1CSQA

Crystal structure of the bacillus subtilis major cold shock protein, cspb: a universal nucleic-acid binding domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLD SHOCK PROTEIN B(CSPB)
publication title Universal nucleic acid-binding domain revealed by crystal structure of the B. subtilis major cold-shock protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulation
total genus 9
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1993-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1csqA00
3E9IA 4RMFA 4BBRH 4GNXC 1XTDA 4ME3A 1KRSA 1A0IA 5FLMH 2I5MX 4JI3L 2MNAA 3G71A 1QUQB 3UE0A 3VDYA 3OTOL 3W1GA 1VQKA 4JI6L 3CC2A 4DR6L 2Q2IA 5C4XG 3G48A 2Z6KA 1EFWA 3CCSA 3S16H 4YCVA 4BY7G 2QEXA 2YV5A 4C3HH 3M9BA 3JAMc 1DGSA 4X65L 3M7NA 1YVCA 4LFCQ 2K4KA 1WCMH 5C0XJ 1BBWA 2K5HA 5C0XG 2YYZA 2E2HH 2R7DA 3RZDH 2I5LX 4GNXA 4LF8Q 3I4MG 2ZTCA 5JJLA 1W3SA 4KHPQ 4GN5A 4LFCL 3D31A 5GAHC 2VUMG 4X6AH 4P71A 4GKJL 2F4VL 2A1AA 4PZ7A 1Q82C 4HIDA 4JI2L 4K0KQ 2VY3A 1V9PA 3T1HQ 1X54A 2MFIA 2NN6I 2WAQE 2PMZE 3I7FA 4UP9A 3PF5A 2D0OA 4QGUA 4H02A 3W1BA 4DV1Q 4QJFA 3I55A 1EIYB 2XGTA 2ATWA 3KF6B 1CKNB 4O2DA 3FP9A 1S3OA 1SLJA 1XMQQ 1K8AC 3PUYA 2OTJA 3PCOB 4A3BH 3L7ZC 4DV1L 2MO0A 1Y1VH 2JEBI 2Y0SE 4HJ8A 1K9MC 1VQ5A 2KHJA 1FGUA 2RHQB 2VQEL 1XMQL 3HOUG 2CFMA 3J80i 4DV3L 2IX1A 1HNWL 1X3GA 3UDXA 4GOPB 4BBSH 2RF4A 5ELOA 4DV7Q 4LF4Q 3Q8DA 2ASBA 1YNXA 4NXMQ 3E0EA 2KHIA 1QUQA 3U4VA 4J15A 3PUVA 3RLOA 1XPRA 1C7YA 1MIUA 1PHJA 1JJGA 1GD7A 4DV7L 3CD6A 1Z9FA 4LF4L 5IYDH 5FJ8H 2R6GA 2B63G 1LM0A 4YHHQ 1SMXA 3CF5A 4Y7NH 2HHHQ 4KLKA 2N49A 5JJIA 1UE5A 4A3CG 1YHQA 1MKHA 2K50A 3PUWA 4LUVA 4YHHL 2EXDA 2KENA 2VNUD 1P8LA 4AQYL 2HHHL 1VQNA 1U0LA 2WFWA 1PH6A 5E7NA 2BA1A 3J81i 3AFPA 1H95A 1LUZA 4X66Q 4DR1L 4OO1G 4A3FH 2E2JH 4C3JH 3CCUA 1T9HA 1I3QH 3JC66 4JI1Q 3CP0A 4IJHA 2JA8H 2C35B 4DV4Q 4B3MQ 4DR4Q 1NBWA 4OX9Q 2AMCB 4QQBX 1PH7A 1Y1WH 1EYGA 3TS2A 1E3PA 1EQRA 2AWOA 3M4QA 4DAMA 4JI1L 4BA1I 3KF6A 1CKNA 1VQJA 3I4NG 5IYBG 4DV4L 1X56A 1QZHA 4IOAA 2AWNA 1E1OA 3F1ZA 1C0AA 4R4TA 5GQOA 1Q86C 3CXCA 3PUZA 2KBNA 1X3EA 2K5VA 3K7AH 3T1YQ 1XPUA 4DUYQ 4JV5Q 2L15A 1WYDA 2E2IH 4DV0L 2IX0A 4JI0L 4BA2I 1PH8A 3PIPA 1B70B 3CCRA 2UUAQ 3KFUA 2DUDA 2DGYA 1OXUA 4DV6Q 1KD1C 4LFBL 1SR3A 4JG2A 4DUYL 4JI5Q 5IP7H 1EWIA 3ICEA 3BJUA 4JV5L 1EOVA 3F2DA 4GOPA 1IBKL 1AH9A 5IP9G 3NEMA 1IZ6A 5C4XH 5C0XI 2HQLA 4OWWB 4LWCA 2R92G 4DNIA 4DV6L 3H15A 2R7ZG 1CSQA 4JI5L 4LNQA 1PH1A 3KOJA 1KIXA 1J6QA 5HY6A 2IHFA 1E7ZA 1V43A 2JQOA 1OXXK 3RLNA 1A8VA 4BY1H 4A3IG 1MJEA 2JA9A 4JCVE 4JI4Q 2EQSA 4DAYB 1S72A 4A3DG 4JYAL 2Z6KC 3PO3H 1JE5A 3HOZG 2UXDL 2UXCQ 2B3GA 4HJ5A 1K73C 2A8VA 4UP7A 2JA6H 2EIFA 2VUMH 1BBUA 1N36Q 4A3JH 2PI2A 1JJCB 4L5SA 4UP8A 2YTYA 4LUZA 3CAMA 3H0GG 1WOCA 1TXYA 1AE3A 3ZJYC 3CCEA 3AEVA 2UXCL 4O0AA 3FKIG 2F52A 3A0JA 2ZTEA 2UUBL 3KDFB 1N36L 4LF7Q 4BXXH 3RLFA 4HIMA 4OWXB 4DV2L 1D7QA 2MQHA 1NTGA 1VQEA 4IOCA 4JBJA 1CUKA 4X64Q 4A3EH 1HR0Q 2K52A 4LF7L 1VQOA 4WJ4A 5C3EG 1G51A 4YWMA 3CCMA 4MZ9A 3M4PA 2N3SA 4L5QA 2JK8A 1R9TH 3TEHB 1QVCA 4X64L 2UUCQ 2BH2A 1VQMA 1HR0L 4GS3A 2WB1G 2Z0SA 4GKKQ 2PNHA 1HH2P 1HJPA 1XJVA 3F8TA 4A4IA 3BU2A 4NXNQ 4JI7Q 2UUCL 1S40A 1M1KC 4GKKL 4GN3B 4AYBG 2R7FA 4LF8L 5JEAJ 1VQ4A 5JEAG 4A3MG 1YBYA 4DR7Q 1BVSA 1Q1EA 5IE8A 4KHPL 4NXNL 2BA0A 3TREA 3HOWH 3GTOH 3CC7A 4P73A 3S1RH 4A3LG 5C44H 2B63H 4K0KL 1SN8A 1YIJA 3PF4A 2JJQA 4C2MH 5M3FH 3T1HL 3J7A5 1WJJA 1BKBA 1XNRQ 4XIGS 3TQYA 4KHZA 1NY4A 3GDEA 3PSIA 4OONA 4L5RC 3GTGH 1YJNA 4OO1I 4YY3Q 2JA5G 1NE3A 2N8NA 3CCQA 2KCMA 3EIVA 4QIWE 1PH5A 5GAEC 4AIMA 3HOXG 3HOYG 4B3RL 5JJKA 1XNRL 1G291 1VQFA 1D8LA 2NZHA 2OTLA 4GLVB 1SROA 4R1JA 4BBRG 4DR2Q 4JOIC 1UE1A 1X55A 2ZM6Q 1VS0A 1FVIA 3MXNB 3RN2A 5GADC 4LF5Q 1I94Q 4IJLA 1VQDA 3KDFA 4APVA 4R4OA 4IO9A 3RN5A 1KC8C 4A93G 4B3SQ 4LF6Q 3PGZA 4DV5Q 3FHWA 1PH9A 3NENA 3I4OA 4NXML 4IPCA 2VQFQ 2IY5B 4PMWA 3HFZB 4ALPA 1IL2A 3B6YA 4JOIA 4DK3C 4LF6L 2GVBA 3A5ZB 3GTKH 2JE6I 5M5WH 1IBLQ 2CWAA 2E8GA 3U4ZA 3S15H 4YCWA 4B3TQ 1Q46A 5M3MG 1KQSA 2OCEA 1KRTA 5M5YH 2E5LQ 3AYHB 1IBLL 4LFAQ 1J5EQ 1HNZQ 2ZJQA 1VQPA 1GKHA 1IBMQ 2JEAI 4DUZQ 3K8AA 4GLXA 4B3TL 3K7UC 4TQUS 5IYCG 4L5TA 1GO3E 4OWTB 1RL2A 4X66L 1ASYA 4UY8C 1UEBA 2E5LL 3L0OA 4HJ9A 1J5EL 3KYHC 1CKMA 3UE1A 4DUZL 4GOPC 4A3BG 1CSPA 4B3ML 1N32Q 4DR4L 1JT8A 1Y1VG 4OX9L 2LXKA 2WB1E 3CCVA 1B8AA 3S14H 4A3GH 3K80C 1LTLA 2VL6A 4NPSA 3GTLH 1NMFA 3CPWA 1L1OB 1O7IA 2OQ0A 5GAGC 1E24A 1SE8A 4PG3A 1EQQA 3GTQH 1A63A 1I5FA 4A3KH 2ALYB 3FKIH 1UWVA 2FXQA 4AYBE 4BBSG 1VQGA 1NJIC 3T1YL 1YHAA 1A62A 1X65A 3H3VH 1HZBA 4PZ6A 3CQZH 1KHIA 5ELNA 1HR0W 5IYDG 2UUAL 4BY7H 5FJ8G 2H5XA 4B3RQ 1B7YB 1I6HH 1WFQA 2KCTA 4GNXB 3K0XA 2NVYH 3CMAA 1XNQQ 4HJ7A 3J81c 4POGA 3I4MH 3JAMi 1GM5A 1E22A 3ULLA 3CW2C 4POFA 5LMNQ 3CC4A 2OQKA 4DKAC 3DM3A 3GD7A 4DR3Q 4JI4L 1XNQL 3SGIA 2AKWB 4A3MH 1FL0A 2B29A 5LMUQ 2Q2HA 4LF9Q 4JBWA 1VQAA 4RG1A 1FJGQ 2JA8G 3OYYA 3M85A 3F2CA 1N34Q 4JBMA 2HIXA 1Y1WG 4WJ3M 3K81C 1JMCA 4LF9L 4LUOA 1VQLA 2JA7G 1K3RA 1N34L 2CKZB 2ZJRA 3G4SA 2NVXH 2HT1A 3KJOA 4IFDI 4JBKA 2ZJPA 3KJPA 3ULPA 3U50C 5FLXc 4JI3Q 3HOXH 3HKZG 3HOUH 4FDBA 4IPDA 1PFSA 1QVFA 2R93G 1EUJA 1XPOA 3M4OH 1L1OA 4P72A 1L2FA 2OWOA 1PVOA 3GTJH 4YCUA 4A75A 4A76A 3UDIA 5IP7G 4X65Q 1K0RA 3HOVG 1VQCA 1N9WA 2QGQA 2VZAA 3G6EA 1M90C 2V1CC 4JI7L 3PO2G 1HNXQ 4A93H 5IY0A 3M3YH 3CCLA 3BZKA 2QA4A 1JB7A 3CPFA 2GVAA 4X62Q 4DR7L 4XTCS 1TWGH 4P75A 3NBHB 4JI8Q 3L2PA 1VQBA 3ER0A 4BY1G 1VQHA 2K5NA 3STBD 1VQ9A 2F4VQ 4GKJQ 4A3CH 1HNXL 1MJCA 2AHOB 1RIPA 4JI2Q 3PO3G 2I5HA 1PV4A 3RZOH 5H1SE 2JA6G 2CQOA 4X62L 1CKOA 4JI8L 4YWKA 3GTPH 4IPGA 4HIKA 4A3JG 3A74A 3PIOA 5IWAQ 2IT1A 1PYSB 5M3MH 2Q2UA 5GROA 4IFDJ 4YY3L 4IFDG 4DR5Q 2Q2TA 4QY7A 2PI2E 4BXXG 1HZAA 5FLMG 4PZ8A 3F2BA 4OXPA 1XMOQ 2RCNA 4GLAC 4JC0A 5IWAL 5IYCH 1Q12A 4A3EG 3S1MH 4DR2L 1GVPA 4DR5L 3S24A 1YEZA 1EIFA 4DK6C 2VQEQ 2ZM6L 3STBC 1XMOL 4UPAA 2ID0A 4LF5L 1I94L 3I4NH 4QL5A 5IYBH 3I56A 2NVTH 2GN5A 1WCMG 3S2DH 3DLLA 4DV3Q 1HNWQ 1PH3A 1Q8KA 2CWPA 2ZTDA 1AE2A 4MTNA 4B3SL 2WP8J 2VW9A 3AQQA 1HZCA 1G6PA 4DV5L 1IXRA 2N78A 1PYBA 2VQFL 1YZ6A 1HZ9A 1SRUA 4YWLA 4GN4B 4LW1A 1U5KA 2F3IA 5M5XH 3UDGA 1OXSC 1W2BA 5DLQE 3CMEA 3WWVA 1LYLA 5IP9H 3HOWG 4HIOA 1NMGA 2LSSA 2K75A 2PQAB 4NB3A 1N33Q 3U58A 2NVQH 1JJ2A 2R92H 1Q7YC 3NELA 4EX5A 5C44G 1VQ8A 2R7ZH 5HGQA 1VQ6A 1KL9A 3ERSX 3J81j 4AQYQ 1VCIA 2D62A 2MO1A 2NN6G 5M3FG 1HNZL 3GO5A 4LFAL 2YU9H 4A3IH 1IBML 1L0WA 1C9OA 1K83H 1I50H 1N33L 5K36G 1Z47A 3J80c 4DR1Q 1K8GA 5AJ3Q 4A3DH 3HOZH 4DR6Q 1YJWA 5LMNW 3HKSA 3HKZE 3IRBA 2YTXA 3RR5A 3TRZA 5J3BA 1X6OA 3H0GH 4DPGA 1IYJB 2HIVA 4C3IH 3PV0A 5AJ3L 1QVGA 2VS1A 2CCZA 3S2HH 4P74A 1YHBA 1N32L 2I0QA 1P16A 1VQIA 3KF8B 3MEFA 1QZGA 1YI2A 2WAQG 4TVAB 3RNUA 2YTVA 2UU9Q 3S1QH 1Q81C 1V1QA 1YITA 1Y14B 1TWHH 3BZCA 5EAYA 3UDFA 4Y52H 1KXLA 1YJ9A 3E9HA 2K14A 1OXVA 5C4JH 5C3EH 1SFOH 2JA7H 4EQ5A 4DV0Q 2NZOA 4KI0A 4JI0Q 5IT9c 2UU9L 1OXTA 3D0FA 2Y0SG 4LFBQ 1TWFH 3H3VI 3GTMH 3S17H 2A19A 4AH6A 2UXBQ 3TS0A 1IBKQ 2IHEA 1N8RC 3S1NH 2R93H 1X3FA 5BR8Q 1TWAH 4R4CA 4A3FG 3LGJA 3HOVH 4R4IA 2UXBL 3A5UA 5LMNL 2ES2A 1KAWA 5BR8L 3W5OA 3PO2H 3AFQA 1TWCH 3EN2A 1PA6A 4DR3L 4JYAQ 2UXDQ 1L1OC 1UE6A 1UE7A 2PQAA 2XTIA 4A3LH 4HJAA 3KLWA 5LMUL 1WI5A 1FJGL 3J7ZC 1X9NA 3CCJA 1VQ7A 1E1TA 2LXJA 3PUXA 2JA5H 4A3GG 4R4QA 2UUBQ 1Q1BA 3HOYH 1PH4A 3I2ZA 4DV2Q 2D0PA 1ASZA 3ULJA 4MNOA 2RHSB 4IPHA 3OTOQ 3OW2A 1OTCA 1PH2A 4A3KG 3EBEA 4JI6Q 2BH8A
chains in the Genus database with same CATH superfamily
4IFDH 4FXKC 2XRSD 4ME3A 5FLMH 5C4HA 3BDCA 3DEOA 4IUPA 4JI3L 3G71A 4IQZA 1PYWD 5E4WC 3CC2A 2XRQD 1GJXA 2Q2IA 3CCSA 2NWGA 2JA5B 1BF4A 2N55A 4C3HH 2WINB 1IYVA 3HRZC 1BBWA 2ZXRA 2IX3A 4DK1A 4BBRB 4GNXA 3I4MG 4V0BA 2ZTCA 3FPUB 2A69C 1W3SA 4GN5A 5GAHC 2VUMG 4X6AH 4P71A 3LX0A 2A1AA 4K0KQ 3S16B 2B2UC 4A93B 2QDBA 1DOMA 3TSSA 4CDEC 1X54A 3I7FA 1TWGB 3IFTA 4H02A 4DV1Q 3I55A 3Q23A 2QCPX 1QE6A 2ATWA 1BQQT 1S3OA 5JAVA 5K5PA 3R8BA 5A2QL 3PCOB 5FK9C 2MO0A 3HGBA 1ICFB 4LMQD 1Y1VH 2J7ZA 2RHQB 3HOUG 2CFMA 1S5BD 3BVMA 1GHJA 2N88A 2RF4A 3Q8DA 3VR4A 1YNNC 1YNXA 3E0EA 1QNKA 4A3BB 3PUVA 1C7YA 1MIUA 3K5LA 1GD7A 2NTSA 5FKAC 2VB3X 2R6GA 5FJ8H 2B63G 3PMFA 3CF5A 2HUGA 3VR2A 5IIFA 3FDTA 5CBEE 1EOTA 2K50A 5EKIA 1VQNA 1U0LA 5E7NA 1PZKD 3FMCA 1XX8A 2SEBD 2J4XA 2JP1A 1LACA 4Y7NB 4B3MQ 2Z6BA 1NBWA 3DM1A 1EWHA 1EYGA 3TS2A 1E3PA 3M4QA 1HTPA 4WJWA 1VQJA 3I4NG 5JVG3 3NPPA 1QWYA 2I07B 4MHEA 4R4TA 4C3IB 3S2HB 2EYOA 2F0VA 2E2IH 1EYCA 3I70A 5C5MA 4JI0L 4O1NA 2K6AA 4ZLTF 1WTHA 2DGYA 1OO9B 1KD1C 4DUYL 3ICEA 1EOVA 5C0XI 2K32A 2R92G 4DNIA 3SK6A 2R7ZG 4JI5L 3KOJA 1J6QA 4R9WA 3HKZB 1E7ZA 2X69A 5D3IB 2JA9A 1S72A 3OMGA 3HOZG 2B3GA 1CQFA 1K73C 4UP7A 4NW2A 1BBUA 4CJ2C 1N36Q 1RHPA 5FLXE 3H0GG 5CR3A 5IGDA 1WOCA 1AE3A 1TS2A 3FKIG 4O0AA 3TP5A 2UUBL 3KDFB 2VXWA 4BXXH 3RLFA 4DV2L 4XDXA 1ICWA 2EOTA 2A68D 3PO3B 1HR0Q 2JA6B 4K8JA 1G51A 3J81L 4MZ9A 4RCNA 2XIWA 3ZYYX 2BH2A 3AB9A 3QB3A 1HA5A 3MA2B 1D1KA 4XYQA 1HJPA 4Q0FA 4QB4A 4JPBW 1SEBD 4A4IA 1CQVA 4ZAIA 1M1KC 2K28A 4GKKL 4GN3B 5JEAG 3P75A 1YBYA 3K5MA 1BVSA 4DR7Q 4C3HB 3OPOA 1AP0A 5D3DA 2K04A 4ODGA 3CC7A 4P73A 1DJRD 1BCPF 4K0KL 1YIJA 1D6EC 5M3FH 1BKBA 4XIGS 3P7JA 5I9OA 2K01A 1NE3A 3CCQA 2EYHA 1PH5A 1JORA 4B3RL 1BOSA 3PIO3 1SBBB 3KLRA 1QB5D 4GLVB 4K5WA 1PRTD 4DR2Q 4RAUC 4CBVA 1BCPB 3RN2A 1WD1A 1UUPA 3A7LA 4APVA 4R4OA 3RN5A 2O2LD 3FHWA 3NENA 4UDUC 2EPBA 2F0IA 4KV6A 2IY5B 4ALPA 1JWMD 3K57A 4DK3C 1E2ZA 2GVBA 2CHBD 3TBIB 5BN4A 4HN7A 3S15H 2LFNA 1C8CA 3E6ZX 1KQSA 3CKIB 4LFAQ 2JEAI 3K8AA 4GLXA 4B3TL 3K7UC 2RDGA 4UY8C 4M1UB 1PTOH 2V4DA 3L0OA 3QG1A 2EVBA 5L37A 3VYUA 1NAPA 4B3ML 4FXDA 4J8QA 2L5TA 1JT8A 2F0JA 3S14H 1B8AA 2IL8A 4A3GH 3K80C 1LTLA 3GTLH 2K7VA 1L1OB 1A63A 2EE1A 4AYBE 1VQGA 1WTVA 2RQXA 3CQZH 1CI3M 1KHIA 5EQ0A 5LL6S 1B7YB 5BN5A 4OEMB 3VYTA 1VF5C 2E2IB 1RKNA 4HJ7A 3J81c 2EY6A 3IFDA 3ULLA 1TS5A 4OGQC 2VB2X 1B44D 2J0TD 4DR3Q 1XNQL 3Q6SA 3EJIA 2AKWB 4EQNA 1I6HB 2B29A 3NTHA 4JBWA 4RG1A 4DK0A 3EQLC 1Y69U 4JBMA 3CRKC 3C3LA 4WJ3M 4LF9L 2L1BA 2FFKB 4LUOA 4PV1C 1K3RA 5A35A 3I3CA 1N34L 2HT1A 3ULPA 1EYDA 1U4RA 1PRTF 5A2QE 5EPJA 1EUJA 3M4OH 3LWUA 1YNJD 4P72A 2OWOA 4YCUA 4A75A 4JK1C 5IP7G 1QOHA 2VZAA 1BUVT 2RBMA 2V1CC 2NVXB 2G9HD 4IURA 3BZKA 1DCZA 1JB7A 4DR7L 1VQBA 1JQYD 2B2TA 1VQ9A 4BWGB 1GUGA 4JI2Q 1FR3A 2I5HA 1PV4A 1H9SB 1U4LA 4JI8L 3GTPH 4HIKA 4A3JG 1YNJC 3A74A 3PIOA 2IT1A 5M3MH 4Q5VA 4OO1H 4OIKA 1R4QB 1FNWA 3WOEA 5M3FB 5IWAL 2M2LA 4B08A 4A3EG 4DR2L 4ZCKA 4QL5A 4TKOB 4E6IA 1EY4A 4DV3Q 1B9MA 2KA7A 1Q8KA 1LTAD 1F2ZA 5FO7B 3KBGA 2HCIA 4ILWA 1G6PA 1RTOA 3S1MB 4LW1A 4DU9A 5M5XH 4KN7C 2GA4B 5FO8B 3T51B 1SYDA 3WWVA 4UHVA 2EJGC 2B8GA 1NMGA 2LSSA 1HA6A 1N33Q 1VQ8A 5HGQA 4AQYQ 1PTOF 2NN6G 5TSSA 4LFAL 3GO5A 2YU9H 5K36G 3OWEB 5C6AA 4A3DH 3I72A 2EY2A 3NTKA 4DR6Q 4XT1B 4DA2A 2A6ED 3IRBA 1STGA 1X6OA 4FNFA 2NVQB 1YHBA 2I0QA 1P16A 1PDQA 2NUCA 2YTVA 4A3IB 1I50B 1TQOA 1D5MC 1EY7A 1O7YA 1TWHH 1Y14B 3UDFA 4WORA 3E9HA 1OXVA 4FF1A 4FF4A 2JA7H 5IT9c 2UU9L 4K2LA 2O5JC 1LTGD 1LT3D 4G7OC 3GTMH 3S17H 2A19A 2MJ8A 2M9VA 1IYUA 2UXBQ 3Q22A 5JOBA 1TWAH 2F0WA 3K0YA 1KDAA 4X3KA 3HOVH 5C4JB 1S5FD 5C3EB 4C3JG 2L55A 3N6RA 4DR3L 4KHVA 5IOCA 1E2VA 2MGSA 2EJFC 3KLWA 4KN4C 1ET9A 4IUNA 1VMPA 4QUCA 1X9NA 2BOSA 2E74C 3NHHA 1E1TA 3PUXA 4AYBB 2AQ3B 2JN4A 2JA5H 3FEWX 1G91A 2B8FA 3I2ZA 1FYCA 1T5XD 3EBEA 3E9IA 5D14A 4BBRH 3FVQA 2I5MX 3X3MA 3VDYA 2DJFC 1X3PA 4N9TA 4Z9CB 5I9PA 1JCKB 5C4XG 1LTID 3S16H 4BY7G 2M00A 5CGKA 3JAMc 2MPMA 1WCMH 2K5HA 1KDCA 4DFAA 4P2CB 4JW0A 1CTMA 4KHPQ 4LFCL 2L12A 5EBDA 1HCZA 4JI2L 4WRDA 2VY3A 2F3VA 1C4QA 2MFIA 4UP9A 3PF5A 2PMZE 1I6VC 4C1NK 4QJFA 1EIYB 2KJXA 1DOLA 3BVGA 2MHVA 2F0PA 2OTJA 3PUYA 1GUOA 1SE2A 3GTPB 4A3BH 5DNFA 2L9HA 2JEBI 5M3MB 4HJ8A 1VQ5A 1AN8A 4EGVA 1CZWA 1XMQL 3VYSA 3D4RA 4DV3L 1SDFA 2EJMA 1X3GA 3UDXA 4HSVA 2RSNA 3NQTA 4NXMQ 1A3VA 3RLOA 1PHJA 1SJED 5IYDH 4LF4L 1LTRD 3KLSA 1TVXA 1SMXA 4Y7NH 1I4RA 3NBIA 5JJIA 1B3QA 1D2BA 3KBXA 4BBSB 5M5XB 1UNSA 2EXDA 3A56A 2KENA 2VNUD 4ZUIA 4AQYL 3BS1A 1PH6A 2O5IC 1H9SA 3AFPA 5BN3A 1LUZA 1B4OA 4X66Q 4A3FH 1EZ6A 3MXUA 2DNEA 2PCFB 3JC66 1RTNA 1AZPA 2C35B 1SYGA 2CW0D 1XTCD 2YU9B 2AMCB 4QQBX 1B50A 4KY6A 1EQRA 2NZ1D 2AWOA 4JI1L 4BA1I 4J6HA 4DXFA 1NCVA 5IYBG 4IOAA 1QZHA 4OELB 1Q86C 3CXCA 3PUZA 3K7AH 2KECA 3M4YA 3T1YQ 2K05A 4DUYQ 1WYDA 1NNXA 1HTLD 1SMYC 4BA2I 3I90A 3OW7A 1PH8A 1JOOA 5DAUA 1B70B 1HFGA 2CQAA 3KFUA 1GXDC 2DUDA 1OXUA 3R93A 1Y1WB 1SR3A 3BDLA 4JI5Q 4K5XA 3BJUA 2LMCB 1AH9A 2JA7B 4HEDA 1QJOA 1QILA 1CSQA 3GTMB 1JC7A 4IALA 1V43A 1OXXK 2SNSA 1XYIA 1TWAB 2Z6KC 3PO3H 1IW7D 2A8VA 2JA6H 2VUMH 1O7ZA 3HOVB 1H9JA 2KHSA 5KRUA 2PI2A 2XNAC 4C3IG 1TXYA 3ZJYC 3AEVA 1SNDA 2ZTEA 3M7GA 1TY2A 3E0JA 4HCEA 1D7QA 4BY1B 1VQEA 1M4VA 4JBJA 4IOCA 4R8NA 3LNNA 3CCMA 2N3SA 2F03A 4X64L 1VQMA 1IW7C 2OT2A 4GS3A 2Z0SA 4GKKQ 2PNHA 3A54A 3F8TA 2F0NA 1CA6A 4JI7Q 1EY0A 2IW3A 1EZ8A 1VQ4A 2QEJC 5JJZA 3AMUA 4KHPL 4NXNL 1D1IA 1STBA 2CH4A 1R9TB 3TREA 3I8ZA 1WCMB 3S1RH 1STEA 4A3LG 3EFXD 2B63H 3D4WA 3J7A5 1F9PA 2KVMA 2B2YC 1WJJA 4B3RQ 3LWEA 3TQYA 1NY4A 4OONA 4K2KA 1A3TA 3GTGH 1ZYRD 2KCMA 3EIVA 3HOYG 5GAEC 3HOXG 1XXGA 5JJKA 1A15A 2NZHA 1AEXA 1SROA 4JOIC 5F2DA 1UE1A 1FVIA 5GADC 2RDHA 2F0GA 2MP1A 4B3SQ 1V1PB 4KD4A 3G6JB 2B2VA 3PGZA 3W3AA 4NXML 1BCPD 2PW5A 1ZYRC 4PMWA 4CKBA 3G7LA 1RODA 1IL2A 1TY0A 5E1FA 2H4OA 2AQ2B 1HRJA 1ET6A 2PMZB 3VA5A 3FPPA 2CWAA 2E8GA 3F2UA 4YCWA 4B3TQ 1CHQD 1Q46A 1KRTA 1TS3A 2Q8RE 3D8GA 3N52A 1IBLL 4RGMA 1GKHA 2HDMA 3GP7A 4TQUS 5IYCG 4L5TA 4X66L 1ASYA 1RL2A 4EVOA 1UEBA 2E5LL 2EY1A 1CKMA 4DUZL 4GOPC 3TP7A 1KDBA 1Y1VG 2F0MA 4A3FB 2VL6A 4NPSA 1VMCA 4PNYA 3CPWA 2OQ0A 1ILQA 4G4KA 4B9WA 4A3KH 2ALYB 3FKIH 1UWVA 1NJIC 3T1YL 3H3VH 5CMDA 3VR3A 3MXNA 1HZBA 1Y8NB 4PZ6A 4DN4M 5FJ8G 3J80L 1I6HH 3K7AB 4HCSA 4LAAA 5ELFA 4CHTB 5I2YA 5C0XH 4DNRB 5C3WA 1XNQQ 4HMIA 1S4ZA 1S5CD 1SAPA 1EQTA 1EY6A 2XVSA 2OF1A 2OQKA 3GD7A 1IHZA 1HPCA 1MBYA 2PNRC 1KTKA 1X3QA 5CV7A 1FL0A 1EIHA 4K14A 4LF9Q 5LMUQ 2Q2HA 4PMCA 3OYYA 3M85A 1LTSD 1N34Q 1MSHA 3I4MB 4DF7A 3QOJA 1VQLA 2VUMB 4X3SA 1SNPA 2NVXH 3NSWA 4RH6A 4CKCA 3G4SA 1TS4A 4ME5A 5JPNC 3KJOA 2ZJPA 4JBKA 2R3ZA 2OXPA 3U50C 5DM73 5NUCA 2R93G 1U9RA 1PVOA 3GTJH 3MEHA 1HFNA 3OSOA 3UDIA 1K0RA 1SYFA 2QGQA 2DNCA 4JI7L 4F87A 3PO2G 1DD2A 1O7LA 1QNUA 2A68C 2Z1CA 1I4HA 2OEOA 2QA4A 3CPFA 2P5ZX 3HOUB 1A3UA 3NBHB 4JI8Q 1DXMA 3O13A 1VQHA 2K5NA 2F4VQ 4A3CH 3DEPA 1HNXL 3T13A 2HCCA 3KLSX 3OOCA 4KJOA 3RZOH 4X62L 4OL7A 4IPGA 4ZQ3A 1PMRA 3C46A 2KCCA 5IWAQ 2Q2UA 3SK8A 2Q8TA 1XWEA 4IFDJ 3H09A 1RJTA 3S1RB 2Q2TA 4QY7A 2PI2E 4BXXG 1HZAA 2B63B 3MAQA 2F0DA 3F2BA 2RKSA 2D9UA 4KMUC 3S1MH 3GTGB 1GVPA 3UI2A 1XMOL 2ID0A 3S2DH 3E5SA 3I56A 2GN5A 3DLLA 2C9OA 4CJ0B 1WTXA 1PH3A 4DXGA 2CWPA 3A8KE 4B3SL 2WP8J 1K3BC 2VW9A 4G57A 2N78A 1PYBA 1HZ9A 1PRTC 1B2TA 4YWLA 4GN4B 4S3SA 1U5KA 2F3IA 4H7BA 5C5LA 3UDGA 1OXSC 1W2BA 5DLQE 3HG9A 5I6YA 1IL8A 4M8AA 3CMEA 5IP9H 4HIOA 4KD3A 2K75A 4NB3A 1Q90A 4NDXA 2NVQH 5FO9B 1JJ2A 1Q7YC 1VQ6A 1KL9A 2HQEA 2D62A 5M3FG 4K8IA 1D5ZC 4FP5D 4A3IH 4K6LA 1K83H 1I50H 3J80c 1PLFA 4DR1Q 3E3XA 3OIPA 1YJWA 5LMNW 1BXTA 3RR5A 5J3BA 2B2WA 1JOKA 4DPGA 1IYJB 3PV0A 1QVGA 3A8IE 2VS1A 2CCZA 2R92B 4P74A 2R7ZB 2WAQG 2DJGC 4C1NI 2UU9Q 2XWBB 4Y52H 3BZCA 5EAYA 1CT1D 4IN3A 1YJ9A 1ZXTA 2K14A 4N8X1 3IL8A 5C4JH 5C3EH 2NB0A 4EQ5A 4DV0Q 2NZOA 4KI0A 1V1PA 2EXZA 1OXTA 3H0GB 4U673 1PTOD 4A3KB 2Y0SG 4LFBQ 3FKIB 2KEDA 1TWFH 2PYKA 2G5DA 4DGZA 4N9PA 2SDFA 1L0YB 3S1QB 4BS9A 3L3OC 2ZXPA 1EYAA 1MGSA 3LGJA 4ZK9B 1SFOB 5BR8L 3W5OA 1ML0D 2UXDQ 1UE6A 5IT9L 5EGTA 5LMUL 1STAA 3S1NB 1PTOC 3J7ZC 1LABA 4A3GG 3MTSA 3RD4A 2F0UA 2D0PA 3KK7A 3ULJA 3OW2A 4IPHA 1TWCB 1CZGA 2BH8A 1JE4A 4GNXC 3EVQA 5LL6X 1XTDA 5G3LF 1KRSA 1HUNA 3W2DA 4MN3A 4HAEA 5CV6A 5ELBA 1VQKA 4JI6L 3G48A 2Z6KA 1EFWA 3DXJC 4YCVA 2YV5A 3M9BA 4U68A 1HUMA 3M7NA 3T16A 2DY8A 4LFCQ 5C0XJ 2E2HH 2R7DA 3RZDH 2JYOA 3SEBA 4LF8Q 3GTJB 4RGTA 5I6WA 3D31A 1GUSA 4QCLA 1FGBD 2IWHA 2F4VL 2H1EA 3VR6A 4PZ7A 1FNVA 1V9PA 3BG3A 1DONA 2NN6I 2ICIA 3W1BA 3JAML 2XGTA 3FP9A 3RZOB 1B3AA 3J7AF 1WTOA 1XMQQ 3L7ZC 4HMJA 3A55A 4C56C 1K9MC 2BE5D 2B2UA 1FGUA 1F2LA 4EQOA 4BBSH 4OIJA 4LF4Q 2B2YA 3SVMA 2EY5A 2KHIA 1QUQA 3U4VA 3S2DB 1XPRA 1JJGA 3QR8A 4DV7L 3CD6A 1LM0A 1MI2A 4XQNA 1RCVD 1UE5A 3X3NA 2F0SA 1MKHA 3NBHA 4YHHL 4NMZA 1G2SA 2HHHL 3NTIA 2BA1A 2EYJA 1H95A 1Q3LA 4DR1L 4OO1G 2E2JH 3C1EA 4G7HC 4C3JH 3CCUA 2AQ1B 1T9HA 1EY9A 1WTPA 4JI1Q 4WFN3 4IJHA 3P20A 2JA8H 4DR4Q 1K83B 4OX9Q 3SK4A 2KEEA 2F0LA 1EQVA 1Y1WH 2F0FA 1S5ED 5JPMC 2QDLA 3KF6A 1CKNA 3QOLA 4DV4L 4LK1C 1H9RA 3F1ZA 2F0EA 2HD3A 1X3EA 2K5VA 4KKSA 1XPUA 4ZRZA 2A6EC 2L15A 3J81E 4DV0L 5CV9A 3TZDA 3PIPA 2NYZD 3CCRA 1EFID 3MVVA 4LFBL 2A5HA 2Z9HA 1EWIA 4JV5L 3BDOA 4GOPA 3DWPA 5C4XH 3C2PA 4RA8A 4LWCA 4DV6L 5KYLA 4HSPA 1TWFB 2IHFA 3T53B 2JQOA 3V2TA 4BY1H 1MJEA 1JOQA 4JCVE 3WOFA 4DAYB 3T4AC 1QG7A 4A3DG 1JE5A 2UXDL 4HJ5A 2F0KA 3K5OA 2Q8IB 2YTYA 4OHJA 4LUZA 3CAMA 3CCEA 3PQIA 2UXCL 2F52A 3A0JA 3DWAA 4OWXB 2MQHA 5KEEA 4X64Q 2K52A 4LF7L 2ZT9C 4L5QA 1R9TH 2JK8A 3TEHB 1EY8A 3RUZA 2WB1G 2LS01 4XT3B 1HH2P 1XJVA 1PFNA 3GQBA 3QO2A 5HGTA 4NXNQ 2UUCL 4CGYB 5IODA 4LF8L 3K58A 5C3XA 4A3MG 3MFGA 1Q1EA 2A6HD 3HOWH 2F4IA 3GTOH 4HR7B 2E2HB 3RZDB 3P1HA 4KY7A 5C44H 2JJQA 2PQEA 5C4ZA 1H9MA 4DNTB 3GDEA 4QF4A 3HS0C 4KKTA 2JA5G 5CORA 2CVRA 2FJ2A 2A74C 4QIWE 3D6WA 1LV9A 1XNRL 1R4PB 1G291 1VQFA 1D8LA 2E76C 2OTLA 2F0TA 4BBRG 1VS0A 3MXNB 2A6HC 4C2MB 1I94Q 1VQDA 1KNAA 4IO9A 3NUCA 1KC8C 2L11A 4A93G 1NSNS 5EKLA 1D5XC 4DV5Q 2XWJB 2A73B 3I4OA 2F1MA 2VQFQ 2BCOA 3HFZB 4H44C 5IGFA 1V8QA 5JVH3 4LF6L 1X32A 5M5WH 1IBLQ 2FINB 1LT6D 3BYTB 4DAPA 3HP3A 1TT2A 2OCEA 2IPKD 1AW7A 2E5LQ 3AYHB 3ND8A 2AUJD 1CHPD 4DUZQ 1G2TA 4HJ9A 2KCNA 3GTKB 1J5EL 4QUFA 4A3BG 2EDGA 3QJYA 1K8MA 3URYA 1CSPA 4DR4L 4OX9L 3ITPA 1SYEA 2E2JB 5IT9E 1LLRD 4L63B 1Y8OB 1NMFA 3R2IA 4C3JB 1EQQA 1O7IA 5GAGC 1SE8A 4PG3A 1I5FA 2JA8B 1GUNA 1ESRA 2F0OA 3NE5B 2FXQA 4H13C 2G9DA 2BDNA 1YHAA 1A62A 1X65A 1LTBD 4TSSA 2CW0C 1SYBA 1JICA 1HR0W 1II3A 2WKDA 5IYDG 2H5XA 2KUMA 3DWQA 3VYRA 5J1ZA 3IKJA 2L0CA 4ZUJA 3I4MH 2QILA 4K5VA 1E22A 3CW2C 4POFA 1LT5D 5C4XB 3DM3A 3NXWA 4BY7B 3D6CA 2Z8LA 1FJGQ 2NVYB 5DM63 3F2CA 1B53A 5KNCA 3K81C 1JMCA 1BBXC 2Z4HA 3K6OA 3JAME 4IFDI 4KK7A 1LT4D 1W6KA 3V05A 3KJPA 5FLXc 2EYFA 3HOXH 3HKZG 2A69D 3HOUH 1UEAB 1QVFA 5ELEA 1XPOA 1L2FA 5J22A 4X65Q 1N9WA 5KIXA 3G6EA 1M90C 3VA7A 4TRDA 5CC4A 1HNXQ 1V1OA 1ZEQX 2R61A 2GVAA 4X62Q 4XTCS 3MC0B 3L2PA 3ER0A 4GKJQ 1MJCA 2AHOB 2DN8A 1RIPA 1F2YA 3PO3G 5H1SE 1PXUA 1SNOA 2JA6G 2CQOA 1CKOA 4DAYA 3NWTA 3A7AB 1VF7A 4B9XA 3OIQA 3HOWB 3GTOB 5GROA 4IFDG 3M3YB 4L8JA 5FLMG 5C44B 4PZ8A 1YNND 1XMOQ 2RCNA 4GLAC 4JC0A 5IYCH 1Q12A 1GUWA 4DR5L 3S24A 1EIFA 4N8FA 4DK6C 2VQEQ 2XN9C 4C3HG 4UPAA 3I4NH 1I94L 1KNEA 3HEJA 2NVTH 4I7AA 1HNWQ 2ZTDA 1AE2A 4RGOS 3AQQA 1HZCA 4DV5L 1IXRA 2VQFL 1YZ6A 2SNMA 3MWYW 1WTRA 2F0HA 4PMBA 4H0LC 4KKUA 2O4XA 5CYUA 3DMUA 1SJHD 2R92H 3NELA 4EX5A 3NQIA 2R7ZH 5T1GA 4QIWB 2X6GA 5I4DA 2X6LA 1BCPC 4FF3A 1ILPA 5M5WB 1L0WA 1C9OA 2WKCA 3TN2A 3HOZH 4MTKA 1SE3A 2YTXA 5DEHA 3H0GH 5AJ3L 4L6TB 1VQIA 3MEFA 1QZGA 4TVAB 3U9OA 3RNUA 5AFWA 3S1QH 1Q81C 1V1QA 1YITA 2KQ3A 1KXLA 1SFOH 4R8IA 5IGCA 2EYPA 4RKBA 3D0FA 3QIAA 3H3VI 3H94A 4AH6A 3TS0A 1IBKQ 3R3OA 2IHEA 1N8RC 3S1NH 2R93H 2RVLA 5BR8Q 1TKWB 4R4CA 1RDPD 4KTAA 4I65A 4R4IA 5JEAH 2K5DA 3A5UA 3PO2H 1B9NA 1TWCH 5E4XA 1PA6A 4JYAQ 1DOKA 1L1OC 1UE7A 2PQAA 2XTIA 1CK1A 2PO4A 2E75C 1LO5D 5E3FA 1WI5A 2TSSA 4X3TA 1FJGL 3CCJA 2LXJA 4RHRA 4R4QA 1PH4A 1HHVA 1ASZA 1QCBD 2K1BA 4JI6Q 3MZ5A 4A3KG 3FRPB 4RMFA 1A0IA 2MNAA 3BVZA 1QUQB 3UE0A 3OTOL 3KF8A 3W1GA 1MD2D 4DR6L 1ENAA 3H3VC 1I4XA 2QEXA 3HOYB 1DGSA 4X65L 3HOXB 1YVCA 2QKIC 2K4KA 4LJZC 5C0XG 1M8AA 2YYZA 4RFBA 2I5LX 2I46A 3AU7A 5JJLA 1K8OA 1SNQA 3V96A 1F9SA 4GKJL 3TZUA 4FXGC 1Q82C 1EWCA 2QW7A 4HIDA 1SNCA 3T1HQ 2WAQE 1RF2D 1NUCA 4CDFC 4F88A 2D0OA 4NP5A 5G3LD 4QGUA 1I4PA 3KF6B 1CKNB 4O2DA 4RHSA 1F9QA 1SLJA 1K8AC 2DY7A 3CHBD 1Q8IA 4DV1L 4CDCC 4EQPA 1JR0D 1MHWC 2Y0SE 4RKLA 3TDQA 4RGNA 2KHJA 2VQEL 3J80i 1O78A 1CA5A 2HDLA 5D65A 5ISRA 2F3WA 2IX1A 1HNWL 3CU7A 4GOPB 4DV7Q 5ELOA 2B39A 1AFPA 2ASBA 4YIJA 3I4NB 4J15A 1TIID 2NVTB 1EU3A 1SXTA 1Y1VB 4RCOA 1Z9FA 2C5CA 1DM0B 4YHHQ 4ULLA 2HHHQ 4KLKA 3SR1A 2N49A 2EYMA 2KOLA 4A3CG 5CV8A 1YHQA 2CH4W 2EYLA 5J39A 1CFMA 3PUWA 4LUVA 1P8LA 3ND9A 3L9AX 4KY5A 2WFWA 1KABA 3J81i 5IGGA 5EPKA 1U4PA 2PW7A 3U9SA 5M9OA 1I3QH 1VDZA 3CP0A 4DV4Q 1A2TA 4QMGA 1C48A 1PH7A 3HOZB 4FO2A 4DAMA 1RD9D 1J8IA 1X56A 1FNUA 2AWNA 1E1OA 1C0AA 5GQOA 2KBNA 2K33A 4JV5Q 2IX0A 3TP6A 4ID6A 1WVLA 2ZXOA 3PIP3 2UUAQ 4DV6Q 3NK9A 3T56B 4JG2A 5IP7H 3F2DA 2NBFA 1IBKL 5IP9G 3NEMA 1IZ6A 2HQLA 4OWWB 1H9KA 3MFYA 1K28A 3H15A 4LNQA 1PH1A 1KIXA 5HY6A 1GUTA 3RLNA 1A8VA 1F77A 5EPLA 4A3IG 2R93B 4JI4Q 2EQSA 4MIUA 4UAIA 4JYAL 2UXCQ 2EIFA 4PQXA 1PFBA 3DHQA 1TR5A 1JJCB 4A3JH 4UP8A 4L5SA 1EEID 4ZKBB 3PO2B 4LF7Q 1TU2B 1N36L 3KUPA 1FD7D 4HIMA 3Q0AA 1CM9A 1NTGA 1GOZA 1CUKA 4A3EH 2IJ0A 1VQOA 4WJ4A 5C3EG 4YWMA 3BYYB 1Z7TA 3M4PA 1QVCA 2UUCQ 1HR0L 2WV6D 5T1IA 3NP8A 4IZ8A 3BU2A 1S40A 1J9OA 3ERQA 4AYBG 2R7FA 4NKLA 5JEAJ 2FMMA 5IE8A 2BA0A 3SHLA 3EROA 3TP8A 1DYQA 1SN8A 3PF4A 1PRTB 5CV4A 4C2MH 3T1HL 2SOBA 2NN6H 1XNRQ 4L5RC 4KHZA 3PSIA 5K36H 1PZJD 1YJNA 4OO1I 4YY3Q 2N8NA 4XQJA 2B2VC 1HQMC 4XQQA 4AIMA 3GV3A 1B1ZA 4V190 5CBAE 4R1JA 3S9WA 1F9RA 1X55A 2ZM6Q 4LF5Q 4IJLA 3KDFA 1G6ZA 3A8JE 1HXYD 3WDNA 1ONLA 4LF6Q 2RA4A 1E0BA 5KGUA 1PH9A 1LTTD 2XSCA 3H91A 4IPCA 4XYOA 4G7ZC 2D2CC 3BZDB 3OHXC 2BE5C 3B6YA 4JOIA 1STNA 1PZID 2WAQB 3J80E 1EEFD 3A5ZB 3GTKH 2JE6I 2EZVA 1KLGD 1NR2A 3U4ZA 5M3MG 1EU4A 5M5YH 1HNZQ 1J5EQ 2ZJQA 1VQPA 1IBMQ 1K0SA 2Z4IA 2MUYA 3J7AV 1ENFA 2Y0SB 1GO3E 4OWTB 1HQRD 4GZYC 1I4GA 1IKMA 3MXGA 3KYHC 3UE1A 2ICEC 3S15B 1N32Q 2LXKA 2WB1E 1EY5A 1G8ZD 4F7XA 3CCVA 4FF2A 4DAVA 3GTQH 1I3QB 1EIGA 1E24A 1S5DD 4BBSG 1PTOB 1A6XA 3MXPA 5ELNA 3S14B 5KYIA 1STHA 2UUAL 3GTLB 4BY7H 3QWNA 4A3GB 1DZ1A 1WFQA 3VR5A 2KCTA 5IGBA 4GNXB 3K0XA 1L0XB 2NVYH 2PZWA 3CMAA 2E2DC 4POGA 3JAMi 1W6JA 1GM5A 5LMNQ 4X3UA 3CC4A 4DKAC 4JI4L 3CQZB 3SGIA 2RCFA 2FMCA 2FHTA 2RSOA 5FOBB 4A3MH 2PZUA 1VQAA 2JA8G 4K6DA 4FVMA 5CV5A 1ENCA 3H6MA 2BDOA 2LKVA 2HIXA 1Y1WG 2TMPA 4ZKCB 2JA7G 4A3JB 2CKZB 4IUTA 1SE4A 2ZJRA 3K5NA 4JI3Q 1NR4A 2D5DA 4FDBA 4IPDA 1PFSA 1WTQA 5ELDA 1L1OA 2K03A 2LY7A 2L4NA 1STYA 1IKLA 4A76A 4A3EB 3HOVG 3TMEA 1GHKA 1VQCA 2QF7A 1KAAA 1SSOA 2RDFA 5ELCA 4A93H 1SYCA 5IY0A 3M3YH 3CCLA 1TWGH 4P75A 4BY1G 3D4DA 3STBD 4I7ZC 5FLXL 3ONAB 3M4OB 1U4MA 4XXEA 1BR9A 1I4QA 4YWKA 5EJWA 3MHBA 4FYDA 2K5QA 3SXHA 2ENBA 1PYSB 4YY3L 4DR5Q 1MSGA 4KJNA 4IUUA 4OXPA 2K5WA 3HZXA 3Q24A 4O42A 1E2WA 2PZTA 4CDDC 1Y8PB 1A2UA 3I73A 1YEZA 2AUKA 3SDZA 2ZM6L 3STBC 1BNZA 4LF5L 3RMHA 3SE0A 5IYBH 1WCMG 4MTNA 3R2TA 1JWSD 4F8MA 1SRUA 4CKEA 4J1MA 4CJ1B 1LYLA 3HOWG 2PQAB 2B2WC 2WACA 3U58A 5C44G 2F0QA 3C1FA 3ERSX 1Z6HA 3J81j 5EKKA 1VCIA 2MO1A 5KNBA 1UAPA 1HNZL 1IBML 1N33L 1Z47A 1K8GA 5AJ3Q 5EBCA 1ZKOA 2JSOA 3CRLC 3HKSA 3HKZE 3OWFA 5M5YB 1WTWA 1BDOA 3TRZA 1SMYD 2HIVA 4C3IH 3GV6A 3S2HH 1N32L 3IAYA 3KF8B 1YI2A 1KLUD 1AZQA 4IUQA 4ABNA 1JWUD 5LHY1 3EA6A 1EL0A 2WIIB 4A3DB 1WD0A 5I2XA 1SNMA 5HURA 1ESFA 4JI0Q 1T5EA 3GTQB 1JB3A 1BO0A 2PPBC 5COYA 2JXMB 1X3FA 4HTHA 4JVZA 1TWHB 5IGEA 3SK5A 4A3FG 2UXBL 1PFMA 5LMNL 2ES2A 1KAWA 4RWSC 3AFQA 3J7YW 3EN2A 2NTTA 1F2MA 3I4LA 2WB1B 4A3LH 3I91A 3NWSA 3K59A 4ZYSA 4HJAA 3S17B 1VQ7A 3OMCA 5KNDA 4IUVA 2UUBQ 1Q1BA 4A3MB 3HOYH 4DV2Q 3D3RA 3OTOQ 3DUZA 2RHSB 4MNOA 1OTCA 1PH2A 2B2TC 1O80A
chains in the Genus database with same CATH topology
3E9IA 4RMFA 4BBRH 4GNXC 1XTDA 4ME3A 1KRSA 1A0IA 5FLMH 2I5MX 4JI3L 2MNAA 3G71A 1QUQB 3UE0A 3VDYA 3OTOL 3W1GA 1VQKA 4JI6L 3CC2A 4DR6L 2Q2IA 5C4XG 3G48A 2Z6KA 1EFWA 3CCSA 3S16H 4YCVA 4BY7G 2QEXA 2YV5A 4C3HH 3M9BA 3JAMc 1DGSA 4X65L 3M7NA 1YVCA 4LFCQ 2K4KA 1WCMH 5C0XJ 1BBWA 2K5HA 5C0XG 2YYZA 2E2HH 2R7DA 3RZDH 2I5LX 4GNXA 4LF8Q 3I4MG 2ZTCA 5JJLA 1W3SA 4KHPQ 4GN5A 4LFCL 3D31A 5GAHC 2VUMG 4X6AH 4P71A 4GKJL 2F4VL 2A1AA 4PZ7A 1Q82C 4HIDA 4JI2L 4K0KQ 2VY3A 1V9PA 3T1HQ 1X54A 2MFIA 2NN6I 2WAQE 2PMZE 3I7FA 4UP9A 3PF5A 2D0OA 4QGUA 4H02A 3W1BA 4DV1Q 4QJFA 3I55A 1EIYB 2XGTA 2ATWA 3KF6B 1CKNB 4O2DA 3FP9A 1S3OA 1SLJA 1XMQQ 1K8AC 3PUYA 2OTJA 3PCOB 4A3BH 3L7ZC 4DV1L 2MO0A 1Y1VH 2JEBI 2Y0SE 4HJ8A 1K9MC 1VQ5A 2KHJA 1FGUA 2RHQB 2VQEL 1XMQL 3HOUG 2CFMA 3J80i 4DV3L 2IX1A 1HNWL 1X3GA 3UDXA 4GOPB 4BBSH 2RF4A 5ELOA 4DV7Q 4LF4Q 3Q8DA 2ASBA 1YNXA 4NXMQ 3E0EA 2KHIA 1QUQA 3U4VA 4J15A 3PUVA 3RLOA 1XPRA 1C7YA 1MIUA 1PHJA 1JJGA 1GD7A 4DV7L 3CD6A 1Z9FA 4LF4L 5IYDH 5FJ8H 2R6GA 2B63G 1LM0A 4YHHQ 1SMXA 3CF5A 4Y7NH 2HHHQ 4KLKA 2N49A 5JJIA 1UE5A 4A3CG 1YHQA 1MKHA 2K50A 3PUWA 4LUVA 4YHHL 2EXDA 2KENA 2VNUD 1P8LA 4AQYL 2HHHL 1VQNA 1U0LA 2WFWA 1PH6A 5E7NA 2BA1A 3J81i 3AFPA 1H95A 1LUZA 4X66Q 4DR1L 4OO1G 4A3FH 2E2JH 4C3JH 3CCUA 1T9HA 1I3QH 3JC66 4JI1Q 3CP0A 4IJHA 2JA8H 2C35B 4DV4Q 4B3MQ 4DR4Q 1NBWA 4OX9Q 2AMCB 4QQBX 1PH7A 1Y1WH 1EYGA 3TS2A 1E3PA 1EQRA 2AWOA 3M4QA 4DAMA 4JI1L 4BA1I 3KF6A 1CKNA 1VQJA 3I4NG 5IYBG 4DV4L 1X56A 1QZHA 4IOAA 2AWNA 1E1OA 3F1ZA 1C0AA 4R4TA 5GQOA 1Q86C 3CXCA 3PUZA 2KBNA 1X3EA 2K5VA 3K7AH 3T1YQ 1XPUA 4DUYQ 4JV5Q 2L15A 1WYDA 2E2IH 4DV0L 2IX0A 4JI0L 4BA2I 1PH8A 3PIPA 1B70B 3CCRA 2UUAQ 3KFUA 2DUDA 2DGYA 1OXUA 4DV6Q 1KD1C 4LFBL 1SR3A 4JG2A 4DUYL 4JI5Q 5IP7H 1EWIA 3ICEA 3BJUA 4JV5L 1EOVA 3F2DA 4GOPA 1IBKL 1AH9A 5IP9G 3NEMA 1IZ6A 5C4XH 5C0XI 2HQLA 4OWWB 4LWCA 2R92G 4DNIA 4DV6L 3H15A 2R7ZG 1CSQA 4JI5L 4LNQA 1PH1A 3KOJA 1KIXA 1J6QA 5HY6A 2IHFA 1E7ZA 1V43A 2JQOA 1OXXK 3RLNA 1A8VA 4BY1H 4A3IG 1MJEA 2JA9A 4JCVE 4JI4Q 2EQSA 4DAYB 1S72A 4A3DG 4JYAL 2Z6KC 3PO3H 1JE5A 3HOZG 2UXDL 2UXCQ 2B3GA 4HJ5A 1K73C 2A8VA 4UP7A 2JA6H 2EIFA 2VUMH 1BBUA 1N36Q 4A3JH 2PI2A 1JJCB 4L5SA 4UP8A 2YTYA 4LUZA 3CAMA 3H0GG 1WOCA 1TXYA 1AE3A 3ZJYC 3CCEA 3AEVA 2UXCL 4O0AA 3FKIG 2F52A 3A0JA 2ZTEA 2UUBL 3KDFB 1N36L 4LF7Q 4BXXH 3RLFA 4HIMA 4OWXB 4DV2L 1D7QA 2MQHA 1NTGA 1VQEA 4IOCA 4JBJA 1CUKA 4X64Q 4A3EH 1HR0Q 2K52A 4LF7L 1VQOA 4WJ4A 5C3EG 1G51A 4YWMA 3CCMA 4MZ9A 3M4PA 2N3SA 4L5QA 2JK8A 1R9TH 3TEHB 1QVCA 4X64L 2UUCQ 2BH2A 1VQMA 1HR0L 4GS3A 2WB1G 2Z0SA 4GKKQ 2PNHA 1HH2P 1HJPA 1XJVA 3F8TA 4A4IA 3BU2A 4NXNQ 4JI7Q 2UUCL 1S40A 1M1KC 4GKKL 4GN3B 4AYBG 2R7FA 4LF8L 5JEAJ 1VQ4A 5JEAG 4A3MG 1YBYA 4DR7Q 1BVSA 1Q1EA 5IE8A 4KHPL 4NXNL 2BA0A 3TREA 3HOWH 3GTOH 3CC7A 4P73A 3S1RH 4A3LG 5C44H 2B63H 4K0KL 1SN8A 1YIJA 3PF4A 2JJQA 4C2MH 5M3FH 3T1HL 3J7A5 1WJJA 1BKBA 1XNRQ 4XIGS 3TQYA 4KHZA 1NY4A 3GDEA 3PSIA 4OONA 4L5RC 3GTGH 1YJNA 4OO1I 4YY3Q 2JA5G 1NE3A 2N8NA 3CCQA 2KCMA 3EIVA 4QIWE 1PH5A 5GAEC 4AIMA 3HOXG 3HOYG 4B3RL 5JJKA 1XNRL 1G291 1VQFA 1D8LA 2NZHA 2OTLA 4GLVB 1SROA 4R1JA 4BBRG 4DR2Q 4JOIC 1UE1A 1X55A 2ZM6Q 1VS0A 1FVIA 3MXNB 3RN2A 5GADC 4LF5Q 1I94Q 4IJLA 1VQDA 3KDFA 4APVA 4R4OA 4IO9A 3RN5A 1KC8C 4A93G 4B3SQ 4LF6Q 3PGZA 4DV5Q 3FHWA 1PH9A 3NENA 3I4OA 4NXML 4IPCA 2VQFQ 2IY5B 4PMWA 3HFZB 4ALPA 1IL2A 3B6YA 4JOIA 4DK3C 4LF6L 2GVBA 3A5ZB 3GTKH 2JE6I 5M5WH 1IBLQ 2CWAA 2E8GA 3U4ZA 3S15H 4YCWA 4B3TQ 1Q46A 5M3MG 1KQSA 2OCEA 1KRTA 5M5YH 2E5LQ 3AYHB 1IBLL 4LFAQ 1J5EQ 1HNZQ 2ZJQA 1VQPA 1GKHA 1IBMQ 2JEAI 4DUZQ 3K8AA 4GLXA 4B3TL 3K7UC 4TQUS 5IYCG 4L5TA 1GO3E 4OWTB 1RL2A 4X66L 1ASYA 4UY8C 1UEBA 2E5LL 3L0OA 4HJ9A 1J5EL 3KYHC 1CKMA 3UE1A 4DUZL 4GOPC 4A3BG 1CSPA 4B3ML 1N32Q 4DR4L 1JT8A 1Y1VG 4OX9L 2LXKA 2WB1E 3CCVA 1B8AA 3S14H 4A3GH 3K80C 1LTLA 2VL6A 4NPSA 3GTLH 1NMFA 3CPWA 1L1OB 1O7IA 2OQ0A 5GAGC 1E24A 1SE8A 4PG3A 1EQQA 3GTQH 1A63A 1I5FA 4A3KH 2ALYB 3FKIH 1UWVA 2FXQA 4AYBE 4BBSG 1VQGA 1NJIC 3T1YL 1YHAA 1A62A 1X65A 3H3VH 1HZBA 4PZ6A 3CQZH 1KHIA 5ELNA 1HR0W 5IYDG 2UUAL 4BY7H 5FJ8G 2H5XA 4B3RQ 1B7YB 1I6HH 1WFQA 2KCTA 4GNXB 3K0XA 2NVYH 3CMAA 1XNQQ 4HJ7A 3J81c 4POGA 3I4MH 3JAMi 1GM5A 1E22A 3ULLA 3CW2C 4POFA 5LMNQ 3CC4A 2OQKA 4DKAC 3DM3A 3GD7A 4DR3Q 4JI4L 1XNQL 3SGIA 2AKWB 4A3MH 1FL0A 2B29A 5LMUQ 2Q2HA 4LF9Q 4JBWA 1VQAA 4RG1A 1FJGQ 2JA8G 3OYYA 3M85A 3F2CA 1N34Q 4JBMA 2HIXA 1Y1WG 4WJ3M 3K81C 1JMCA 4LF9L 4LUOA 1VQLA 2JA7G 1K3RA 1N34L 2CKZB 2ZJRA 3G4SA 2NVXH 2HT1A 3KJOA 4IFDI 4JBKA 2ZJPA 3KJPA 3ULPA 3U50C 5FLXc 4JI3Q 3HOXH 3HKZG 3HOUH 4FDBA 4IPDA 1PFSA 1QVFA 2R93G 1EUJA 1XPOA 3M4OH 1L1OA 4P72A 1L2FA 2OWOA 1PVOA 3GTJH 4YCUA 4A75A 4A76A 3UDIA 5IP7G 4X65Q 1K0RA 3HOVG 1VQCA 1N9WA 2QGQA 2VZAA 3G6EA 1M90C 2V1CC 4JI7L 3PO2G 1HNXQ 4A93H 5IY0A 3M3YH 3CCLA 3BZKA 2QA4A 1JB7A 3CPFA 2GVAA 4X62Q 4DR7L 4XTCS 1TWGH 4P75A 3NBHB 4JI8Q 3L2PA 1VQBA 3ER0A 4BY1G 1VQHA 2K5NA 3STBD 1VQ9A 2F4VQ 4GKJQ 4A3CH 1HNXL 1MJCA 2AHOB 1RIPA 4JI2Q 3PO3G 2I5HA 1PV4A 3RZOH 5H1SE 2JA6G 2CQOA 4X62L 1CKOA 4JI8L 4YWKA 3GTPH 4IPGA 4HIKA 4A3JG 3A74A 3PIOA 5IWAQ 2IT1A 1PYSB 5M3MH 2Q2UA 5GROA 4IFDJ 4YY3L 4IFDG 4DR5Q 2Q2TA 4QY7A 2PI2E 4BXXG 1HZAA 5FLMG 4PZ8A 3F2BA 4OXPA 1XMOQ 2RCNA 4GLAC 4JC0A 5IWAL 5IYCH 1Q12A 4A3EG 3S1MH 4DR2L 1GVPA 4DR5L 3S24A 1YEZA 1EIFA 4DK6C 2VQEQ 2ZM6L 3STBC 1XMOL 4UPAA 2ID0A 4LF5L 1I94L 3I4NH 4QL5A 5IYBH 3I56A 2NVTH 2GN5A 1WCMG 3S2DH 3DLLA 4DV3Q 1HNWQ 1PH3A 1Q8KA 2CWPA 2ZTDA 1AE2A 4MTNA 4B3SL 2WP8J 2VW9A 3AQQA 1HZCA 1G6PA 4DV5L 1IXRA 2N78A 1PYBA 2VQFL 1YZ6A 1HZ9A 1SRUA 4YWLA 4GN4B 4LW1A 1U5KA 2F3IA 5M5XH 3UDGA 1OXSC 1W2BA 5DLQE 3CMEA 3WWVA 1LYLA 5IP9H 3HOWG 4HIOA 1NMGA 2LSSA 2K75A 2PQAB 4NB3A 1N33Q 3U58A 2NVQH 1JJ2A 2R92H 1Q7YC 3NELA 4EX5A 5C44G 1VQ8A 2R7ZH 5HGQA 1VQ6A 1KL9A 3ERSX 3J81j 4AQYQ 1VCIA 2D62A 2MO1A 2NN6G 5M3FG 1HNZL 3GO5A 4LFAL 2YU9H 4A3IH 1IBML 1L0WA 1C9OA 1K83H 1I50H 1N33L 5K36G 1Z47A 3J80c 4DR1Q 1K8GA 5AJ3Q 4A3DH 3HOZH 4DR6Q 1YJWA 5LMNW 3HKSA 3HKZE 3IRBA 2YTXA 3RR5A 3TRZA 5J3BA 1X6OA 3H0GH 4DPGA 1IYJB 2HIVA 4C3IH 3PV0A 5AJ3L 1QVGA 2VS1A 2CCZA 3S2HH 4P74A 1YHBA 1N32L 2I0QA 1P16A 1VQIA 3KF8B 3MEFA 1QZGA 1YI2A 2WAQG 4TVAB 3RNUA 2YTVA 2UU9Q 3S1QH 1Q81C 1V1QA 1YITA 1Y14B 1TWHH 3BZCA 5EAYA 3UDFA 4Y52H 1KXLA 1YJ9A 3E9HA 2K14A 1OXVA 5C4JH 5C3EH 1SFOH 2JA7H 4EQ5A 4DV0Q 2NZOA 4KI0A 4JI0Q 5IT9c 2UU9L 1OXTA 3D0FA 2Y0SG 4LFBQ 1TWFH 3H3VI 3GTMH 3S17H 2A19A 4AH6A 2UXBQ 3TS0A 1IBKQ 2IHEA 1N8RC 3S1NH 2R93H 1X3FA 5BR8Q 1TWAH 4R4CA 4A3FG 3LGJA 3HOVH 4R4IA 2UXBL 3A5UA 5LMNL 2ES2A 1KAWA 5BR8L 3W5OA 3PO2H 3AFQA 1TWCH 3EN2A 1PA6A 4DR3L 4JYAQ 2UXDQ 1L1OC 1UE6A 1UE7A 2PQAA 2XTIA 4A3LH 4HJAA 3KLWA 5LMUL 1WI5A 1FJGL 3J7ZC 1X9NA 3CCJA 1VQ7A 1E1TA 2LXJA 3PUXA 2JA5H 4A3GG 4R4QA 2UUBQ 1Q1BA 3HOYH 1PH4A 3I2ZA 4DV2Q 2D0PA 1ASZA 3ULJA 4MNOA 2RHSB 4IPHA 3OTOQ 3OW2A 1OTCA 1PH2A 4A3KG 3EBEA 4JI6Q 2BH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9I A;  4RMF A;  4BBR H;  4GNX C;  1XTD A;  4ME3 A;  1KRS A;  1A0I A;  5FLM H;  2I5M X;  4JI3 L;  2MNA A;  3G71 A;  1QUQ B;  3UE0 A;  3VDY A;  3OTO L;  3W1G A;  1VQK A;  4JI6 L;  3CC2 A;  4DR6 L;  2Q2I A;  5C4X G;  3G48 A;  2Z6K A;  1EFW A;  3CCS A;  3S16 H;  4YCV A;  4BY7 G;  2QEX A;  2YV5 A;  4C3H H;  3M9B A;  3JAM c;  1DGS A;  4X65 L;  3M7N A;  1YVC A;  4LFC Q;  2K4K A;  1WCM H;  5C0X J;  1BBW A;  2K5H A;  5C0X G;  2YYZ A;  2E2H H;  2R7D A;  3RZD H;  2I5L X;  4GNX A;  4LF8 Q;  3I4M G;  2ZTC A;  5JJL A;  1W3S A;  4KHP Q;  4GN5 A;  4LFC L;  3D31 A;  5GAH C;  2VUM G;  4X6A H;  4P71 A;  4GKJ L;  2F4V L;  2A1A A;  4PZ7 A;  1Q82 C;  4HID A;  4JI2 L;  4K0K Q;  2VY3 A;  1V9P A;  3T1H Q;  1X54 A;  2MFI A;  2NN6 I;  2WAQ E;  2PMZ E;  3I7F A;  4UP9 A;  3PF5 A;  2D0O A;  4QGU A;  4H02 A;  3W1B A;  4DV1 Q;  4QJF A;  3I55 A;  1EIY B;  2XGT A;  2ATW A;  3KF6 B;  1CKN B;  4O2D A;  3FP9 A;  1S3O A;  1SLJ A;  1XMQ Q;  1K8A C;  3PUY A;  2OTJ A;  3PCO B;  4A3B H;  3L7Z C;  4DV1 L;  2MO0 A;  1Y1V H;  2JEB I;  2Y0S E;  4HJ8 A;  1K9M C;  1VQ5 A;  2KHJ A;  1FGU A;  2RHQ B;  2VQE L;  1XMQ L;  3HOU G;  2CFM A;  3J80 i;  4DV3 L;  2IX1 A;  1HNW L;  1X3G A;  3UDX A;  4GOP B;  4BBS H;  2RF4 A;  5ELO A;  4DV7 Q;  4LF4 Q;  3Q8D A;  2ASB A;  1YNX A;  4NXM Q;  3E0E A;  2KHI A;  1QUQ A;  3U4V A;  4J15 A;  3PUV A;  3RLO A;  1XPR A;  1C7Y A;  1MIU A;  1PHJ A;  1JJG A;  1GD7 A;  4DV7 L;  3CD6 A;  1Z9F A;  4LF4 L;  5IYD H;  5FJ8 H;  2R6G A;  2B63 G;  1LM0 A;  4YHH Q;  1SMX A;  3CF5 A;  4Y7N H;  2HHH Q;  4KLK A;  2N49 A;  5JJI A;  1UE5 A;  4A3C G;  1YHQ A;  1MKH A;  2K50 A;  3PUW A;  4LUV A;  4YHH L;  2EXD A;  2KEN A;  2VNU D;  1P8L A;  4AQY L;  2HHH L;  1VQN A;  1U0L A;  2WFW A;  1PH6 A;  5E7N A;  2BA1 A;  3J81 i;  3AFP A;  1H95 A;  1LUZ A;  4X66 Q;  4DR1 L;  4OO1 G;  4A3F H;  2E2J H;  4C3J H;  3CCU A;  1T9H A;  1I3Q H;  3JC6 6;  4JI1 Q;  3CP0 A;  4IJH A;  2JA8 H;  2C35 B;  4DV4 Q;  4B3M Q;  4DR4 Q;  1NBW A;  4OX9 Q;  2AMC B;  4QQB X;  1PH7 A;  1Y1W H;  1EYG A;  3TS2 A;  1E3P A;  1EQR A;  2AWO A;  3M4Q A;  4DAM A;  4JI1 L;  4BA1 I;  3KF6 A;  1CKN A;  1VQJ A;  3I4N G;  5IYB G;  4DV4 L;  1X56 A;  1QZH A;  4IOA A;  2AWN A;  1E1O A;  3F1Z A;  1C0A A;  4R4T A;  5GQO A;  1Q86 C;  3CXC A;  3PUZ A;  2KBN A;  1X3E A;  2K5V A;  3K7A H;  3T1Y Q;  1XPU A;  4DUY Q;  4JV5 Q;  2L15 A;  1WYD A;  2E2I H;  4DV0 L;  2IX0 A;  4JI0 L;  4BA2 I;  1PH8 A;  3PIP A;  1B70 B;  3CCR A;  2UUA Q;  3KFU A;  2DUD A;  2DGY A;  1OXU A;  4DV6 Q;  1KD1 C;  4LFB L;  1SR3 A;  4JG2 A;  4DUY L;  4JI5 Q;  5IP7 H;  1EWI A;  3ICE A;  3BJU A;  4JV5 L;  1EOV A;  3F2D A;  4GOP A;  1IBK L;  1AH9 A;  5IP9 G;  3NEM A;  1IZ6 A;  5C4X H;  5C0X I;  2HQL A;  4OWW B;  4LWC A;  2R92 G;  4DNI A;  4DV6 L;  3H15 A;  2R7Z G;  1CSQ A;  4JI5 L;  4LNQ A;  1PH1 A;  3KOJ A;  1KIX A;  1J6Q A;  5HY6 A;  2IHF A;  1E7Z A;  1V43 A;  2JQO A;  1OXX K;  3RLN A;  1A8V A;  4BY1 H;  4A3I G;  1MJE A;  2JA9 A;  4JCV E;  4JI4 Q;  2EQS A;  4DAY B;  1S72 A;  4A3D G;  4JYA L;  2Z6K C;  3PO3 H;  1JE5 A;  3HOZ G;  2UXD L;  2UXC Q;  2B3G A;  4HJ5 A;  1K73 C;  2A8V A;  4UP7 A;  2JA6 H;  2EIF A;  2VUM H;  1BBU A;  1N36 Q;  4A3J H;  2PI2 A;  1JJC B;  4L5S A;  4UP8 A;  2YTY A;  4LUZ A;  3CAM A;  3H0G G;  1WOC A;  1TXY A;  1AE3 A;  3ZJY C;  3CCE A;  3AEV A;  2UXC L;  4O0A A;  3FKI G;  2F52 A;  3A0J A;  2ZTE A;  2UUB L;  3KDF B;  1N36 L;  4LF7 Q;  4BXX H;  3RLF A;  4HIM A;  4OWX B;  4DV2 L;  1D7Q A;  2MQH A;  1NTG A;  1VQE A;  4IOC A;  4JBJ A;  1CUK A;  4X64 Q;  4A3E H;  1HR0 Q;  2K52 A;  4LF7 L;  1VQO A;  4WJ4 A;  5C3E G;  1G51 A;  4YWM A;  3CCM A;  4MZ9 A;  3M4P A;  2N3S A;  4L5Q A;  2JK8 A;  1R9T H;  3TEH B;  1QVC A;  4X64 L;  2UUC Q;  2BH2 A;  1VQM A;  1HR0 L;  4GS3 A;  2WB1 G;  2Z0S A;  4GKK Q;  2PNH A;  1HH2 P;  1HJP A;  1XJV A;  3F8T A;  4A4I A;  3BU2 A;  4NXN Q;  4JI7 Q;  2UUC L;  1S40 A;  1M1K C;  4GKK L;  4GN3 B;  4AYB G;  2R7F A;  4LF8 L;  5JEA J;  1VQ4 A;  5JEA G;  4A3M G;  1YBY A;  4DR7 Q;  1BVS A;  1Q1E A;  5IE8 A;  4KHP L;  4NXN L;  2BA0 A;  3TRE A;  3HOW H;  3GTO H;  3CC7 A;  4P73 A;  3S1R H;  4A3L G;  5C44 H;  2B63 H;  4K0K L;  1SN8 A;  1YIJ A;  3PF4 A;  2JJQ A;  4C2M H;  5M3F H;  3T1H L;  3J7A 5;  1WJJ A;  1BKB A;  1XNR Q;  4XIG S;  3TQY A;  4KHZ A;  1NY4 A;  3GDE A;  3PSI A;  4OON A;  4L5R C;  3GTG H;  1YJN A;  4OO1 I;  4YY3 Q;  2JA5 G;  1NE3 A;  2N8N A;  3CCQ A;  2KCM A;  3EIV A;  4QIW E;  1PH5 A;  5GAE C;  4AIM A;  3HOX G;  3HOY G;  4B3R L;  5JJK A;  1XNR L;  1G29 1;  1VQF A;  1D8L A;  2NZH A;  2OTL A;  4GLV B;  1SRO A;  4R1J A;  4BBR G;  4DR2 Q;  4JOI C;  1UE1 A;  1X55 A;  2ZM6 Q;  1VS0 A;  1FVI A;  3MXN B;  3RN2 A;  5GAD C;  4LF5 Q;  1I94 Q;  4IJL A;  1VQD A;  3KDF A;  4APV A;  4R4O A;  4IO9 A;  3RN5 A;  1KC8 C;  4A93 G;  4B3S Q;  4LF6 Q;  3PGZ A;  4DV5 Q;  3FHW A;  1PH9 A;  3NEN A;  3I4O A;  4NXM L;  4IPC A;  2VQF Q;  2IY5 B;  4PMW A;  3HFZ B;  4ALP A;  1IL2 A;  3B6Y A;  4JOI A;  4DK3 C;  4LF6 L;  2GVB A;  3A5Z B;  3GTK H;  2JE6 I;  5M5W H;  1IBL Q;  2CWA A;  2E8G A;  3U4Z A;  3S15 H;  4YCW A;  4B3T Q;  1Q46 A;  5M3M G;  1KQS A;  2OCE A;  1KRT A;  5M5Y H;  2E5L Q;  3AYH B;  1IBL L;  4LFA Q;  1J5E Q;  1HNZ Q;  2ZJQ A;  1VQP A;  1GKH A;  1IBM Q;  2JEA I;  4DUZ Q;  3K8A A;  4GLX A;  4B3T L;  3K7U C;  4TQU S;  5IYC G;  4L5T A;  1GO3 E;  4OWT B;  1RL2 A;  4X66 L;  1ASY A;  4UY8 C;  1UEB A;  2E5L L;  3L0O A;  4HJ9 A;  1J5E L;  3KYH C;  1CKM A;  3UE1 A;  4DUZ L;  4GOP C;  4A3B G;  1CSP A;  4B3M L;  1N32 Q;  4DR4 L;  1JT8 A;  1Y1V G;  4OX9 L;  2LXK A;  2WB1 E;  3CCV A;  1B8A A;  3S14 H;  4A3G H;  3K80 C;  1LTL A;  2VL6 A;  4NPS A;  3GTL H;  1NMF A;  3CPW A;  1L1O B;  1O7I A;  2OQ0 A;  5GAG C;  1E24 A;  1SE8 A;  4PG3 A;  1EQQ A;  3GTQ H;  1A63 A;  1I5F A;  4A3K H;  2ALY B;  3FKI H;  1UWV A;  2FXQ A;  4AYB E;  4BBS G;  1VQG A;  1NJI C;  3T1Y L;  1YHA A;  1A62 A;  1X65 A;  3H3V H;  1HZB A;  4PZ6 A;  3CQZ H;  1KHI A;  5ELN A;  1HR0 W;  5IYD G;  2UUA L;  4BY7 H;  5FJ8 G;  2H5X A;  4B3R Q;  1B7Y B;  1I6H H;  1WFQ A;  2KCT A;  4GNX B;  3K0X A;  2NVY H;  3CMA A;  1XNQ Q;  4HJ7 A;  3J81 c;  4POG A;  3I4M H;  3JAM i;  1GM5 A;  1E22 A;  3ULL A;  3CW2 C;  4POF A;  5LMN Q;  3CC4 A;  2OQK A;  4DKA C;  3DM3 A;  3GD7 A;  4DR3 Q;  4JI4 L;  1XNQ L;  3SGI A;  2AKW B;  4A3M H;  1FL0 A;  2B29 A;  5LMU Q;  2Q2H A;  4LF9 Q;  4JBW A;  1VQA A;  4RG1 A;  1FJG Q;  2JA8 G;  3OYY A;  3M85 A;  3F2C A;  1N34 Q;  4JBM A;  2HIX A;  1Y1W G;  4WJ3 M;  3K81 C;  1JMC A;  4LF9 L;  4LUO A;  1VQL A;  2JA7 G;  1K3R A;  1N34 L;  2CKZ B;  2ZJR A;  3G4S A;  2NVX H;  2HT1 A;  3KJO A;  4IFD I;  4JBK A;  2ZJP A;  3KJP A;  3ULP A;  3U50 C;  5FLX c;  4JI3 Q;  3HOX H;  3HKZ G;  3HOU H;  4FDB A;  4IPD A;  1PFS A;  1QVF A;  2R93 G;  1EUJ A;  1XPO A;  3M4O H;  1L1O A;  4P72 A;  1L2F A;  2OWO A;  1PVO A;  3GTJ H;  4YCU A;  4A75 A;  4A76 A;  3UDI A;  5IP7 G;  4X65 Q;  1K0R A;  3HOV G;  1VQC A;  1N9W A;  2QGQ A;  2VZA A;  3G6E A;  1M90 C;  2V1C C;  4JI7 L;  3PO2 G;  1HNX Q;  4A93 H;  5IY0 A;  3M3Y H;  3CCL A;  3BZK A;  2QA4 A;  1JB7 A;  3CPF A;  2GVA A;  4X62 Q;  4DR7 L;  4XTC S;  1TWG H;  4P75 A;  3NBH B;  4JI8 Q;  3L2P A;  1VQB A;  3ER0 A;  4BY1 G;  1VQH A;  2K5N A;  3STB D;  1VQ9 A;  2F4V Q;  4GKJ Q;  4A3C H;  1HNX L;  1MJC A;  2AHO B;  1RIP A;  4JI2 Q;  3PO3 G;  2I5H A;  1PV4 A;  3RZO H;  5H1S E;  2JA6 G;  2CQO A;  4X62 L;  1CKO A;  4JI8 L;  4YWK A;  3GTP H;  4IPG A;  4HIK A;  4A3J G;  3A74 A;  3PIO A;  5IWA Q;  2IT1 A;  1PYS B;  5M3M H;  2Q2U A;  5GRO A;  4IFD J;  4YY3 L;  4IFD G;  4DR5 Q;  2Q2T A;  4QY7 A;  2PI2 E;  4BXX G;  1HZA A;  5FLM G;  4PZ8 A;  3F2B A;  4OXP A;  1XMO Q;  2RCN A;  4GLA C;  4JC0 A;  5IWA L;  5IYC H;  1Q12 A;  4A3E G;  3S1M H;  4DR2 L;  1GVP A;  4DR5 L;  3S24 A;  1YEZ A;  1EIF A;  4DK6 C;  2VQE Q;  2ZM6 L;  3STB C;  1XMO L;  4UPA A;  2ID0 A;  4LF5 L;  1I94 L;  3I4N H;  4QL5 A;  5IYB H;  3I56 A;  2NVT H;  2GN5 A;  1WCM G;  3S2D H;  3DLL A;  4DV3 Q;  1HNW Q;  1PH3 A;  1Q8K A;  2CWP A;  2ZTD A;  1AE2 A;  4MTN A;  4B3S L;  2WP8 J;  2VW9 A;  3AQQ A;  1HZC A;  1G6P A;  4DV5 L;  1IXR A;  2N78 A;  1PYB A;  2VQF L;  1YZ6 A;  1HZ9 A;  1SRU A;  4YWL A;  4GN4 B;  4LW1 A;  1U5K A;  2F3I A;  5M5X H;  3UDG A;  1OXS C;  1W2B A;  5DLQ E;  3CME A;  3WWV A;  1LYL A;  5IP9 H;  3HOW G;  4HIO A;  1NMG A;  2LSS A;  2K75 A;  2PQA B;  4NB3 A;  1N33 Q;  3U58 A;  2NVQ H;  1JJ2 A;  2R92 H;  1Q7Y C;  3NEL A;  4EX5 A;  5C44 G;  1VQ8 A;  2R7Z H;  5HGQ A;  1VQ6 A;  1KL9 A;  3ERS X;  3J81 j;  4AQY Q;  1VCI A;  2D62 A;  2MO1 A;  2NN6 G;  5M3F G;  1HNZ L;  3GO5 A;  4LFA L;  2YU9 H;  4A3I H;  1IBM L;  1L0W A;  1C9O A;  1K83 H;  1I50 H;  1N33 L;  5K36 G;  1Z47 A;  3J80 c;  4DR1 Q;  1K8G A;  5AJ3 Q;  4A3D H;  3HOZ H;  4DR6 Q;  1YJW A;  5LMN W;  3HKS A;  3HKZ E;  3IRB A;  2YTX A;  3RR5 A;  3TRZ A;  5J3B A;  1X6O A;  3H0G H;  4DPG A;  1IYJ B;  2HIV A;  4C3I H;  3PV0 A;  5AJ3 L;  1QVG A;  2VS1 A;  2CCZ A;  3S2H H;  4P74 A;  1YHB A;  1N32 L;  2I0Q A;  1P16 A;  1VQI A;  3KF8 B;  3MEF A;  1QZG A;  1YI2 A;  2WAQ G;  4TVA B;  3RNU A;  2YTV A;  2UU9 Q;  3S1Q H;  1Q81 C;  1V1Q A;  1YIT A;  1Y14 B;  1TWH H;  3BZC A;  5EAY A;  3UDF A;  4Y52 H;  1KXL A;  1YJ9 A;  3E9H A;  2K14 A;  1OXV A;  5C4J H;  5C3E H;  1SFO H;  2JA7 H;  4EQ5 A;  4DV0 Q;  2NZO A;  4KI0 A;  4JI0 Q;  5IT9 c;  2UU9 L;  1OXT A;  3D0F A;  2Y0S G;  4LFB Q;  1TWF H;  3H3V I;  3GTM H;  3S17 H;  2A19 A;  4AH6 A;  2UXB Q;  3TS0 A;  1IBK Q;  2IHE A;  1N8R C;  3S1N H;  2R93 H;  1X3F A;  5BR8 Q;  1TWA H;  4R4C A;  4A3F G;  3LGJ A;  3HOV H;  4R4I A;  2UXB L;  3A5U A;  5LMN L;  2ES2 A;  1KAW A;  5BR8 L;  3W5O A;  3PO2 H;  3AFQ A;  1TWC H;  3EN2 A;  1PA6 A;  4DR3 L;  4JYA Q;  2UXD Q;  1L1O C;  1UE6 A;  1UE7 A;  2PQA A;  2XTI A;  4A3L H;  4HJA A;  3KLW A;  5LMU L;  1WI5 A;  1FJG L;  3J7Z C;  1X9N A;  3CCJ A;  1VQ7 A;  1E1T A;  2LXJ A;  3PUX A;  2JA5 H;  4A3G G;  4R4Q A;  2UUB Q;  1Q1B A;  3HOY H;  1PH4 A;  3I2Z A;  4DV2 Q;  2D0P A;  1ASZ A;  3ULJ A;  4MNO A;  2RHS B;  4IPH A;  3OTO Q;  3OW2 A;  1OTC A;  1PH2 A;  4A3K G;  3EBE A;  4JI6 Q;  2BH8 A; 
#chains in the Genus database with same CATH topology
 4IFD H;  4FXK C;  2XRS D;  4ME3 A;  5FLM H;  5C4H A;  3BDC A;  3DEO A;  4IUP A;  4JI3 L;  3G71 A;  4IQZ A;  1PYW D;  5E4W C;  3CC2 A;  2XRQ D;  1GJX A;  2Q2I A;  3CCS A;  2NWG A;  2JA5 B;  1BF4 A;  2N55 A;  4C3H H;  2WIN B;  1IYV A;  3HRZ C;  1BBW A;  2ZXR A;  2IX3 A;  4DK1 A;  4BBR B;  4GNX A;  3I4M G;  4V0B A;  2ZTC A;  3FPU B;  2A69 C;  1W3S A;  4GN5 A;  5GAH C;  2VUM G;  4X6A H;  4P71 A;  3LX0 A;  2A1A A;  4K0K Q;  3S16 B;  2B2U C;  4A93 B;  2QDB A;  1DOM A;  3TSS A;  4CDE C;  1X54 A;  3I7F A;  1TWG B;  3IFT A;  4H02 A;  4DV1 Q;  3I55 A;  3Q23 A;  2QCP X;  1QE6 A;  2ATW A;  1BQQ T;  1S3O A;  5JAV A;  5K5P A;  3R8B A;  5A2Q L;  3PCO B;  5FK9 C;  2MO0 A;  3HGB A;  1ICF B;  4LMQ D;  1Y1V H;  2J7Z A;  2RHQ B;  3HOU G;  2CFM A;  1S5B D;  3BVM A;  1GHJ A;  2N88 A;  2RF4 A;  3Q8D A;  3VR4 A;  1YNN C;  1YNX A;  3E0E A;  1QNK A;  4A3B B;  3PUV A;  1C7Y A;  1MIU A;  3K5L A;  1GD7 A;  2NTS A;  5FKA C;  2VB3 X;  2R6G A;  5FJ8 H;  2B63 G;  3PMF A;  3CF5 A;  2HUG A;  3VR2 A;  5IIF A;  3FDT A;  5CBE E;  1EOT A;  2K50 A;  5EKI A;  1VQN A;  1U0L A;  5E7N A;  1PZK D;  3FMC A;  1XX8 A;  2SEB D;  2J4X A;  2JP1 A;  1LAC A;  4Y7N B;  4B3M Q;  2Z6B A;  1NBW A;  3DM1 A;  1EWH A;  1EYG A;  3TS2 A;  1E3P A;  3M4Q A;  1HTP A;  4WJW A;  1VQJ A;  3I4N G;  5JVG 3;  3NPP A;  1QWY A;  2I07 B;  4MHE A;  4R4T A;  4C3I B;  3S2H B;  2EYO A;  2F0V A;  2E2I H;  1EYC A;  3I70 A;  5C5M A;  4JI0 L;  4O1N A;  2K6A A;  4ZLT F;  1WTH A;  2DGY A;  1OO9 B;  1KD1 C;  4DUY L;  3ICE A;  1EOV A;  5C0X I;  2K32 A;  2R92 G;  4DNI A;  3SK6 A;  2R7Z G;  4JI5 L;  3KOJ A;  1J6Q A;  4R9W A;  3HKZ B;  1E7Z A;  2X69 A;  5D3I B;  2JA9 A;  1S72 A;  3OMG A;  3HOZ G;  2B3G A;  1CQF A;  1K73 C;  4UP7 A;  4NW2 A;  1BBU A;  4CJ2 C;  1N36 Q;  1RHP A;  5FLX E;  3H0G G;  5CR3 A;  5IGD A;  1WOC A;  1AE3 A;  1TS2 A;  3FKI G;  4O0A A;  3TP5 A;  2UUB L;  3KDF B;  2VXW A;  4BXX H;  3RLF A;  4DV2 L;  4XDX A;  1ICW A;  2EOT A;  2A68 D;  3PO3 B;  1HR0 Q;  2JA6 B;  4K8J A;  1G51 A;  3J81 L;  4MZ9 A;  4RCN A;  2XIW A;  3ZYY X;  2BH2 A;  3AB9 A;  3QB3 A;  1HA5 A;  3MA2 B;  1D1K A;  4XYQ A;  1HJP A;  4Q0F A;  4QB4 A;  4JPB W;  1SEB D;  4A4I A;  1CQV A;  4ZAI A;  1M1K C;  2K28 A;  4GKK L;  4GN3 B;  5JEA G;  3P75 A;  1YBY A;  3K5M A;  1BVS A;  4DR7 Q;  4C3H B;  3OPO A;  1AP0 A;  5D3D A;  2K04 A;  4ODG A;  3CC7 A;  4P73 A;  1DJR D;  1BCP F;  4K0K L;  1YIJ A;  1D6E C;  5M3F H;  1BKB A;  4XIG S;  3P7J A;  5I9O A;  2K01 A;  1NE3 A;  3CCQ A;  2EYH A;  1PH5 A;  1JOR A;  4B3R L;  1BOS A;  3PIO 3;  1SBB B;  3KLR A;  1QB5 D;  4GLV B;  4K5W A;  1PRT D;  4DR2 Q;  4RAU C;  4CBV A;  1BCP B;  3RN2 A;  1WD1 A;  1UUP A;  3A7L A;  4APV A;  4R4O A;  3RN5 A;  2O2L D;  3FHW A;  3NEN A;  4UDU C;  2EPB A;  2F0I A;  4KV6 A;  2IY5 B;  4ALP A;  1JWM D;  3K57 A;  4DK3 C;  1E2Z A;  2GVB A;  2CHB D;  3TBI B;  5BN4 A;  4HN7 A;  3S15 H;  2LFN A;  1C8C A;  3E6Z X;  1KQS A;  3CKI B;  4LFA Q;  2JEA I;  3K8A A;  4GLX A;  4B3T L;  3K7U C;  2RDG A;  4UY8 C;  4M1U B;  1PTO H;  2V4D A;  3L0O A;  3QG1 A;  2EVB A;  5L37 A;  3VYU A;  1NAP A;  4B3M L;  4FXD A;  4J8Q A;  2L5T A;  1JT8 A;  2F0J A;  3S14 H;  1B8A A;  2IL8 A;  4A3G H;  3K80 C;  1LTL A;  3GTL H;  2K7V A;  1L1O B;  1A63 A;  2EE1 A;  4AYB E;  1VQG A;  1WTV A;  2RQX A;  3CQZ H;  1CI3 M;  1KHI A;  5EQ0 A;  5LL6 S;  1B7Y B;  5BN5 A;  4OEM B;  3VYT A;  1VF5 C;  2E2I B;  1RKN A;  4HJ7 A;  3J81 c;  2EY6 A;  3IFD A;  3ULL A;  1TS5 A;  4OGQ C;  2VB2 X;  1B44 D;  2J0T D;  4DR3 Q;  1XNQ L;  3Q6S A;  3EJI A;  2AKW B;  4EQN A;  1I6H B;  2B29 A;  3NTH A;  4JBW A;  4RG1 A;  4DK0 A;  3EQL C;  1Y69 U;  4JBM A;  3CRK C;  3C3L A;  4WJ3 M;  4LF9 L;  2L1B A;  2FFK B;  4LUO A;  4PV1 C;  1K3R A;  5A35 A;  3I3C A;  1N34 L;  2HT1 A;  3ULP A;  1EYD A;  1U4R A;  1PRT F;  5A2Q E;  5EPJ A;  1EUJ A;  3M4O H;  3LWU A;  1YNJ D;  4P72 A;  2OWO A;  4YCU A;  4A75 A;  4JK1 C;  5IP7 G;  1QOH A;  2VZA A;  1BUV T;  2RBM A;  2V1C C;  2NVX B;  2G9H D;  4IUR A;  3BZK A;  1DCZ A;  1JB7 A;  4DR7 L;  1VQB A;  1JQY D;  2B2T A;  1VQ9 A;  4BWG B;  1GUG A;  4JI2 Q;  1FR3 A;  2I5H A;  1PV4 A;  1H9S B;  1U4L A;  4JI8 L;  3GTP H;  4HIK A;  4A3J G;  1YNJ C;  3A74 A;  3PIO A;  2IT1 A;  5M3M H;  4Q5V A;  4OO1 H;  4OIK A;  1R4Q B;  1FNW A;  3WOE A;  5M3F B;  5IWA L;  2M2L A;  4B08 A;  4A3E G;  4DR2 L;  4ZCK A;  4QL5 A;  4TKO B;  4E6I A;  1EY4 A;  4DV3 Q;  1B9M A;  2KA7 A;  1Q8K A;  1LTA D;  1F2Z A;  5FO7 B;  3KBG A;  2HCI A;  4ILW A;  1G6P A;  1RTO A;  3S1M B;  4LW1 A;  4DU9 A;  5M5X H;  4KN7 C;  2GA4 B;  5FO8 B;  3T51 B;  1SYD A;  3WWV A;  4UHV A;  2EJG C;  2B8G A;  1NMG A;  2LSS A;  1HA6 A;  1N33 Q;  1VQ8 A;  5HGQ A;  4AQY Q;  1PTO F;  2NN6 G;  5TSS A;  4LFA L;  3GO5 A;  2YU9 H;  5K36 G;  3OWE B;  5C6A A;  4A3D H;  3I72 A;  2EY2 A;  3NTK A;  4DR6 Q;  4XT1 B;  4DA2 A;  2A6E D;  3IRB A;  1STG A;  1X6O A;  4FNF A;  2NVQ B;  1YHB A;  2I0Q A;  1P16 A;  1PDQ A;  2NUC A;  2YTV A;  4A3I B;  1I50 B;  1TQO A;  1D5M C;  1EY7 A;  1O7Y A;  1TWH H;  1Y14 B;  3UDF A;  4WOR A;  3E9H A;  1OXV A;  4FF1 A;  4FF4 A;  2JA7 H;  5IT9 c;  2UU9 L;  4K2L A;  2O5J C;  1LTG D;  1LT3 D;  4G7O C;  3GTM H;  3S17 H;  2A19 A;  2MJ8 A;  2M9V A;  1IYU A;  2UXB Q;  3Q22 A;  5JOB A;  1TWA H;  2F0W A;  3K0Y A;  1KDA A;  4X3K A;  3HOV H;  5C4J B;  1S5F D;  5C3E B;  4C3J G;  2L55 A;  3N6R A;  4DR3 L;  4KHV A;  5IOC A;  1E2V A;  2MGS A;  2EJF C;  3KLW A;  4KN4 C;  1ET9 A;  4IUN A;  1VMP A;  4QUC A;  1X9N A;  2BOS A;  2E74 C;  3NHH A;  1E1T A;  3PUX A;  4AYB B;  2AQ3 B;  2JN4 A;  2JA5 H;  3FEW X;  1G91 A;  2B8F A;  3I2Z A;  1FYC A;  1T5X D;  3EBE A;  3E9I A;  5D14 A;  4BBR H;  3FVQ A;  2I5M X;  3X3M A;  3VDY A;  2DJF C;  1X3P A;  4N9T A;  4Z9C B;  5I9P A;  1JCK B;  5C4X G;  1LTI D;  3S16 H;  4BY7 G;  2M00 A;  5CGK A;  3JAM c;  2MPM A;  1WCM H;  2K5H A;  1KDC A;  4DFA A;  4P2C B;  4JW0 A;  1CTM A;  4KHP Q;  4LFC L;  2L12 A;  5EBD A;  1HCZ A;  4JI2 L;  4WRD A;  2VY3 A;  2F3V A;  1C4Q A;  2MFI A;  4UP9 A;  3PF5 A;  2PMZ E;  1I6V C;  4C1N K;  4QJF A;  1EIY B;  2KJX A;  1DOL A;  3BVG A;  2MHV A;  2F0P A;  2OTJ A;  3PUY A;  1GUO A;  1SE2 A;  3GTP B;  4A3B H;  5DNF A;  2L9H A;  2JEB I;  5M3M B;  4HJ8 A;  1VQ5 A;  1AN8 A;  4EGV A;  1CZW A;  1XMQ L;  3VYS A;  3D4R A;  4DV3 L;  1SDF A;  2EJM A;  1X3G A;  3UDX A;  4HSV A;  2RSN A;  3NQT A;  4NXM Q;  1A3V A;  3RLO A;  1PHJ A;  1SJE D;  5IYD H;  4LF4 L;  1LTR D;  3KLS A;  1TVX A;  1SMX A;  4Y7N H;  1I4R A;  3NBI A;  5JJI A;  1B3Q A;  1D2B A;  3KBX A;  4BBS B;  5M5X B;  1UNS A;  2EXD A;  3A56 A;  2KEN A;  2VNU D;  4ZUI A;  4AQY L;  3BS1 A;  1PH6 A;  2O5I C;  1H9S A;  3AFP A;  5BN3 A;  1LUZ A;  1B4O A;  4X66 Q;  4A3F H;  1EZ6 A;  3MXU A;  2DNE A;  2PCF B;  3JC6 6;  1RTN A;  1AZP A;  2C35 B;  1SYG A;  2CW0 D;  1XTC D;  2YU9 B;  2AMC B;  4QQB X;  1B50 A;  4KY6 A;  1EQR A;  2NZ1 D;  2AWO A;  4JI1 L;  4BA1 I;  4J6H A;  4DXF A;  1NCV A;  5IYB G;  4IOA A;  1QZH A;  4OEL B;  1Q86 C;  3CXC A;  3PUZ A;  3K7A H;  2KEC A;  3M4Y A;  3T1Y Q;  2K05 A;  4DUY Q;  1WYD A;  1NNX A;  1HTL D;  1SMY C;  4BA2 I;  3I90 A;  3OW7 A;  1PH8 A;  1JOO A;  5DAU A;  1B70 B;  1HFG A;  2CQA A;  3KFU A;  1GXD C;  2DUD A;  1OXU A;  3R93 A;  1Y1W B;  1SR3 A;  3BDL A;  4JI5 Q;  4K5X A;  3BJU A;  2LMC B;  1AH9 A;  2JA7 B;  4HED A;  1QJO A;  1QIL A;  1CSQ A;  3GTM B;  1JC7 A;  4IAL A;  1V43 A;  1OXX K;  2SNS A;  1XYI A;  1TWA B;  2Z6K C;  3PO3 H;  1IW7 D;  2A8V A;  2JA6 H;  2VUM H;  1O7Z A;  3HOV B;  1H9J A;  2KHS A;  5KRU A;  2PI2 A;  2XNA C;  4C3I G;  1TXY A;  3ZJY C;  3AEV A;  1SND A;  2ZTE A;  3M7G A;  1TY2 A;  3E0J A;  4HCE A;  1D7Q A;  4BY1 B;  1VQE A;  1M4V A;  4JBJ A;  4IOC A;  4R8N A;  3LNN A;  3CCM A;  2N3S A;  2F03 A;  4X64 L;  1VQM A;  1IW7 C;  2OT2 A;  4GS3 A;  2Z0S A;  4GKK Q;  2PNH A;  3A54 A;  3F8T A;  2F0N A;  1CA6 A;  4JI7 Q;  1EY0 A;  2IW3 A;  1EZ8 A;  1VQ4 A;  2QEJ C;  5JJZ A;  3AMU A;  4KHP L;  4NXN L;  1D1I A;  1STB A;  2CH4 A;  1R9T B;  3TRE A;  3I8Z A;  1WCM B;  3S1R H;  1STE A;  4A3L G;  3EFX D;  2B63 H;  3D4W A;  3J7A 5;  1F9P A;  2KVM A;  2B2Y C;  1WJJ A;  4B3R Q;  3LWE A;  3TQY A;  1NY4 A;  4OON A;  4K2K A;  1A3T A;  3GTG H;  1ZYR D;  2KCM A;  3EIV A;  3HOY G;  5GAE C;  3HOX G;  1XXG A;  5JJK A;  1A15 A;  2NZH A;  1AEX A;  1SRO A;  4JOI C;  5F2D A;  1UE1 A;  1FVI A;  5GAD C;  2RDH A;  2F0G A;  2MP1 A;  4B3S Q;  1V1P B;  4KD4 A;  3G6J B;  2B2V A;  3PGZ A;  3W3A A;  4NXM L;  1BCP D;  2PW5 A;  1ZYR C;  4PMW A;  4CKB A;  3G7L A;  1ROD A;  1IL2 A;  1TY0 A;  5E1F A;  2H4O A;  2AQ2 B;  1HRJ A;  1ET6 A;  2PMZ B;  3VA5 A;  3FPP A;  2CWA A;  2E8G A;  3F2U A;  4YCW A;  4B3T Q;  1CHQ D;  1Q46 A;  1KRT A;  1TS3 A;  2Q8R E;  3D8G A;  3N52 A;  1IBL L;  4RGM A;  1GKH A;  2HDM A;  3GP7 A;  4TQU S;  5IYC G;  4L5T A;  4X66 L;  1ASY A;  1RL2 A;  4EVO A;  1UEB A;  2E5L L;  2EY1 A;  1CKM A;  4DUZ L;  4GOP C;  3TP7 A;  1KDB A;  1Y1V G;  2F0M A;  4A3F B;  2VL6 A;  4NPS A;  1VMC A;  4PNY A;  3CPW A;  2OQ0 A;  1ILQ A;  4G4K A;  4B9W A;  4A3K H;  2ALY B;  3FKI H;  1UWV A;  1NJI C;  3T1Y L;  3H3V H;  5CMD A;  3VR3 A;  3MXN A;  1HZB A;  1Y8N B;  4PZ6 A;  4DN4 M;  5FJ8 G;  3J80 L;  1I6H H;  3K7A B;  4HCS A;  4LAA A;  5ELF A;  4CHT B;  5I2Y A;  5C0X H;  4DNR B;  5C3W A;  1XNQ Q;  4HMI A;  1S4Z A;  1S5C D;  1SAP A;  1EQT A;  1EY6 A;  2XVS A;  2OF1 A;  2OQK A;  3GD7 A;  1IHZ A;  1HPC A;  1MBY A;  2PNR C;  1KTK A;  1X3Q A;  5CV7 A;  1FL0 A;  1EIH A;  4K14 A;  4LF9 Q;  5LMU Q;  2Q2H A;  4PMC A;  3OYY A;  3M85 A;  1LTS D;  1N34 Q;  1MSH A;  3I4M B;  4DF7 A;  3QOJ A;  1VQL A;  2VUM B;  4X3S A;  1SNP A;  2NVX H;  3NSW A;  4RH6 A;  4CKC A;  3G4S A;  1TS4 A;  4ME5 A;  5JPN C;  3KJO A;  2ZJP A;  4JBK A;  2R3Z A;  2OXP A;  3U50 C;  5DM7 3;  5NUC A;  2R93 G;  1U9R A;  1PVO A;  3GTJ H;  3MEH A;  1HFN A;  3OSO A;  3UDI A;  1K0R A;  1SYF A;  2QGQ A;  2DNC A;  4JI7 L;  4F87 A;  3PO2 G;  1DD2 A;  1O7L A;  1QNU A;  2A68 C;  2Z1C A;  1I4H A;  2OEO A;  2QA4 A;  3CPF A;  2P5Z X;  3HOU B;  1A3U A;  3NBH B;  4JI8 Q;  1DXM A;  3O13 A;  1VQH A;  2K5N A;  2F4V Q;  4A3C H;  3DEP A;  1HNX L;  3T13 A;  2HCC A;  3KLS X;  3OOC A;  4KJO A;  3RZO H;  4X62 L;  4OL7 A;  4IPG A;  4ZQ3 A;  1PMR A;  3C46 A;  2KCC A;  5IWA Q;  2Q2U A;  3SK8 A;  2Q8T A;  1XWE A;  4IFD J;  3H09 A;  1RJT A;  3S1R B;  2Q2T A;  4QY7 A;  2PI2 E;  4BXX G;  1HZA A;  2B63 B;  3MAQ A;  2F0D A;  3F2B A;  2RKS A;  2D9U A;  4KMU C;  3S1M H;  3GTG B;  1GVP A;  3UI2 A;  1XMO L;  2ID0 A;  3S2D H;  3E5S A;  3I56 A;  2GN5 A;  3DLL A;  2C9O A;  4CJ0 B;  1WTX A;  1PH3 A;  4DXG A;  2CWP A;  3A8K E;  4B3S L;  2WP8 J;  1K3B C;  2VW9 A;  4G57 A;  2N78 A;  1PYB A;  1HZ9 A;  1PRT C;  1B2T A;  4YWL A;  4GN4 B;  4S3S A;  1U5K A;  2F3I A;  4H7B A;  5C5L A;  3UDG A;  1OXS C;  1W2B A;  5DLQ E;  3HG9 A;  5I6Y A;  1IL8 A;  4M8A A;  3CME A;  5IP9 H;  4HIO A;  4KD3 A;  2K75 A;  4NB3 A;  1Q90 A;  4NDX A;  2NVQ H;  5FO9 B;  1JJ2 A;  1Q7Y C;  1VQ6 A;  1KL9 A;  2HQE A;  2D62 A;  5M3F G;  4K8I A;  1D5Z C;  4FP5 D;  4A3I H;  4K6L A;  1K83 H;  1I50 H;  3J80 c;  1PLF A;  4DR1 Q;  3E3X A;  3OIP A;  1YJW A;  5LMN W;  1BXT A;  3RR5 A;  5J3B A;  2B2W A;  1JOK A;  4DPG A;  1IYJ B;  3PV0 A;  1QVG A;  3A8I E;  2VS1 A;  2CCZ A;  2R92 B;  4P74 A;  2R7Z B;  2WAQ G;  2DJG C;  4C1N I;  2UU9 Q;  2XWB B;  4Y52 H;  3BZC A;  5EAY A;  1CT1 D;  4IN3 A;  1YJ9 A;  1ZXT A;  2K14 A;  4N8X 1;  3IL8 A;  5C4J H;  5C3E H;  2NB0 A;  4EQ5 A;  4DV0 Q;  2NZO A;  4KI0 A;  1V1P A;  2EXZ A;  1OXT A;  3H0G B;  4U67 3;  1PTO D;  4A3K B;  2Y0S G;  4LFB Q;  3FKI B;  2KED A;  1TWF H;  2PYK A;  2G5D A;  4DGZ A;  4N9P A;  2SDF A;  1L0Y B;  3S1Q B;  4BS9 A;  3L3O C;  2ZXP A;  1EYA A;  1MGS A;  3LGJ A;  4ZK9 B;  1SFO B;  5BR8 L;  3W5O A;  1ML0 D;  2UXD Q;  1UE6 A;  5IT9 L;  5EGT A;  5LMU L;  1STA A;  3S1N B;  1PTO C;  3J7Z C;  1LAB A;  4A3G G;  3MTS A;  3RD4 A;  2F0U A;  2D0P A;  3KK7 A;  3ULJ A;  3OW2 A;  4IPH A;  1TWC B;  1CZG A;  2BH8 A;  1JE4 A;  4GNX C;  3EVQ A;  5LL6 X;  1XTD A;  5G3L F;  1KRS A;  1HUN A;  3W2D A;  4MN3 A;  4HAE A;  5CV6 A;  5ELB A;  1VQK A;  4JI6 L;  3G48 A;  2Z6K A;  1EFW A;  3DXJ C;  4YCV A;  2YV5 A;  3M9B A;  4U68 A;  1HUM A;  3M7N A;  3T16 A;  2DY8 A;  4LFC Q;  5C0X J;  2E2H H;  2R7D A;  3RZD H;  2JYO A;  3SEB A;  4LF8 Q;  3GTJ B;  4RGT A;  5I6W A;  3D31 A;  1GUS A;  4QCL A;  1FGB D;  2IWH A;  2F4V L;  2H1E A;  3VR6 A;  4PZ7 A;  1FNV A;  1V9P A;  3BG3 A;  1DON A;  2NN6 I;  2ICI A;  3W1B A;  3JAM L;  2XGT A;  3FP9 A;  3RZO B;  1B3A A;  3J7A F;  1WTO A;  1XMQ Q;  3L7Z C;  4HMJ A;  3A55 A;  4C56 C;  1K9M C;  2BE5 D;  2B2U A;  1FGU A;  1F2L A;  4EQO A;  4BBS H;  4OIJ A;  4LF4 Q;  2B2Y A;  3SVM A;  2EY5 A;  2KHI A;  1QUQ A;  3U4V A;  3S2D B;  1XPR A;  1JJG A;  3QR8 A;  4DV7 L;  3CD6 A;  1LM0 A;  1MI2 A;  4XQN A;  1RCV D;  1UE5 A;  3X3N A;  2F0S A;  1MKH A;  3NBH A;  4YHH L;  4NMZ A;  1G2S A;  2HHH L;  3NTI A;  2BA1 A;  2EYJ A;  1H95 A;  1Q3L A;  4DR1 L;  4OO1 G;  2E2J H;  3C1E A;  4G7H C;  4C3J H;  3CCU A;  2AQ1 B;  1T9H A;  1EY9 A;  1WTP A;  4JI1 Q;  4WFN 3;  4IJH A;  3P20 A;  2JA8 H;  4DR4 Q;  1K83 B;  4OX9 Q;  3SK4 A;  2KEE A;  2F0L A;  1EQV A;  1Y1W H;  2F0F A;  1S5E D;  5JPM C;  2QDL A;  3KF6 A;  1CKN A;  3QOL A;  4DV4 L;  4LK1 C;  1H9R A;  3F1Z A;  2F0E A;  2HD3 A;  1X3E A;  2K5V A;  4KKS A;  1XPU A;  4ZRZ A;  2A6E C;  2L15 A;  3J81 E;  4DV0 L;  5CV9 A;  3TZD A;  3PIP A;  2NYZ D;  3CCR A;  1EFI D;  3MVV A;  4LFB L;  2A5H A;  2Z9H A;  1EWI A;  4JV5 L;  3BDO A;  4GOP A;  3DWP A;  5C4X H;  3C2P A;  4RA8 A;  4LWC A;  4DV6 L;  5KYL A;  4HSP A;  1TWF B;  2IHF A;  3T53 B;  2JQO A;  3V2T A;  4BY1 H;  1MJE A;  1JOQ A;  4JCV E;  3WOF A;  4DAY B;  3T4A C;  1QG7 A;  4A3D G;  1JE5 A;  2UXD L;  4HJ5 A;  2F0K A;  3K5O A;  2Q8I B;  2YTY A;  4OHJ A;  4LUZ A;  3CAM A;  3CCE A;  3PQI A;  2UXC L;  2F52 A;  3A0J A;  3DWA A;  4OWX B;  2MQH A;  5KEE A;  4X64 Q;  2K52 A;  4LF7 L;  2ZT9 C;  4L5Q A;  1R9T H;  2JK8 A;  3TEH B;  1EY8 A;  3RUZ A;  2WB1 G;  2LS0 1;  4XT3 B;  1HH2 P;  1XJV A;  1PFN A;  3GQB A;  3QO2 A;  5HGT A;  4NXN Q;  2UUC L;  4CGY B;  5IOD A;  4LF8 L;  3K58 A;  5C3X A;  4A3M G;  3MFG A;  1Q1E A;  2A6H D;  3HOW H;  2F4I A;  3GTO H;  4HR7 B;  2E2H B;  3RZD B;  3P1H A;  4KY7 A;  5C44 H;  2JJQ A;  2PQE A;  5C4Z A;  1H9M A;  4DNT B;  3GDE A;  4QF4 A;  3HS0 C;  4KKT A;  2JA5 G;  5COR A;  2CVR A;  2FJ2 A;  2A74 C;  4QIW E;  3D6W A;  1LV9 A;  1XNR L;  1R4P B;  1G29 1;  1VQF A;  1D8L A;  2E76 C;  2OTL A;  2F0T A;  4BBR G;  1VS0 A;  3MXN B;  2A6H C;  4C2M B;  1I94 Q;  1VQD A;  1KNA A;  4IO9 A;  3NUC A;  1KC8 C;  2L11 A;  4A93 G;  1NSN S;  5EKL A;  1D5X C;  4DV5 Q;  2XWJ B;  2A73 B;  3I4O A;  2F1M A;  2VQF Q;  2BCO A;  3HFZ B;  4H44 C;  5IGF A;  1V8Q A;  5JVH 3;  4LF6 L;  1X32 A;  5M5W H;  1IBL Q;  2FIN B;  1LT6 D;  3BYT B;  4DAP A;  3HP3 A;  1TT2 A;  2OCE A;  2IPK D;  1AW7 A;  2E5L Q;  3AYH B;  3ND8 A;  2AUJ D;  1CHP D;  4DUZ Q;  1G2T A;  4HJ9 A;  2KCN A;  3GTK B;  1J5E L;  4QUF A;  4A3B G;  2EDG A;  3QJY A;  1K8M A;  3URY A;  1CSP A;  4DR4 L;  4OX9 L;  3ITP A;  1SYE A;  2E2J B;  5IT9 E;  1LLR D;  4L63 B;  1Y8O B;  1NMF A;  3R2I A;  4C3J B;  1EQQ A;  1O7I A;  5GAG C;  1SE8 A;  4PG3 A;  1I5F A;  2JA8 B;  1GUN A;  1ESR A;  2F0O A;  3NE5 B;  2FXQ A;  4H13 C;  2G9D A;  2BDN A;  1YHA A;  1A62 A;  1X65 A;  1LTB D;  4TSS A;  2CW0 C;  1SYB A;  1JIC A;  1HR0 W;  1II3 A;  2WKD A;  5IYD G;  2H5X A;  2KUM A;  3DWQ A;  3VYR A;  5J1Z A;  3IKJ A;  2L0C A;  4ZUJ A;  3I4M H;  2QIL A;  4K5V A;  1E22 A;  3CW2 C;  4POF A;  1LT5 D;  5C4X B;  3DM3 A;  3NXW A;  4BY7 B;  3D6C A;  2Z8L A;  1FJG Q;  2NVY B;  5DM6 3;  3F2C A;  1B53 A;  5KNC A;  3K81 C;  1JMC A;  1BBX C;  2Z4H A;  3K6O A;  3JAM E;  4IFD I;  4KK7 A;  1LT4 D;  1W6K A;  3V05 A;  3KJP A;  5FLX c;  2EYF A;  3HOX H;  3HKZ G;  2A69 D;  3HOU H;  1UEA B;  1QVF A;  5ELE A;  1XPO A;  1L2F A;  5J22 A;  4X65 Q;  1N9W A;  5KIX A;  3G6E A;  1M90 C;  3VA7 A;  4TRD A;  5CC4 A;  1HNX Q;  1V1O A;  1ZEQ X;  2R61 A;  2GVA A;  4X62 Q;  4XTC S;  3MC0 B;  3L2P A;  3ER0 A;  4GKJ Q;  1MJC A;  2AHO B;  2DN8 A;  1RIP A;  1F2Y A;  3PO3 G;  5H1S E;  1PXU A;  1SNO A;  2JA6 G;  2CQO A;  1CKO A;  4DAY A;  3NWT A;  3A7A B;  1VF7 A;  4B9X A;  3OIQ A;  3HOW B;  3GTO B;  5GRO A;  4IFD G;  3M3Y B;  4L8J A;  5FLM G;  5C44 B;  4PZ8 A;  1YNN D;  1XMO Q;  2RCN A;  4GLA C;  4JC0 A;  5IYC H;  1Q12 A;  1GUW A;  4DR5 L;  3S24 A;  1EIF A;  4N8F A;  4DK6 C;  2VQE Q;  2XN9 C;  4C3H G;  4UPA A;  3I4N H;  1I94 L;  1KNE A;  3HEJ A;  2NVT H;  4I7A A;  1HNW Q;  2ZTD A;  1AE2 A;  4RGO S;  3AQQ A;  1HZC A;  4DV5 L;  1IXR A;  2VQF L;  1YZ6 A;  2SNM A;  3MWY W;  1WTR A;  2F0H A;  4PMB A;  4H0L C;  4KKU A;  2O4X A;  5CYU A;  3DMU A;  1SJH D;  2R92 H;  3NEL A;  4EX5 A;  3NQI A;  2R7Z H;  5T1G A;  4QIW B;  2X6G A;  5I4D A;  2X6L A;  1BCP C;  4FF3 A;  1ILP A;  5M5W B;  1L0W A;  1C9O A;  2WKC A;  3TN2 A;  3HOZ H;  4MTK A;  1SE3 A;  2YTX A;  5DEH A;  3H0G H;  5AJ3 L;  4L6T B;  1VQI A;  3MEF A;  1QZG A;  4TVA B;  3U9O A;  3RNU A;  5AFW A;  3S1Q H;  1Q81 C;  1V1Q A;  1YIT A;  2KQ3 A;  1KXL A;  1SFO H;  4R8I A;  5IGC A;  2EYP A;  4RKB A;  3D0F A;  3QIA A;  3H3V I;  3H94 A;  4AH6 A;  3TS0 A;  1IBK Q;  3R3O A;  2IHE A;  1N8R C;  3S1N H;  2R93 H;  2RVL A;  5BR8 Q;  1TKW B;  4R4C A;  1RDP D;  4KTA A;  4I65 A;  4R4I A;  5JEA H;  2K5D A;  3A5U A;  3PO2 H;  1B9N A;  1TWC H;  5E4X A;  1PA6 A;  4JYA Q;  1DOK A;  1L1O C;  1UE7 A;  2PQA A;  2XTI A;  1CK1 A;  2PO4 A;  2E75 C;  1LO5 D;  5E3F A;  1WI5 A;  2TSS A;  4X3T A;  1FJG L;  3CCJ A;  2LXJ A;  4RHR A;  4R4Q A;  1PH4 A;  1HHV A;  1ASZ A;  1QCB D;  2K1B A;  4JI6 Q;  3MZ5 A;  4A3K G;  3FRP B;  4RMF A;  1A0I A;  2MNA A;  3BVZ A;  1QUQ B;  3UE0 A;  3OTO L;  3KF8 A;  3W1G A;  1MD2 D;  4DR6 L;  1ENA A;  3H3V C;  1I4X A;  2QEX A;  3HOY B;  1DGS A;  4X65 L;  3HOX B;  1YVC A;  2QKI C;  2K4K A;  4LJZ C;  5C0X G;  1M8A A;  2YYZ A;  4RFB A;  2I5L X;  2I46 A;  3AU7 A;  5JJL A;  1K8O A;  1SNQ A;  3V96 A;  1F9S A;  4GKJ L;  3TZU A;  4FXG C;  1Q82 C;  1EWC A;  2QW7 A;  4HID A;  1SNC A;  3T1H Q;  2WAQ E;  1RF2 D;  1NUC A;  4CDF C;  4F88 A;  2D0O A;  4NP5 A;  5G3L D;  4QGU A;  1I4P A;  3KF6 B;  1CKN B;  4O2D A;  4RHS A;  1F9Q A;  1SLJ A;  1K8A C;  2DY7 A;  3CHB D;  1Q8I A;  4DV1 L;  4CDC C;  4EQP A;  1JR0 D;  1MHW C;  2Y0S E;  4RKL A;  3TDQ A;  4RGN A;  2KHJ A;  2VQE L;  3J80 i;  1O78 A;  1CA5 A;  2HDL A;  5D65 A;  5ISR A;  2F3W A;  2IX1 A;  1HNW L;  3CU7 A;  4GOP B;  4DV7 Q;  5ELO A;  2B39 A;  1AFP A;  2ASB A;  4YIJ A;  3I4N B;  4J15 A;  1TII D;  2NVT B;  1EU3 A;  1SXT A;  1Y1V B;  4RCO A;  1Z9F A;  2C5C A;  1DM0 B;  4YHH Q;  4ULL A;  2HHH Q;  4KLK A;  3SR1 A;  2N49 A;  2EYM A;  2KOL A;  4A3C G;  5CV8 A;  1YHQ A;  2CH4 W;  2EYL A;  5J39 A;  1CFM A;  3PUW A;  4LUV A;  1P8L A;  3ND9 A;  3L9A X;  4KY5 A;  2WFW A;  1KAB A;  3J81 i;  5IGG A;  5EPK A;  1U4P A;  2PW7 A;  3U9S A;  5M9O A;  1I3Q H;  1VDZ A;  3CP0 A;  4DV4 Q;  1A2T A;  4QMG A;  1C48 A;  1PH7 A;  3HOZ B;  4FO2 A;  4DAM A;  1RD9 D;  1J8I A;  1X56 A;  1FNU A;  2AWN A;  1E1O A;  1C0A A;  5GQO A;  2KBN A;  2K33 A;  4JV5 Q;  2IX0 A;  3TP6 A;  4ID6 A;  1WVL A;  2ZXO A;  3PIP 3;  2UUA Q;  4DV6 Q;  3NK9 A;  3T56 B;  4JG2 A;  5IP7 H;  3F2D A;  2NBF A;  1IBK L;  5IP9 G;  3NEM A;  1IZ6 A;  2HQL A;  4OWW B;  1H9K A;  3MFY A;  1K28 A;  3H15 A;  4LNQ A;  1PH1 A;  1KIX A;  5HY6 A;  1GUT A;  3RLN A;  1A8V A;  1F77 A;  5EPL A;  4A3I G;  2R93 B;  4JI4 Q;  2EQS A;  4MIU A;  4UAI A;  4JYA L;  2UXC Q;  2EIF A;  4PQX A;  1PFB A;  3DHQ A;  1TR5 A;  1JJC B;  4A3J H;  4UP8 A;  4L5S A;  1EEI D;  4ZKB B;  3PO2 B;  4LF7 Q;  1TU2 B;  1N36 L;  3KUP A;  1FD7 D;  4HIM A;  3Q0A A;  1CM9 A;  1NTG A;  1GOZ A;  1CUK A;  4A3E H;  2IJ0 A;  1VQO A;  4WJ4 A;  5C3E G;  4YWM A;  3BYY B;  1Z7T A;  3M4P A;  1QVC A;  2UUC Q;  1HR0 L;  2WV6 D;  5T1I A;  3NP8 A;  4IZ8 A;  3BU2 A;  1S40 A;  1J9O A;  3ERQ A;  4AYB G;  2R7F A;  4NKL A;  5JEA J;  2FMM A;  5IE8 A;  2BA0 A;  3SHL A;  3ERO A;  3TP8 A;  1DYQ A;  1SN8 A;  3PF4 A;  1PRT B;  5CV4 A;  4C2M H;  3T1H L;  2SOB A;  2NN6 H;  1XNR Q;  4L5R C;  4KHZ A;  3PSI A;  5K36 H;  1PZJ D;  1YJN A;  4OO1 I;  4YY3 Q;  2N8N A;  4XQJ A;  2B2V C;  1HQM C;  4XQQ A;  4AIM A;  3GV3 A;  1B1Z A;  4V19 0;  5CBA E;  4R1J A;  3S9W A;  1F9R A;  1X55 A;  2ZM6 Q;  4LF5 Q;  4IJL A;  3KDF A;  1G6Z A;  3A8J E;  1HXY D;  3WDN A;  1ONL A;  4LF6 Q;  2RA4 A;  1E0B A;  5KGU A;  1PH9 A;  1LTT D;  2XSC A;  3H91 A;  4IPC A;  4XYO A;  4G7Z C;  2D2C C;  3BZD B;  3OHX C;  2BE5 C;  3B6Y A;  4JOI A;  1STN A;  1PZI D;  2WAQ B;  3J80 E;  1EEF D;  3A5Z B;  3GTK H;  2JE6 I;  2EZV A;  1KLG D;  1NR2 A;  3U4Z A;  5M3M G;  1EU4 A;  5M5Y H;  1HNZ Q;  1J5E Q;  2ZJQ A;  1VQP A;  1IBM Q;  1K0S A;  2Z4I A;  2MUY A;  3J7A V;  1ENF A;  2Y0S B;  1GO3 E;  4OWT B;  1HQR D;  4GZY C;  1I4G A;  1IKM A;  3MXG A;  3KYH C;  3UE1 A;  2ICE C;  3S15 B;  1N32 Q;  2LXK A;  2WB1 E;  1EY5 A;  1G8Z D;  4F7X A;  3CCV A;  4FF2 A;  4DAV A;  3GTQ H;  1I3Q B;  1EIG A;  1E24 A;  1S5D D;  4BBS G;  1PTO B;  1A6X A;  3MXP A;  5ELN A;  3S14 B;  5KYI A;  1STH A;  2UUA L;  3GTL B;  4BY7 H;  3QWN A;  4A3G B;  1DZ1 A;  1WFQ A;  3VR5 A;  2KCT A;  5IGB A;  4GNX B;  3K0X A;  1L0X B;  2NVY H;  2PZW A;  3CMA A;  2E2D C;  4POG A;  3JAM i;  1W6J A;  1GM5 A;  5LMN Q;  4X3U A;  3CC4 A;  4DKA C;  4JI4 L;  3CQZ B;  3SGI A;  2RCF A;  2FMC A;  2FHT A;  2RSO A;  5FOB B;  4A3M H;  2PZU A;  1VQA A;  2JA8 G;  4K6D A;  4FVM A;  5CV5 A;  1ENC A;  3H6M A;  2BDO A;  2LKV A;  2HIX A;  1Y1W G;  2TMP A;  4ZKC B;  2JA7 G;  4A3J B;  2CKZ B;  4IUT A;  1SE4 A;  2ZJR A;  3K5N A;  4JI3 Q;  1NR4 A;  2D5D A;  4FDB A;  4IPD A;  1PFS A;  1WTQ A;  5ELD A;  1L1O A;  2K03 A;  2LY7 A;  2L4N A;  1STY A;  1IKL A;  4A76 A;  4A3E B;  3HOV G;  3TME A;  1GHK A;  1VQC A;  2QF7 A;  1KAA A;  1SSO A;  2RDF A;  5ELC A;  4A93 H;  1SYC A;  5IY0 A;  3M3Y H;  3CCL A;  1TWG H;  4P75 A;  4BY1 G;  3D4D A;  3STB D;  4I7Z C;  5FLX L;  3ONA B;  3M4O B;  1U4M A;  4XXE A;  1BR9 A;  1I4Q A;  4YWK A;  5EJW A;  3MHB A;  4FYD A;  2K5Q A;  3SXH A;  2ENB A;  1PYS B;  4YY3 L;  4DR5 Q;  1MSG A;  4KJN A;  4IUU A;  4OXP A;  2K5W A;  3HZX A;  3Q24 A;  4O42 A;  1E2W A;  2PZT A;  4CDD C;  1Y8P B;  1A2U A;  3I73 A;  1YEZ A;  2AUK A;  3SDZ A;  2ZM6 L;  3STB C;  1BNZ A;  4LF5 L;  3RMH A;  3SE0 A;  5IYB H;  1WCM G;  4MTN A;  3R2T A;  1JWS D;  4F8M A;  1SRU A;  4CKE A;  4J1M A;  4CJ1 B;  1LYL A;  3HOW G;  2PQA B;  2B2W C;  2WAC A;  3U58 A;  5C44 G;  2F0Q A;  3C1F A;  3ERS X;  1Z6H A;  3J81 j;  5EKK A;  1VCI A;  2MO1 A;  5KNB A;  1UAP A;  1HNZ L;  1IBM L;  1N33 L;  1Z47 A;  1K8G A;  5AJ3 Q;  5EBC A;  1ZKO A;  2JSO A;  3CRL C;  3HKS A;  3HKZ E;  3OWF A;  5M5Y B;  1WTW A;  1BDO A;  3TRZ A;  1SMY D;  2HIV A;  4C3I H;  3GV6 A;  3S2H H;  1N32 L;  3IAY A;  3KF8 B;  1YI2 A;  1KLU D;  1AZQ A;  4IUQ A;  4ABN A;  1JWU D;  5LHY 1;  3EA6 A;  1EL0 A;  2WII B;  4A3D B;  1WD0 A;  5I2X A;  1SNM A;  5HUR A;  1ESF A;  4JI0 Q;  1T5E A;  3GTQ B;  1JB3 A;  1BO0 A;  2PPB C;  5COY A;  2JXM B;  1X3F A;  4HTH A;  4JVZ A;  1TWH B;  5IGE A;  3SK5 A;  4A3F G;  2UXB L;  1PFM A;  5LMN L;  2ES2 A;  1KAW A;  4RWS C;  3AFQ A;  3J7Y W;  3EN2 A;  2NTT A;  1F2M A;  3I4L A;  2WB1 B;  4A3L H;  3I91 A;  3NWS A;  3K59 A;  4ZYS A;  4HJA A;  3S17 B;  1VQ7 A;  3OMC A;  5KND A;  4IUV A;  2UUB Q;  1Q1B A;  4A3M B;  3HOY H;  4DV2 Q;  3D3R A;  3OTO Q;  3DUZ A;  2RHS B;  4MNO A;  1OTC A;  1PH2 A;  2B2T C;  1O80 A; 
#chains in the Genus database with same CATH homology
 3E9I A;  4RMF A;  4BBR H;  4GNX C;  1XTD A;  4ME3 A;  1KRS A;  1A0I A;  5FLM H;  2I5M X;  4JI3 L;  2MNA A;  3G71 A;  1QUQ B;  3UE0 A;  3VDY A;  3OTO L;  3W1G A;  1VQK A;  4JI6 L;  3CC2 A;  4DR6 L;  2Q2I A;  5C4X G;  3G48 A;  2Z6K A;  1EFW A;  3CCS A;  3S16 H;  4YCV A;  4BY7 G;  2QEX A;  2YV5 A;  4C3H H;  3M9B A;  3JAM c;  1DGS A;  4X65 L;  3M7N A;  1YVC A;  4LFC Q;  2K4K A;  1WCM H;  5C0X J;  1BBW A;  2K5H A;  5C0X G;  2YYZ A;  2E2H H;  2R7D A;  3RZD H;  2I5L X;  4GNX A;  4LF8 Q;  3I4M G;  2ZTC A;  5JJL A;  1W3S A;  4KHP Q;  4GN5 A;  4LFC L;  3D31 A;  5GAH C;  2VUM G;  4X6A H;  4P71 A;  4GKJ L;  2F4V L;  2A1A A;  4PZ7 A;  1Q82 C;  4HID A;  4JI2 L;  4K0K Q;  2VY3 A;  1V9P A;  3T1H Q;  1X54 A;  2MFI A;  2NN6 I;  2WAQ E;  2PMZ E;  3I7F A;  4UP9 A;  3PF5 A;  2D0O A;  4QGU A;  4H02 A;  3W1B A;  4DV1 Q;  4QJF A;  3I55 A;  1EIY B;  2XGT A;  2ATW A;  3KF6 B;  1CKN B;  4O2D A;  3FP9 A;  1S3O A;  1SLJ A;  1XMQ Q;  1K8A C;  3PUY A;  2OTJ A;  3PCO B;  4A3B H;  3L7Z C;  4DV1 L;  2MO0 A;  1Y1V H;  2JEB I;  2Y0S E;  4HJ8 A;  1K9M C;  1VQ5 A;  2KHJ A;  1FGU A;  2RHQ B;  2VQE L;  1XMQ L;  3HOU G;  2CFM A;  3J80 i;  4DV3 L;  2IX1 A;  1HNW L;  1X3G A;  3UDX A;  4GOP B;  4BBS H;  2RF4 A;  5ELO A;  4DV7 Q;  4LF4 Q;  3Q8D A;  2ASB A;  1YNX A;  4NXM Q;  3E0E A;  2KHI A;  1QUQ A;  3U4V A;  4J15 A;  3PUV A;  3RLO A;  1XPR A;  1C7Y A;  1MIU A;  1PHJ A;  1JJG A;  1GD7 A;  4DV7 L;  3CD6 A;  1Z9F A;  4LF4 L;  5IYD H;  5FJ8 H;  2R6G A;  2B63 G;  1LM0 A;  4YHH Q;  1SMX A;  3CF5 A;  4Y7N H;  2HHH Q;  4KLK A;  2N49 A;  5JJI A;  1UE5 A;  4A3C G;  1YHQ A;  1MKH A;  2K50 A;  3PUW A;  4LUV A;  4YHH L;  2EXD A;  2KEN A;  2VNU D;  1P8L A;  4AQY L;  2HHH L;  1VQN A;  1U0L A;  2WFW A;  1PH6 A;  5E7N A;  2BA1 A;  3J81 i;  3AFP A;  1H95 A;  1LUZ A;  4X66 Q;  4DR1 L;  4OO1 G;  4A3F H;  2E2J H;  4C3J H;  3CCU A;  1T9H A;  1I3Q H;  3JC6 6;  4JI1 Q;  3CP0 A;  4IJH A;  2JA8 H;  2C35 B;  4DV4 Q;  4B3M Q;  4DR4 Q;  1NBW A;  4OX9 Q;  2AMC B;  4QQB X;  1PH7 A;  1Y1W H;  1EYG A;  3TS2 A;  1E3P A;  1EQR A;  2AWO A;  3M4Q A;  4DAM A;  4JI1 L;  4BA1 I;  3KF6 A;  1CKN A;  1VQJ A;  3I4N G;  5IYB G;  4DV4 L;  1X56 A;  1QZH A;  4IOA A;  2AWN A;  1E1O A;  3F1Z A;  1C0A A;  4R4T A;  5GQO A;  1Q86 C;  3CXC A;  3PUZ A;  2KBN A;  1X3E A;  2K5V A;  3K7A H;  3T1Y Q;  1XPU A;  4DUY Q;  4JV5 Q;  2L15 A;  1WYD A;  2E2I H;  4DV0 L;  2IX0 A;  4JI0 L;  4BA2 I;  1PH8 A;  3PIP A;  1B70 B;  3CCR A;  2UUA Q;  3KFU A;  2DUD A;  2DGY A;  1OXU A;  4DV6 Q;  1KD1 C;  4LFB L;  1SR3 A;  4JG2 A;  4DUY L;  4JI5 Q;  5IP7 H;  1EWI A;  3ICE A;  3BJU A;  4JV5 L;  1EOV A;  3F2D A;  4GOP A;  1IBK L;  1AH9 A;  5IP9 G;  3NEM A;  1IZ6 A;  5C4X H;  5C0X I;  2HQL A;  4OWW B;  4LWC A;  2R92 G;  4DNI A;  4DV6 L;  3H15 A;  2R7Z G;  1CSQ A;  4JI5 L;  4LNQ A;  1PH1 A;  3KOJ A;  1KIX A;  1J6Q A;  5HY6 A;  2IHF A;  1E7Z A;  1V43 A;  2JQO A;  1OXX K;  3RLN A;  1A8V A;  4BY1 H;  4A3I G;  1MJE A;  2JA9 A;  4JCV E;  4JI4 Q;  2EQS A;  4DAY B;  1S72 A;  4A3D G;  4JYA L;  2Z6K C;  3PO3 H;  1JE5 A;  3HOZ G;  2UXD L;  2UXC Q;  2B3G A;  4HJ5 A;  1K73 C;  2A8V A;  4UP7 A;  2JA6 H;  2EIF A;  2VUM H;  1BBU A;  1N36 Q;  4A3J H;  2PI2 A;  1JJC B;  4L5S A;  4UP8 A;  2YTY A;  4LUZ A;  3CAM A;  3H0G G;  1WOC A;  1TXY A;  1AE3 A;  3ZJY C;  3CCE A;  3AEV A;  2UXC L;  4O0A A;  3FKI G;  2F52 A;  3A0J A;  2ZTE A;  2UUB L;  3KDF B;  1N36 L;  4LF7 Q;  4BXX H;  3RLF A;  4HIM A;  4OWX B;  4DV2 L;  1D7Q A;  2MQH A;  1NTG A;  1VQE A;  4IOC A;  4JBJ A;  1CUK A;  4X64 Q;  4A3E H;  1HR0 Q;  2K52 A;  4LF7 L;  1VQO A;  4WJ4 A;  5C3E G;  1G51 A;  4YWM A;  3CCM A;  4MZ9 A;  3M4P A;  2N3S A;  4L5Q A;  2JK8 A;  1R9T H;  3TEH B;  1QVC A;  4X64 L;  2UUC Q;  2BH2 A;  1VQM A;  1HR0 L;  4GS3 A;  2WB1 G;  2Z0S A;  4GKK Q;  2PNH A;  1HH2 P;  1HJP A;  1XJV A;  3F8T A;  4A4I A;  3BU2 A;  4NXN Q;  4JI7 Q;  2UUC L;  1S40 A;  1M1K C;  4GKK L;  4GN3 B;  4AYB G;  2R7F A;  4LF8 L;  5JEA J;  1VQ4 A;  5JEA G;  4A3M G;  1YBY A;  4DR7 Q;  1BVS A;  1Q1E A;  5IE8 A;  4KHP L;  4NXN L;  2BA0 A;  3TRE A;  3HOW H;  3GTO H;  3CC7 A;  4P73 A;  3S1R H;  4A3L G;  5C44 H;  2B63 H;  4K0K L;  1SN8 A;  1YIJ A;  3PF4 A;  2JJQ A;  4C2M H;  5M3F H;  3T1H L;  3J7A 5;  1WJJ A;  1BKB A;  1XNR Q;  4XIG S;  3TQY A;  4KHZ A;  1NY4 A;  3GDE A;  3PSI A;  4OON A;  4L5R C;  3GTG H;  1YJN A;  4OO1 I;  4YY3 Q;  2JA5 G;  1NE3 A;  2N8N A;  3CCQ A;  2KCM A;  3EIV A;  4QIW E;  1PH5 A;  5GAE C;  4AIM A;  3HOX G;  3HOY G;  4B3R L;  5JJK A;  1XNR L;  1G29 1;  1VQF A;  1D8L A;  2NZH A;  2OTL A;  4GLV B;  1SRO A;  4R1J A;  4BBR G;  4DR2 Q;  4JOI C;  1UE1 A;  1X55 A;  2ZM6 Q;  1VS0 A;  1FVI A;  3MXN B;  3RN2 A;  5GAD C;  4LF5 Q;  1I94 Q;  4IJL A;  1VQD A;  3KDF A;  4APV A;  4R4O A;  4IO9 A;  3RN5 A;  1KC8 C;  4A93 G;  4B3S Q;  4LF6 Q;  3PGZ A;  4DV5 Q;  3FHW A;  1PH9 A;  3NEN A;  3I4O A;  4NXM L;  4IPC A;  2VQF Q;  2IY5 B;  4PMW A;  3HFZ B;  4ALP A;  1IL2 A;  3B6Y A;  4JOI A;  4DK3 C;  4LF6 L;  2GVB A;  3A5Z B;  3GTK H;  2JE6 I;  5M5W H;  1IBL Q;  2CWA A;  2E8G A;  3U4Z A;  3S15 H;  4YCW A;  4B3T Q;  1Q46 A;  5M3M G;  1KQS A;  2OCE A;  1KRT A;  5M5Y H;  2E5L Q;  3AYH B;  1IBL L;  4LFA Q;  1J5E Q;  1HNZ Q;  2ZJQ A;  1VQP A;  1GKH A;  1IBM Q;  2JEA I;  4DUZ Q;  3K8A A;  4GLX A;  4B3T L;  3K7U C;  4TQU S;  5IYC G;  4L5T A;  1GO3 E;  4OWT B;  1RL2 A;  4X66 L;  1ASY A;  4UY8 C;  1UEB A;  2E5L L;  3L0O A;  4HJ9 A;  1J5E L;  3KYH C;  1CKM A;  3UE1 A;  4DUZ L;  4GOP C;  4A3B G;  1CSP A;  4B3M L;  1N32 Q;  4DR4 L;  1JT8 A;  1Y1V G;  4OX9 L;  2LXK A;  2WB1 E;  3CCV A;  1B8A A;  3S14 H;  4A3G H;  3K80 C;  1LTL A;  2VL6 A;  4NPS A;  3GTL H;  1NMF A;  3CPW A;  1L1O B;  1O7I A;  2OQ0 A;  5GAG C;  1E24 A;  1SE8 A;  4PG3 A;  1EQQ A;  3GTQ H;  1A63 A;  1I5F A;  4A3K H;  2ALY B;  3FKI H;  1UWV A;  2FXQ A;  4AYB E;  4BBS G;  1VQG A;  1NJI C;  3T1Y L;  1YHA A;  1A62 A;  1X65 A;  3H3V H;  1HZB A;  4PZ6 A;  3CQZ H;  1KHI A;  5ELN A;  1HR0 W;  5IYD G;  2UUA L;  4BY7 H;  5FJ8 G;  2H5X A;  4B3R Q;  1B7Y B;  1I6H H;  1WFQ A;  2KCT A;  4GNX B;  3K0X A;  2NVY H;  3CMA A;  1XNQ Q;  4HJ7 A;  3J81 c;  4POG A;  3I4M H;  3JAM i;  1GM5 A;  1E22 A;  3ULL A;  3CW2 C;  4POF A;  5LMN Q;  3CC4 A;  2OQK A;  4DKA C;  3DM3 A;  3GD7 A;  4DR3 Q;  4JI4 L;  1XNQ L;  3SGI A;  2AKW B;  4A3M H;  1FL0 A;  2B29 A;  5LMU Q;  2Q2H A;  4LF9 Q;  4JBW A;  1VQA A;  4RG1 A;  1FJG Q;  2JA8 G;  3OYY A;  3M85 A;  3F2C A;  1N34 Q;  4JBM A;  2HIX A;  1Y1W G;  4WJ3 M;  3K81 C;  1JMC A;  4LF9 L;  4LUO A;  1VQL A;  2JA7 G;  1K3R A;  1N34 L;  2CKZ B;  2ZJR A;  3G4S A;  2NVX H;  2HT1 A;  3KJO A;  4IFD I;  4JBK A;  2ZJP A;  3KJP A;  3ULP A;  3U50 C;  5FLX c;  4JI3 Q;  3HOX H;  3HKZ G;  3HOU H;  4FDB A;  4IPD A;  1PFS A;  1QVF A;  2R93 G;  1EUJ A;  1XPO A;  3M4O H;  1L1O A;  4P72 A;  1L2F A;  2OWO A;  1PVO A;  3GTJ H;  4YCU A;  4A75 A;  4A76 A;  3UDI A;  5IP7 G;  4X65 Q;  1K0R A;  3HOV G;  1VQC A;  1N9W A;  2QGQ A;  2VZA A;  3G6E A;  1M90 C;  2V1C C;  4JI7 L;  3PO2 G;  1HNX Q;  4A93 H;  5IY0 A;  3M3Y H;  3CCL A;  3BZK A;  2QA4 A;  1JB7 A;  3CPF A;  2GVA A;  4X62 Q;  4DR7 L;  4XTC S;  1TWG H;  4P75 A;  3NBH B;  4JI8 Q;  3L2P A;  1VQB A;  3ER0 A;  4BY1 G;  1VQH A;  2K5N A;  3STB D;  1VQ9 A;  2F4V Q;  4GKJ Q;  4A3C H;  1HNX L;  1MJC A;  2AHO B;  1RIP A;  4JI2 Q;  3PO3 G;  2I5H A;  1PV4 A;  3RZO H;  5H1S E;  2JA6 G;  2CQO A;  4X62 L;  1CKO A;  4JI8 L;  4YWK A;  3GTP H;  4IPG A;  4HIK A;  4A3J G;  3A74 A;  3PIO A;  5IWA Q;  2IT1 A;  1PYS B;  5M3M H;  2Q2U A;  5GRO A;  4IFD J;  4YY3 L;  4IFD G;  4DR5 Q;  2Q2T A;  4QY7 A;  2PI2 E;  4BXX G;  1HZA A;  5FLM G;  4PZ8 A;  3F2B A;  4OXP A;  1XMO Q;  2RCN A;  4GLA C;  4JC0 A;  5IWA L;  5IYC H;  1Q12 A;  4A3E G;  3S1M H;  4DR2 L;  1GVP A;  4DR5 L;  3S24 A;  1YEZ A;  1EIF A;  4DK6 C;  2VQE Q;  2ZM6 L;  3STB C;  1XMO L;  4UPA A;  2ID0 A;  4LF5 L;  1I94 L;  3I4N H;  4QL5 A;  5IYB H;  3I56 A;  2NVT H;  2GN5 A;  1WCM G;  3S2D H;  3DLL A;  4DV3 Q;  1HNW Q;  1PH3 A;  1Q8K A;  2CWP A;  2ZTD A;  1AE2 A;  4MTN A;  4B3S L;  2WP8 J;  2VW9 A;  3AQQ A;  1HZC A;  1G6P A;  4DV5 L;  1IXR A;  2N78 A;  1PYB A;  2VQF L;  1YZ6 A;  1HZ9 A;  1SRU A;  4YWL A;  4GN4 B;  4LW1 A;  1U5K A;  2F3I A;  5M5X H;  3UDG A;  1OXS C;  1W2B A;  5DLQ E;  3CME A;  3WWV A;  1LYL A;  5IP9 H;  3HOW G;  4HIO A;  1NMG A;  2LSS A;  2K75 A;  2PQA B;  4NB3 A;  1N33 Q;  3U58 A;  2NVQ H;  1JJ2 A;  2R92 H;  1Q7Y C;  3NEL A;  4EX5 A;  5C44 G;  1VQ8 A;  2R7Z H;  5HGQ A;  1VQ6 A;  1KL9 A;  3ERS X;  3J81 j;  4AQY Q;  1VCI A;  2D62 A;  2MO1 A;  2NN6 G;  5M3F G;  1HNZ L;  3GO5 A;  4LFA L;  2YU9 H;  4A3I H;  1IBM L;  1L0W A;  1C9O A;  1K83 H;  1I50 H;  1N33 L;  5K36 G;  1Z47 A;  3J80 c;  4DR1 Q;  1K8G A;  5AJ3 Q;  4A3D H;  3HOZ H;  4DR6 Q;  1YJW A;  5LMN W;  3HKS A;  3HKZ E;  3IRB A;  2YTX A;  3RR5 A;  3TRZ A;  5J3B A;  1X6O A;  3H0G H;  4DPG A;  1IYJ B;  2HIV A;  4C3I H;  3PV0 A;  5AJ3 L;  1QVG A;  2VS1 A;  2CCZ A;  3S2H H;  4P74 A;  1YHB A;  1N32 L;  2I0Q A;  1P16 A;  1VQI A;  3KF8 B;  3MEF A;  1QZG A;  1YI2 A;  2WAQ G;  4TVA B;  3RNU A;  2YTV A;  2UU9 Q;  3S1Q H;  1Q81 C;  1V1Q A;  1YIT A;  1Y14 B;  1TWH H;  3BZC A;  5EAY A;  3UDF A;  4Y52 H;  1KXL A;  1YJ9 A;  3E9H A;  2K14 A;  1OXV A;  5C4J H;  5C3E H;  1SFO H;  2JA7 H;  4EQ5 A;  4DV0 Q;  2NZO A;  4KI0 A;  4JI0 Q;  5IT9 c;  2UU9 L;  1OXT A;  3D0F A;  2Y0S G;  4LFB Q;  1TWF H;  3H3V I;  3GTM H;  3S17 H;  2A19 A;  4AH6 A;  2UXB Q;  3TS0 A;  1IBK Q;  2IHE A;  1N8R C;  3S1N H;  2R93 H;  1X3F A;  5BR8 Q;  1TWA H;  4R4C A;  4A3F G;  3LGJ A;  3HOV H;  4R4I A;  2UXB L;  3A5U A;  5LMN L;  2ES2 A;  1KAW A;  5BR8 L;  3W5O A;  3PO2 H;  3AFQ A;  1TWC H;  3EN2 A;  1PA6 A;  4DR3 L;  4JYA Q;  2UXD Q;  1L1O C;  1UE6 A;  1UE7 A;  2PQA A;  2XTI A;  4A3L H;  4HJA A;  3KLW A;  5LMU L;  1WI5 A;  1FJG L;  3J7Z C;  1X9N A;  3CCJ A;  1VQ7 A;  1E1T A;  2LXJ A;  3PUX A;  2JA5 H;  4A3G G;  4R4Q A;  2UUB Q;  1Q1B A;  3HOY H;  1PH4 A;  3I2Z A;  4DV2 Q;  2D0P A;  1ASZ A;  3ULJ A;  4MNO A;  2RHS B;  4IPH A;  3OTO Q;  3OW2 A;  1OTC A;  1PH2 A;  4A3K G;  3EBE A;  4JI6 Q;  2BH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...