A;  1M27 C;  2LQW A;  1VQK T;  3TVT A;  2FPE A;  2ZPH B;  1KFZ A;  3WVE B;  1YP5 A;  5AT1 B;  1M3B A;  3HPW A;  4M7A D;  4II1 A;  1O9S A;  1OYX A;  1WIE A;  2GTJ A;  4J9H A;  3CCV T;  1SKU B;  1XJW B;  5GAN 7;  3BE3 A;  1UJ0 A;  4M78 D;  3CCR T;  1UEC A;  4OMO A;  2ZPF B;  2IVW A;  3UT1 A;  4RTX A;  1B7T A;  2O4X B;  1GCQ C;  3VRY A;  1UG1 A;  4MML A;  2HD0 A;  4O5V A;  2LC4 A;  4BY6 B;  1WNL A;  4LN2 A;  4NL3 A;  3PVQ A;  2ZCF B;  3CCL A;  2BZY A;  2KMT A;  2G3R A;  4BE0 A;  4E7K A;  1C1A A;  3FB9 A;  4M75 D;  4JUV A;  1QWE A;  3PE0 A;  4QT7 A;  5J26 A;  2RJF A;  4OMQ A;  3E1S A;  4A4G A;  2HZY A;  3QHS A;  2RJC A;  3CXC P;  3J80 E;  1KG1 A;  4HXJ A;  1KIK A;  3HFN A;  3GNF B;  4FM4 B;  2LNH B;  3EFO B;  4F7U G;  3NFC A;  2E65 A;  2JW4 A;  1X6O A;  2VKN A;  1Q86 C;  3MP8 A;  2NLU A;  1R0B G;  1ZQ1 A;  4IIO A;  4D6W A;  2VYT A;  5FRO A;  4GLK A;  2EYY A;  1PWT A;  2QTV A;  1M1K U;  4AG1 C;  4FYX B;  1VQ4 T;  1VQ7 T;  1WJS A;  4F14 A;  2KYB A;  4A63 B;  4FSX A;  3THK A;  3G1J A;  2CZ6 B;  2GFA A;  5FU6 C;  5LJ3 d;  1ZSG A;  2RQV A;  4M7A B;  4FSS A;  4OP0 A;  2ATC B;  1D1B A;  2EYW A;  1NEG A;  3CC2 A;  1X6B A;  2HL5 C;  1RI9 A;  3GF5 A;  1K73 R;  4RKU E;  4M78 B;  2VGN A;  3JB9 H;  1M8M A;  1UB4 A;  5CAI A;  3MEU A;  3JCM Q;  1JQQ A;  2DIL A;  5LJ3 j;  1VQP Q;  4IUU A;  1VQK A;  3DLM A;  5FRM A;  4JZ4 A;  1FMW A;  2CSI A;  1G83 A;  1D09 B;  2D0Q B;  4E7L A;  2FZG B;  2GBQ A;  1AWO A;  1LJO A;  1YHQ Q;  3UA6 A;  4PJJ A;  1K4U S;  1X43 A;  2LJ1 A;  3V8J A;  2M16 A;  1P92 A;  3CCV A;  1WFW A;  2RNA A;  4M75 B;  1BIB A;  4E7I A;  4JPB W;  1RL2 A;  1CKB A;  2KRM A;  3I55 A;  3BDU A;  1D0X A;  1Y96 A;  1VQL Q;  1WDX A;  4ZGD B;  1LOJ A;  2D0N A;  2RMO A;  1I8F A;  3E2U A;  5IH2 A;  2PU9 B;  3VUZ A;  4NOY A;  1BYM A;  1KHC A;  5CK9 A;  1N6A A;  2DPP B;  3E9G A;  3CCM Q;  1TS9 A;  1D0Y A;  3MO8 A;  3I5S A;  4XU2 A;  4PJO E;  4AFS C;  4BI8 B;  4JLG A;  4C8Q A;  2EGA A;  1UGR B;  2CP7 A;  2R5A A;  1YBY A;  2Y90 A;  1WHH A;  1KK7 A;  5I22 A;  1KD1 U;  1YFN A;  5GAN f;  3QDF A;  4X9C A;  2HL3 A;  2RQT A;  2QDY B;  3OYD A;  1YIT T;  2LCS A;  4C0D C;  5IXB A;  4LUD A;  1OZ3 A;  4E2F B;  4ATO A;  1BB9 A;  1K0S A;  1NE8 A;  4J6X A;  2JXB A;  3QKJ A;  2BUD A;  3SWN C;  2NWM A;  4C92 A;  5KYX A;  2L3R A;  1AT1 B;  2JT4 A;  1U1T A;  5A0D A;  2QGG A;  1WHJ A;  2XI9 A;  3I56 A;  2ESW A;  2PZ1 A;  3LX7 A;  2LJ0 A;  1M4Z A;  1JB0 E;  3DB3 A;  4RTZ A;  2E3I A;  3EFS A;  4KRT A;  1NPR A;  1Q82 C;  2L3P A;  3BW1 A;  1BU1 A;  2MOX A;  5D7U A;  3G4S T;  2H8H A;  2RH2 A;  5GJV B;  3VV0 A;  1BI3 A;  4XU3 A;  3M0P A;  1BCM A;  3NGP A;  3OYG A;  2P84 A;  3LW5 E;  3EG0 A;  3H0F A;  1W2B S;  1MHN A;  2QQB A;  2ED1 A;  2XG8 D;  4L59 A;  4MZP A;  5CR2 A;  3CD6 A;  2COZ A;  5KCO A;  2C06 A;  1U8R A;  4J9E A;  1W2B A;  2L3S A;  1HSQ A;  3OB9 A;  3NTH A;  5IHI A;  2EJG A;  2RI3 A;  3KBG A;  3MET A;  3CCS Q;  4C92 G;  2YRD A;  1G3T A;  1NEB A;  3FLG A;  3HP9 A;  3QYH B;  5GAM g;  4IUP A;  1T0J A;  3VKI A;  1E6H A;  2BE9 B;  1WLP B;  4KH0 B;  4RTT A;  1VQ9 A;  3M58 A;  1I5O B;  3JCM f;  3EGD B;  4WCI A;  1ZA1 B;  5GMK m;  1S72 T;  3RER A;  2HQE A;  3V7S A;  3SB2 A;  4PJN A;  1X75 C;  3M57 A;  1MV0 B;  2NUZ A;  1SSF A;  1QVG P;  4M78 A;  1H92 A;  3T9N A;  2GFU A;  2GGR A;  1BKB A;  2F5T X;  4R56 A;  2DL7 A;  1YJ9 A;  3CBM A;  1W1F A;  5C0M A;  4FCY A;  3CCR Q;  5FW9 A;  1PNJ A;  2A3L A;  1KQS S;  2YUP A;  5GAN 2;  3JCM W;  4J9C A;  4DOW A;  2K3Y A;  1KC8 C;  2DAQ A;  1WXU A;  2PVO B;  2RD1 A;  1PSE A;  3JCM g;  4M75 A;  4Y28 E;  1GCP A;  5ECA A;  3PMI A;  5GAN 6;  1KQS A;  5CQX A;  1Z9Q A;  3CCU T;  2EQU A;  2DYB A;  2XDP A;  2P0K A;  3M5A A;  1VQN T;  2KQW A;  4J6Y A;  3R6N A;  1NJI C;  1I81 A;  1XTD A;  2EYX A;  1GRI A;  4XAX B;  1IHW A;  4YTL A;  3M0Q A;  1Q86 R;  2DEU A;  3VS0 A;  1TUC A;  2EQK A;  3G4S A;  2VXE A;  3UDC A;  2JUF A;  2DMO A;  2LTO A;  1VQ8 Q;  4IKF A;  2F5K A;  5CKB A;  4F7U B;  4QVC A;  4D8K A;  3A98 A;  5GMK j;  1IXD A;  1KHI A;  4QVZ A;  4BUG A;  2FRY A;  3PVL A;  2M51 A;  4MZM A;  1VQ4 Q;  2E10 A;  1VQ7 Q;  1ZBX A;  4DBR A;  1J3T A;  3EHR A;  4JJD A;  1PSF A;  2MWP A;  3V7C A;  1UHF A;  4OMF B;  1N8R U;  4XTY A;  2Y4X A;  4M7D E;  2EKH A;  4XU1 A;  2M0Y A;  4C8Q E;  1M3A A;  2NYS A;  3OQ5 A;  3CCM T;  1D3B B;  1N5Z A;  1QCN A;  3SWN B;  2OAW A;  3EGU A;  2KNB B;  1YNZ A;  4OVA A;  3UWN A;  2E4H A;  3EAE A;  1Q81 U;  3RUX A;  2JTM A;  1UGV A;  2C0I A;  2BE7 D;  3FJ5 A;  2GQI A;  2DZC A;  2CP2 A;  2A7Y A;  1K9A A;  2CGH A;  2FPF A;  3M59 A;  9ATC B;  1T3S A;  3OSS C;  5GAO p;  4DBF A;  3D7S B;  3CC7 Q;  1G2B A;  4BI4 A;  4Y91 A;  5GAM e;  2DXU A;  1WPY A;  2DX1 A;  1B34 B;  2LDM A;  4QW2 A;  4RCC A;  1K8A U;  1BI1 A;  4RTV A;  1V76 A;  4EMK C;  2KSS A;  4M4Z A;  1WA7 A;  3P8B B;  3QDR B;  1QCO A;  3NTK A;  4RUG A;  4JDS A;  2A36 A;  3CPW S;  3M54 A;  2DRK A;  2BIV A;  4C92 D;  2O9V A;  4PJL A;  4RCB A;  3PFS A;  1U06 A;  3GP8 A;  2LQK A;  3E19 A;  1WHG A;  3EGD A;  5LJ5 g;  1JO8 A;  3RES A;  5GJW B;  3CPW A;  2JN0 A;  2DF6 A;  2M0O A;  4NS5 A;  5FRN A;  1UJY A;  1VQO T;  1VQP A;  2AZS A;  2LZ6 B;  3OYH A;  1YIT Q;  4JRP A;  1W70 A;  4J9G A;  3JCM e;  1JJ2 P;  1Q82 R;  1H3Z A;  2W0Z A;  4KBM B;  1Y96 B;  5C6S A;  1WHK A;  5GAM h;  1TSF A;  2LP5 A;  3CCQ T;  4MDW A;  4OGC A;  1BIA A;  1MND A;  3H8Z A;  3MCA B;  1WHL A;  5EC7 A;  1VQL A;  4ME7 A;  5HKC A;  4M7A E;  1NG2 A;  2EWN A;  3QPH A;  4RTY A;  1SRL A;  1U5S A;  3VJP A;  3SDZ A;  1YCS B;  1NPP A;  1PD0 A;  4C5H A;  2E41 A;  2FL7 A;  1BI2 A;  3CCM A;  1OUL A;  2RO0 A;  1WXT A;  4A4H A;  1RAD B;  5LJ3 f;  2E1H A;  1RAF B;  2RI5 A;  2RB6 A;  2MCN A;  1AWX A;  3ULR B;  4E7H A;  4HT9 A;  1XNI A;  2DRM A;  2PUK B;  2ABL A;  4HCB A;  1G3W A;  1UTI A;  7AT1 B;  5A0G A;  2IG0 A;  4C5G A;  2FHD A;  2OAU A;  4F7U A;  1GBQ A;  5IHK A;  1RAC B;  2OTJ T;  4C92 B;  5KYX B;  3JCM h;  2E6Z A;  2ZPG B;  3UF4 A;  1QCF A;  3X28 B;  2FPD A;  5D6W A;  2EAY A;  3RDV A;  2JZ2 A;  2AKK A;  1QMC A;  4BAC A;  4ZTF A;  3EG9 B;  3A8L B;  4D8D A;  2DIQ A;  2K79 A;  5HK3 A;  3OYK A;  2KAF A;  3LH0 A;  3OW2 S;  1QP3 A;  2DTO A;  3RKX A;  1IGQ A;  4B6M A;  2HBW A;  1Y0M A;  1S72 Q;  2ROL A;  2O01 E;  2EQI A;  4HVU A;  3SEM A;  1JXO A;  1KC8 R;  2MWO A;  2DFU A;  1D3B A;  1ABQ A;  1RAA B;  4ZTJ A;  3SWN A;  3OW2 A;  4DOV A;  4C0Z A;  4LDY A;  1RAE B;  2QQS A;  1EFN A;  3CCJ T;  1VQ8 T;  3ZEH A;  1D1A A;  5D6X A;  4QVD A;  5GAO q;  1HXD A;  1NJI R;  4J9B A;  2G6F X;  2VAS A;  3C4S A;  2QEX Q;  2RQR A;  2QYZ A;  1F1B B;  4E7J A;  1ZLM A;  3GNG A;  5CCA A;  2K2V A;  1AVZ C;  4BD3 A;  3A8H B;  5KYU A;  2K5F A;  4FW1 A;  3L1A A;  4HCK A;  2D8H A;  1K73 U;  3M53 A;  2A0F B;  1B34 A;  1QLY A;  1WQ7 A;  3M55 A;  3QII A;  1OU8 A;  3CCU Q;  3CCS A;  2O31 A;  4J9I A;  1VQN Q;  3J81 E;  5LJ5 e;  1MGQ A;  1ZSZ C;  2SRC A;  1QVF P;  4KGX B;  2EJ9 A;  1M2V B;  1K0X A;  2VV5 A;  4OGE A;  2L3Q A;  1FMK A;  3CEY A;  1LNX A;  4EMK B;  2KI7 A;  4PJO C;  3Q1J A;  5GMK l;  2LX7 A;  4L6V 5;  2EYQ A;  1K9M C;  3WXM B;  4FT2 A;  2ZPB B;  3UA7 A;  3AHU A;  2FZK B;  2DD4 A;  2D9T A;  4OB0 B;  4A53 A;  4XQ3 A;  1WJR A;  1I0C A;  3S3N A;  4Z02 A;  5D6Y A;  4C5I A;  4C0G A;  4B9W A;  2LT1 A;  1G3S A;  4J5Y A;  3CC7 T;  1QVG S;  2O9S A;  5I2M A;  3CCR A;  4OMP A;  3GIB A;  2GNC A;  4GY5 A;  2DEQ A;  1RAH B;  1SHG A;  1WX6 A;  2QDL A;  2Y4Y A;  1VQ5 T;  3F70 A;  3OSV A;  3M0U A;  3HRS A;  4PJM A;  1QVG A;  1BBZ A;  1VOM A;  4AT1 B;  1PC0 A;  4CC7 A;  4EIK A;  1I1J A;  2CT4 A;  1SEM A;  5LJ5 h;  2QGF B;  1VIE A;  1AZG B;  2NUT A;  5IN1 A;  3BFM A;  2HNI A;  3S3M A;  2E3H A;  2JTF A;  2JJ9 A;  4M77 E;  2FB7 A;  3DLL A;  2OI3 A;  4PJO F;  1M90 C;  2A37 A;  1PG5 B;  4M77 F;  2RK2 A;  2K3B A;  2EVR A;  1AOJ A;  4XTU A;  2HSE B;  4WTO B;  2OJ2 A;  4BE2 A;  1VQ8 A;  1PRM C;  2LMJ A;  4E47 A;  2KXC A;  3BY7 A;  2EBP A;  1GFD A;  2CS7 A;  4EDU A;  1ZA2 B;  2E70 A;  2K3X A;  5LJ3 e;  2EIF A;  5GAN 3;  2DXT A;  3KXT A;  2KK4 A;  2HQH A;  1ZHI A;  2HEQ A;  1RAG B;  1VQ4 A;  2RHZ A;  2WAC A;  1VQ7 A;  4HCC A;  1Y7X A;  1NYG A;  3QZ9 B;  2DER A;  4RTW A;  4PJO D;  1KQ1 A;  3EG9 A;  3PTA A;  2J7I A;  4KT0 E;  2QA4 Q;  5GAN g;  4DQ2 A;  4XTW A;  4Z88 A;  3VS6 A;  3DKM A;  5GAO n;  1W4S A;  5FU7 C;  3PT9 A;  3MKD A;  2EQM A;  1RLQ C;  1UGS B;  1M30 A;  1VQO Q;  2E64 A;  2PQW A;  2YWW A;  3JCM V;  2ZZD A;  4J7I A;  2PVD B;  5GMK i;  2K7A A;  4F7U E;  1BK2 A;  2MI6 A;  2QQ9 A;  2XD0 A;  3CC4 T;  4M7D G;  1SSH A;  2RA2 A;  1XQH A;  2QAZ A;  3JB9 J;  5KYW A;  4XTZ A;  2CH4 W;  3O5Z A;  2O88 A;  3EG3 A;  3CC7 A;  3SHW A;  2F2V A;  3CCQ Q;  5I21 A;  5L23 A;  2FO0 A;  3OYY A;  1XOV A;  3UAT A;  1X27 A;  2HDA A;  3I35 A;  4FYW B;  1TU0 B;  2DTH A;  2KGT A;  3A5Z B;  3V8K A;  1OEB A;  4FU6 A;  5I11 A;  2SEM A;  3CBO A;  2KDS A;  1MNE A;  2AK5 A;  2KR3 A;  3QWY A;  4AFZ C;  2YUN A;  1M2V A;  1Q7Y C;  5KYN A;  4JRI A;  2WSF E;  3G7Z A;  1OV3 A;  1SG5 A;  1YWO A;  5FU6 B;  4EMK A;  1RI0 A;  4BDZ A;  2D8J A;  4Q5W A;  1O75 A;  2VWF A;  2DET A;  1B07 A;  2CRE A;  1CKA A;  1RAB B;  3JRZ A;  3QYG B;  2QEX T;  4CC2 A;  1YIT A;  2OTL Q;  2DM1 A;  4QQG A;  2OTJ Q;  4F16 A;  4BB7 A;  2L5Q A;  2QTX A;  1OI1 A;  2YUO A;  2F1L A;  1Q86 U;  5CKD A;  1U3O A;  2MYS A;  2E5Q A;  3OS5 A;  1KQ2 A;  3I5R A;  1JJ2 S;  3OA6 A;  1Y07 A;  4E6R A;  4F17 A;  5M9O A;  3OY9 A;  3L2W A;  5CVI A;  1M3C A;  3REA B;  4OB2 B;  1YJW T;  4M7D C;  1H8K A;  4PLI A;  1VUB A;  2BZ8 A;  2LCC A;  2M9U A;  5GAN 4;  5GAM d;  1KSW A;  3RMS A;  3CCJ Q;  3QXE B;  1IZ6 A;  1GL5 A;  2ED0 A;  3INZ A;  1H3H A;  1RUW A;  2WSE E;  3OYL A;  2F2W A;  4FIB A;  2RHU A;  5GAO m;  2W10 A;  1T3L A;  2GQV A;  2CUB A;  5GAM j;  2V1Q A;  3X26 B;  2DVJ A;  2E5K A;  2DXC A;  1ARK A;  2DD5 A;  5CIU A;  4KUD K;  3QJY A;  3L2R A;  1FMV A;  1GXI E;  1K9M R;  3VS3 A;  4FT4 A;  2KRO A;  2JVV A;  5KYY B;  4PLL A;  4LUE A;  4MMK A;  5GAN e;  4LDX A;  2AKL A;  1HD3 A;  3TSW A;  4C0D B;  1OZ2 A;  2F69 A;  1YJN T;  4R0K A;  1JXM A;  4LNP A;  3X20 B;  2KYM A;  4HT8 A;  1BI0 A;  3CCE T;  3FEO A;  1M1K C;  3RIR A;  3M9Q A;  1MMA A;  4M7D F;  3JCM d;  5CKE A;  4C8Q F;  1R77 A;  2OX7 A;  1PM3 A;  1S72 A;  3OYE A;  3J7A F;  2KT8 A;  1M1F A;  5CKH A;  3G71 T;  4Z89 A;  5KH6 A;  3TU4 K;  3CMA T;  1YIJ T;  2FZC B;  1X2K A;  4LD6 A;  4EPC A;  1W2B P;  2CH4 A;  2RJE A;  5KE3 A;  2A08 A;  2XU8 A;  4FL6 A;  3CME T;  1UGQ B;  2R5M A;  5KYU B;  3LYI A;  5FU7 B;  2DVE A;  2J6K A;  2QEX A;  4C92 E;  1VQ6 Q;  2DBM A;  2X51 A;  3MEA A;  4IUV A;  1VQ5 Q;  1TUD A;  5GAN 8;  1M90 R;  3CXC S;  2MF2 A;  3H0I A;  1SHF A;  2YLB A;  3EHQ A;  2FVU A;  4M7D D;  3H6Z A;  2CT3 A;  1NBE B;  3CCU A;  3OS2 A;  3OYM A;  4M7A C;  2XIC A;  2QI2 A;  1PD1 A;  1OX9 A;  3JCM c;  3CXC A;  5GAN h;  1VQN A;  1D0Z A;  2YXY A;  2GCX A;  5FWB A;  3LH5 A;  3VYH B;  2QA4 T;  2YUQ A;  4GBQ A;  2NUP A;  4J8O A;  1Q82 U;  2BKD N; 
#chains in the Genus database with same CATH homology
 4LE9 A;  2DLP A;  2EGE A;  1BB9 A;  1K0S A;  4CC3 A;  2YT6 A;  4J9D A;  4J9B A;  2G6F X;  2KE9 A;  2RQR A;  1UE9 A;  2HCK A;  1ZLM A;  2JXB A;  4OMN A;  1NM7 A;  2RN8 A;  2NWM A;  3VS1 A;  1AVZ C;  1WI7 A;  2I0N A;  3REB B;  2C0T A;  4HCK A;  2D8H A;  2JT4 A;  1QLY A;  1TG0 A;  1T0H A;  2ESW A;  3ZL7 C;  2PZ1 A;  2LJ0 A;  2O31 A;  4RTZ A;  3QWX X;  4J9I A;  2VVK A;  4KRT A;  2LQN A;  2L3P A;  2SRC A;  1HJD A;  1BU1 A;  2MOX A;  2H8H A;  1K0X A;  5GJV B;  1NYF A;  1S1N A;  1MV3 A;  2L3Q A;  1FMK A;  1ZUY A;  2J06 A;  3M0P A;  3NGP A;  4HVV A;  3NPF A;  3EG0 A;  3H0F A;  2K2M A;  1RLP C;  2LX7 A;  2ED1 A;  1Y57 A;  3UA7 A;  2JMA A;  1KJW A;  1OOT A;  2DJQ A;  2X3X D;  1I0C A;  2FEI A;  2JM8 A;  4AFU C;  1AWW A;  4J9E A;  1GBR A;  2L3S A;  1HSQ A;  5IHI A;  3VS2 A;  1VYU A;  2DL8 A;  2O9S A;  1NEB A;  2GTO A;  4OMP A;  4ZNX A;  1YWP A;  2C0O A;  2GNC A;  3KFV A;  1T0J A;  1E6H A;  1SHG A;  1WX6 A;  2QDL A;  1SPK A;  3VS7 A;  1WLP B;  4RTT A;  4CC4 B;  4JJC A;  3M0U A;  1UDL A;  5FWC A;  1BBZ A;  1GCQ A;  2KRN A;  4WCI A;  1CSK A;  4CC7 A;  4EIK A;  1I1J A;  2CT4 A;  1SEM A;  2YSQ A;  1PKT A;  3VRZ A;  3IQL A;  4DEY A;  1NLO C;  1MV0 B;  1AZG B;  2NUZ A;  1H92 A;  1ZUU A;  1QKX A;  1AD5 A;  2J05 A;  2GGR A;  1SRM A;  3EG2 A;  2K9G A;  2OI3 A;  2A37 A;  2DL7 A;  2RF0 A;  4JJB A;  2K3B A;  5IXF A;  2K6D A;  1JU5 C;  1UUE A;  1AOJ A;  2EVR A;  1W1F A;  4ORZ A;  4OML A;  5FW9 A;  2OJ2 A;  1PNJ A;  2YUP A;  3NHN A;  1PRM C;  1ZBJ A;  2LMJ A;  4J9C A;  1IO6 A;  2KXC A;  2KBT A;  2LJ3 A;  3M0T A;  2L2P A;  3H41 A;  1WXU A;  1VYT A;  2KXD A;  4GLM A;  2EBP A;  1GFD A;  1GCP A;  5ECA A;  3H0H A;  1Z9Q A;  1AEY A;  4K11 A;  2B86 A;  2DYB A;  2HEQ A;  3EG1 A;  3R6N A;  2D1X A;  2L0A A;  5HCK A;  2DA9 A;  2FG0 A;  2JTE A;  2EYX A;  1GRI A;  1B3Q A;  1NYG A;  1X69 A;  3M0Q A;  1E7O A;  1WXB A;  4DEX A;  4RTW A;  3VS0 A;  1TUC A;  2J7I A;  2DL4 A;  2F2X A;  2J6O A;  2XMF A;  1K76 A;  2PNI A;  2DMO A;  2DBK A;  4Z88 A;  3VS6 A;  1FYN A;  1NLP C;  2DL5 A;  4ESR A;  2O2O A;  4JZ3 A;  1UFF A;  1ZUK A;  1RLQ C;  1W6X A;  1M30 A;  1LCK A;  4D8K A;  2P4R A;  3A98 A;  2K7A A;  4Y92 A;  1BK2 A;  2JMC A;  1GFC A;  2MIO A;  2BZX A;  1YN8 A;  1ABO A;  1VYV A;  2EPD A;  3M0R A;  2FRY A;  3PVL A;  2M51 A;  1SSH A;  2DNU A;  1Z9Z A;  2ECZ A;  1J3T A;  1PHT A;  2CH4 W;  3O5Z A;  2O88 A;  2HSP A;  2RQU A;  3EG3 A;  3SHW A;  2IIM A;  2F2V A;  3EHR A;  4JJD A;  3VS5 A;  1E6G A;  5L23 A;  1UHF A;  1X6G A;  2FO0 A;  1XOV A;  2JS0 A;  2ROT A;  4RTU A;  3UAT A;  1X27 A;  2HDA A;  2EKH A;  3GBQ A;  3I35 A;  2KGT A;  2M0Y A;  2J6F A;  1M27 C;  2LQW A;  1M3A A;  2KT1 A;  1OEB A;  3TVT A;  5I11 A;  2FPE A;  1N5Z A;  2SEM A;  2OAW A;  3EGU A;  2KNB B;  1YNZ A;  2AK5 A;  1KFZ A;  1YP5 A;  2KR3 A;  3QWY A;  1M3B A;  1UGV A;  4AFZ C;  2C0I A;  2YUN A;  3FJ5 A;  2GQI A;  1WIE A;  2GTJ A;  1OV3 A;  4J9H A;  1K9A A;  2FPF A;  1YWO A;  1UJ0 A;  1UEC A;  2A28 A;  1MUZ A;  1T3S A;  4OMO A;  3VS4 A;  2D8J A;  2RPN A;  2AZV A;  4RTX A;  2DL3 A;  1G2B A;  2VWF A;  1GCQ C;  1JEG A;  1B07 A;  1PRL C;  2DX1 A;  3VRY A;  2CRE A;  1PKS A;  1CKA A;  1UG1 A;  4RTV A;  1X2Q A;  4CC2 A;  2DM1 A;  3RBB B;  4F16 A;  2BTT A;  3CQT A;  1V1C A;  2FRW A;  4M4Z A;  4LN2 A;  3PVQ A;  1WA7 A;  2BZY A;  2YUO A;  3TSZ A;  4X1V A;  2YDL A;  1U3O A;  4RUG A;  1AZE A;  4QT7 A;  1QWE A;  3PE0 A;  2A36 A;  3I5R A;  4F17 A;  4E6R A;  2KEA A;  1M3C A;  4OMQ A;  3REA B;  2DRK A;  2O9V A;  3U23 A;  1U06 A;  2JS2 A;  4IIM A;  1H8K A;  1JO8 A;  4J9F A;  2CUD A;  5GJW B;  1VA7 A;  2BZ8 A;  4HXJ A;  2DF6 A;  1KIK A;  1UJY A;  2JM9 A;  1KSW A;  2LNH B;  2AZS A;  2EYZ A;  2LZ6 B;  2JW4 A;  2VKN A;  1GL5 A;  2ED0 A;  4IIO A;  1W70 A;  4J9G A;  1H3H A;  1RUW A;  3JV3 A;  2EYY A;  1PWT A;  2W0Z A;  4AG1 C;  1QKW A;  4AG2 C;  2F2W A;  2CDT A;  2W10 A;  4F14 A;  2KYB A;  1T3L A;  1AWJ A;  2CUB A;  4A63 B;  3THK A;  2V1Q A;  1K1Z A;  4AFQ C;  2DVJ A;  2LP5 A;  2EGC A;  1ZSG A;  2E5K A;  1ARK A;  2RQV A;  4FSS A;  2EYW A;  1NEG A;  1X6B A;  3VS3 A;  5EC7 A;  2KRO A;  1RI9 A;  1NG2 A;  4LUE A;  4RTY A;  1SRL A;  1U5S A;  1YCS B;  2AKL A;  1HD3 A;  3TSW A;  5IHN A;  1M8M A;  2X3W D;  4R0K A;  1JQQ A;  1JXM A;  2DIL A;  4LNP A;  2ENM A;  2KYM A;  1WXT A;  4JZ4 A;  2CSI A;  1G83 A;  2PTK A;  2CSQ A;  2RQW A;  2MCN A;  1AWX A;  3ULR B;  2GBQ A;  1AWO A;  2EW3 A;  2DRM A;  2ABL A;  2KT8 A;  1UHC A;  3UA6 A;  1K4U S;  1X43 A;  2LJ1 A;  1UTI A;  4Z89 A;  1WFW A;  2RNA A;  2V1R A;  1OPK A;  1X2K A;  1OPL A;  4JPB W;  2CH4 A;  1CKB A;  2KRM A;  2A08 A;  1GBQ A;  5IHK A;  1WDX A;  1ZX6 A;  3UF4 A;  2KRS A;  1QCF A;  2D0N A;  2RMO A;  5IH2 A;  2FPD A;  2J6K A;  2DBM A;  2AKK A;  4HVW A;  1QWF A;  1TUD A;  4OMM A;  3H0I A;  4D8D A;  1SHF A;  1WYX A;  3EHQ A;  3I5S A;  2DE0 X;  2K79 A;  1I07 A;  4AFS C;  1A0N B;  3RNJ A;  2EGA A;  2CT3 A;  2HBW A;  1Y0M A;  2ROL A;  2EQI A;  4HVU A;  3SEM A;  3NMZ C;  1JXO A;  5I22 A;  1ABQ A;  4Z8A A;  2RQT A;  5FWB A;  3LH5 A;  3I9Q A;  3M0S A;  1EFN A;  2YUQ A;  4GBQ A;  3C0C A;  2LCS A;  5IXB A;  4LUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...