1CSQA

Crystal structure of the bacillus subtilis major cold shock protein, cspb: a universal nucleic-acid binding domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
67
structure length
67
Chain Sequence
b'MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLD SHOCK PROTEIN B(CSPB)
publication title Universal nucleic acid-binding domain revealed by crystal structure of the B. subtilis major cold-shock protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulation
total genus 9
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1993-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1csqA00
4UP9A 1WI5A 2E5LQ 1E24A 3H0GH 4BA2I 1L1OA 1IYJB 1K73C 1N32Q 1OXSC 3FKIH 3CF5A 5GAHC 3M3YH 2Z6KC 4BXXH 3KOJA 1HNWQ 1I3QH 1L0WA 3T1YL 1UE5A 5IP7H 5IYCG 2UXBQ 3CAMA 3H0GG 2WB1E 2K5HA 5C4XH 1VQCA 5K36G 4HIDA 5IYBG 3JAMc 3M4OH 1YHBA 4IOAA 4B3RQ 4K0KL 3RLFA 2NVXH 4A3EH 1Y1VH 2VQEQ 1I94Q 1P8LA 4JYAQ 1YVCA 2K52A 3K8AA 1KC8C 5IWAL 1EIFA 2OWOA 5GADC 4X66Q 1DGSA 1G6PA 2YV5A 4X64Q 4HJ9A 1Q82C 4MTNA 4GKKL 1Q1BA 2B63H 1HZBA 1Y1VG 2I5LX 1H95A 2PI2A 2ALYB 4YCWA 3ULLA 3CCMA 5ELOA 1VQIA 3U4VA 1YJNA 1PH1A 4BY7H 2NN6G 2Q2HA 4C3IH 4DUZQ 4DAMA 3ICEA 3U4ZA 1V1QA 1PVOA 3G6EA 4JI6Q 4ME3A 2B63G 3S16H 4LF8Q 3GO5A 1WJJA 3J80i 1TWFH 2NVTH 1C0AA 4RG1A 3K81C 3TEHB 4LFBL 3S2DH 3J81j 4IFDI 1O7IA 2HHHL 4OO1I 2N78A 4C3HH 4DR7Q 3T1YQ 5HGQA 1I50H 2L15A 1UWVA 3E0EA 2JA8H 1YI2A 2WP8J 3E9IA 3EIVA 5M3MH 1BVSA 2BA0A 3KDFB 1Y14B 1YBYA 3W5OA 4LF6L 4P72A 4A3MH 5C0XJ 4LF9L 2KHJA 1SMXA 4P74A 4DV6Q 2R7ZH 3U50C 3S1MH 4YHHL 4Y52H 4Y7NH 4R4TA 1XNRL 1LTLA 1GO3E 2JA6G 4GKKQ 4DV4L 2CWPA 3L0OA 2YTVA 1WFQA 2IX0A 4QJFA 3FHWA 4DR6Q 4JBMA 4A3GH 1D8LA 4UY8C 3GTOH 2HIXA 1VQMA 1UE1A 4LF4L 1NTGA 3KDFA 4YY3L 5M3FH 3PGZA 5LMNQ 1YHQA 2HT1A 2K5NA 4KHPL 2NZHA 1JMCA 4A3JG 2ZJQA 4OX9Q 4IPCA 5GQOA 5JJKA 3CPWA 3Q8DA 3RN5A 1VQ6A 2N3SA 1EYGA 3OTOL 4LFBQ 4HIMA 1NE3A 1HJPA 5AJ3Q 2HHHQ 1UEBA 1I6HH 2VZAA 2JEAI 5JJLA 1A63A 2ZJRA 1QZGA 1X3FA 1X54A 2KCMA 2OCEA 4A3BH 4PZ7A 3L2PA 4BBSH 2EQSA 3PUZA 1N36L 2GN5A 3HKZG 4JOIC 1FL0A 4R4QA 4IJHA 2B3GA 3KF6A 4LF9Q 1NY4A 2K14A 1LYLA 3GTPH 4JI1L 3S17H 4AYBG 4YHHQ 4BBSG 1XNRQ 1HNZL 1KHIA 4BY1G 1SRUA 4GLXA 4DV4Q 2VQFL 1KRSA 4YCVA 2PMZE 3ER0A 1YEZA 4JI5L 4C2MH 2IY5B 1JJGA 4LNQA 1SFOH 2GVBA 4B3ML 2MO1A 3BU2A 5M5XH 1YNXA 5H1SE 4YY3Q 4POGA 1X55A 4KHPQ 3I4MH 1L2FA 5E7NA 3CC7A 3TS0A 2JA5G 1P16A 2BA1A 1U5KA 3CCSA 2EIFA 3OTOQ 3CCQA 5IP9H 4JBWA 2VNUD 1VQEA 2VUMG 4A3IG 2F4VQ 3DLLA 5JEAG 1X6OA 1EUJA 1G291 2WAQG 2YTXA 3NENA 5ELNA 4POFA 4GOPA 2R7DA 4DR5Q 3BZCA 1OXXK 2Y0SE 2DUDA 4IPHA 5GAEC 1IBKQ 4DR2Q 4PZ6A 1PH8A 3S1QH 1PH7A 4A76A 3J7A5 4HJ7A 2KHIA 1FGUA 2Z6KA 1IBML 1CKNB 3A5UA 3PF4A 1M90C 4A93G 2AWNA 1GD7A 1KIXA 5IYDH 1HNZQ 2N49A 2UUAL 4JI5Q 4ALPA 4A4IA 2Q2TA 3PIOA 4B3MQ 1TXYA 4OWWB 2JA9A 1YHAA 3HOXG 3PO3G 1IXRA 2ASBA 3JC66 2R7FA 4BBRG 1VQNA 4A3DH 1IBLL 1GKHA 4JI8L 3M7NA 3F1ZA 1Z47A 3W1GA 2R93G 4KI0A 2UUBL 4IPGA 4R4OA 5IE8A 4JI3L 1VS0A 3GTKH 4A3DG 4MZ9A 4GN4B 4JI0L 5HY6A 4LW1A 1N8RC 1VQBA 1PH6A 4A3LH 3RLOA 5JEAJ 4L5QA 1I5FA 3PUYA 4NPSA 1K9MC 5LMUQ 1YJ9A 4GKJL 2JA7H 1K8GA 3FKIG 2KENA 2MO0A 3CC2A 4A3FH 4BXXG 5C0XG 3PUWA 5IP7G 3GTLH 1MJEA 4LFAL 2OQ0A 4DUYL 4C3JH 2UXCQ 5C4XG 4DV0L 2K4KA 1PH2A 1VQKA 3MXNB 3W1BA 4A3EG 2IHFA 1K3RA 3A0JA 3PCOB 3PV0A 4WJ3M 3RNUA 4QL5A 1XMQL 2PNHA 1PH5A 3HOWH 4EQ5A 2UUCL 4DV2Q 2QEXA 3HOZH 4GNXC 2NVYH 1YJWA 1KL9A 4IFDJ 1XJVA 3H15A 4EX5A 4BY7G 1NBWA 3U58A 4HJ5A 4DK6C 2UU9L 2LXKA 3HOWG 4GN3B 2E2HH 1S72A 1VQDA 3I7FA 3NBHB 4H02A 4JI0Q 2D0OA 3I4OA 4DK3C 2E8GA 4UP7A 4DV7L 3JAMi 2MNAA 4IO9A 4L5SA 4K0KQ 4IOCA 4A3KH 4JI7L 2CWAA 2LSSA 3T1HL 1K8AC 4DR1L 3PSIA 2K5VA 2JA8G 5IWAQ 1VQAA 1Q86C 2IHEA 4LFAQ 3F2CA 5C44H 1PH3A 4XTCS 5M3MG 1PA6A 1B7YB 3KLWA 1TWAH 1QZHA 4A3KG 3HOVH 5JJIA 2RCNA 1HR0L 1ASYA 1SROA 3ERSX 3PUVA 4JOIA 4O2DA 4P71A 1UE7A 4DV5L 4A3MG 2R7ZG 2DGYA 3NEMA 3CPFA 1XMQQ 1NMFA 1E7ZA 4LFCL 3AFPA 4YWKA 2UUCQ 4QIWE 2CCZA 1XNQL 2AHOB 4A3GG 3GD7A 4LUZA 2VS1A 1TWGH 2XGTA 3K7AH 2UU9Q 2UXDL 3TQYA 5M3FG 5BR8L 1Y1WH 1QUQB 1BBUA 3A5ZB 2OTLA 3H3VH 3HOUH 2I0QA 3PUXA 2AMCB 3S1NH 2N8NA 3UE0A 1KQSA 4JI7Q 4YWMA 4DR4L 3T1HQ 2B29A 3RZDH 2ZTCA 4LF6Q 4JI6L 4JI2L 1OXUA 1QVGA 4DKAC 4JC0A 4A3BG 1Z9FA 3G71A 1QUQA 1E1TA 1EFWA 1PYBA 2NN6I 1VQFA 5FJ8H 2WFWA 2JK8A 3I55A 3D31A 1HR0Q 1BKBA 3UDIA 3GTMH 4LF4Q 1C9OA 5GAGC 1XPOA 1XNQQ 4KHZA 3STBC 1JE5A 1Q8KA 4APVA 5FLMH 2IT1A 5DLQE 2JQOA 1YITA 4BA1I 1B70B 4L5TA 2UXDQ 1EWIA 4TVAB 3PO2H 3S14H 5BR8Q 3I4MG 4DNIA 1K83H 1OTCA 4OXPA 4NXNL 2VL6A 2JEBI 1Q46A 2KCTA 3PIPA 3CCVA 4IJLA 3BJUA 1JJ2A 1HR0W 5IP9G 1N36Q 3J81c 3HKZE 4XIGS 1VQ5A 1EQQA 2XTIA 1EQRA 4JI1Q 1OXVA 4MNOA 2A8VA 1XPUA 3I4NH 4AYBE 1TWHH 5GROA 2C35B 4AH6A 2E5LL 1N9WA 3CCLA 3CQZH 2VQFQ 4AQYL 1CSQA 1X65A 3AQQA 4FDBA 2H5XA 3CC4A 4GNXB 1CKMA 1VQJA 3CXCA 2MFIA 3G48A 3HKSA 1VQ8A 1QVFA 3KF8B 1E3PA 1HNWL 5IYDG 4O0AA 4X65L 3J7ZC 3CMAA 3M9BA 1CKNA 3F8TA 1N34L 2WB1G 4LF5L 4IFDG 2NVQH 4WJ4A 2LXJA 4LUVA 3KJPA 4P73A 4OO1G 3OYYA 5IY0A 4LUOA 1Q81C 1MKHA 1NJIC 3S1RH 4LWCA 1RL2A 2AKWB 3RR5A 1VQ4A 4NXNQ 4X64L 5J3BA 1FJGL 2QA4A 2EXDA 2WAQE 4R1JA 2BH8A 2RF4A 1WCMH 4DR3L 3UDGA 1JJCB 1SE8A 4HIKA 3RN2A 1VQ9A 2R6GA 1HZAA 1ASZA 1IBMQ 3CP0A 4A3LG 3I56A 3DM3A 1X9NA 4B3TL 1VCIA 4DAYB 1BBWA 1WCMG 3E9HA 3G4SA 2JA7G 1VQHA 4HJ8A 1GM5A 5IYCH 4AQYQ 2UUAQ 2AWOA 4A3FG 4YWLA 1SR3A 4A3CH 5IYBH 3AYHB 4JCVE 3J80c 1UE6A 3KYHC 3SGIA 5C3EH 3KFUA 3UE1A 4LF7L 1Q7YC 4X65Q 4JI4L 4DR7L 3D0FA 3HFZB 3M4QA 2VW9A 1N34Q 4OWXB 1IBLQ 4LF5Q 2ZTDA 1D7QA 3ZJYC 4JI8Q 1GVPA 2K50A 3EBEA 4A3CG 2OQKA 4QY7A 5C3EG 1K0RA 3ULPA 1NMGA 1J6QA 2PI2E 2UUBQ 4B3SL 4JI3Q 3HOZG 1B8AA 4DV6L 2F52A 4QQBX 4OWTB 3GDEA 4QGUA 1W3SA 5M5YH 1FJGQ 2YTYA 3KJOA 1MJCA 3S2HH 4GKJQ 2GVAA 5FLXc 2NZOA 2D62A 4DV1L 4DR3Q 1VQLA 3M85A 4DR6L 1L1OC 3CCJA 3CCUA 2OTJA 1XTDA 5LMNL 4DUYQ 3M4PA 4DV0Q 1A8VA 3IRBA 4B3TQ 4OX9L 1N33L 1WYDA 3NELA 1KAWA 1X3EA 2CFMA 1QVCA 2I5MX 1AH9A 1RIPA 3STBD 3CD6A 3RLNA 3HOYH 3TREA 2YU9H 4LF7Q 5C44G 2Q2IA 3LGJA 5AJ3L 1HZ9A 1TWCH 4JI4Q 3A74A 1KD1C 1KXLA 2PQAB 3HOVG 1CKOA 1E22A 1PHJA 5EAYA 2CKZB 1PYSB 1SN8A 1A0IA 3L7ZC 4HIOA 2ZM6L 2HQLA 2JA6H 2Z0SA 3HOYG 2YYZA 1VQOA 4B3SQ 3WWVA 1LM0A 2IX1A 2KBNA 3S24A 1S40A 3MEFA 4DV7Q 5C0XI 4A75A 4A3JH 1SLJA 2PQAA 2QGQA 4DV1Q 1IL2A 4NB3A 2BH2A 3EN2A 5IT9c 2ZTEA 1C7YA 3TRZA 4DR1Q 1CUKA 4AIMA 1IZ6A 1Y1WG 3AEVA 4X62L 4JG2A 1A62A 1WOCA 1JB7A 4R4CA 4HJAA 1R9TH 3HOUG 1V43A 1HH2P 1AE3A 1VQGA 3K0XA 3VDYA 4L5RC 2CQOA 4DV3L 1N33Q 1HZCA 2JE6I 3FP9A 3CW2C 2R92H 4JBKA 2A1AA 1X3GA 1X56A 3KF6B 2V1CC 1S3OA 4DV5Q 1JT8A 1XMOL 1FVIA 5M5WH 3K80C 1Q1EA 3RZOH 4YCUA 2E2JH 4LFCQ 2F4VL 3AFQA 2RHSB 5FJ8G 2Q2UA 2Y0SG 4DR5L 2R92G 4BY1H 1IBKL 4DR2L 1VQ7A 2ZM6Q 3GTGH 1AE2A 1OXTA 1EIYB 1VQPA 1W2BA 1J5EL 4IPDA 1KRTA 1LUZA 5LMNW 2VY3A 4PMWA 1PH4A 4UPAA 1PFSA 2I5HA 4PG3A 2FXQA 4P75A 4GS3A 4OONA 5FLMG 2HIVA 4NXML 3I2ZA 1MIUA 1HNXL 2ATWA 1PH9A 1V9PA 3CCEA 2JA5H 3PO2G 4DR4Q 3CMEA 1G51A 4JV5L 3ULJA 3BZKA 3PF5A 3OW2A 4X62Q 1CSPA 4JI2Q 4GOPB 4R4IA 4A3IH 2VUMH 3TS2A 4DV3Q 3GTQH 4J15A 4TQUS 2JJQA 1PV4A 2F3IA 1N32L 1XMOQ 4KLKA 4PZ8A 3I4NG 1Q12A 4A93H 2UXBL 1U0LA 4X6AH 2ID0A 1T9HA 4JBJA 5LMUL 4B3RL 1E1OA 2RHQB 4UP8A 2VQEL 1I94L 1J5EQ 3GTJH 4JYAL 1XPRA 3F2DA 3S15H 3UDXA 1YIJA 4GNXA 4X66L 3HOXH 3PO3H 2UXCL 5C4JH 3CCRA 3K7UC 3B6YA 2A19A 2D0PA 4BBRH 4DPGA 2E2IH 1L1OB 4NXMQ 4GLVB 3J81i 1HNXQ 4GLAC 3H3VI 3UDFA 1EOVA 4JV5Q 2R93H 4GN5A 1YZ6A 4DUZL 1M1KC 2ES2A 2MQHA 2K75A 3F2BA 4DV2L 4RMFA 2ZJPA 4LF8L 4GOPC
chains in the Genus database with same CATH superfamily
1EU4A 3H0GH 5CC4A 4BA2I 1L1OA 5CBAE 1K73C 2CW0C 1FNUA 2EZVA 1SXTA 2UXBQ 1VQCA 4HIDA 2Q8RE 4IOAA 1CTMA 4XYQA 1EIFA 5HURA 3TP6A 1LLRD 3GTKB 5J39A 3FPPA 4OIJA 1Q1BA 3VR2A 1HZBA 2B63H 4GKKL 1H95A 3ULLA 1V1OA 2LS01 1VQIA 5ELOA 1PH1A 3OMGA 3M4OB 2NN6G 4DAMA 1ENAA 3TZUA 3S16H 4ME3A 4RH6A 4C3JB 5A2QE 3QOJA 3TEHB 4LFBL 5IGFA 4IFDI 2RDFA 4RFBA 5M9OA 1FNVA 2HHHL 3DXJC 2N78A 4DR7Q 1I50H 1UWVA 3EIVA 5M3MH 1KNEA 3SK4A 1Y69U 1YBYA 4LF6L 1TWFB 4P72A 4LF9L 4P74A 4DV6Q 4IUVA 3L3OC 3S2DB 4KJNA 4R4TA 5JAVA 4Y7NH 1WTPA 1S5BD 4GKKQ 4DV4L 1WFQA 1KLUD 1VQMA 4YY3L 1YHQA 5LMNQ 2NZHA 1JMCA 1PTOD 3CPWA 4JPBW 1TWAB 1QCBD 4RGOS 4LFBQ 4RGTA 1O80A 1STBA 1STNA 4ZKCB 5JJZA 4F7XA 1TS5A 2HHHQ 4A3GB 1DXMA 2OCEA 4BBSH 4X3KA 4N9TA 4KD3A 2MJ8A 1TWGB 4LF9Q 1SBBB 3QR8A 1MI2A 4DV4Q 2VQFL 2PMZE 3ER0A 3V96A 2Z4HA 1YNJD 4A3BB 2F3WA 3I4LA 1B3QA 2WINB 3HRZC 4YY3Q 4POGA 3RZDB 3I4MH 1BCPD 3SK8A 1L2FA 1MSHA 5E7NA 2F0FA 3S17B 3TS0A 2JA5G 1P16A 3H09A 3CCSA 5E4WC 2EIFA 3CCQA 4BS9A 2VNUD 4A3IG 3FVQA 5T1IA 3DLLA 1X6OA 1G291 2YTXA 4GOPA 3GTMB 4POFA 4ID6A 2DUDA 2IW3A 2CH4A 4H13C 4RCNA 2OT2A 2Z6KA 1IBML 1CKNB 3QG1A 2B2UA 3A5UA 4CDCC 1M90C 2XWJB 1X32A 3D3RA 3S14B 1PZJD 1NUCA 1V1PA 3KLSX 1AN8A 1HTLD 4ALPA 5JPNC 4OWWB 4OGQC 3HOXG 4X3UA 3JC66 2R7FA 2F1MA 4KD4A 2QW7A 4I7ZC 4FF1A 4G4KA 2LFNA 3OWFA 4PMCA 3SDZA 1Y8OB 2WB1B 3E3XA 1VS0A 4PQXA 1YNNC 4JI3L 4DFAA 1VQBA 5I9PA 1PH6A 1PFBA 3BZDB 3EVQA 1EYDA 1CZGA 3VA5A 5LMUQ 3J80E 5DAUA 1K8GA 5C0XG 2XN9C 5IP7G 3GTLH 4MTKA 2OQ0A 4DUYL 5CORA 4DV0L 5DNFA 1TY2A 4DNTB 1K3RA 2QDLA 4K5VA 4WJ3M 1PH5A 3BYTB 2JA7B 5C6AA 1GUOA 2D5DA 5CV5A 1QB5D 3VYRA 1XJVA 4RGNA 1B50A 1LACA 4DK6C 4GN3B 4IQZA 3I7FA 3I4OA 2E8GA 4UP7A 5C3EB 4FVMA 3HOZB 4K0KQ 2RKSA 1NSNS 4DR1L 2JA8G 5IWAQ 5C4ZA 3K5NA 3KLSA 2E2HB 1IW7C 4XTCS 3C46A 1QZHA 1PTOH 3HOVH 2RCNA 1ASYA 1SROA 1KDCA 1UE7A 5I2XA 3NWTA 2EY2A 1E7ZA 4K8IA 4ZK9B 2AHOB 2F0JA 4A3GG 5C44B 2VS1A 3BDLA 1L0YB 1QWYA 1RD9D 4CDDC 4NP5A 5BR8L 4DK1A 5M3FG 1QUQB 1Y1WH 1SDFA 1WTXA 1BBUA 3A5ZB 5FLXL 1T5XD 2AMCB 3KBGA 3Q23A 3R2IA 3UE0A 4WORA 4DR4L 2B29A 3QJYA 2A73B 1MGSA 2Z1CA 3K7AB 4QMGA 4A3BG 2CH4W 5FJ8H 3I55A 3NTHA 4RCOA 1JWMD 1BKBA 5G3LD 4A3JB 2MP1A 3FPUB 1B53A 2K05A 1B1ZA 3VR4A 1C9OA 1XPOA 1HRJA 3MTSA 3NHHA 1Q8KA 4APVA 3J7AF 2IT1A 2JQOA 3WOEA 1B70B 4L5TA 2IWHA 3T13A 1EWIA 4TVAB 2R92B 5BR8Q 1K83H 1OTCA 3SK5A 3OIPA 4RKLA 2KCTA 1JJ2A 3RZOB 4IJLA 3BJUA 1N36Q 4AYBB 3LWEA 4BY1B 3HS0C 1VQ5A 2XTIA 1EQRA 3F2UA 3I4NH 1BR9A 1SYGA 1TWHH 3CCLA 4AQYL 5KNDA 4NMZA 3DWQA 1BUVT 1CKMA 3CXCA 3G48A 1QVFA 3KF8B 1CHPD 2P5ZX 3R8BA 3CMAA 3EROA 1CKNA 3F8TA 1RTOA 2WB1G 4IFDG 2F0VA 1A3VA 2EJMA 3LWUA 4K5XA 3SE0A 1MKHA 4L63B 3S1RH 2JXMB 4OL7A 1DOLA 1RKNA 4DR3L 1SE8A 4J6HA 3RN2A 4KMUC 2K1BA 2NTSA 4QB4A 1SNOA 3GTJB 3DM3A 4DAYB 1BBWA 3U9SA 1LTBD 3E9HA 1ONLA 1VQHA 2JA7G 1HUNA 2UUAQ 4AQYQ 5K36H 4A3FG 2E2IB 5IYBH 1EEFD 3KYHC 3Q0AA 3SGIA 3A8JE 4LF7L 5F2DA 1ILQA 3HFZB 3QIAA 5CBEE 1D7QA 1G6ZA 2ZTDA 3ZJYC 1GVPA 3EBEA 3VYTA 5C3EG 2UUBQ 3H0GB 3HOZG 3T16A 2SOBA 4OWTB 3GDEA 1II3A 5CV4A 4NW2A 4DF7A 3I72A 4GKJQ 2D62A 4DV1L 4DR3Q 3M85A 3D6CA 3CCUA 3TZDA 2K28A 5D14A 4OX9L 4NKLA 2SDFA 3GP7A 5ELFA 5I6YA 1F9SA 1KAWA 1X3EA 5FO7B 1AH9A 5M5YB 1RIPA 1G91A 2B63B 2EXZA 3RLNA 4LF7Q 5C44G 1TWCH 3P1HA 1QILA 1JORA 2VB3X 2PQAB 3IAYA 1CKOA 2Z9HA 5EAYA 2CKZB 2HCCA 1SN8A 1MBYA 1QE6A 2ZM6L 2HQLA 2PPBC 3S16B 1RODA 2YYZA 3NSWA 2RSNA 2X6LA 2KBNA 1Q8IA 3P7JA 1A2UA 5EGTA 1SLJA 1I50B 4DV1Q 2ZTEA 1C7YA 5M3MB 1IZ6A 3AEVA 2IL8A 4PNYA 1A62A 2JN4A 4U68A 1R9TH 3HOUG 1X3PA 1W6JA 1AE3A 1VQGA 4Y7NB 1GOZA 1X56A 2A1AA 2B2VC 3KF6B 1O7ZA 4DV5Q 1IHZA 3K80C 2RHSB 2H4OA 3D8GA 4DR5L 2R92G 1XWEA 3A7AB 4EVOA 4DR2L 2ZM6Q 3C2PA 2A68D 1VQPA 1W2BA 2FMMA 1STHA 1KRTA 1LUZA 4MN3A 2E2DC 4KHVA 1PH4A 1PFSA 2PO4A 3HKZB 4P75A 4OONA 1PYWD 1EQTA 2RCFA 3BVGA 5EBDA 1PH9A 5D65A 1V9PA 3CCEA 2O5IC 4BBSB 4JV5L 1G51A 2RSOA 1UNSA 3GTGB 3T51B 2VUMH 1EEID 3GTQH 4TQUS 4R9WA 5IGGA 2A69D 4K2KA 1N32L 1C8CA 1UEAB 1L0XB 4KLKA 2CVRA 3GQBA 3CRLC 4A93H 2K5QA 4XT1B 5JVH3 5IIFA 3I4MB 3OSOA 2RHQB 1I94L 3F2DA 1ZEQX 5JOBA 1YIJA 2EY5A 3PO3H 3BDOA 4OHJA 2UXCL 4CDFC 3CCRA 1SMYC 3KF8A 1JQYD 3HGBA 4BBRH 1L1OB 3I70A 1F2LA 3DWPA 4JV5Q 4DUZL 1M1KC 4DV2L 5ELDA 4JI6L 3GTOH 4LF8L 2EYJA 5J1ZA 1H9JA 1U9RA 1N32Q 1OXSC 1A3TA 5GAHC 1CA6A 4BXXH 3KOJA 2R93B 4IALA 3CAMA 3DUZA 2WB1E 3H0GG 3JAMc 1YHBA 2NVXH 4A3EH 1Y1VH 1I94Q 1CA5A 3K8AA 1KC8C 2A74C 3DEPA 1STAA 1Q3LA 2NB0A 3FKIB 4X64Q 1Q82C 5TSSA 1I3QB 3CCMA 1CZWA 3U4VA 1YJNA 4BY7H 4C3IH 4DUZQ 4DXFA 3ICEA 1NCVA 1V1QA 2BDNA 3G6EA 4DNRB 4JI6Q 2B63G 1J9OA 4LF8Q 3GTLB 3GO5A 1HHVA 1JWUD 3PIP3 4H7BA 1C0AA 4RG1A 3K81C 2NUCA 4C3HH 5HGQA 2J4XA 1B9NA 2L15A 3I91A 2WP8J 1C4QA 1ILPA 3WOFA 1BVSA 1CM9A 2KOLA 1SNCA 4A3MH 3A8KE 5C0XJ 3S1MH 1CQVA 1H9RA 1QNKA 3J7YW 2JA6G 2YTVA 4DR6Q 1SNQA 4I65A 3FHWA 4WJWA 2F0NA 1D8LA 3TSSA 4Z9CB 1UE1A 2A6HC 4LF4L 2HT1A 4KHPL 1PZID 2ZJQA 2R7ZB 4IPCA 1B3AA 2AQ3B 3OTOL 1PTOB 1WVLA 1RJTA 1SJED 1HJPA 5AJ3Q 2L0CA 2VZAA 2JEAI 5JJLA 1A63A 1PLFA 1X3FA 1X54A 2B2YA 2KCMA 2XIWA 4PZ7A 1IKMA 2HDLA 1G8ZD 2GN5A 2WIIB 1FR3A 1FL0A 3HKZG 3KLRA 4JOIC 1F9RA 1I4XA 3KF6A 2K14A 3GV3A 1LYLA 3GTPH 1CK1A 4BBSG 5IGDA 3MAQA 1HXYD 1KRSA 1I4HA 2FMCA 1YEZA 4KKUA 4JI5L 1SE3A 3VA7A 2GVBA 3RD4A 1D6EC 1JOOA 1D5ZC 1YNXA 1Q90A 5H1SE 4KHPQ 1ICFB 5CV6A 5FKAC 1BCPB 1MHWC 1PMRA 3N52A 3OTOQ 5IP9H 4JBWA 1DZ1A 1SFOB 2F4VQ 4ZRZA 1EUJA 2BE5C 1IYUA 1V1PB 3QOLA 5ELNA 1AW7A 3SVMA 5M5XB 5IT9L 4IPHA 5GAEC 1IBKQ 4PZ6A 3Q6SA 1PH7A 4FF4A 3J7A5 4KY6A 1SNDA 3H91A 4HR7B 2NTTA 1GD7A 5IYDH 1LO5D 1K83B 2F0HA 2N49A 4JI5Q 4OO1H 5FO8B 2JA9A 1YHAA 1FD7D 2ASBA 1F2MA 1VQNA 1IBLL 1GKHA 3M7NA 2F0UA 2R93G 4IUPA 1QG7A 1STGA 3I4NB 1TY0A 1PFMA 5AFWA 5BN4A 2QKIC 4GN4B 5HY6A 1N8RC 4A3LH 3RLOA 5JEAJ 3J81L 3PUYA 3S9WA 1K9MC 4ILWA 3FKIG 3CC2A 1PZKD 1HQMC 2B39A 4LFAL 5C4XG 2K4KA 3S1RB 3W1BA 1EIHA 1IL8A 4F8MA 3PV0A 1XMQL 2F0OA 4EQ5A 2NVYH 4WFN3 1YJWA 1NAPA 2EYMA 4IFDJ 4V0BA 4EX5A 1E2VA 5CR3A 1NBWA 1TS4A 4C1NK 4HJ5A 2UU9L 2HD3A 1QJOA 2AUKA 3IFDA 1WTOA 1VQDA 4H02A 2D0OA 1TR5A 2AQ1B 4K14A 4DV7L 1K3BC 3JAMi 3VR3A 4L5SA 2PZUA 4FNFA 1WTHA 4A3KH 2L1BA 2F0MA 1KNAA 3E0JA 3GV6A 2AQ2B 3BG3A 1KDAA 4LFAQ 1PH3A 2EJFC 1FNWA 1RF2D 5FOBB 1BF4A 1HR0L 1DOKA 1F9PA 3ERSX 4P71A 2R7ZG 3CPFA 1XMQQ 1NMFA 4IUUA 3A54A 2KHSA 3OOCA 2KCCA 2XGTA 3HG9A 4B9XA 2UU9Q 3TQYA 2M00A 2X69A 2XRSD 1S5DD 1BO0A 4KY5A 4F88A 1U4LA 1LTTD 2E75C 1TWCB 1JE4A 5EQ0A 1A3UA 1B44D 1SE4A 3W2DA 1JOQA 4LF6Q 5IOCA 4JI2L 2PZTA 1QVGA 3MWYW 1Z9FA 3NP8A 1PYBA 1VQFA 2JK8A 1HR0Q 1HCZA 2C5CA 2B2TA 3S1NB 1VMPA 4KHZA 3STBC 5A2QL 3E5SA 1R9TB 1JE5A 1YITA 2KJXA 3ND8A 3A8IE 1QOHA 4CBVA 3HKZE 1SYCA 2A8VA 1XPUA 3PO2B 5GROA 1PXUA 2C35B 4AH6A 2E5LL 1GHJA 1N9WA 5A35A 3CQZH 2VQFQ 3I73A 1CSQA 1X65A 2H5XA 4RHRA 4GNXB 2MFIA 1HNWL 4OEMB 4EQOA 2TSSA 4X65L 3HZXA 3M9BA 4WJ4A 2LXJA 4LUVA 2VUMB 4CKEA 4LUOA 5IY0A 4XQQA 1Q81C 3GTQB 1DJRD 2EYLA 3QB3A 3RR5A 3R3OA 1S5ED 5D3IB 4A93B 2NVQB 2R6GA 1ASZA 2IPKD 1IBMQ 3CP0A 2K03A 2MGSA 5KRUA 4B3TL 3G4SA 3PO3B 2AWOA 4YWLA 4A3CH 3NTKA 4JCVE 3J80c 3ITPA 4Q0FA 4FO2A 3KFUA 2QEJC 4C3JG 5I2YA 5I9OA 4X65Q 4JI4L 2A6EC 3M4QA 1H9KA 1B9MA 5FLXE 2K50A 4ULLA 4QY7A 3GTOB 4H44C 3TP8A 2E76C 2LMCB 3ULPA 4B3SL 4JI3Q 2F52A 4QQBX 2B8FA 1W3SA 2KUMA 2GVAA 5FLXc 2K6AA 1L1OC 4NDXA 3CCJA 3E6ZX 1Y1VB 2ICIA 4DXGA 4DUYQ 3M4PA 4F87A 4EQPA 3IRBA 4DV0Q 4B3TQ 1S5CD 2O2LD 1LT4D 5HGTA 2RDHA 3S2HB 1WTWA 1SNPA 2Q2IA 3I90A 1HZ9A 1H9MA 4JI4Q 3A74A 2CQAA 4C3IB 1PHJA 5LHY1 3MA2B 1PYSB 4HMJA 1ICWA 3FEWX 5IGCA 3FRPB 3MHBA 3RMHA 4B3SQ 3H6MA 3MEFA 4DAPA 3TRZA 4DR1Q 4AIMA 1K8OA 4JG2A 3TBIB 4A3MB 3VDYA 2QDBA 4DV3L 2JE6I 4HTHA 1JT8A 1XMOL 5M5WH 2RDGA 1PFNA 3EQLC 4RAUC 4DN4M 1ML0D 1AE2A 2L5TA 3D4RA 4PMWA 2FJ2A 2I5HA 3BVMA 3K5MA 1PRTD 5FLMG 2E2JB 1TU2B 3TDQA 1DYQA 2JA5H 3PO2G 4DR4Q 3CMEA 3ULJA 3PF5A 1CSPA 2KECA 1NR4A 3M7GA 5CV7A 4KKSA 4A3IH 3TS2A 4DV3Q 3GTPB 4J15A 4HSVA 2K7VA 1XMOQ 1JWSD 2MPMA 2TMPA 1PTOC 2J7ZA 1KLGD 3MFGA 5L37A 1U0LA 1T9HA 1FGBD 1U4PA 3ERQA 4B3RL 1D2BA 1VF5C 1E1OA 4JYAL 2VQEL 1QNUA 3S15H 4TKOB 1EQVA 4TRDA 4X66L 2WACA 3HOXH 4GNXA 2A19A 2PW5A 3B6YA 2GA4B 1ENCA 4GLAC 2F0GA 1Z6HA 3TP7A 2ES2A 2MQHA 2K75A 1FYCA 3F2BA 1EYCA 4E6IA 4GOPC 1YNJC 4UP9A 1ZYRD 1E24A 2FHTA 5C4JB 4HCSA 5LL6X 1LTID 1SJHD 3CF5A 1BCPC 2Z6KC 5C0XH 2B2UC 1L0WA 4UAIA 5IP7H 1AZPA 5IYCG 2K5HA 2NWGA 2L4NA 3M4OH 4HN7A 4B3RQ 3A56A 2EYPA 3QO2A 2VQEQ 4JYAQ 1P8LA 5IGEA 4X66Q 5DM73 1WD0A 5FO9B 1K28A 4MTNA 4R8NA 1Y1VG 2I5LX 2PI2A 3URYA 2BOSA 2M2LA 3OMCA 1PVOA 1WJJA 3QWNA 3J80i 1TWFH 1GUGA 3IKJA 3S2DH 2JA8H 2QILA 3E9IA 2Z4IA 1H9SA 3SEBA 3K0YA 1I4PA 3BYYB 1VDZA 1XXGA 4JW0A 3W5OA 1SMXA 3U50C 4Y52H 2B8GA 1LTLA 1GO3E 2JP1A 2CWPA 3L0OA 1SYEA 2IX0A 4O42A 1WD1A 4JBMA 4A3GH 4CJ0B 1DOMA 2HIXA 1E2WA 4A3KB 1R4PB 1CQFA 1NTGA 1TKWB 3KDFA 3PGZA 4S3SA 5M3FH 1G2TA 2K5NA 4P2CB 4A3JG 3HEJA 4OX9Q 3OWEB 4IN3A 5GQOA 2C9OA 2EYHA 3RN5A 1VQ6A 2K33A 3SK6A 1SAPA 1NE3A 5ISRA 1I6HH 1UEBA 1IYVA 2Z6BA 2F0QA 2ZJRA 1MD2D 1QZGA 1VMCA 1I4QA 4A3BH 4QCLA 2EQSA 4IURA 2B3GA 3C1FA 4MHEA 3S17H 4N9PA 1U4RA 4JI1L 4AYBG 4BY1G 4O1NA 4C2MH 4DGZA 3BU2A 1PTOF 1HA6A 5E3FA 1SE2A 2CW0D 4JK1C 1LTSD 4KY7A 4M1UB 5JEAH 3CC7A 1S4ZA 2BA1A 1U5KA 3NWSA 4DU9A 1G2SA 2DY7A 1D1KA 3CC4A 2K01A 3NENA 4DR5Q 3S1QH 4DR2Q 1PH8A 4A76A 4HAEA 2F3VA 2EYFA 5DEHA 1RTNA 1V8QA 2AWNA 2DJGC 3OW7A 4IFDH 2EDGA 3KUPA 4CDEC 1E0BA 2Q2TA 4A4IA 2N55A 3PIOA 5KNBA 1BCPF 1IXRA 1I4RA 4KN4C 5CV9A 3NXWA 4A3DH 2HCIA 4XXEA 2F0SA 4JI8L 2EJGC 3X3NA 2PYKA 3ONAB 1EY8A 2LY7A 4IPGA 3CQZB 3K57A 5IE8A 4MZ9A 4K6LA 1W6KA 4L5QA 1I5FA 2M9VA 2JA7H 2KENA 2MO0A 4YIJA 4A3FH 2K5WA 3MXUA 3V2TA 1EY9A 1Y8PB 2UXCQ 1KDBA 1PH2A 3MXNB 1HFGA 2PW7A 2G5DA 2SNMA 3Q24A 4QUCA 4ABNA 3RNUA 2PNHA 5KNCA 3HOWH 4KN7C 2L55A 1JOKA 2QEXA 4DV2Q 4GNXC 3HOZH 2F0IA 2LXKA 2E2HH 1EY7A 3NBHB 4DK3C 4KJOA 1EZ6A 4IO9A 1STYA 4CGYB 4JI7L 2LSSA 1ESFA 1TT2A 2DJFC 1KAAA 2AUJD 3P75A 1VQAA 4ZQ3A 3F2CA 2MHVA 1HA5A 5C44H 5M3MG 1PA6A 4A3KG 3PUVA 2DGYA 4N8FA 3NEMA 4LFCL 3AFPA 4FXKC 3EJIA 1A2TA 2CCZA 5D3DA 3JAML 1XNQL 1B2TA 2L12A 4LUZA 5E1FA 1ENFA 3K7AH 3HOVB 2F0DA 2UXDL 4QF4A 3NBIA 1STEA 3H3VH 3HOUH 2I0QA 1GUSA 3PUXA 1WTQA 4JI7Q 4B08A 4YWMA 5C4HA 4ZCKA 3VR6A 1M4VA 5T1GA 4H0LC 3SHLA 2FFKB 4JC0A 2R3ZA 1EFWA 1LT3D 1Y1WB 4G7OC 1BXTA 2J0TD 1SYBA 2WKCA 3UDIA 5CYUA 4LF4Q 2IJ0A 1XNQQ 1YNND 4XYOA 4RKBA 3J81E 5DLQE 2Z8LA 2UXDQ 2B2WA 2Y0SB 3I4MG 3MXGA 1WTVA 4DNIA 1BBXC 2DNCA 4NXNL 2VL6A 2JEBI 1Q46A 3OHXC 5M5WB 1HR0W 4ZLTF 3J81c 1GUNA 3NQIA 5ELEA 3BVZA 1EQQA 1IKLA 1OXVA 4MNOA 1RHPA 4AYBE 5G3LF 1E2ZA 3AQQA 3K58A 1VQJA 3HKSA 1E3PA 4O0AA 3J7ZC 3LX0A 1N34L 4QUFA 1SYDA 2ICEC 3KJPA 4HSPA 4A3IB 3OYYA 1TWHB 1KTKA 1RL2A 4NXNQ 5J3BA 1FJGL 2A68C 2EXDA 4R1JA 2BH8A 2RF4A 1IW7D 1WCMH 5COYA 3UDGA 1VQ9A 3K5LA 1XX8A 4JVZA 1HZAA 3D4WA 4FP5D 1EY4A 1VCIA 3S15B 2EY6A 3PQIA 3HOXB 5JJKA 1SR3A 3DMUA 5BN5A 1UE6A 4G57A 3LNNA 1Q7YC 4DR7L 1JICA 3D0FA 2VW9A 3FMCA 1N34Q 1Y8NB 1IBLQ 2A69C 2RQXA 4A3CG 3SR1A 3MXNA 3NPPA 3K59A 1CHQD 1NMGA 1J6QA 1OO9B 2FINB 5EKIA 1B8AA 4DV6L 3MXPA 4QGUA 5M5YH 1FJGQ 2PCFB 3VYSA 2K32A 2NZOA 1VQLA 2F0EA 1CT1D 1GHKA 1J8IA 2OTJA 1XTDA 5LMNL 5ELCA 2Q8IB 2XNAC 1A8VA 3NBHA 1N33L 1WYDA 3L9AX 2CFMA 4QIWB 1AEXA 2I5MX 5C3XA 1I6VC 3HOYH 2YU9H 4ZAIA 3LGJA 4EGVA 4ME5A 1DD2A 1KD1C 3HOVG 1BOSA 1D1IA 2HQEA 1SYFA 2EE1A 4HIOA 3L7ZC 1A0IA 1JC7A 1EZ8A 1MSGA 5EBCA 5CGKA 2JA6H 5LL6S 3NQTA 5C3WA 4DK0A 3NUCA 3WWVA 1SEBD 1K8MA 3N6RA 2ZXRA 3S24A 4DV7Q 1KABA 4HCEA 4A75A 2BH2A 2QGQA 1BNZA 2JA8B 2I07B 4NB3A 3EN2A 1Y1WG 3OPOA 1WOCA 1JB7A 4R4CA 3VYUA 4HJAA 4FF3A 1HH2P 3K0XA 4L5RC 1N33Q 2CQOA 1HZCA 4JBKA 5KYLA 3EA6A 4WRDA 2V1CC 1XTCD 5KIXA 1LTAD 3KBXA 3AFQA 3VR5A 5FJ8G 2Y0SG 5M3FB 5EKLA 4ZKBB 3GTGH 1OXTA 3H94A 1EIYB 4IPDA 4V190 2VY3A 3IFTA 2O5JC 4PG3A 1HTPA 1I6HB 3I2ZA 1HNXL 2ATWA 1PRTB 4IUNA 1HFNA 3BZKA 3OW2A 4JI2Q 2RA4A 2N88A 2B2YC 2PZWA 4R8IA 2F3IA 1S5FD 2RBMA 4C2MB 3I4NG 2ZXPA 4X6AH 4JBJA 5LMUL 2BCOA 4UP8A 2OEOA 3R93A 2WAQB 1AP0A 4ZUIA 1VF7A 3K7UC 2D0PA 4DPGA 3V05A 3I8ZA 3J81i 3TP5A 1HNXQ 3H3VI 1AFPA 2PNRC 2R93H 3S1QB 1LABA 2B2WC 2WKDA 1LTRD 4RMFA 4OELB 2ZJPA 3T53B 1WI5A 2E5LQ 1XYIA 1EWCA 3SXHA 1IYJB 4BBRB 3FKIH 3M3YH 2OXPA 1HNWQ 1I3QH 3T1YL 4XT3B 1UE5A 1RDPD 5K36G 1JCKB 5C4XH 2NZ1D 3MVVA 5IYBG 4A3DB 4K0KL 4M8AA 3RLFA 4FYDA 1TS2A 2ENBA 1YVCA 4RGMA 4C56C 2K52A 2OWOA 4KKTA 5IWAL 1U4MA 1JR0D 2NN6H 5GADC 1EY6A 1DGSA 1G6PA 2YV5A 5I6WA 4HJ9A 1UUPA 2ALYB 4YCWA 2EVBA 3EFXD 3R2TA 3D4DA 2G9DA 2Q2HA 4FXGC 2DNEA 2NVXB 4A3EB 3U4ZA 3RUZA 4A3FB 4DA2A 3ND9A 1H9SB 4K6DA 4KTAA 2NVTH 2L9HA 3J81j 1O7IA 2KVMA 3DHQA 4OO1I 4BY7B 3T1YQ 3E0EA 1YI2A 3HOWB 4LAAA 1K0SA 1B4OA 1LTGD 2B2VA 2BA0A 2I46A 2WV6D 1TIID 3NTIA 3OIQA 3KDFB 1Y14B 2R7ZH 2KHJA 5EPLA 2DY8A 4YHHL 1XNRL 3J80L 2BDOA 1EY5A 4C3HB 4QJFA 1M8AA 4UY8C 1X3QA 2O4XA 3T4AC 4K5WA 2ZT9C 1A6XA 4LJZC 3S1MB 5I4DA 1HQRD 3Q8DA 1ZXTA 4L8JA 1CFMA 1DCZA 2N3SA 3TMEA 1EYGA 1T5EA 4HIMA 2HUGA 5BN3A 2F03A 1Z7TA 3L2PA 3W3AA 1SMYD 3PUZA 4DAVA 1N36L 1NR2A 4R4QA 4IJHA 2KEDA 2D9UA 1NY4A 5IODA 4YHHQ 2KA7A 3MEHA 1XNRQ 1HNZL 1KHIA 5CMDA 1SRUA 4GLXA 2IY5B 4YCVA 1JJGA 2E74C 4RA8A 4LNQA 3HOUB 1SFOH 4B3ML 2MO1A 4J1MA 5M5XH 3CHBD 1X55A 4LMQD 2SNSA 5IGBA 3CRKC 3M4YA 2EYOA 4K2LA 2CHBD 3DEOA 1VQEA 2VUMG 4EQNA 2HDMA 5JEAG 2WAQG 3K5OA 2R7DA 3BZCA 1OXXK 2Y0SE 2IX3A 2XRQD 2EOTA 4HJ7A 2KHIA 1FGUA 2B2TC 3PF4A 4A93G 3J7AV 1KIXA 1HNZQ 3DWAA 4OIKA 2UUAL 4B3MQ 1TXYA 1LT6D 3PO3G 2KCNA 1BQQT 4BBRG 4G7HC 4Q5VA 4UDUC 3F1ZA 1ZKOA 1Z47A 3W1GA 4KI0A 2UUBL 4HMIA 4R4OA 3GTKH 4A3DG 4JI0L 4LW1A 4ODGA 4NPSA 4GKJL 1YJ9A 3K6OA 4L6TB 4BXXG 2H1EA 1R4QB 1D5MC 3PUWA 1MJEA 4C3JH 1F77A 1VQKA 2A6HD 3I3CA 4A3EG 2IHFA 1ET6A 4CJ2C 3A0JA 3PCOB 1WCMB 4QL5A 3AMUA 2UUCL 5E4XA 4FXDA 1ESRA 1KL9A 3ZYYX 4B9WA 3H15A 4BY7G 4TSSA 4C3IG 3U58A 2QF7A 3HOWG 1S72A 4JI0Q 3HP3A 2MNAA 2SEBD 2NVYB 4IOCA 3CKIB 2CWAA 3T1HL 1K8AC 3PSIA 4C3HG 2K5VA 4X3TA 1Q86C 2IHEA 1GUTA 1B7YB 1SNMA 3KLWA 1TWAH 3C3LA 2VB2X 5JJIA 2NYZD 4JOIA 4O2DA 4DV5L 4A3MG 4YWKA 2UUCQ 4QIWE 1SSOA 3GD7A 2BE5D 1TWGH 4XDXA 2F0KA 5EPJA 2LKVA 4CHTB 2OTLA 3HOYB 1A15A 2YU9B 2F0PA 4CKCA 3MFYA 2N8NA 1O7LA 3S1NH 1KQSA 1EOTA 2F0LA 3T1HQ 3RZDH 2G9HD 2ZTCA 2JA6B 2PMZB 1OXUA 2L11A 4DKAC 1D5XC 3G71A 2V4DA 1QUQA 1E1TA 5EPKA 2NN6I 2WFWA 3AB9A 4UHVA 3D31A 1AZQA 2X6GA 2F0TA 3GTMH 2A5HA 1EIGA 4K8JA 5GAGC 4HEDA 5FLMH 4I7AA 4ZYSA 4BA1I 1BDOA 4KK7A 3PO2H 3S14H 1WTRA 2KEEA 4OXPA 5NUCA 3PIPA 3CCVA 3CU7A 2DN8A 5IP9G 4XIGS 1LV9A 4JI1Q 5JVG3 1GJXA 4FDBA 5C5LA 1UAPA 3A55A 3G6JB 1VQ8A 4PV1C 5IYDG 5KGUA 1F9QA 1EFID 2EPBA 1JB3A 4LF5L 3U9OA 2NVQH 4P73A 4OO1G 3O13A 4IZ8A 3T56B 1NJIC 4LWCA 2AKWB 1VQ4A 4RHSA 5KEEA 4X64L 2QA4A 2WAQE 1JJCB 4HIKA 1O7YA 1PRTC 4A3LG 3I56A 5JPMC 1X9NA 1WCMG 3JAME 3TN2A 4HJ8A 1GM5A 5IYCH 4MIUA 1I4GA 3UI2A 3AYHB 2QCPX 1GXDC 5C3EH 1TVXA 3UE1A 4OWXB 4LF5Q 3A7LA 4JI8Q 4XQJA 2OQKA 3D6WA 4DAYA 1K0RA 2PI2E 3NE5B 1F2ZA 3P20A 1EWHA 2JSOA 2PQEA 2F4IA 5EKKA 1HUMA 3M3YB 2YTYA 3KJOA 1MJCA 3S2HH 1PDQA 4DR6L 2R61A 5C4XB 2MUYA 1F2YA 2EY1A 4ZUJA 1TS3A 1HPCA 4CJ1B 3NELA 1GUWA 1QVCA 3STBD 2XVSA 3CD6A 1TQOA 3TREA 5AJ3L 1ZYRC 3Q22A 1RCVD 2JYOA 1KXLA 1E22A 4BWGB 5IT9E 4IUQA 2K04A 2Z0SA 3BDCA 3NK9A 4RWSC 3HOYG 3G7LA 1VQOA 1ET9A 2RVLA 2NVTB 1LM0A 3MC0B 1O78A 3PIO3 2IX1A 2NBFA 3IL8A 2K5DA 1S40A 5C0XI 4A3JH 2PQAA 1IL2A 4N8X1 5IT9c 1CUKA 4X62L 5C5MA 1EU3A 1V43A 4U673 5J22A 3FP9A 5CV8A 3CW2C 2R92H 1X3GA 3X3MA 1S3OA 2ZXOA 1FVIA 3MZ5A 1Q1EA 3RZOH 4YCUA 4G7ZC 2E2JH 4LFCQ 2F4VL 2D2CC 2Q2UA 5ELBA 1EY0A 4FF2A 4PMBA 4BY1H 1IBKL 1VQ7A 3WDNA 3FDTA 1J5EL 3BS1A 3PMFA 1NNXA 5LMNW 5KYIA 4UPAA 2VXWA 1EYAA 4C1NI 2FXQA 5FK9C 4GS3A 2HIVA 4NXML 1MIUA 4IUTA 3AU7A 2XWBB 2Q8TA 4X62Q 4GOPB 4J8QA 5EJWA 4R4IA 4LK1C 4KV6A 2A6ED 2JJQA 1PV4A 1LT5D 4PZ8A 2JA5B 3C1EA 4XQNA 4CKBA 1Q12A 4X3SA 1DONA 5K5PA 1CI3M 2UXBL 1EL0A 2ID0A 1J5EQ 3GTJH 1XPRA 3UDXA 1PRTF 5C4JH 5DM63 2E2IH 1C48A 3KK7A 4NXMQ 4GLVB 2KQ3A 3UDFA 1EOVA 3DM1A 2F0WA 2OF1A 1YZ6A 4GN5A 1DM0B 4GZYC 3H3VC 2XSCA
chains in the Genus database with same CATH topology
4UP9A 1WI5A 2E5LQ 1E24A 3H0GH 4BA2I 1L1OA 1IYJB 1K73C 1N32Q 1OXSC 3FKIH 3CF5A 5GAHC 3M3YH 2Z6KC 4BXXH 3KOJA 1HNWQ 1I3QH 1L0WA 3T1YL 1UE5A 5IP7H 5IYCG 2UXBQ 3CAMA 3H0GG 2WB1E 2K5HA 5C4XH 1VQCA 5K36G 4HIDA 5IYBG 3JAMc 3M4OH 1YHBA 4IOAA 4B3RQ 4K0KL 3RLFA 2NVXH 4A3EH 1Y1VH 2VQEQ 1I94Q 1P8LA 4JYAQ 1YVCA 2K52A 3K8AA 1KC8C 5IWAL 1EIFA 2OWOA 5GADC 4X66Q 1DGSA 1G6PA 2YV5A 4X64Q 4HJ9A 1Q82C 4MTNA 4GKKL 1Q1BA 2B63H 1HZBA 1Y1VG 2I5LX 1H95A 2PI2A 2ALYB 4YCWA 3ULLA 3CCMA 5ELOA 1VQIA 3U4VA 1YJNA 1PH1A 4BY7H 2NN6G 2Q2HA 4C3IH 4DUZQ 4DAMA 3ICEA 3U4ZA 1V1QA 1PVOA 3G6EA 4JI6Q 4ME3A 2B63G 3S16H 4LF8Q 3GO5A 1WJJA 3J80i 1TWFH 2NVTH 1C0AA 4RG1A 3K81C 3TEHB 4LFBL 3S2DH 3J81j 4IFDI 1O7IA 2HHHL 4OO1I 2N78A 4C3HH 4DR7Q 3T1YQ 5HGQA 1I50H 2L15A 1UWVA 3E0EA 2JA8H 1YI2A 2WP8J 3E9IA 3EIVA 5M3MH 1BVSA 2BA0A 3KDFB 1Y14B 1YBYA 3W5OA 4LF6L 4P72A 4A3MH 5C0XJ 4LF9L 2KHJA 1SMXA 4P74A 4DV6Q 2R7ZH 3U50C 3S1MH 4YHHL 4Y52H 4Y7NH 4R4TA 1XNRL 1LTLA 1GO3E 2JA6G 4GKKQ 4DV4L 2CWPA 3L0OA 2YTVA 1WFQA 2IX0A 4QJFA 3FHWA 4DR6Q 4JBMA 4A3GH 1D8LA 4UY8C 3GTOH 2HIXA 1VQMA 1UE1A 4LF4L 1NTGA 3KDFA 4YY3L 5M3FH 3PGZA 5LMNQ 1YHQA 2HT1A 2K5NA 4KHPL 2NZHA 1JMCA 4A3JG 2ZJQA 4OX9Q 4IPCA 5GQOA 5JJKA 3CPWA 3Q8DA 3RN5A 1VQ6A 2N3SA 1EYGA 3OTOL 4LFBQ 4HIMA 1NE3A 1HJPA 5AJ3Q 2HHHQ 1UEBA 1I6HH 2VZAA 2JEAI 5JJLA 1A63A 2ZJRA 1QZGA 1X3FA 1X54A 2KCMA 2OCEA 4A3BH 4PZ7A 3L2PA 4BBSH 2EQSA 3PUZA 1N36L 2GN5A 3HKZG 4JOIC 1FL0A 4R4QA 4IJHA 2B3GA 3KF6A 4LF9Q 1NY4A 2K14A 1LYLA 3GTPH 4JI1L 3S17H 4AYBG 4YHHQ 4BBSG 1XNRQ 1HNZL 1KHIA 4BY1G 1SRUA 4GLXA 4DV4Q 2VQFL 1KRSA 4YCVA 2PMZE 3ER0A 1YEZA 4JI5L 4C2MH 2IY5B 1JJGA 4LNQA 1SFOH 2GVBA 4B3ML 2MO1A 3BU2A 5M5XH 1YNXA 5H1SE 4YY3Q 4POGA 1X55A 4KHPQ 3I4MH 1L2FA 5E7NA 3CC7A 3TS0A 2JA5G 1P16A 2BA1A 1U5KA 3CCSA 2EIFA 3OTOQ 3CCQA 5IP9H 4JBWA 2VNUD 1VQEA 2VUMG 4A3IG 2F4VQ 3DLLA 5JEAG 1X6OA 1EUJA 1G291 2WAQG 2YTXA 3NENA 5ELNA 4POFA 4GOPA 2R7DA 4DR5Q 3BZCA 1OXXK 2Y0SE 2DUDA 4IPHA 5GAEC 1IBKQ 4DR2Q 4PZ6A 1PH8A 3S1QH 1PH7A 4A76A 3J7A5 4HJ7A 2KHIA 1FGUA 2Z6KA 1IBML 1CKNB 3A5UA 3PF4A 1M90C 4A93G 2AWNA 1GD7A 1KIXA 5IYDH 1HNZQ 2N49A 2UUAL 4JI5Q 4ALPA 4A4IA 2Q2TA 3PIOA 4B3MQ 1TXYA 4OWWB 2JA9A 1YHAA 3HOXG 3PO3G 1IXRA 2ASBA 3JC66 2R7FA 4BBRG 1VQNA 4A3DH 1IBLL 1GKHA 4JI8L 3M7NA 3F1ZA 1Z47A 3W1GA 2R93G 4KI0A 2UUBL 4IPGA 4R4OA 5IE8A 4JI3L 1VS0A 3GTKH 4A3DG 4MZ9A 4GN4B 4JI0L 5HY6A 4LW1A 1N8RC 1VQBA 1PH6A 4A3LH 3RLOA 5JEAJ 4L5QA 1I5FA 3PUYA 4NPSA 1K9MC 5LMUQ 1YJ9A 4GKJL 2JA7H 1K8GA 3FKIG 2KENA 2MO0A 3CC2A 4A3FH 4BXXG 5C0XG 3PUWA 5IP7G 3GTLH 1MJEA 4LFAL 2OQ0A 4DUYL 4C3JH 2UXCQ 5C4XG 4DV0L 2K4KA 1PH2A 1VQKA 3MXNB 3W1BA 4A3EG 2IHFA 1K3RA 3A0JA 3PCOB 3PV0A 4WJ3M 3RNUA 4QL5A 1XMQL 2PNHA 1PH5A 3HOWH 4EQ5A 2UUCL 4DV2Q 2QEXA 3HOZH 4GNXC 2NVYH 1YJWA 1KL9A 4IFDJ 1XJVA 3H15A 4EX5A 4BY7G 1NBWA 3U58A 4HJ5A 4DK6C 2UU9L 2LXKA 3HOWG 4GN3B 2E2HH 1S72A 1VQDA 3I7FA 3NBHB 4H02A 4JI0Q 2D0OA 3I4OA 4DK3C 2E8GA 4UP7A 4DV7L 3JAMi 2MNAA 4IO9A 4L5SA 4K0KQ 4IOCA 4A3KH 4JI7L 2CWAA 2LSSA 3T1HL 1K8AC 4DR1L 3PSIA 2K5VA 2JA8G 5IWAQ 1VQAA 1Q86C 2IHEA 4LFAQ 3F2CA 5C44H 1PH3A 4XTCS 5M3MG 1PA6A 1B7YB 3KLWA 1TWAH 1QZHA 4A3KG 3HOVH 5JJIA 2RCNA 1HR0L 1ASYA 1SROA 3ERSX 3PUVA 4JOIA 4O2DA 4P71A 1UE7A 4DV5L 4A3MG 2R7ZG 2DGYA 3NEMA 3CPFA 1XMQQ 1NMFA 1E7ZA 4LFCL 3AFPA 4YWKA 2UUCQ 4QIWE 2CCZA 1XNQL 2AHOB 4A3GG 3GD7A 4LUZA 2VS1A 1TWGH 2XGTA 3K7AH 2UU9Q 2UXDL 3TQYA 5M3FG 5BR8L 1Y1WH 1QUQB 1BBUA 3A5ZB 2OTLA 3H3VH 3HOUH 2I0QA 3PUXA 2AMCB 3S1NH 2N8NA 3UE0A 1KQSA 4JI7Q 4YWMA 4DR4L 3T1HQ 2B29A 3RZDH 2ZTCA 4LF6Q 4JI6L 4JI2L 1OXUA 1QVGA 4DKAC 4JC0A 4A3BG 1Z9FA 3G71A 1QUQA 1E1TA 1EFWA 1PYBA 2NN6I 1VQFA 5FJ8H 2WFWA 2JK8A 3I55A 3D31A 1HR0Q 1BKBA 3UDIA 3GTMH 4LF4Q 1C9OA 5GAGC 1XPOA 1XNQQ 4KHZA 3STBC 1JE5A 1Q8KA 4APVA 5FLMH 2IT1A 5DLQE 2JQOA 1YITA 4BA1I 1B70B 4L5TA 2UXDQ 1EWIA 4TVAB 3PO2H 3S14H 5BR8Q 3I4MG 4DNIA 1K83H 1OTCA 4OXPA 4NXNL 2VL6A 2JEBI 1Q46A 2KCTA 3PIPA 3CCVA 4IJLA 3BJUA 1JJ2A 1HR0W 5IP9G 1N36Q 3J81c 3HKZE 4XIGS 1VQ5A 1EQQA 2XTIA 1EQRA 4JI1Q 1OXVA 4MNOA 2A8VA 1XPUA 3I4NH 4AYBE 1TWHH 5GROA 2C35B 4AH6A 2E5LL 1N9WA 3CCLA 3CQZH 2VQFQ 4AQYL 1CSQA 1X65A 3AQQA 4FDBA 2H5XA 3CC4A 4GNXB 1CKMA 1VQJA 3CXCA 2MFIA 3G48A 3HKSA 1VQ8A 1QVFA 3KF8B 1E3PA 1HNWL 5IYDG 4O0AA 4X65L 3J7ZC 3CMAA 3M9BA 1CKNA 3F8TA 1N34L 2WB1G 4LF5L 4IFDG 2NVQH 4WJ4A 2LXJA 4LUVA 3KJPA 4P73A 4OO1G 3OYYA 5IY0A 4LUOA 1Q81C 1MKHA 1NJIC 3S1RH 4LWCA 1RL2A 2AKWB 3RR5A 1VQ4A 4NXNQ 4X64L 5J3BA 1FJGL 2QA4A 2EXDA 2WAQE 4R1JA 2BH8A 2RF4A 1WCMH 4DR3L 3UDGA 1JJCB 1SE8A 4HIKA 3RN2A 1VQ9A 2R6GA 1HZAA 1ASZA 1IBMQ 3CP0A 4A3LG 3I56A 3DM3A 1X9NA 4B3TL 1VCIA 4DAYB 1BBWA 1WCMG 3E9HA 3G4SA 2JA7G 1VQHA 4HJ8A 1GM5A 5IYCH 4AQYQ 2UUAQ 2AWOA 4A3FG 4YWLA 1SR3A 4A3CH 5IYBH 3AYHB 4JCVE 3J80c 1UE6A 3KYHC 3SGIA 5C3EH 3KFUA 3UE1A 4LF7L 1Q7YC 4X65Q 4JI4L 4DR7L 3D0FA 3HFZB 3M4QA 2VW9A 1N34Q 4OWXB 1IBLQ 4LF5Q 2ZTDA 1D7QA 3ZJYC 4JI8Q 1GVPA 2K50A 3EBEA 4A3CG 2OQKA 4QY7A 5C3EG 1K0RA 3ULPA 1NMGA 1J6QA 2PI2E 2UUBQ 4B3SL 4JI3Q 3HOZG 1B8AA 4DV6L 2F52A 4QQBX 4OWTB 3GDEA 4QGUA 1W3SA 5M5YH 1FJGQ 2YTYA 3KJOA 1MJCA 3S2HH 4GKJQ 2GVAA 5FLXc 2NZOA 2D62A 4DV1L 4DR3Q 1VQLA 3M85A 4DR6L 1L1OC 3CCJA 3CCUA 2OTJA 1XTDA 5LMNL 4DUYQ 3M4PA 4DV0Q 1A8VA 3IRBA 4B3TQ 4OX9L 1N33L 1WYDA 3NELA 1KAWA 1X3EA 2CFMA 1QVCA 2I5MX 1AH9A 1RIPA 3STBD 3CD6A 3RLNA 3HOYH 3TREA 2YU9H 4LF7Q 5C44G 2Q2IA 3LGJA 5AJ3L 1HZ9A 1TWCH 4JI4Q 3A74A 1KD1C 1KXLA 2PQAB 3HOVG 1CKOA 1E22A 1PHJA 5EAYA 2CKZB 1PYSB 1SN8A 1A0IA 3L7ZC 4HIOA 2ZM6L 2HQLA 2JA6H 2Z0SA 3HOYG 2YYZA 1VQOA 4B3SQ 3WWVA 1LM0A 2IX1A 2KBNA 3S24A 1S40A 3MEFA 4DV7Q 5C0XI 4A75A 4A3JH 1SLJA 2PQAA 2QGQA 4DV1Q 1IL2A 4NB3A 2BH2A 3EN2A 5IT9c 2ZTEA 1C7YA 3TRZA 4DR1Q 1CUKA 4AIMA 1IZ6A 1Y1WG 3AEVA 4X62L 4JG2A 1A62A 1WOCA 1JB7A 4R4CA 4HJAA 1R9TH 3HOUG 1V43A 1HH2P 1AE3A 1VQGA 3K0XA 3VDYA 4L5RC 2CQOA 4DV3L 1N33Q 1HZCA 2JE6I 3FP9A 3CW2C 2R92H 4JBKA 2A1AA 1X3GA 1X56A 3KF6B 2V1CC 1S3OA 4DV5Q 1JT8A 1XMOL 1FVIA 5M5WH 3K80C 1Q1EA 3RZOH 4YCUA 2E2JH 4LFCQ 2F4VL 3AFQA 2RHSB 5FJ8G 2Q2UA 2Y0SG 4DR5L 2R92G 4BY1H 1IBKL 4DR2L 1VQ7A 2ZM6Q 3GTGH 1AE2A 1OXTA 1EIYB 1VQPA 1W2BA 1J5EL 4IPDA 1KRTA 1LUZA 5LMNW 2VY3A 4PMWA 1PH4A 4UPAA 1PFSA 2I5HA 4PG3A 2FXQA 4P75A 4GS3A 4OONA 5FLMG 2HIVA 4NXML 3I2ZA 1MIUA 1HNXL 2ATWA 1PH9A 1V9PA 3CCEA 2JA5H 3PO2G 4DR4Q 3CMEA 1G51A 4JV5L 3ULJA 3BZKA 3PF5A 3OW2A 4X62Q 1CSPA 4JI2Q 4GOPB 4R4IA 4A3IH 2VUMH 3TS2A 4DV3Q 3GTQH 4J15A 4TQUS 2JJQA 1PV4A 2F3IA 1N32L 1XMOQ 4KLKA 4PZ8A 3I4NG 1Q12A 4A93H 2UXBL 1U0LA 4X6AH 2ID0A 1T9HA 4JBJA 5LMUL 4B3RL 1E1OA 2RHQB 4UP8A 2VQEL 1I94L 1J5EQ 3GTJH 4JYAL 1XPRA 3F2DA 3S15H 3UDXA 1YIJA 4GNXA 4X66L 3HOXH 3PO3H 2UXCL 5C4JH 3CCRA 3K7UC 3B6YA 2A19A 2D0PA 4BBRH 4DPGA 2E2IH 1L1OB 4NXMQ 4GLVB 3J81i 1HNXQ 4GLAC 3H3VI 3UDFA 1EOVA 4JV5Q 2R93H 4GN5A 1YZ6A 4DUZL 1M1KC 2ES2A 2MQHA 2K75A 3F2BA 4DV2L 4RMFA 2ZJPA 4LF8L 4GOPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UP9 A;  1WI5 A;  2E5L Q;  1E24 A;  3H0G H;  4BA2 I;  1L1O A;  1IYJ B;  1K73 C;  1N32 Q;  1OXS C;  3FKI H;  3CF5 A;  5GAH C;  3M3Y H;  2Z6K C;  4BXX H;  3KOJ A;  1HNW Q;  1I3Q H;  1L0W A;  3T1Y L;  1UE5 A;  5IP7 H;  5IYC G;  2UXB Q;  3CAM A;  3H0G G;  2WB1 E;  2K5H A;  5C4X H;  1VQC A;  5K36 G;  4HID A;  5IYB G;  3JAM c;  3M4O H;  1YHB A;  4IOA A;  4B3R Q;  4K0K L;  3RLF A;  2NVX H;  4A3E H;  1Y1V H;  2VQE Q;  1I94 Q;  1P8L A;  4JYA Q;  1YVC A;  2K52 A;  3K8A A;  1KC8 C;  5IWA L;  1EIF A;  2OWO A;  5GAD C;  4X66 Q;  1DGS A;  1G6P A;  2YV5 A;  4X64 Q;  4HJ9 A;  1Q82 C;  4MTN A;  4GKK L;  1Q1B A;  2B63 H;  1HZB A;  1Y1V G;  2I5L X;  1H95 A;  2PI2 A;  2ALY B;  4YCW A;  3ULL A;  3CCM A;  5ELO A;  1VQI A;  3U4V A;  1YJN A;  1PH1 A;  4BY7 H;  2NN6 G;  2Q2H A;  4C3I H;  4DUZ Q;  4DAM A;  3ICE A;  3U4Z A;  1V1Q A;  1PVO A;  3G6E A;  4JI6 Q;  4ME3 A;  2B63 G;  3S16 H;  4LF8 Q;  3GO5 A;  1WJJ A;  3J80 i;  1TWF H;  2NVT H;  1C0A A;  4RG1 A;  3K81 C;  3TEH B;  4LFB L;  3S2D H;  3J81 j;  4IFD I;  1O7I A;  2HHH L;  4OO1 I;  2N78 A;  4C3H H;  4DR7 Q;  3T1Y Q;  5HGQ A;  1I50 H;  2L15 A;  1UWV A;  3E0E A;  2JA8 H;  1YI2 A;  2WP8 J;  3E9I A;  3EIV A;  5M3M H;  1BVS A;  2BA0 A;  3KDF B;  1Y14 B;  1YBY A;  3W5O A;  4LF6 L;  4P72 A;  4A3M H;  5C0X J;  4LF9 L;  2KHJ A;  1SMX A;  4P74 A;  4DV6 Q;  2R7Z H;  3U50 C;  3S1M H;  4YHH L;  4Y52 H;  4Y7N H;  4R4T A;  1XNR L;  1LTL A;  1GO3 E;  2JA6 G;  4GKK Q;  4DV4 L;  2CWP A;  3L0O A;  2YTV A;  1WFQ A;  2IX0 A;  4QJF A;  3FHW A;  4DR6 Q;  4JBM A;  4A3G H;  1D8L A;  4UY8 C;  3GTO H;  2HIX A;  1VQM A;  1UE1 A;  4LF4 L;  1NTG A;  3KDF A;  4YY3 L;  5M3F H;  3PGZ A;  5LMN Q;  1YHQ A;  2HT1 A;  2K5N A;  4KHP L;  2NZH A;  1JMC A;  4A3J G;  2ZJQ A;  4OX9 Q;  4IPC A;  5GQO A;  5JJK A;  3CPW A;  3Q8D A;  3RN5 A;  1VQ6 A;  2N3S A;  1EYG A;  3OTO L;  4LFB Q;  4HIM A;  1NE3 A;  1HJP A;  5AJ3 Q;  2HHH Q;  1UEB A;  1I6H H;  2VZA A;  2JEA I;  5JJL A;  1A63 A;  2ZJR A;  1QZG A;  1X3F A;  1X54 A;  2KCM A;  2OCE A;  4A3B H;  4PZ7 A;  3L2P A;  4BBS H;  2EQS A;  3PUZ A;  1N36 L;  2GN5 A;  3HKZ G;  4JOI C;  1FL0 A;  4R4Q A;  4IJH A;  2B3G A;  3KF6 A;  4LF9 Q;  1NY4 A;  2K14 A;  1LYL A;  3GTP H;  4JI1 L;  3S17 H;  4AYB G;  4YHH Q;  4BBS G;  1XNR Q;  1HNZ L;  1KHI A;  4BY1 G;  1SRU A;  4GLX A;  4DV4 Q;  2VQF L;  1KRS A;  4YCV A;  2PMZ E;  3ER0 A;  1YEZ A;  4JI5 L;  4C2M H;  2IY5 B;  1JJG A;  4LNQ A;  1SFO H;  2GVB A;  4B3M L;  2MO1 A;  3BU2 A;  5M5X H;  1YNX A;  5H1S E;  4YY3 Q;  4POG A;  1X55 A;  4KHP Q;  3I4M H;  1L2F A;  5E7N A;  3CC7 A;  3TS0 A;  2JA5 G;  1P16 A;  2BA1 A;  1U5K A;  3CCS A;  2EIF A;  3OTO Q;  3CCQ A;  5IP9 H;  4JBW A;  2VNU D;  1VQE A;  2VUM G;  4A3I G;  2F4V Q;  3DLL A;  5JEA G;  1X6O A;  1EUJ A;  1G29 1;  2WAQ G;  2YTX A;  3NEN A;  5ELN A;  4POF A;  4GOP A;  2R7D A;  4DR5 Q;  3BZC A;  1OXX K;  2Y0S E;  2DUD A;  4IPH A;  5GAE C;  1IBK Q;  4DR2 Q;  4PZ6 A;  1PH8 A;  3S1Q H;  1PH7 A;  4A76 A;  3J7A 5;  4HJ7 A;  2KHI A;  1FGU A;  2Z6K A;  1IBM L;  1CKN B;  3A5U A;  3PF4 A;  1M90 C;  4A93 G;  2AWN A;  1GD7 A;  1KIX A;  5IYD H;  1HNZ Q;  2N49 A;  2UUA L;  4JI5 Q;  4ALP A;  4A4I A;  2Q2T A;  3PIO A;  4B3M Q;  1TXY A;  4OWW B;  2JA9 A;  1YHA A;  3HOX G;  3PO3 G;  1IXR A;  2ASB A;  3JC6 6;  2R7F A;  4BBR G;  1VQN A;  4A3D H;  1IBL L;  1GKH A;  4JI8 L;  3M7N A;  3F1Z A;  1Z47 A;  3W1G A;  2R93 G;  4KI0 A;  2UUB L;  4IPG A;  4R4O A;  5IE8 A;  4JI3 L;  1VS0 A;  3GTK H;  4A3D G;  4MZ9 A;  4GN4 B;  4JI0 L;  5HY6 A;  4LW1 A;  1N8R C;  1VQB A;  1PH6 A;  4A3L H;  3RLO A;  5JEA J;  4L5Q A;  1I5F A;  3PUY A;  4NPS A;  1K9M C;  5LMU Q;  1YJ9 A;  4GKJ L;  2JA7 H;  1K8G A;  3FKI G;  2KEN A;  2MO0 A;  3CC2 A;  4A3F H;  4BXX G;  5C0X G;  3PUW A;  5IP7 G;  3GTL H;  1MJE A;  4LFA L;  2OQ0 A;  4DUY L;  4C3J H;  2UXC Q;  5C4X G;  4DV0 L;  2K4K A;  1PH2 A;  1VQK A;  3MXN B;  3W1B A;  4A3E G;  2IHF A;  1K3R A;  3A0J A;  3PCO B;  3PV0 A;  4WJ3 M;  3RNU A;  4QL5 A;  1XMQ L;  2PNH A;  1PH5 A;  3HOW H;  4EQ5 A;  2UUC L;  4DV2 Q;  2QEX A;  3HOZ H;  4GNX C;  2NVY H;  1YJW A;  1KL9 A;  4IFD J;  1XJV A;  3H15 A;  4EX5 A;  4BY7 G;  1NBW A;  3U58 A;  4HJ5 A;  4DK6 C;  2UU9 L;  2LXK A;  3HOW G;  4GN3 B;  2E2H H;  1S72 A;  1VQD A;  3I7F A;  3NBH B;  4H02 A;  4JI0 Q;  2D0O A;  3I4O A;  4DK3 C;  2E8G A;  4UP7 A;  4DV7 L;  3JAM i;  2MNA A;  4IO9 A;  4L5S A;  4K0K Q;  4IOC A;  4A3K H;  4JI7 L;  2CWA A;  2LSS A;  3T1H L;  1K8A C;  4DR1 L;  3PSI A;  2K5V A;  2JA8 G;  5IWA Q;  1VQA A;  1Q86 C;  2IHE A;  4LFA Q;  3F2C A;  5C44 H;  1PH3 A;  4XTC S;  5M3M G;  1PA6 A;  1B7Y B;  3KLW A;  1TWA H;  1QZH A;  4A3K G;  3HOV H;  5JJI A;  2RCN A;  1HR0 L;  1ASY A;  1SRO A;  3ERS X;  3PUV A;  4JOI A;  4O2D A;  4P71 A;  1UE7 A;  4DV5 L;  4A3M G;  2R7Z G;  2DGY A;  3NEM A;  3CPF A;  1XMQ Q;  1NMF A;  1E7Z A;  4LFC L;  3AFP A;  4YWK A;  2UUC Q;  4QIW E;  2CCZ A;  1XNQ L;  2AHO B;  4A3G G;  3GD7 A;  4LUZ A;  2VS1 A;  1TWG H;  2XGT A;  3K7A H;  2UU9 Q;  2UXD L;  3TQY A;  5M3F G;  5BR8 L;  1Y1W H;  1QUQ B;  1BBU A;  3A5Z B;  2OTL A;  3H3V H;  3HOU H;  2I0Q A;  3PUX A;  2AMC B;  3S1N H;  2N8N A;  3UE0 A;  1KQS A;  4JI7 Q;  4YWM A;  4DR4 L;  3T1H Q;  2B29 A;  3RZD H;  2ZTC A;  4LF6 Q;  4JI6 L;  4JI2 L;  1OXU A;  1QVG A;  4DKA C;  4JC0 A;  4A3B G;  1Z9F A;  3G71 A;  1QUQ A;  1E1T A;  1EFW A;  1PYB A;  2NN6 I;  1VQF A;  5FJ8 H;  2WFW A;  2JK8 A;  3I55 A;  3D31 A;  1HR0 Q;  1BKB A;  3UDI A;  3GTM H;  4LF4 Q;  1C9O A;  5GAG C;  1XPO A;  1XNQ Q;  4KHZ A;  3STB C;  1JE5 A;  1Q8K A;  4APV A;  5FLM H;  2IT1 A;  5DLQ E;  2JQO A;  1YIT A;  4BA1 I;  1B70 B;  4L5T A;  2UXD Q;  1EWI A;  4TVA B;  3PO2 H;  3S14 H;  5BR8 Q;  3I4M G;  4DNI A;  1K83 H;  1OTC A;  4OXP A;  4NXN L;  2VL6 A;  2JEB I;  1Q46 A;  2KCT A;  3PIP A;  3CCV A;  4IJL A;  3BJU A;  1JJ2 A;  1HR0 W;  5IP9 G;  1N36 Q;  3J81 c;  3HKZ E;  4XIG S;  1VQ5 A;  1EQQ A;  2XTI A;  1EQR A;  4JI1 Q;  1OXV A;  4MNO A;  2A8V A;  1XPU A;  3I4N H;  4AYB E;  1TWH H;  5GRO A;  2C35 B;  4AH6 A;  2E5L L;  1N9W A;  3CCL A;  3CQZ H;  2VQF Q;  4AQY L;  1CSQ A;  1X65 A;  3AQQ A;  4FDB A;  2H5X A;  3CC4 A;  4GNX B;  1CKM A;  1VQJ A;  3CXC A;  2MFI A;  3G48 A;  3HKS A;  1VQ8 A;  1QVF A;  3KF8 B;  1E3P A;  1HNW L;  5IYD G;  4O0A A;  4X65 L;  3J7Z C;  3CMA A;  3M9B A;  1CKN A;  3F8T A;  1N34 L;  2WB1 G;  4LF5 L;  4IFD G;  2NVQ H;  4WJ4 A;  2LXJ A;  4LUV A;  3KJP A;  4P73 A;  4OO1 G;  3OYY A;  5IY0 A;  4LUO A;  1Q81 C;  1MKH A;  1NJI C;  3S1R H;  4LWC A;  1RL2 A;  2AKW B;  3RR5 A;  1VQ4 A;  4NXN Q;  4X64 L;  5J3B A;  1FJG L;  2QA4 A;  2EXD A;  2WAQ E;  4R1J A;  2BH8 A;  2RF4 A;  1WCM H;  4DR3 L;  3UDG A;  1JJC B;  1SE8 A;  4HIK A;  3RN2 A;  1VQ9 A;  2R6G A;  1HZA A;  1ASZ A;  1IBM Q;  3CP0 A;  4A3L G;  3I56 A;  3DM3 A;  1X9N A;  4B3T L;  1VCI A;  4DAY B;  1BBW A;  1WCM G;  3E9H A;  3G4S A;  2JA7 G;  1VQH A;  4HJ8 A;  1GM5 A;  5IYC H;  4AQY Q;  2UUA Q;  2AWO A;  4A3F G;  4YWL A;  1SR3 A;  4A3C H;  5IYB H;  3AYH B;  4JCV E;  3J80 c;  1UE6 A;  3KYH C;  3SGI A;  5C3E H;  3KFU A;  3UE1 A;  4LF7 L;  1Q7Y C;  4X65 Q;  4JI4 L;  4DR7 L;  3D0F A;  3HFZ B;  3M4Q A;  2VW9 A;  1N34 Q;  4OWX B;  1IBL Q;  4LF5 Q;  2ZTD A;  1D7Q A;  3ZJY C;  4JI8 Q;  1GVP A;  2K50 A;  3EBE A;  4A3C G;  2OQK A;  4QY7 A;  5C3E G;  1K0R A;  3ULP A;  1NMG A;  1J6Q A;  2PI2 E;  2UUB Q;  4B3S L;  4JI3 Q;  3HOZ G;  1B8A A;  4DV6 L;  2F52 A;  4QQB X;  4OWT B;  3GDE A;  4QGU A;  1W3S A;  5M5Y H;  1FJG Q;  2YTY A;  3KJO A;  1MJC A;  3S2H H;  4GKJ Q;  2GVA A;  5FLX c;  2NZO A;  2D62 A;  4DV1 L;  4DR3 Q;  1VQL A;  3M85 A;  4DR6 L;  1L1O C;  3CCJ A;  3CCU A;  2OTJ A;  1XTD A;  5LMN L;  4DUY Q;  3M4P A;  4DV0 Q;  1A8V A;  3IRB A;  4B3T Q;  4OX9 L;  1N33 L;  1WYD A;  3NEL A;  1KAW A;  1X3E A;  2CFM A;  1QVC A;  2I5M X;  1AH9 A;  1RIP A;  3STB D;  3CD6 A;  3RLN A;  3HOY H;  3TRE A;  2YU9 H;  4LF7 Q;  5C44 G;  2Q2I A;  3LGJ A;  5AJ3 L;  1HZ9 A;  1TWC H;  4JI4 Q;  3A74 A;  1KD1 C;  1KXL A;  2PQA B;  3HOV G;  1CKO A;  1E22 A;  1PHJ A;  5EAY A;  2CKZ B;  1PYS B;  1SN8 A;  1A0I A;  3L7Z C;  4HIO A;  2ZM6 L;  2HQL A;  2JA6 H;  2Z0S A;  3HOY G;  2YYZ A;  1VQO A;  4B3S Q;  3WWV A;  1LM0 A;  2IX1 A;  2KBN A;  3S24 A;  1S40 A;  3MEF A;  4DV7 Q;  5C0X I;  4A75 A;  4A3J H;  1SLJ A;  2PQA A;  2QGQ A;  4DV1 Q;  1IL2 A;  4NB3 A;  2BH2 A;  3EN2 A;  5IT9 c;  2ZTE A;  1C7Y A;  3TRZ A;  4DR1 Q;  1CUK A;  4AIM A;  1IZ6 A;  1Y1W G;  3AEV A;  4X62 L;  4JG2 A;  1A62 A;  1WOC A;  1JB7 A;  4R4C A;  4HJA A;  1R9T H;  3HOU G;  1V43 A;  1HH2 P;  1AE3 A;  1VQG A;  3K0X A;  3VDY A;  4L5R C;  2CQO A;  4DV3 L;  1N33 Q;  1HZC A;  2JE6 I;  3FP9 A;  3CW2 C;  2R92 H;  4JBK A;  2A1A A;  1X3G A;  1X56 A;  3KF6 B;  2V1C C;  1S3O A;  4DV5 Q;  1JT8 A;  1XMO L;  1FVI A;  5M5W H;  3K80 C;  1Q1E A;  3RZO H;  4YCU A;  2E2J H;  4LFC Q;  2F4V L;  3AFQ A;  2RHS B;  5FJ8 G;  2Q2U A;  2Y0S G;  4DR5 L;  2R92 G;  4BY1 H;  1IBK L;  4DR2 L;  1VQ7 A;  2ZM6 Q;  3GTG H;  1AE2 A;  1OXT A;  1EIY B;  1VQP A;  1W2B A;  1J5E L;  4IPD A;  1KRT A;  1LUZ A;  5LMN W;  2VY3 A;  4PMW A;  1PH4 A;  4UPA A;  1PFS A;  2I5H A;  4PG3 A;  2FXQ A;  4P75 A;  4GS3 A;  4OON A;  5FLM G;  2HIV A;  4NXM L;  3I2Z A;  1MIU A;  1HNX L;  2ATW A;  1PH9 A;  1V9P A;  3CCE A;  2JA5 H;  3PO2 G;  4DR4 Q;  3CME A;  1G51 A;  4JV5 L;  3ULJ A;  3BZK A;  3PF5 A;  3OW2 A;  4X62 Q;  1CSP A;  4JI2 Q;  4GOP B;  4R4I A;  4A3I H;  2VUM H;  3TS2 A;  4DV3 Q;  3GTQ H;  4J15 A;  4TQU S;  2JJQ A;  1PV4 A;  2F3I A;  1N32 L;  1XMO Q;  4KLK A;  4PZ8 A;  3I4N G;  1Q12 A;  4A93 H;  2UXB L;  1U0L A;  4X6A H;  2ID0 A;  1T9H A;  4JBJ A;  5LMU L;  4B3R L;  1E1O A;  2RHQ B;  4UP8 A;  2VQE L;  1I94 L;  1J5E Q;  3GTJ H;  4JYA L;  1XPR A;  3F2D A;  3S15 H;  3UDX A;  1YIJ A;  4GNX A;  4X66 L;  3HOX H;  3PO3 H;  2UXC L;  5C4J H;  3CCR A;  3K7U C;  3B6Y A;  2A19 A;  2D0P A;  4BBR H;  4DPG A;  2E2I H;  1L1O B;  4NXM Q;  4GLV B;  3J81 i;  1HNX Q;  4GLA C;  3H3V I;  3UDF A;  1EOV A;  4JV5 Q;  2R93 H;  4GN5 A;  1YZ6 A;  4DUZ L;  1M1K C;  2ES2 A;  2MQH A;  2K75 A;  3F2B A;  4DV2 L;  4RMF A;  2ZJP A;  4LF8 L;  4GOP C; 
#chains in the Genus database with same CATH topology
 1EU4 A;  3H0G H;  5CC4 A;  4BA2 I;  1L1O A;  5CBA E;  1K73 C;  2CW0 C;  1FNU A;  2EZV A;  1SXT A;  2UXB Q;  1VQC A;  4HID A;  2Q8R E;  4IOA A;  1CTM A;  4XYQ A;  1EIF A;  5HUR A;  3TP6 A;  1LLR D;  3GTK B;  5J39 A;  3FPP A;  4OIJ A;  1Q1B A;  3VR2 A;  1HZB A;  2B63 H;  4GKK L;  1H95 A;  3ULL A;  1V1O A;  2LS0 1;  1VQI A;  5ELO A;  1PH1 A;  3OMG A;  3M4O B;  2NN6 G;  4DAM A;  1ENA A;  3TZU A;  3S16 H;  4ME3 A;  4RH6 A;  4C3J B;  5A2Q E;  3QOJ A;  3TEH B;  4LFB L;  5IGF A;  4IFD I;  2RDF A;  4RFB A;  5M9O A;  1FNV A;  2HHH L;  3DXJ C;  2N78 A;  4DR7 Q;  1I50 H;  1UWV A;  3EIV A;  5M3M H;  1KNE A;  3SK4 A;  1Y69 U;  1YBY A;  4LF6 L;  1TWF B;  4P72 A;  4LF9 L;  4P74 A;  4DV6 Q;  4IUV A;  3L3O C;  3S2D B;  4KJN A;  4R4T A;  5JAV A;  4Y7N H;  1WTP A;  1S5B D;  4GKK Q;  4DV4 L;  1WFQ A;  1KLU D;  1VQM A;  4YY3 L;  1YHQ A;  5LMN Q;  2NZH A;  1JMC A;  1PTO D;  3CPW A;  4JPB W;  1TWA B;  1QCB D;  4RGO S;  4LFB Q;  4RGT A;  1O80 A;  1STB A;  1STN A;  4ZKC B;  5JJZ A;  4F7X A;  1TS5 A;  2HHH Q;  4A3G B;  1DXM A;  2OCE A;  4BBS H;  4X3K A;  4N9T A;  4KD3 A;  2MJ8 A;  1TWG B;  4LF9 Q;  1SBB B;  3QR8 A;  1MI2 A;  4DV4 Q;  2VQF L;  2PMZ E;  3ER0 A;  3V96 A;  2Z4H A;  1YNJ D;  4A3B B;  2F3W A;  3I4L A;  1B3Q A;  2WIN B;  3HRZ C;  4YY3 Q;  4POG A;  3RZD B;  3I4M H;  1BCP D;  3SK8 A;  1L2F A;  1MSH A;  5E7N A;  2F0F A;  3S17 B;  3TS0 A;  2JA5 G;  1P16 A;  3H09 A;  3CCS A;  5E4W C;  2EIF A;  3CCQ A;  4BS9 A;  2VNU D;  4A3I G;  3FVQ A;  5T1I A;  3DLL A;  1X6O A;  1G29 1;  2YTX A;  4GOP A;  3GTM B;  4POF A;  4ID6 A;  2DUD A;  2IW3 A;  2CH4 A;  4H13 C;  4RCN A;  2OT2 A;  2Z6K A;  1IBM L;  1CKN B;  3QG1 A;  2B2U A;  3A5U A;  4CDC C;  1M90 C;  2XWJ B;  1X32 A;  3D3R A;  3S14 B;  1PZJ D;  1NUC A;  1V1P A;  3KLS X;  1AN8 A;  1HTL D;  4ALP A;  5JPN C;  4OWW B;  4OGQ C;  3HOX G;  4X3U A;  3JC6 6;  2R7F A;  2F1M A;  4KD4 A;  2QW7 A;  4I7Z C;  4FF1 A;  4G4K A;  2LFN A;  3OWF A;  4PMC A;  3SDZ A;  1Y8O B;  2WB1 B;  3E3X A;  1VS0 A;  4PQX A;  1YNN C;  4JI3 L;  4DFA A;  1VQB A;  5I9P A;  1PH6 A;  1PFB A;  3BZD B;  3EVQ A;  1EYD A;  1CZG A;  3VA5 A;  5LMU Q;  3J80 E;  5DAU A;  1K8G A;  5C0X G;  2XN9 C;  5IP7 G;  3GTL H;  4MTK A;  2OQ0 A;  4DUY L;  5COR A;  4DV0 L;  5DNF A;  1TY2 A;  4DNT B;  1K3R A;  2QDL A;  4K5V A;  4WJ3 M;  1PH5 A;  3BYT B;  2JA7 B;  5C6A A;  1GUO A;  2D5D A;  5CV5 A;  1QB5 D;  3VYR A;  1XJV A;  4RGN A;  1B50 A;  1LAC A;  4DK6 C;  4GN3 B;  4IQZ A;  3I7F A;  3I4O A;  2E8G A;  4UP7 A;  5C3E B;  4FVM A;  3HOZ B;  4K0K Q;  2RKS A;  1NSN S;  4DR1 L;  2JA8 G;  5IWA Q;  5C4Z A;  3K5N A;  3KLS A;  2E2H B;  1IW7 C;  4XTC S;  3C46 A;  1QZH A;  1PTO H;  3HOV H;  2RCN A;  1ASY A;  1SRO A;  1KDC A;  1UE7 A;  5I2X A;  3NWT A;  2EY2 A;  1E7Z A;  4K8I A;  4ZK9 B;  2AHO B;  2F0J A;  4A3G G;  5C44 B;  2VS1 A;  3BDL A;  1L0Y B;  1QWY A;  1RD9 D;  4CDD C;  4NP5 A;  5BR8 L;  4DK1 A;  5M3F G;  1QUQ B;  1Y1W H;  1SDF A;  1WTX A;  1BBU A;  3A5Z B;  5FLX L;  1T5X D;  2AMC B;  3KBG A;  3Q23 A;  3R2I A;  3UE0 A;  4WOR A;  4DR4 L;  2B29 A;  3QJY A;  2A73 B;  1MGS A;  2Z1C A;  3K7A B;  4QMG A;  4A3B G;  2CH4 W;  5FJ8 H;  3I55 A;  3NTH A;  4RCO A;  1JWM D;  1BKB A;  5G3L D;  4A3J B;  2MP1 A;  3FPU B;  1B53 A;  2K05 A;  1B1Z A;  3VR4 A;  1C9O A;  1XPO A;  1HRJ A;  3MTS A;  3NHH A;  1Q8K A;  4APV A;  3J7A F;  2IT1 A;  2JQO A;  3WOE A;  1B70 B;  4L5T A;  2IWH A;  3T13 A;  1EWI A;  4TVA B;  2R92 B;  5BR8 Q;  1K83 H;  1OTC A;  3SK5 A;  3OIP A;  4RKL A;  2KCT A;  1JJ2 A;  3RZO B;  4IJL A;  3BJU A;  1N36 Q;  4AYB B;  3LWE A;  4BY1 B;  3HS0 C;  1VQ5 A;  2XTI A;  1EQR A;  3F2U A;  3I4N H;  1BR9 A;  1SYG A;  1TWH H;  3CCL A;  4AQY L;  5KND A;  4NMZ A;  3DWQ A;  1BUV T;  1CKM A;  3CXC A;  3G48 A;  1QVF A;  3KF8 B;  1CHP D;  2P5Z X;  3R8B A;  3CMA A;  3ERO A;  1CKN A;  3F8T A;  1RTO A;  2WB1 G;  4IFD G;  2F0V A;  1A3V A;  2EJM A;  3LWU A;  4K5X A;  3SE0 A;  1MKH A;  4L63 B;  3S1R H;  2JXM B;  4OL7 A;  1DOL A;  1RKN A;  4DR3 L;  1SE8 A;  4J6H A;  3RN2 A;  4KMU C;  2K1B A;  2NTS A;  4QB4 A;  1SNO A;  3GTJ B;  3DM3 A;  4DAY B;  1BBW A;  3U9S A;  1LTB D;  3E9H A;  1ONL A;  1VQH A;  2JA7 G;  1HUN A;  2UUA Q;  4AQY Q;  5K36 H;  4A3F G;  2E2I B;  5IYB H;  1EEF D;  3KYH C;  3Q0A A;  3SGI A;  3A8J E;  4LF7 L;  5F2D A;  1ILQ A;  3HFZ B;  3QIA A;  5CBE E;  1D7Q A;  1G6Z A;  2ZTD A;  3ZJY C;  1GVP A;  3EBE A;  3VYT A;  5C3E G;  2UUB Q;  3H0G B;  3HOZ G;  3T16 A;  2SOB A;  4OWT B;  3GDE A;  1II3 A;  5CV4 A;  4NW2 A;  4DF7 A;  3I72 A;  4GKJ Q;  2D62 A;  4DV1 L;  4DR3 Q;  3M85 A;  3D6C A;  3CCU A;  3TZD A;  2K28 A;  5D14 A;  4OX9 L;  4NKL A;  2SDF A;  3GP7 A;  5ELF A;  5I6Y A;  1F9S A;  1KAW A;  1X3E A;  5FO7 B;  1AH9 A;  5M5Y B;  1RIP A;  1G91 A;  2B63 B;  2EXZ A;  3RLN A;  4LF7 Q;  5C44 G;  1TWC H;  3P1H A;  1QIL A;  1JOR A;  2VB3 X;  2PQA B;  3IAY A;  1CKO A;  2Z9H A;  5EAY A;  2CKZ B;  2HCC A;  1SN8 A;  1MBY A;  1QE6 A;  2ZM6 L;  2HQL A;  2PPB C;  3S16 B;  1ROD A;  2YYZ A;  3NSW A;  2RSN A;  2X6L A;  2KBN A;  1Q8I A;  3P7J A;  1A2U A;  5EGT A;  1SLJ A;  1I50 B;  4DV1 Q;  2ZTE A;  1C7Y A;  5M3M B;  1IZ6 A;  3AEV A;  2IL8 A;  4PNY A;  1A62 A;  2JN4 A;  4U68 A;  1R9T H;  3HOU G;  1X3P A;  1W6J A;  1AE3 A;  1VQG A;  4Y7N B;  1GOZ A;  1X56 A;  2A1A A;  2B2V C;  3KF6 B;  1O7Z A;  4DV5 Q;  1IHZ A;  3K80 C;  2RHS B;  2H4O A;  3D8G A;  4DR5 L;  2R92 G;  1XWE A;  3A7A B;  4EVO A;  4DR2 L;  2ZM6 Q;  3C2P A;  2A68 D;  1VQP A;  1W2B A;  2FMM A;  1STH A;  1KRT A;  1LUZ A;  4MN3 A;  2E2D C;  4KHV A;  1PH4 A;  1PFS A;  2PO4 A;  3HKZ B;  4P75 A;  4OON A;  1PYW D;  1EQT A;  2RCF A;  3BVG A;  5EBD A;  1PH9 A;  5D65 A;  1V9P A;  3CCE A;  2O5I C;  4BBS B;  4JV5 L;  1G51 A;  2RSO A;  1UNS A;  3GTG B;  3T51 B;  2VUM H;  1EEI D;  3GTQ H;  4TQU S;  4R9W A;  5IGG A;  2A69 D;  4K2K A;  1N32 L;  1C8C A;  1UEA B;  1L0X B;  4KLK A;  2CVR A;  3GQB A;  3CRL C;  4A93 H;  2K5Q A;  4XT1 B;  5JVH 3;  5IIF A;  3I4M B;  3OSO A;  2RHQ B;  1I94 L;  3F2D A;  1ZEQ X;  5JOB A;  1YIJ A;  2EY5 A;  3PO3 H;  3BDO A;  4OHJ A;  2UXC L;  4CDF C;  3CCR A;  1SMY C;  3KF8 A;  1JQY D;  3HGB A;  4BBR H;  1L1O B;  3I70 A;  1F2L A;  3DWP A;  4JV5 Q;  4DUZ L;  1M1K C;  4DV2 L;  5ELD A;  4JI6 L;  3GTO H;  4LF8 L;  2EYJ A;  5J1Z A;  1H9J A;  1U9R A;  1N32 Q;  1OXS C;  1A3T A;  5GAH C;  1CA6 A;  4BXX H;  3KOJ A;  2R93 B;  4IAL A;  3CAM A;  3DUZ A;  2WB1 E;  3H0G G;  3JAM c;  1YHB A;  2NVX H;  4A3E H;  1Y1V H;  1I94 Q;  1CA5 A;  3K8A A;  1KC8 C;  2A74 C;  3DEP A;  1STA A;  1Q3L A;  2NB0 A;  3FKI B;  4X64 Q;  1Q82 C;  5TSS A;  1I3Q B;  3CCM A;  1CZW A;  3U4V A;  1YJN A;  4BY7 H;  4C3I H;  4DUZ Q;  4DXF A;  3ICE A;  1NCV A;  1V1Q A;  2BDN A;  3G6E A;  4DNR B;  4JI6 Q;  2B63 G;  1J9O A;  4LF8 Q;  3GTL B;  3GO5 A;  1HHV A;  1JWU D;  3PIP 3;  4H7B A;  1C0A A;  4RG1 A;  3K81 C;  2NUC A;  4C3H H;  5HGQ A;  2J4X A;  1B9N A;  2L15 A;  3I91 A;  2WP8 J;  1C4Q A;  1ILP A;  3WOF A;  1BVS A;  1CM9 A;  2KOL A;  1SNC A;  4A3M H;  3A8K E;  5C0X J;  3S1M H;  1CQV A;  1H9R A;  1QNK A;  3J7Y W;  2JA6 G;  2YTV A;  4DR6 Q;  1SNQ A;  4I65 A;  3FHW A;  4WJW A;  2F0N A;  1D8L A;  3TSS A;  4Z9C B;  1UE1 A;  2A6H C;  4LF4 L;  2HT1 A;  4KHP L;  1PZI D;  2ZJQ A;  2R7Z B;  4IPC A;  1B3A A;  2AQ3 B;  3OTO L;  1PTO B;  1WVL A;  1RJT A;  1SJE D;  1HJP A;  5AJ3 Q;  2L0C A;  2VZA A;  2JEA I;  5JJL A;  1A63 A;  1PLF A;  1X3F A;  1X54 A;  2B2Y A;  2KCM A;  2XIW A;  4PZ7 A;  1IKM A;  2HDL A;  1G8Z D;  2GN5 A;  2WII B;  1FR3 A;  1FL0 A;  3HKZ G;  3KLR A;  4JOI C;  1F9R A;  1I4X A;  3KF6 A;  2K14 A;  3GV3 A;  1LYL A;  3GTP H;  1CK1 A;  4BBS G;  5IGD A;  3MAQ A;  1HXY D;  1KRS A;  1I4H A;  2FMC A;  1YEZ A;  4KKU A;  4JI5 L;  1SE3 A;  3VA7 A;  2GVB A;  3RD4 A;  1D6E C;  1JOO A;  1D5Z C;  1YNX A;  1Q90 A;  5H1S E;  4KHP Q;  1ICF B;  5CV6 A;  5FKA C;  1BCP B;  1MHW C;  1PMR A;  3N52 A;  3OTO Q;  5IP9 H;  4JBW A;  1DZ1 A;  1SFO B;  2F4V Q;  4ZRZ A;  1EUJ A;  2BE5 C;  1IYU A;  1V1P B;  3QOL A;  5ELN A;  1AW7 A;  3SVM A;  5M5X B;  5IT9 L;  4IPH A;  5GAE C;  1IBK Q;  4PZ6 A;  3Q6S A;  1PH7 A;  4FF4 A;  3J7A 5;  4KY6 A;  1SND A;  3H91 A;  4HR7 B;  2NTT A;  1GD7 A;  5IYD H;  1LO5 D;  1K83 B;  2F0H A;  2N49 A;  4JI5 Q;  4OO1 H;  5FO8 B;  2JA9 A;  1YHA A;  1FD7 D;  2ASB A;  1F2M A;  1VQN A;  1IBL L;  1GKH A;  3M7N A;  2F0U A;  2R93 G;  4IUP A;  1QG7 A;  1STG A;  3I4N B;  1TY0 A;  1PFM A;  5AFW A;  5BN4 A;  2QKI C;  4GN4 B;  5HY6 A;  1N8R C;  4A3L H;  3RLO A;  5JEA J;  3J81 L;  3PUY A;  3S9W A;  1K9M C;  4ILW A;  3FKI G;  3CC2 A;  1PZK D;  1HQM C;  2B39 A;  4LFA L;  5C4X G;  2K4K A;  3S1R B;  3W1B A;  1EIH A;  1IL8 A;  4F8M A;  3PV0 A;  1XMQ L;  2F0O A;  4EQ5 A;  2NVY H;  4WFN 3;  1YJW A;  1NAP A;  2EYM A;  4IFD J;  4V0B A;  4EX5 A;  1E2V A;  5CR3 A;  1NBW A;  1TS4 A;  4C1N K;  4HJ5 A;  2UU9 L;  2HD3 A;  1QJO A;  2AUK A;  3IFD A;  1WTO A;  1VQD A;  4H02 A;  2D0O A;  1TR5 A;  2AQ1 B;  4K14 A;  4DV7 L;  1K3B C;  3JAM i;  3VR3 A;  4L5S A;  2PZU A;  4FNF A;  1WTH A;  4A3K H;  2L1B A;  2F0M A;  1KNA A;  3E0J A;  3GV6 A;  2AQ2 B;  3BG3 A;  1KDA A;  4LFA Q;  1PH3 A;  2EJF C;  1FNW A;  1RF2 D;  5FOB B;  1BF4 A;  1HR0 L;  1DOK A;  1F9P A;  3ERS X;  4P71 A;  2R7Z G;  3CPF A;  1XMQ Q;  1NMF A;  4IUU A;  3A54 A;  2KHS A;  3OOC A;  2KCC A;  2XGT A;  3HG9 A;  4B9X A;  2UU9 Q;  3TQY A;  2M00 A;  2X69 A;  2XRS D;  1S5D D;  1BO0 A;  4KY5 A;  4F88 A;  1U4L A;  1LTT D;  2E75 C;  1TWC B;  1JE4 A;  5EQ0 A;  1A3U A;  1B44 D;  1SE4 A;  3W2D A;  1JOQ A;  4LF6 Q;  5IOC A;  4JI2 L;  2PZT A;  1QVG A;  3MWY W;  1Z9F A;  3NP8 A;  1PYB A;  1VQF A;  2JK8 A;  1HR0 Q;  1HCZ A;  2C5C A;  2B2T A;  3S1N B;  1VMP A;  4KHZ A;  3STB C;  5A2Q L;  3E5S A;  1R9T B;  1JE5 A;  1YIT A;  2KJX A;  3ND8 A;  3A8I E;  1QOH A;  4CBV A;  3HKZ E;  1SYC A;  2A8V A;  1XPU A;  3PO2 B;  5GRO A;  1PXU A;  2C35 B;  4AH6 A;  2E5L L;  1GHJ A;  1N9W A;  5A35 A;  3CQZ H;  2VQF Q;  3I73 A;  1CSQ A;  1X65 A;  2H5X A;  4RHR A;  4GNX B;  2MFI A;  1HNW L;  4OEM B;  4EQO A;  2TSS A;  4X65 L;  3HZX A;  3M9B A;  4WJ4 A;  2LXJ A;  4LUV A;  2VUM B;  4CKE A;  4LUO A;  5IY0 A;  4XQQ A;  1Q81 C;  3GTQ B;  1DJR D;  2EYL A;  3QB3 A;  3RR5 A;  3R3O A;  1S5E D;  5D3I B;  4A93 B;  2NVQ B;  2R6G A;  1ASZ A;  2IPK D;  1IBM Q;  3CP0 A;  2K03 A;  2MGS A;  5KRU A;  4B3T L;  3G4S A;  3PO3 B;  2AWO A;  4YWL A;  4A3C H;  3NTK A;  4JCV E;  3J80 c;  3ITP A;  4Q0F A;  4FO2 A;  3KFU A;  2QEJ C;  4C3J G;  5I2Y A;  5I9O A;  4X65 Q;  4JI4 L;  2A6E C;  3M4Q A;  1H9K A;  1B9M A;  5FLX E;  2K50 A;  4ULL A;  4QY7 A;  3GTO B;  4H44 C;  3TP8 A;  2E76 C;  2LMC B;  3ULP A;  4B3S L;  4JI3 Q;  2F52 A;  4QQB X;  2B8F A;  1W3S A;  2KUM A;  2GVA A;  5FLX c;  2K6A A;  1L1O C;  4NDX A;  3CCJ A;  3E6Z X;  1Y1V B;  2ICI A;  4DXG A;  4DUY Q;  3M4P A;  4F87 A;  4EQP A;  3IRB A;  4DV0 Q;  4B3T Q;  1S5C D;  2O2L D;  1LT4 D;  5HGT A;  2RDH A;  3S2H B;  1WTW A;  1SNP A;  2Q2I A;  3I90 A;  1HZ9 A;  1H9M A;  4JI4 Q;  3A74 A;  2CQA A;  4C3I B;  1PHJ A;  5LHY 1;  3MA2 B;  1PYS B;  4HMJ A;  1ICW A;  3FEW X;  5IGC A;  3FRP B;  3MHB A;  3RMH A;  4B3S Q;  3H6M A;  3MEF A;  4DAP A;  3TRZ A;  4DR1 Q;  4AIM A;  1K8O A;  4JG2 A;  3TBI B;  4A3M B;  3VDY A;  2QDB A;  4DV3 L;  2JE6 I;  4HTH A;  1JT8 A;  1XMO L;  5M5W H;  2RDG A;  1PFN A;  3EQL C;  4RAU C;  4DN4 M;  1ML0 D;  1AE2 A;  2L5T A;  3D4R A;  4PMW A;  2FJ2 A;  2I5H A;  3BVM A;  3K5M A;  1PRT D;  5FLM G;  2E2J B;  1TU2 B;  3TDQ A;  1DYQ A;  2JA5 H;  3PO2 G;  4DR4 Q;  3CME A;  3ULJ A;  3PF5 A;  1CSP A;  2KEC A;  1NR4 A;  3M7G A;  5CV7 A;  4KKS A;  4A3I H;  3TS2 A;  4DV3 Q;  3GTP B;  4J15 A;  4HSV A;  2K7V A;  1XMO Q;  1JWS D;  2MPM A;  2TMP A;  1PTO C;  2J7Z A;  1KLG D;  3MFG A;  5L37 A;  1U0L A;  1T9H A;  1FGB D;  1U4P A;  3ERQ A;  4B3R L;  1D2B A;  1VF5 C;  1E1O A;  4JYA L;  2VQE L;  1QNU A;  3S15 H;  4TKO B;  1EQV A;  4TRD A;  4X66 L;  2WAC A;  3HOX H;  4GNX A;  2A19 A;  2PW5 A;  3B6Y A;  2GA4 B;  1ENC A;  4GLA C;  2F0G A;  1Z6H A;  3TP7 A;  2ES2 A;  2MQH A;  2K75 A;  1FYC A;  3F2B A;  1EYC A;  4E6I A;  4GOP C;  1YNJ C;  4UP9 A;  1ZYR D;  1E24 A;  2FHT A;  5C4J B;  4HCS A;  5LL6 X;  1LTI D;  1SJH D;  3CF5 A;  1BCP C;  2Z6K C;  5C0X H;  2B2U C;  1L0W A;  4UAI A;  5IP7 H;  1AZP A;  5IYC G;  2K5H A;  2NWG A;  2L4N A;  3M4O H;  4HN7 A;  4B3R Q;  3A56 A;  2EYP A;  3QO2 A;  2VQE Q;  4JYA Q;  1P8L A;  5IGE A;  4X66 Q;  5DM7 3;  1WD0 A;  5FO9 B;  1K28 A;  4MTN A;  4R8N A;  1Y1V G;  2I5L X;  2PI2 A;  3URY A;  2BOS A;  2M2L A;  3OMC A;  1PVO A;  1WJJ A;  3QWN A;  3J80 i;  1TWF H;  1GUG A;  3IKJ A;  3S2D H;  2JA8 H;  2QIL A;  3E9I A;  2Z4I A;  1H9S A;  3SEB A;  3K0Y A;  1I4P A;  3BYY B;  1VDZ A;  1XXG A;  4JW0 A;  3W5O A;  1SMX A;  3U50 C;  4Y52 H;  2B8G A;  1LTL A;  1GO3 E;  2JP1 A;  2CWP A;  3L0O A;  1SYE A;  2IX0 A;  4O42 A;  1WD1 A;  4JBM A;  4A3G H;  4CJ0 B;  1DOM A;  2HIX A;  1E2W A;  4A3K B;  1R4P B;  1CQF A;  1NTG A;  1TKW B;  3KDF A;  3PGZ A;  4S3S A;  5M3F H;  1G2T A;  2K5N A;  4P2C B;  4A3J G;  3HEJ A;  4OX9 Q;  3OWE B;  4IN3 A;  5GQO A;  2C9O A;  2EYH A;  3RN5 A;  1VQ6 A;  2K33 A;  3SK6 A;  1SAP A;  1NE3 A;  5ISR A;  1I6H H;  1UEB A;  1IYV A;  2Z6B A;  2F0Q A;  2ZJR A;  1MD2 D;  1QZG A;  1VMC A;  1I4Q A;  4A3B H;  4QCL A;  2EQS A;  4IUR A;  2B3G A;  3C1F A;  4MHE A;  3S17 H;  4N9P A;  1U4R A;  4JI1 L;  4AYB G;  4BY1 G;  4O1N A;  4C2M H;  4DGZ A;  3BU2 A;  1PTO F;  1HA6 A;  5E3F A;  1SE2 A;  2CW0 D;  4JK1 C;  1LTS D;  4KY7 A;  4M1U B;  5JEA H;  3CC7 A;  1S4Z A;  2BA1 A;  1U5K A;  3NWS A;  4DU9 A;  1G2S A;  2DY7 A;  1D1K A;  3CC4 A;  2K01 A;  3NEN A;  4DR5 Q;  3S1Q H;  4DR2 Q;  1PH8 A;  4A76 A;  4HAE A;  2F3V A;  2EYF A;  5DEH A;  1RTN A;  1V8Q A;  2AWN A;  2DJG C;  3OW7 A;  4IFD H;  2EDG A;  3KUP A;  4CDE C;  1E0B A;  2Q2T A;  4A4I A;  2N55 A;  3PIO A;  5KNB A;  1BCP F;  1IXR A;  1I4R A;  4KN4 C;  5CV9 A;  3NXW A;  4A3D H;  2HCI A;  4XXE A;  2F0S A;  4JI8 L;  2EJG C;  3X3N A;  2PYK A;  3ONA B;  1EY8 A;  2LY7 A;  4IPG A;  3CQZ B;  3K57 A;  5IE8 A;  4MZ9 A;  4K6L A;  1W6K A;  4L5Q A;  1I5F A;  2M9V A;  2JA7 H;  2KEN A;  2MO0 A;  4YIJ A;  4A3F H;  2K5W A;  3MXU A;  3V2T A;  1EY9 A;  1Y8P B;  2UXC Q;  1KDB A;  1PH2 A;  3MXN B;  1HFG A;  2PW7 A;  2G5D A;  2SNM A;  3Q24 A;  4QUC A;  4ABN A;  3RNU A;  2PNH A;  5KNC A;  3HOW H;  4KN7 C;  2L55 A;  1JOK A;  2QEX A;  4DV2 Q;  4GNX C;  3HOZ H;  2F0I A;  2LXK A;  2E2H H;  1EY7 A;  3NBH B;  4DK3 C;  4KJO A;  1EZ6 A;  4IO9 A;  1STY A;  4CGY B;  4JI7 L;  2LSS A;  1ESF A;  1TT2 A;  2DJF C;  1KAA A;  2AUJ D;  3P75 A;  1VQA A;  4ZQ3 A;  3F2C A;  2MHV A;  1HA5 A;  5C44 H;  5M3M G;  1PA6 A;  4A3K G;  3PUV A;  2DGY A;  4N8F A;  3NEM A;  4LFC L;  3AFP A;  4FXK C;  3EJI A;  1A2T A;  2CCZ A;  5D3D A;  3JAM L;  1XNQ L;  1B2T A;  2L12 A;  4LUZ A;  5E1F A;  1ENF A;  3K7A H;  3HOV B;  2F0D A;  2UXD L;  4QF4 A;  3NBI A;  1STE A;  3H3V H;  3HOU H;  2I0Q A;  1GUS A;  3PUX A;  1WTQ A;  4JI7 Q;  4B08 A;  4YWM A;  5C4H A;  4ZCK A;  3VR6 A;  1M4V A;  5T1G A;  4H0L C;  3SHL A;  2FFK B;  4JC0 A;  2R3Z A;  1EFW A;  1LT3 D;  1Y1W B;  4G7O C;  1BXT A;  2J0T D;  1SYB A;  2WKC A;  3UDI A;  5CYU A;  4LF4 Q;  2IJ0 A;  1XNQ Q;  1YNN D;  4XYO A;  4RKB A;  3J81 E;  5DLQ E;  2Z8L A;  2UXD Q;  2B2W A;  2Y0S B;  3I4M G;  3MXG A;  1WTV A;  4DNI A;  1BBX C;  2DNC A;  4NXN L;  2VL6 A;  2JEB I;  1Q46 A;  3OHX C;  5M5W B;  1HR0 W;  4ZLT F;  3J81 c;  1GUN A;  3NQI A;  5ELE A;  3BVZ A;  1EQQ A;  1IKL A;  1OXV A;  4MNO A;  1RHP A;  4AYB E;  5G3L F;  1E2Z A;  3AQQ A;  3K58 A;  1VQJ A;  3HKS A;  1E3P A;  4O0A A;  3J7Z C;  3LX0 A;  1N34 L;  4QUF A;  1SYD A;  2ICE C;  3KJP A;  4HSP A;  4A3I B;  3OYY A;  1TWH B;  1KTK A;  1RL2 A;  4NXN Q;  5J3B A;  1FJG L;  2A68 C;  2EXD A;  4R1J A;  2BH8 A;  2RF4 A;  1IW7 D;  1WCM H;  5COY A;  3UDG A;  1VQ9 A;  3K5L A;  1XX8 A;  4JVZ A;  1HZA A;  3D4W A;  4FP5 D;  1EY4 A;  1VCI A;  3S15 B;  2EY6 A;  3PQI A;  3HOX B;  5JJK A;  1SR3 A;  3DMU A;  5BN5 A;  1UE6 A;  4G57 A;  3LNN A;  1Q7Y C;  4DR7 L;  1JIC A;  3D0F A;  2VW9 A;  3FMC A;  1N34 Q;  1Y8N B;  1IBL Q;  2A69 C;  2RQX A;  4A3C G;  3SR1 A;  3MXN A;  3NPP A;  3K59 A;  1CHQ D;  1NMG A;  1J6Q A;  1OO9 B;  2FIN B;  5EKI A;  1B8A A;  4DV6 L;  3MXP A;  4QGU A;  5M5Y H;  1FJG Q;  2PCF B;  3VYS A;  2K32 A;  2NZO A;  1VQL A;  2F0E A;  1CT1 D;  1GHK A;  1J8I A;  2OTJ A;  1XTD A;  5LMN L;  5ELC A;  2Q8I B;  2XNA C;  1A8V A;  3NBH A;  1N33 L;  1WYD A;  3L9A X;  2CFM A;  4QIW B;  1AEX A;  2I5M X;  5C3X A;  1I6V C;  3HOY H;  2YU9 H;  4ZAI A;  3LGJ A;  4EGV A;  4ME5 A;  1DD2 A;  1KD1 C;  3HOV G;  1BOS A;  1D1I A;  2HQE A;  1SYF A;  2EE1 A;  4HIO A;  3L7Z C;  1A0I A;  1JC7 A;  1EZ8 A;  1MSG A;  5EBC A;  5CGK A;  2JA6 H;  5LL6 S;  3NQT A;  5C3W A;  4DK0 A;  3NUC A;  3WWV A;  1SEB D;  1K8M A;  3N6R A;  2ZXR A;  3S24 A;  4DV7 Q;  1KAB A;  4HCE A;  4A75 A;  2BH2 A;  2QGQ A;  1BNZ A;  2JA8 B;  2I07 B;  4NB3 A;  3EN2 A;  1Y1W G;  3OPO A;  1WOC A;  1JB7 A;  4R4C A;  3VYU A;  4HJA A;  4FF3 A;  1HH2 P;  3K0X A;  4L5R C;  1N33 Q;  2CQO A;  1HZC A;  4JBK A;  5KYL A;  3EA6 A;  4WRD A;  2V1C C;  1XTC D;  5KIX A;  1LTA D;  3KBX A;  3AFQ A;  3VR5 A;  5FJ8 G;  2Y0S G;  5M3F B;  5EKL A;  4ZKB B;  3GTG H;  1OXT A;  3H94 A;  1EIY B;  4IPD A;  4V19 0;  2VY3 A;  3IFT A;  2O5J C;  4PG3 A;  1HTP A;  1I6H B;  3I2Z A;  1HNX L;  2ATW A;  1PRT B;  4IUN A;  1HFN A;  3BZK A;  3OW2 A;  4JI2 Q;  2RA4 A;  2N88 A;  2B2Y C;  2PZW A;  4R8I A;  2F3I A;  1S5F D;  2RBM A;  4C2M B;  3I4N G;  2ZXP A;  4X6A H;  4JBJ A;  5LMU L;  2BCO A;  4UP8 A;  2OEO A;  3R93 A;  2WAQ B;  1AP0 A;  4ZUI A;  1VF7 A;  3K7U C;  2D0P A;  4DPG A;  3V05 A;  3I8Z A;  3J81 i;  3TP5 A;  1HNX Q;  3H3V I;  1AFP A;  2PNR C;  2R93 H;  3S1Q B;  1LAB A;  2B2W C;  2WKD A;  1LTR D;  4RMF A;  4OEL B;  2ZJP A;  3T53 B;  1WI5 A;  2E5L Q;  1XYI A;  1EWC A;  3SXH A;  1IYJ B;  4BBR B;  3FKI H;  3M3Y H;  2OXP A;  1HNW Q;  1I3Q H;  3T1Y L;  4XT3 B;  1UE5 A;  1RDP D;  5K36 G;  1JCK B;  5C4X H;  2NZ1 D;  3MVV A;  5IYB G;  4A3D B;  4K0K L;  4M8A A;  3RLF A;  4FYD A;  1TS2 A;  2ENB A;  1YVC A;  4RGM A;  4C56 C;  2K52 A;  2OWO A;  4KKT A;  5IWA L;  1U4M A;  1JR0 D;  2NN6 H;  5GAD C;  1EY6 A;  1DGS A;  1G6P A;  2YV5 A;  5I6W A;  4HJ9 A;  1UUP A;  2ALY B;  4YCW A;  2EVB A;  3EFX D;  3R2T A;  3D4D A;  2G9D A;  2Q2H A;  4FXG C;  2DNE A;  2NVX B;  4A3E B;  3U4Z A;  3RUZ A;  4A3F B;  4DA2 A;  3ND9 A;  1H9S B;  4K6D A;  4KTA A;  2NVT H;  2L9H A;  3J81 j;  1O7I A;  2KVM A;  3DHQ A;  4OO1 I;  4BY7 B;  3T1Y Q;  3E0E A;  1YI2 A;  3HOW B;  4LAA A;  1K0S A;  1B4O A;  1LTG D;  2B2V A;  2BA0 A;  2I46 A;  2WV6 D;  1TII D;  3NTI A;  3OIQ A;  3KDF B;  1Y14 B;  2R7Z H;  2KHJ A;  5EPL A;  2DY8 A;  4YHH L;  1XNR L;  3J80 L;  2BDO A;  1EY5 A;  4C3H B;  4QJF A;  1M8A A;  4UY8 C;  1X3Q A;  2O4X A;  3T4A C;  4K5W A;  2ZT9 C;  1A6X A;  4LJZ C;  3S1M B;  5I4D A;  1HQR D;  3Q8D A;  1ZXT A;  4L8J A;  1CFM A;  1DCZ A;  2N3S A;  3TME A;  1EYG A;  1T5E A;  4HIM A;  2HUG A;  5BN3 A;  2F03 A;  1Z7T A;  3L2P A;  3W3A A;  1SMY D;  3PUZ A;  4DAV A;  1N36 L;  1NR2 A;  4R4Q A;  4IJH A;  2KED A;  2D9U A;  1NY4 A;  5IOD A;  4YHH Q;  2KA7 A;  3MEH A;  1XNR Q;  1HNZ L;  1KHI A;  5CMD A;  1SRU A;  4GLX A;  2IY5 B;  4YCV A;  1JJG A;  2E74 C;  4RA8 A;  4LNQ A;  3HOU B;  1SFO H;  4B3M L;  2MO1 A;  4J1M A;  5M5X H;  3CHB D;  1X55 A;  4LMQ D;  2SNS A;  5IGB A;  3CRK C;  3M4Y A;  2EYO A;  4K2L A;  2CHB D;  3DEO A;  1VQE A;  2VUM G;  4EQN A;  2HDM A;  5JEA G;  2WAQ G;  3K5O A;  2R7D A;  3BZC A;  1OXX K;  2Y0S E;  2IX3 A;  2XRQ D;  2EOT A;  4HJ7 A;  2KHI A;  1FGU A;  2B2T C;  3PF4 A;  4A93 G;  3J7A V;  1KIX A;  1HNZ Q;  3DWA A;  4OIK A;  2UUA L;  4B3M Q;  1TXY A;  1LT6 D;  3PO3 G;  2KCN A;  1BQQ T;  4BBR G;  4G7H C;  4Q5V A;  4UDU C;  3F1Z A;  1ZKO A;  1Z47 A;  3W1G A;  4KI0 A;  2UUB L;  4HMI A;  4R4O A;  3GTK H;  4A3D G;  4JI0 L;  4LW1 A;  4ODG A;  4NPS A;  4GKJ L;  1YJ9 A;  3K6O A;  4L6T B;  4BXX G;  2H1E A;  1R4Q B;  1D5M C;  3PUW A;  1MJE A;  4C3J H;  1F77 A;  1VQK A;  2A6H D;  3I3C A;  4A3E G;  2IHF A;  1ET6 A;  4CJ2 C;  3A0J A;  3PCO B;  1WCM B;  4QL5 A;  3AMU A;  2UUC L;  5E4X A;  4FXD A;  1ESR A;  1KL9 A;  3ZYY X;  4B9W A;  3H15 A;  4BY7 G;  4TSS A;  4C3I G;  3U58 A;  2QF7 A;  3HOW G;  1S72 A;  4JI0 Q;  3HP3 A;  2MNA A;  2SEB D;  2NVY B;  4IOC A;  3CKI B;  2CWA A;  3T1H L;  1K8A C;  3PSI A;  4C3H G;  2K5V A;  4X3T A;  1Q86 C;  2IHE A;  1GUT A;  1B7Y B;  1SNM A;  3KLW A;  1TWA H;  3C3L A;  2VB2 X;  5JJI A;  2NYZ D;  4JOI A;  4O2D A;  4DV5 L;  4A3M G;  4YWK A;  2UUC Q;  4QIW E;  1SSO A;  3GD7 A;  2BE5 D;  1TWG H;  4XDX A;  2F0K A;  5EPJ A;  2LKV A;  4CHT B;  2OTL A;  3HOY B;  1A15 A;  2YU9 B;  2F0P A;  4CKC A;  3MFY A;  2N8N A;  1O7L A;  3S1N H;  1KQS A;  1EOT A;  2F0L A;  3T1H Q;  3RZD H;  2G9H D;  2ZTC A;  2JA6 B;  2PMZ B;  1OXU A;  2L11 A;  4DKA C;  1D5X C;  3G71 A;  2V4D A;  1QUQ A;  1E1T A;  5EPK A;  2NN6 I;  2WFW A;  3AB9 A;  4UHV A;  3D31 A;  1AZQ A;  2X6G A;  2F0T A;  3GTM H;  2A5H A;  1EIG A;  4K8J A;  5GAG C;  4HED A;  5FLM H;  4I7A A;  4ZYS A;  4BA1 I;  1BDO A;  4KK7 A;  3PO2 H;  3S14 H;  1WTR A;  2KEE A;  4OXP A;  5NUC A;  3PIP A;  3CCV A;  3CU7 A;  2DN8 A;  5IP9 G;  4XIG S;  1LV9 A;  4JI1 Q;  5JVG 3;  1GJX A;  4FDB A;  5C5L A;  1UAP A;  3A55 A;  3G6J B;  1VQ8 A;  4PV1 C;  5IYD G;  5KGU A;  1F9Q A;  1EFI D;  2EPB A;  1JB3 A;  4LF5 L;  3U9O A;  2NVQ H;  4P73 A;  4OO1 G;  3O13 A;  4IZ8 A;  3T56 B;  1NJI C;  4LWC A;  2AKW B;  1VQ4 A;  4RHS A;  5KEE A;  4X64 L;  2QA4 A;  2WAQ E;  1JJC B;  4HIK A;  1O7Y A;  1PRT C;  4A3L G;  3I56 A;  5JPM C;  1X9N A;  1WCM G;  3JAM E;  3TN2 A;  4HJ8 A;  1GM5 A;  5IYC H;  4MIU A;  1I4G A;  3UI2 A;  3AYH B;  2QCP X;  1GXD C;  5C3E H;  1TVX A;  3UE1 A;  4OWX B;  4LF5 Q;  3A7L A;  4JI8 Q;  4XQJ A;  2OQK A;  3D6W A;  4DAY A;  1K0R A;  2PI2 E;  3NE5 B;  1F2Z A;  3P20 A;  1EWH A;  2JSO A;  2PQE A;  2F4I A;  5EKK A;  1HUM A;  3M3Y B;  2YTY A;  3KJO A;  1MJC A;  3S2H H;  1PDQ A;  4DR6 L;  2R61 A;  5C4X B;  2MUY A;  1F2Y A;  2EY1 A;  4ZUJ A;  1TS3 A;  1HPC A;  4CJ1 B;  3NEL A;  1GUW A;  1QVC A;  3STB D;  2XVS A;  3CD6 A;  1TQO A;  3TRE A;  5AJ3 L;  1ZYR C;  3Q22 A;  1RCV D;  2JYO A;  1KXL A;  1E22 A;  4BWG B;  5IT9 E;  4IUQ A;  2K04 A;  2Z0S A;  3BDC A;  3NK9 A;  4RWS C;  3HOY G;  3G7L A;  1VQO A;  1ET9 A;  2RVL A;  2NVT B;  1LM0 A;  3MC0 B;  1O78 A;  3PIO 3;  2IX1 A;  2NBF A;  3IL8 A;  2K5D A;  1S40 A;  5C0X I;  4A3J H;  2PQA A;  1IL2 A;  4N8X 1;  5IT9 c;  1CUK A;  4X62 L;  5C5M A;  1EU3 A;  1V43 A;  4U67 3;  5J22 A;  3FP9 A;  5CV8 A;  3CW2 C;  2R92 H;  1X3G A;  3X3M A;  1S3O A;  2ZXO A;  1FVI A;  3MZ5 A;  1Q1E A;  3RZO H;  4YCU A;  4G7Z C;  2E2J H;  4LFC Q;  2F4V L;  2D2C C;  2Q2U A;  5ELB A;  1EY0 A;  4FF2 A;  4PMB A;  4BY1 H;  1IBK L;  1VQ7 A;  3WDN A;  3FDT A;  1J5E L;  3BS1 A;  3PMF A;  1NNX A;  5LMN W;  5KYI A;  4UPA A;  2VXW A;  1EYA A;  4C1N I;  2FXQ A;  5FK9 C;  4GS3 A;  2HIV A;  4NXM L;  1MIU A;  4IUT A;  3AU7 A;  2XWB B;  2Q8T A;  4X62 Q;  4GOP B;  4J8Q A;  5EJW A;  4R4I A;  4LK1 C;  4KV6 A;  2A6E D;  2JJQ A;  1PV4 A;  1LT5 D;  4PZ8 A;  2JA5 B;  3C1E A;  4XQN A;  4CKB A;  1Q12 A;  4X3S A;  1DON A;  5K5P A;  1CI3 M;  2UXB L;  1EL0 A;  2ID0 A;  1J5E Q;  3GTJ H;  1XPR A;  3UDX A;  1PRT F;  5C4J H;  5DM6 3;  2E2I H;  1C48 A;  3KK7 A;  4NXM Q;  4GLV B;  2KQ3 A;  3UDF A;  1EOV A;  3DM1 A;  2F0W A;  2OF1 A;  1YZ6 A;  4GN5 A;  1DM0 B;  4GZY C;  3H3V C;  2XSC A; 
#chains in the Genus database with same CATH homology
 4UP9 A;  1WI5 A;  2E5L Q;  1E24 A;  3H0G H;  4BA2 I;  1L1O A;  1IYJ B;  1K73 C;  1N32 Q;  1OXS C;  3FKI H;  3CF5 A;  5GAH C;  3M3Y H;  2Z6K C;  4BXX H;  3KOJ A;  1HNW Q;  1I3Q H;  1L0W A;  3T1Y L;  1UE5 A;  5IP7 H;  5IYC G;  2UXB Q;  3CAM A;  3H0G G;  2WB1 E;  2K5H A;  5C4X H;  1VQC A;  5K36 G;  4HID A;  5IYB G;  3JAM c;  3M4O H;  1YHB A;  4IOA A;  4B3R Q;  4K0K L;  3RLF A;  2NVX H;  4A3E H;  1Y1V H;  2VQE Q;  1I94 Q;  1P8L A;  4JYA Q;  1YVC A;  2K52 A;  3K8A A;  1KC8 C;  5IWA L;  1EIF A;  2OWO A;  5GAD C;  4X66 Q;  1DGS A;  1G6P A;  2YV5 A;  4X64 Q;  4HJ9 A;  1Q82 C;  4MTN A;  4GKK L;  1Q1B A;  2B63 H;  1HZB A;  1Y1V G;  2I5L X;  1H95 A;  2PI2 A;  2ALY B;  4YCW A;  3ULL A;  3CCM A;  5ELO A;  1VQI A;  3U4V A;  1YJN A;  1PH1 A;  4BY7 H;  2NN6 G;  2Q2H A;  4C3I H;  4DUZ Q;  4DAM A;  3ICE A;  3U4Z A;  1V1Q A;  1PVO A;  3G6E A;  4JI6 Q;  4ME3 A;  2B63 G;  3S16 H;  4LF8 Q;  3GO5 A;  1WJJ A;  3J80 i;  1TWF H;  2NVT H;  1C0A A;  4RG1 A;  3K81 C;  3TEH B;  4LFB L;  3S2D H;  3J81 j;  4IFD I;  1O7I A;  2HHH L;  4OO1 I;  2N78 A;  4C3H H;  4DR7 Q;  3T1Y Q;  5HGQ A;  1I50 H;  2L15 A;  1UWV A;  3E0E A;  2JA8 H;  1YI2 A;  2WP8 J;  3E9I A;  3EIV A;  5M3M H;  1BVS A;  2BA0 A;  3KDF B;  1Y14 B;  1YBY A;  3W5O A;  4LF6 L;  4P72 A;  4A3M H;  5C0X J;  4LF9 L;  2KHJ A;  1SMX A;  4P74 A;  4DV6 Q;  2R7Z H;  3U50 C;  3S1M H;  4YHH L;  4Y52 H;  4Y7N H;  4R4T A;  1XNR L;  1LTL A;  1GO3 E;  2JA6 G;  4GKK Q;  4DV4 L;  2CWP A;  3L0O A;  2YTV A;  1WFQ A;  2IX0 A;  4QJF A;  3FHW A;  4DR6 Q;  4JBM A;  4A3G H;  1D8L A;  4UY8 C;  3GTO H;  2HIX A;  1VQM A;  1UE1 A;  4LF4 L;  1NTG A;  3KDF A;  4YY3 L;  5M3F H;  3PGZ A;  5LMN Q;  1YHQ A;  2HT1 A;  2K5N A;  4KHP L;  2NZH A;  1JMC A;  4A3J G;  2ZJQ A;  4OX9 Q;  4IPC A;  5GQO A;  5JJK A;  3CPW A;  3Q8D A;  3RN5 A;  1VQ6 A;  2N3S A;  1EYG A;  3OTO L;  4LFB Q;  4HIM A;  1NE3 A;  1HJP A;  5AJ3 Q;  2HHH Q;  1UEB A;  1I6H H;  2VZA A;  2JEA I;  5JJL A;  1A63 A;  2ZJR A;  1QZG A;  1X3F A;  1X54 A;  2KCM A;  2OCE A;  4A3B H;  4PZ7 A;  3L2P A;  4BBS H;  2EQS A;  3PUZ A;  1N36 L;  2GN5 A;  3HKZ G;  4JOI C;  1FL0 A;  4R4Q A;  4IJH A;  2B3G A;  3KF6 A;  4LF9 Q;  1NY4 A;  2K14 A;  1LYL A;  3GTP H;  4JI1 L;  3S17 H;  4AYB G;  4YHH Q;  4BBS G;  1XNR Q;  1HNZ L;  1KHI A;  4BY1 G;  1SRU A;  4GLX A;  4DV4 Q;  2VQF L;  1KRS A;  4YCV A;  2PMZ E;  3ER0 A;  1YEZ A;  4JI5 L;  4C2M H;  2IY5 B;  1JJG A;  4LNQ A;  1SFO H;  2GVB A;  4B3M L;  2MO1 A;  3BU2 A;  5M5X H;  1YNX A;  5H1S E;  4YY3 Q;  4POG A;  1X55 A;  4KHP Q;  3I4M H;  1L2F A;  5E7N A;  3CC7 A;  3TS0 A;  2JA5 G;  1P16 A;  2BA1 A;  1U5K A;  3CCS A;  2EIF A;  3OTO Q;  3CCQ A;  5IP9 H;  4JBW A;  2VNU D;  1VQE A;  2VUM G;  4A3I G;  2F4V Q;  3DLL A;  5JEA G;  1X6O A;  1EUJ A;  1G29 1;  2WAQ G;  2YTX A;  3NEN A;  5ELN A;  4POF A;  4GOP A;  2R7D A;  4DR5 Q;  3BZC A;  1OXX K;  2Y0S E;  2DUD A;  4IPH A;  5GAE C;  1IBK Q;  4DR2 Q;  4PZ6 A;  1PH8 A;  3S1Q H;  1PH7 A;  4A76 A;  3J7A 5;  4HJ7 A;  2KHI A;  1FGU A;  2Z6K A;  1IBM L;  1CKN B;  3A5U A;  3PF4 A;  1M90 C;  4A93 G;  2AWN A;  1GD7 A;  1KIX A;  5IYD H;  1HNZ Q;  2N49 A;  2UUA L;  4JI5 Q;  4ALP A;  4A4I A;  2Q2T A;  3PIO A;  4B3M Q;  1TXY A;  4OWW B;  2JA9 A;  1YHA A;  3HOX G;  3PO3 G;  1IXR A;  2ASB A;  3JC6 6;  2R7F A;  4BBR G;  1VQN A;  4A3D H;  1IBL L;  1GKH A;  4JI8 L;  3M7N A;  3F1Z A;  1Z47 A;  3W1G A;  2R93 G;  4KI0 A;  2UUB L;  4IPG A;  4R4O A;  5IE8 A;  4JI3 L;  1VS0 A;  3GTK H;  4A3D G;  4MZ9 A;  4GN4 B;  4JI0 L;  5HY6 A;  4LW1 A;  1N8R C;  1VQB A;  1PH6 A;  4A3L H;  3RLO A;  5JEA J;  4L5Q A;  1I5F A;  3PUY A;  4NPS A;  1K9M C;  5LMU Q;  1YJ9 A;  4GKJ L;  2JA7 H;  1K8G A;  3FKI G;  2KEN A;  2MO0 A;  3CC2 A;  4A3F H;  4BXX G;  5C0X G;  3PUW A;  5IP7 G;  3GTL H;  1MJE A;  4LFA L;  2OQ0 A;  4DUY L;  4C3J H;  2UXC Q;  5C4X G;  4DV0 L;  2K4K A;  1PH2 A;  1VQK A;  3MXN B;  3W1B A;  4A3E G;  2IHF A;  1K3R A;  3A0J A;  3PCO B;  3PV0 A;  4WJ3 M;  3RNU A;  4QL5 A;  1XMQ L;  2PNH A;  1PH5 A;  3HOW H;  4EQ5 A;  2UUC L;  4DV2 Q;  2QEX A;  3HOZ H;  4GNX C;  2NVY H;  1YJW A;  1KL9 A;  4IFD J;  1XJV A;  3H15 A;  4EX5 A;  4BY7 G;  1NBW A;  3U58 A;  4HJ5 A;  4DK6 C;  2UU9 L;  2LXK A;  3HOW G;  4GN3 B;  2E2H H;  1S72 A;  1VQD A;  3I7F A;  3NBH B;  4H02 A;  4JI0 Q;  2D0O A;  3I4O A;  4DK3 C;  2E8G A;  4UP7 A;  4DV7 L;  3JAM i;  2MNA A;  4IO9 A;  4L5S A;  4K0K Q;  4IOC A;  4A3K H;  4JI7 L;  2CWA A;  2LSS A;  3T1H L;  1K8A C;  4DR1 L;  3PSI A;  2K5V A;  2JA8 G;  5IWA Q;  1VQA A;  1Q86 C;  2IHE A;  4LFA Q;  3F2C A;  5C44 H;  1PH3 A;  4XTC S;  5M3M G;  1PA6 A;  1B7Y B;  3KLW A;  1TWA H;  1QZH A;  4A3K G;  3HOV H;  5JJI A;  2RCN A;  1HR0 L;  1ASY A;  1SRO A;  3ERS X;  3PUV A;  4JOI A;  4O2D A;  4P71 A;  1UE7 A;  4DV5 L;  4A3M G;  2R7Z G;  2DGY A;  3NEM A;  3CPF A;  1XMQ Q;  1NMF A;  1E7Z A;  4LFC L;  3AFP A;  4YWK A;  2UUC Q;  4QIW E;  2CCZ A;  1XNQ L;  2AHO B;  4A3G G;  3GD7 A;  4LUZ A;  2VS1 A;  1TWG H;  2XGT A;  3K7A H;  2UU9 Q;  2UXD L;  3TQY A;  5M3F G;  5BR8 L;  1Y1W H;  1QUQ B;  1BBU A;  3A5Z B;  2OTL A;  3H3V H;  3HOU H;  2I0Q A;  3PUX A;  2AMC B;  3S1N H;  2N8N A;  3UE0 A;  1KQS A;  4JI7 Q;  4YWM A;  4DR4 L;  3T1H Q;  2B29 A;  3RZD H;  2ZTC A;  4LF6 Q;  4JI6 L;  4JI2 L;  1OXU A;  1QVG A;  4DKA C;  4JC0 A;  4A3B G;  1Z9F A;  3G71 A;  1QUQ A;  1E1T A;  1EFW A;  1PYB A;  2NN6 I;  1VQF A;  5FJ8 H;  2WFW A;  2JK8 A;  3I55 A;  3D31 A;  1HR0 Q;  1BKB A;  3UDI A;  3GTM H;  4LF4 Q;  1C9O A;  5GAG C;  1XPO A;  1XNQ Q;  4KHZ A;  3STB C;  1JE5 A;  1Q8K A;  4APV A;  5FLM H;  2IT1 A;  5DLQ E;  2JQO A;  1YIT A;  4BA1 I;  1B70 B;  4L5T A;  2UXD Q;  1EWI A;  4TVA B;  3PO2 H;  3S14 H;  5BR8 Q;  3I4M G;  4DNI A;  1K83 H;  1OTC A;  4OXP A;  4NXN L;  2VL6 A;  2JEB I;  1Q46 A;  2KCT A;  3PIP A;  3CCV A;  4IJL A;  3BJU A;  1JJ2 A;  1HR0 W;  5IP9 G;  1N36 Q;  3J81 c;  3HKZ E;  4XIG S;  1VQ5 A;  1EQQ A;  2XTI A;  1EQR A;  4JI1 Q;  1OXV A;  4MNO A;  2A8V A;  1XPU A;  3I4N H;  4AYB E;  1TWH H;  5GRO A;  2C35 B;  4AH6 A;  2E5L L;  1N9W A;  3CCL A;  3CQZ H;  2VQF Q;  4AQY L;  1CSQ A;  1X65 A;  3AQQ A;  4FDB A;  2H5X A;  3CC4 A;  4GNX B;  1CKM A;  1VQJ A;  3CXC A;  2MFI A;  3G48 A;  3HKS A;  1VQ8 A;  1QVF A;  3KF8 B;  1E3P A;  1HNW L;  5IYD G;  4O0A A;  4X65 L;  3J7Z C;  3CMA A;  3M9B A;  1CKN A;  3F8T A;  1N34 L;  2WB1 G;  4LF5 L;  4IFD G;  2NVQ H;  4WJ4 A;  2LXJ A;  4LUV A;  3KJP A;  4P73 A;  4OO1 G;  3OYY A;  5IY0 A;  4LUO A;  1Q81 C;  1MKH A;  1NJI C;  3S1R H;  4LWC A;  1RL2 A;  2AKW B;  3RR5 A;  1VQ4 A;  4NXN Q;  4X64 L;  5J3B A;  1FJG L;  2QA4 A;  2EXD A;  2WAQ E;  4R1J A;  2BH8 A;  2RF4 A;  1WCM H;  4DR3 L;  3UDG A;  1JJC B;  1SE8 A;  4HIK A;  3RN2 A;  1VQ9 A;  2R6G A;  1HZA A;  1ASZ A;  1IBM Q;  3CP0 A;  4A3L G;  3I56 A;  3DM3 A;  1X9N A;  4B3T L;  1VCI A;  4DAY B;  1BBW A;  1WCM G;  3E9H A;  3G4S A;  2JA7 G;  1VQH A;  4HJ8 A;  1GM5 A;  5IYC H;  4AQY Q;  2UUA Q;  2AWO A;  4A3F G;  4YWL A;  1SR3 A;  4A3C H;  5IYB H;  3AYH B;  4JCV E;  3J80 c;  1UE6 A;  3KYH C;  3SGI A;  5C3E H;  3KFU A;  3UE1 A;  4LF7 L;  1Q7Y C;  4X65 Q;  4JI4 L;  4DR7 L;  3D0F A;  3HFZ B;  3M4Q A;  2VW9 A;  1N34 Q;  4OWX B;  1IBL Q;  4LF5 Q;  2ZTD A;  1D7Q A;  3ZJY C;  4JI8 Q;  1GVP A;  2K50 A;  3EBE A;  4A3C G;  2OQK A;  4QY7 A;  5C3E G;  1K0R A;  3ULP A;  1NMG A;  1J6Q A;  2PI2 E;  2UUB Q;  4B3S L;  4JI3 Q;  3HOZ G;  1B8A A;  4DV6 L;  2F52 A;  4QQB X;  4OWT B;  3GDE A;  4QGU A;  1W3S A;  5M5Y H;  1FJG Q;  2YTY A;  3KJO A;  1MJC A;  3S2H H;  4GKJ Q;  2GVA A;  5FLX c;  2NZO A;  2D62 A;  4DV1 L;  4DR3 Q;  1VQL A;  3M85 A;  4DR6 L;  1L1O C;  3CCJ A;  3CCU A;  2OTJ A;  1XTD A;  5LMN L;  4DUY Q;  3M4P A;  4DV0 Q;  1A8V A;  3IRB A;  4B3T Q;  4OX9 L;  1N33 L;  1WYD A;  3NEL A;  1KAW A;  1X3E A;  2CFM A;  1QVC A;  2I5M X;  1AH9 A;  1RIP A;  3STB D;  3CD6 A;  3RLN A;  3HOY H;  3TRE A;  2YU9 H;  4LF7 Q;  5C44 G;  2Q2I A;  3LGJ A;  5AJ3 L;  1HZ9 A;  1TWC H;  4JI4 Q;  3A74 A;  1KD1 C;  1KXL A;  2PQA B;  3HOV G;  1CKO A;  1E22 A;  1PHJ A;  5EAY A;  2CKZ B;  1PYS B;  1SN8 A;  1A0I A;  3L7Z C;  4HIO A;  2ZM6 L;  2HQL A;  2JA6 H;  2Z0S A;  3HOY G;  2YYZ A;  1VQO A;  4B3S Q;  3WWV A;  1LM0 A;  2IX1 A;  2KBN A;  3S24 A;  1S40 A;  3MEF A;  4DV7 Q;  5C0X I;  4A75 A;  4A3J H;  1SLJ A;  2PQA A;  2QGQ A;  4DV1 Q;  1IL2 A;  4NB3 A;  2BH2 A;  3EN2 A;  5IT9 c;  2ZTE A;  1C7Y A;  3TRZ A;  4DR1 Q;  1CUK A;  4AIM A;  1IZ6 A;  1Y1W G;  3AEV A;  4X62 L;  4JG2 A;  1A62 A;  1WOC A;  1JB7 A;  4R4C A;  4HJA A;  1R9T H;  3HOU G;  1V43 A;  1HH2 P;  1AE3 A;  1VQG A;  3K0X A;  3VDY A;  4L5R C;  2CQO A;  4DV3 L;  1N33 Q;  1HZC A;  2JE6 I;  3FP9 A;  3CW2 C;  2R92 H;  4JBK A;  2A1A A;  1X3G A;  1X56 A;  3KF6 B;  2V1C C;  1S3O A;  4DV5 Q;  1JT8 A;  1XMO L;  1FVI A;  5M5W H;  3K80 C;  1Q1E A;  3RZO H;  4YCU A;  2E2J H;  4LFC Q;  2F4V L;  3AFQ A;  2RHS B;  5FJ8 G;  2Q2U A;  2Y0S G;  4DR5 L;  2R92 G;  4BY1 H;  1IBK L;  4DR2 L;  1VQ7 A;  2ZM6 Q;  3GTG H;  1AE2 A;  1OXT A;  1EIY B;  1VQP A;  1W2B A;  1J5E L;  4IPD A;  1KRT A;  1LUZ A;  5LMN W;  2VY3 A;  4PMW A;  1PH4 A;  4UPA A;  1PFS A;  2I5H A;  4PG3 A;  2FXQ A;  4P75 A;  4GS3 A;  4OON A;  5FLM G;  2HIV A;  4NXM L;  3I2Z A;  1MIU A;  1HNX L;  2ATW A;  1PH9 A;  1V9P A;  3CCE A;  2JA5 H;  3PO2 G;  4DR4 Q;  3CME A;  1G51 A;  4JV5 L;  3ULJ A;  3BZK A;  3PF5 A;  3OW2 A;  4X62 Q;  1CSP A;  4JI2 Q;  4GOP B;  4R4I A;  4A3I H;  2VUM H;  3TS2 A;  4DV3 Q;  3GTQ H;  4J15 A;  4TQU S;  2JJQ A;  1PV4 A;  2F3I A;  1N32 L;  1XMO Q;  4KLK A;  4PZ8 A;  3I4N G;  1Q12 A;  4A93 H;  2UXB L;  1U0L A;  4X6A H;  2ID0 A;  1T9H A;  4JBJ A;  5LMU L;  4B3R L;  1E1O A;  2RHQ B;  4UP8 A;  2VQE L;  1I94 L;  1J5E Q;  3GTJ H;  4JYA L;  1XPR A;  3F2D A;  3S15 H;  3UDX A;  1YIJ A;  4GNX A;  4X66 L;  3HOX H;  3PO3 H;  2UXC L;  5C4J H;  3CCR A;  3K7U C;  3B6Y A;  2A19 A;  2D0P A;  4BBR H;  4DPG A;  2E2I H;  1L1O B;  4NXM Q;  4GLV B;  3J81 i;  1HNX Q;  4GLA C;  3H3V I;  3UDF A;  1EOV A;  4JV5 Q;  2R93 H;  4GN5 A;  1YZ6 A;  4DUZ L;  1M1K C;  2ES2 A;  2MQH A;  2K75 A;  3F2B A;  4DV2 L;  4RMF A;  2ZJP A;  4LF8 L;  4GOP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...