1CSQA

Crystal structure of the bacillus subtilis major cold shock protein, cspb: a universal nucleic-acid binding domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Universal nucleic acid-binding domain revealed by crystal structure of the B. subtilis major cold-shock protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulation
molecule keywords COLD SHOCK PROTEIN B(CSPB)
total genus 9
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1993-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1csqA00
2HHHL 5GAHC 3JAMc 3KFUA 4DUYQ 2RHSB 4R4QA 1KRTA 1HR0W 3I2ZA 5FJ8H 4WJ3M 3KLWA 3G6EA 3CMAA 1RIPA 1P8LA 3OTOL 3S16H 4JYAQ 2R93H 3U4ZA 5IWAQ 1Z9FA 2EXDA 1A62A 2ZTDA 2UUAQ 5GADC 3OW2A 1Q81C 4L5RC 1AH9A 2QGQA 1Y14B 4NB3A 2R7FA 5FLXc 4JI0Q 4JG2A 4DV4Q 1YNXA 2PI2A 4QJFA 5BR8L 4BY1H 3UDFA 3J81i 1U0LA 3S1NH 1IBLQ 2PQAB 4KLKA 1JE5A 4LUVA 4DR2L 1QVCA 1L1OC 2UUCQ 2VY3A 1S3OA 2OWOA 4ME3A 2UXDL 2NZOA 5FLMH 2ZJPA 2A1AA 2LXJA 4YWLA 1Y1WG 1UE7A 5C44H 3HKZE 1K8AC 4NXNQ 3CCEA 4BBRH 4KHPQ 4JI3L 4NXML 2HIXA 3TS2A 1W3SA 3PUZA 1SFOH 3AYHB 2R92G 2B63G 3HFZB 4GN3B 3S2DH 1X54A 3E9HA 4QQBX 5IYCH 2BA1A 3I55A 4HJAA 3RNUA 1HNXL 1EIYB 3PO2H 1TWAH 4LFCL 2JEAI 4RG1A 3ER0A 1X3EA 4LF7Q 1L1OA 1YEZA 1VQ5A 2IY5B 2Q2HA 3J81c 1TWGH 1QUQA 1MIUA 2CKZB 5HY6A 2YU9H 4A93G 2YV5A 4LF4L 3HOVG 1WCMG 2E2JH 2UUBL 4AQYQ 2IHEA 1S40A 5K36G 1L1OB 2I5MX 2Z6KA 3IRBA 3F2BA 1PV4A 3J80c 1N36Q 3T1HL 4JBKA 4QIWE 4B3RL 4LF4Q 4DR3L 3TEHB 5AJ3Q 2OQKA 2A19A 1VQCA 4A3JH 4A3FG 1YJ9A 1V43A 1N8RC 2BA0A 3HOUH 4A3CG 4WJ4A 2YTYA 3HOYG 4DR3Q 3NENA 3KJOA 4P72A 1Q1BA 3ULJA 3T1YQ 4BA1I 2NVYH 5LMUL 2WB1E 4GN4B 1XMOQ 4OWWB 4DR1L 4P71A 5IP9H 4DUZL 3S14H 2E2IH 4YWKA 3FKIG 2JA5H 2K14A 1OXUA 3GTKH 1LTLA 1SRUA 2Y0SE 5C3EH 1E1TA 4JCVE 5GAGC 1QVFA 3K0XA 4JI5L 1LM0A 4DV6L 2K4KA 4IPHA 3UDGA 2N49A 4IJHA 4C3HH 1E3PA 2HQLA 4DUYL 2YTVA 3S24A 1BKBA 5C0XG 3G4SA 3ERSX 2F52A 1ASYA 4DV6Q 2LXKA 3G71A 1EIFA 4LW1A 4B3SL 3CPFA 4YCWA 4A3KH 1PA6A 4LF5Q 3KYHC 3K81C 3MXNB 5JJLA 2IHFA 1GO3E 3EBEA 4DPGA 1JB7A 4DAYB 1EYGA 2EQSA 4JI7L 2FXQA 4FDBA 4IJLA 4BBSG 1A8VA 3AQQA 1VQAA 2I5LX 2GN5A 1HH2P 1XJVA 3RN5A 2ZM6L 2E8GA 4GKKL 5JEAJ 5C4XG 2CWAA 5C44G 4YHHL 1IBKL 2Z0SA 2PNHA 1PVOA 3S15H 4LFAQ 3M3YH 3CPWA 5IYCG 4ALPA 2CWPA 3F2CA 2ID0A 3A74A 2HT1A 3PCOB 1X3GA 3S1RH 2E2HH 1N34L 4B3TQ 3CW2C 1BBWA 4HIMA 1VQBA 4NXMQ 4BBRG 4IPDA 4PG3A 4BY1G 1NMFA 1I3QH 3BZCA 2D62A 1QUQB 2Q2IA 2ATWA 1X56A 4X64L 3GTLH 1KL9A 5FLMG 1Z47A 4K0KQ 4R4OA 1W2BA 4IFDI 1IYJB 4OWXB 3D31A 2R7ZG 2IX1A 2JA8G 2GVBA 4JI1L 2MO0A 1V9PA 4B3RQ 2UU9Q 4DV7Q 2JA7G 3HOXG 4JBWA 1NBWA 1DGSA 1HR0L 4LF8Q 3GTGH 2NVTH 3KF8B 5M3MG 2VUMH 3KF6A 1Q46A 1IZ6A 4UP8A 4NPSA 1GM5A 1YVCA 1PH9A 3A0JA 2EIFA 2RHQB 4QL5A 2NN6I 4GKJL 1YHQA 4X6AH 4JV5L 3STBC 1B8AA 4A3LH 5M5XH 4EQ5A 2K5VA 3PGZA 4LF7L 4A3BH 4LFBQ 3DLLA 2VW9A 1WFQA 4DV2L 2K52A 2KCMA 4LF9L 4A3DH 2JA6G 4A3GG 4UP7A 3FP9A 2PI2E 1K83H 1GVPA 2KCTA 4A3JG 2D0OA 1N9WA 4HIKA 1OXVA 1TXYA 1VQDA 1QVGA 1NMGA 3CC2A 1XNQL 4IOAA 3VDYA 1K9MC 3GTPH 3T1HQ 4J15A 1VQ7A 3M7NA 3BU2A 2VQFQ 4L5QA 4DR4Q 4DK3C 1XMQQ 1UEBA 2AHOB 1M1KC 2N3SA 4DR1Q 1X9NA 1JJCB 2OCEA 2I0QA 4A3MH 1FGUA 1SR3A 1VQEA 2KHIA 3NEMA 1CKNB 4H02A 4AYBE 1WCMH 5GAEC 2ASBA 3GD7A 4Y7NH 3I4MG 2K50A 1Q1EA 5IP7H 4BY7H 1PFSA 4JC0A 5IE8A 4L5TA 1IBLL 3RZOH 1CKNA 4IFDG 4L5SA 1K3RA 2AKWB 3PIOA 2HIVA 1I6HH 5IY0A 1WYDA 2VZAA 3KDFB 3J81j 1YBYA 2UUCL 1NE3A 2VQEQ 3S1MH 3PO2G 3NELA 1HNZQ 4X62Q 3L7ZC 1XPRA 4NXNL 1I5FA 3DM3A 4GOPA 5H1SE 2R92H 1N33Q 5IWAL 3H0GG 1A0IA 1HZBA 3PO3G 2IT1A 4PZ8A 4X62L 4DR5Q 4DR7L 4R1JA 2RF4A 2QA4A 1VQFA 4A3DG 1VS0A 1X3FA 2KHJA 3CCLA 1NTGA 4X66L 1R9TH 1EQRA 5C4JH 3UE1A 1OXXK 1NY4A 1VQMA 4GS3A 1B70B 4JI3Q 5IT9c 1X55A 3HOZG 2UUAL 3HOWG 4OONA 3CCSA 5DLQE 1AE3A 4QY7A 4PZ7A 3B6YA 4AQYL 1MKHA 5M3FH 1HR0Q 2AWOA 4LUZA 5IYDG 3HOXH 1EQQA 4O0AA 3CCMA 4JI0L 1U5KA 2CCZA 4P74A 1YITA 3W1BA 4X65Q 1VQ8A 3BZKA 5IYBH 4LFAL 4HJ9A 2ZJQA 4KHZA 4IFDJ 5M3FG 5AJ3L 1NJIC 5IYDH 1JT8A 1QZGA 4HJ7A 3KDFA 3U4VA 4K0KL 4R4CA 4C3JH 4QGUA 3CCUA 3TQYA 1Q82C 4LWCA 2UXCQ 1BBUA 2N8NA 1KRSA 4AYBG 3D0FA 1FL0A 1XNRL 2F4VQ 4OO1I 4DKAC 3TS0A 3KF6B 1Y1VG 4HIOA 4KHPL 1X65A 3I4NH 4A4IA 1T9HA 3RLNA 1HZCA 3EN2A 4IPGA 3GTJH 2YYZA 3JAMi 4LF8L 4OWTB 3L2PA 1FJGQ 3W5OA 3CP0A 4DV1Q 4GNXC 4MTNA 3ICEA 5IP7G 2DUDA 4JOIC 1N32L 4LF9Q 3BJUA 3UDXA 2AWNA 2KENA 3E0EA 2PMZE 2JK8A 5HGQA 4BXXG 3CF5A 1A63A 1GD7A 2ZJRA 2ES2A 2UXBQ 5LMNQ 1LYLA 3S1QH 3CAMA 2WB1G 4BA2I 1E1OA 5M5YH 4DR4L 1VQHA 3JC66 4IPCA 4JBJA 4OXPA 4R4TA 4TVAB 4AH6A 3T1YL 1OTCA 5LMUQ 3PUXA 2Q2TA 4OX9L 1XMOL 2UXBL 4XIGS 3CC4A 4C3IH 4DR2Q 4A75A 3GTQH 4JI2Q 1O7IA 3CXCA 1HNWL 4PZ6A 4RMFA 1PH5A 1C0AA 1JMCA 3H3VH 3M4QA 1WOCA 2JEBI 1SLJA 4JOIA 1PH4A 1VQGA 4GNXA 2JA9A 2OQ0A 5IP9G 2R7DA 3KJPA 2WP8J 3M4PA 2Y0SG 3A5UA 1AE2A 1HNZL 3PSIA 2JA6H 1YHAA 3AFQA 1I50H 4JBMA 4GOPB 3NBHB 2C35B 1YHBA 2E5LL 4LF5L 3MEFA 1K0RA 1H95A 5J3BA 4A3LG 2WAQE 1G51A 3H3VI 4YHHQ 1IBKQ 1P16A 3A5ZB 1PYBA 1Q12A 1WI5A 1FVIA 5JEAG 2E5LQ 2I5HA 1N33L 2ZM6Q 3HOZH 3RZDH 3CCJA 4DAMA 5M3MH 5C0XI 1KIXA 2VUMG 1QZHA 3CCRA 3I4OA 1PH2A 5IYBG 1PH1A 4DV4L 2ZTEA 3K8AA 4P75A 5BR8Q 2R7ZH 3PUYA 3CQZH 4EX5A 2B3GA 2QEXA 1EWIA 4YCVA 1N32Q 1SE8A 2CQOA 1VQ4A 2XGTA 1JJ2A 4JI6Q 1HZ9A 1SMXA 3CD6A 2MQHA 2OTLA 1C7YA 2B29A 1Q8KA 2NN6G 1HNXQ 4JI1Q 1G291 2AMCB 1KHIA 2MFIA 3H0GH 4P73A 3CMEA 1KQSA 4O2DA 4GKKQ 3L0OA 3S17H 4GN5A 1KC8C 1SROA 4LFCQ 3TRZA 4GOPC 2B63H 3U50C 3J80i 4GNXB 1FJGL 3RLOA 1OXSC 4BBSH 4HJ8A 1PYSB 3F1ZA 4YCUA 1BVSA 2F3IA 2PQAA 4KI0A 1YJNA 1UWVA 4GKJQ 2VQFL 1LUZA 1VQ9A 4B3MQ 5C4XH 2JQOA 1KD1C 1JJGA 3GTOH 1UE1A 3K7UC 4UP9A 1L0WA 3PF5A 2NVXH 3LGJA 5ELNA 1KXLA 2N78A 3M4OH 3F2DA 1J5EQ 3PIPA 2UXCL 3PV0A 3PUWA 4X64Q 1UE5A 1VQKA 3ULLA 5LMNW 2NVQH 5ELOA 1K73C 4POGA 4LFBL 2VS1A 1VQPA 4JI2L 3AEVA 2OTJA 2JJQA 4DV5Q 4JI4L 1B7YB 3HKZG 4DV0L 4BY7G 4JI7Q 3GDEA 2K5HA 4JI8Q 1CUKA 1VCIA 2MO1A 3GO5A 3PUVA 3KOJA 1TWHH 1CKOA 1XTDA 1OXTA 4HIDA 4JYAL 1SN8A 4DV5L 4A3MG 2A8VA 5EAYA 4DR6L 3HOYH 2RCNA 3U58A 3UDIA 3I56A 5JJIA 2R6GA 1Y1VH 3W1GA 5FJ8G 3H15A 1L2FA 2MNAA 2ZTCA 1IXRA 2WFWA 4HJ5A 4B3SQ 1X6OA 5C3EG 4DV3L 1XPOA 3OTOQ 2K75A 2KBNA 4IOCA 3FKIH 2JA5G 4A76A 5GROA 4GLXA 4PMWA 3RR5A 1YI2A 1M90C 1K8GA 3SGIA 2LSSA 4DUZQ 4DV3Q 4TQUS 4B3TL 4A3IH 2BH2A 4YY3L 1PH3A 3I4NG 3WWVA 3J7ZC 4A3BG 2JA7H 3HOVH 3HOUG 2XTIA 4A3FH 4A3CH 1PH8A 4LF6Q 1E24A 1RL2A 3I7FA 2VQEL 4YY3Q 3M85A 3AFPA 1UE6A 4UY8C 4X66Q 3HOWH 2YTXA 1HJPA 2UU9L 4LF6L 3CCVA 2NZHA 4JI6L 1V1QA 1G6PA 4DR5L 2D0PA 4AIMA 4DR7Q 1N34Q 2UUBQ 4A93H 2JA8H 4DNIA 1I94L 1E22A 1S72A 3F8TA 1EFWA 1PHJA 1VQOA 1XNRQ 4OX9Q 2F4VL 1YJWA 1EUJA 3PO3H 1I94Q 1IBML 3CC7A 3CCQA 4IO9A 1PH7A 4A3EG 4DV7L 1Q7YC 1YZ6A 1D8LA 2UXDQ 4UPAA 3UE0A 3Q8DA 4GLAC 4C2MH 1MJCA 2K5NA 1VQIA 1KAWA 2L15A 4XTCS 4LNQA 4A3EH 3J7A5 1CSQA 1EOVA 2JE6I 1IBMQ 1VQNA 3K80C 4Y52H 4APVA 1J5EL 5M5WH 1Y1WH 2H5XA 1D7QA 4JV5Q 1XMQL 2Q2UA 2BH8A 1IL2A 2IX0A 3ZJYC 3TREA 3RN2A 3EIVA 1C9OA 3I4MH 5JJKA 4POFA 2CFMA 1YIJA 1TWFH 3G48A 2R93G 3PF4A 3E9IA 2V1CC 2Z6KC 4MZ9A 2WAQG 4DV1L 4GLVB 5C0XJ 4BXXH 1XNQQ 1TWCH 4LUOA 1VQ6A 3FHWA 5GQOA 4X65L 4A3KG 4DK6C 4DV2Q 1MJEA 1XPUA 3S2HH 4YWMA 4DR6Q 1HNWQ 1Q86C 4B3ML 4JI5Q 1VQLA 4MNOA 3RLFA 1GKHA 1E7ZA 4R4IA 2ALYB 4OO1G 1N36L 4A3GH 1WJJA 4A3IG 2HHHQ 3K7AH 2VNUD 5E7NA 4JI4Q 3ULPA 1HZAA 2DGYA 2GVAA 2VL6A 4DV0Q 1ASZA 1CSPA 1J6QA 3M9BA 4JI8L 3GTMH 3OYYA 1CKMA 1PH6A 3STBD 5LMNL 1VQJA 3HKSA
chains in the Genus database with same CATH superfamily
1I50B 2A6HD 1HR0W 4WJ3M 3G6EA 5C3WA 4JYAQ 1PMRA 2EXDA 2UUAQ 3C3LA 3OHXC 5GADC 4HSPA 4A3JB 1CI3M 2NWGA 3BS1A 5FLXc 1YNXA 3LWUA 3J81i 2SNSA 1U0LA 1MHWC 1EOTA 3QOLA 4LUVA 1ZYRC 4XT3B 2M00A 2F3VA 1JWUD 1L1OC 3S1QB 1WTVA 5DNFA 2DN8A 2K7VA 2ZJPA 2VUMB 1BR9A 2A1AA 2LXJA 5KNCA 3HKZE 4NXNQ 5J1ZA 4C1NK 2OF1A 2B2UA 2N88A 2I46A 2HIXA 1RCVD 1W3SA 4FXKC 4HCSA 5ELFA 2B63G 1DOMA 3BDLA 2Q8RE 4QQBX 1MBYA 4HJAA 1S4ZA 1TWAH 1MGSA 1Y8NB 4LAAA 3T53B 4LFCL 4IFDH 4LF7Q 1YEZA 2IY5B 2Q2HA 2F0PA 2JA8B 1PRTF 2E2JH 4C3HG 5ELBA 2R61A 2I5MX 2Z6KA 1IYVA 3VA7A 3J80c 1PV4A 4B3RL 4LF4Q 4DR3L 1WCMB 2OQKA 4FXGC 1VQCA 4A3CG 1N8RC 3HOUH 4RWSC 4WJ4A 1M8AA 1I4XA 1EY5A 1S5FD 4EQPA 2EVBA 2FMCA 5FO9B 4JK1C 4JCVE 3K58A 4QCLA 2K32A 1IW7C 5M5XB 2N49A 5BN4A 5KNBA 4H7BA 5C0XG 2F52A 1AW7A 1EIFA 2EYLA 1EZ8A 1A3UA 2F0JA 2IHFA 1JE4A 3NTHA 4QMGA 3PO2B 2MGSA 3RN5A 2ZM6L 2E8GA 2EY2A 3K5MA 4GKKL 1V1PB 2M2LA 1GXDC 2F0KA 2AQ2B 1IBKL 2F0NA 3S15H 1ENCA 3CPWA 5IYCG 5KRUA 1A6XA 4L6TB 2CH4W 1D1IA 2ID0A 5FLXE 2E2HH 3QIAA 3S1RH 4B3TQ 2F0LA 3CW2C 1BBWA 2E75C 2WAQB 2ZXPA 4BBRG 1SYDA 4OHJA 5BN3A 1I3QH 3NSWA 5COYA 2Q2IA 2ATWA 4K5WA 1X56A 3EJIA 4R4OA 1VF7A 4CHTB 5JPMC 2IJ0A 3E6ZX 1CK1A 3HGBA 3G6JB 3GTGH 3UI2A 2B2VC 1Q46A 3R2TA 1QNKA 2RHQB 4X6AH 2NB0A 1TS4A 3TP7A 4DA2A 3HKZB 2K5VA 4LF7L 1DM0B 1KNEA 4I65A 4A3BH 3A56A 1A2TA 2K52A 2CH4A 3PQIA 1F2LA 1TY2A 2PI2E 2TSSA 5EBDA 2D0OA 3GV3A 1LTID 4RGOS 1EY0A 3GTPH 3T1HQ 1VQ7A 3M7NA 2VQFQ 1UEBA 1M1KC 2KCNA 2I0QA 1JJCB 2OCEA 4YIJA 3VR5A 1PFBA 2ASBA 5ELEA 1EY8A 5IOCA 3M4YA 5G3LF 4JC0A 1I6HH 3TP6A 2VZAA 1YBYA 4TSSA 3S1MH 4X62Q 1A3TA 1PRTB 4IN3A 2JP1A 4XT1B 1XPRA 1HA5A 4KHVA 4U68A 1JB3A 2IT1A 4FF3A 2F0EA 4A3DG 4ZCKA 2B2UC 1R9TH 2E74C 1EQRA 3TSSA 2KCCA 1HPCA 3I90A 3GV6A 1B4OA 2KEEA 1AE3A 1EQQA 1U5KA 3E3XA 2R3ZA 5D65A 5IYDH 2ZJQA 4IFDJ 5M3FG 3HOXB 4QGUA 3QWNA 5CBAE 2NVQB 1Q82C 3KLRA 4LWCA 2N8NA 1PZKD 1FL0A 1XNRL 2F4VQ 3DUZA 1ICWA 1T9HA 3RLNA 3GTLB 2YYZA 1NUCA 3L2PA 3W5OA 1STBA 4GNXC 1Y1VB 2RDGA 4MTNA 4I7AA 4BBRB 1N32L 1NCVA 4FO2A 4H13C 2RDHA 3OMCA 2JK8A 2SDFA 5HGQA 1A63A 2Z1CA 1WTOA 1DD2A 1LYLA 1I4GA 4BBSB 4MN3A 3W2DA 1SJHD 4DR4L 1VQHA 1PDQA 4JBJA 4R4TA 4PV1C 3Q0AA 1OTCA 5LMUQ 4OX9L 4BWGB 2K04A 4DR2Q 1O7IA 1U4RA 3D4RA 5DEHA 1EEID 4RMFA 3CHBD 4ME5A 3M4QA 1WOCA 2A6ED 1SLJA 2B2YA 3S15B 1SJED 1XXGA 2NN6H 3M4PA 2Y0SG 3A5UA 1AE2A 1E0BA 3PSIA 1HXYD 2J7ZA 2QILA 4R8NA 1YHAA 2JA6H 1I50H 4GOPB 5C5MA 3TN2A 4A3LG 3ZYYX 1IBKQ 2EY1A 3A5ZB 3MXUA 4C3JG 5M3MH 5K36H 4HAEA 5IYBG 1PH1A 1CHPD 4DV4L 5JVG3 2EJMA 1AP0A 2AUJD 2ZTEA 3OPOA 4EX5A 1JWMD 3S9WA 3VYRA 1VQ4A 4JI6Q 2XGTA 4K2KA 3S14B 3CD6A 1BCPF 4F87A 1UUPA 2A69D 1G291 4WFN3 4GKKQ 3U9OA 1R4PB 2XVSA 1KC8C 1DCZA 3TRZA 1OXSC 4HJ8A 3D6CA 4KI0A 2F0IA 1UWVA 4GKJQ 2VQFL 1HUNA 2B63B 5C4XH 4KD3A 1KD1C 4UP9A 1TWAB 3PF5A 5DAUA 2EYJA 3V96A 1II3A 5D3IB 3ERQA 4X64Q 2K01A 3KLSA 3VYUA 1CA5A 3QOJA 5ELOA 1K73C 4L63B 4IALA 5KNDA 1PFNA 1KDBA 1B7YB 2BCOA 3R93A 4BY7G 1VCIA 4JYAL 1XTDA 1OXTA 2HDMA 1FYCA 4A3MG 1SDFA 4DR6L 1YNJC 5JJIA 1SYFA 2QCPX 5D14A 2WKDA 5T1IA 3RR5A 4K2LA 1M90C 1K8GA 3SGIA 4DV3Q 1W6KA 2IWHA 4YY3L 3I4NG 3MTSA 3WWVA 3J7ZC 2F0OA 3I70A 1E2VA 1FNVA 5ELCA 3N52A 3I7FA 3GTQB 3C1EA 3FMCA 4YY3Q 3D4WA 3M85A 1DONA 1ML0D 2UU9L 3M7GA 2F0QA 2NZHA 1V1QA 4DR7Q 1PZID 2YU9B 4A93H 5G3LD 1AN8A 2EOTA 1LT3D 1PHJA 1VQOA 3OWEB 3HS0C 4N8FA 3K5NA 4IO9A 1DZ1A 1YZ6A 3Q8DA 4C2MH 1HA6A 2K5NA 1KAWA 4JVZA 2CQAA 3J7A5 1EOVA 2V4DA 1IBMQ 1CHQD 3HOZB 3K80C 4CJ1B 2H5XA 4OGQC 1GJXA 1XMQL 2BH8A 1JWSD 4K5VA 3TREA 3CRLC 2X6LA 1C9OA 5E3FA 1TWFH 4ZLTF 2R93G 1TS2A 5C4ZA 2F0UA 4FVMA 5I6YA 5C0XJ 3BDOA 4LUOA 3DWPA 5C3XA 1N32Q 4P2CB 3K5OA 1BCPD 4A3IB 1XPUA 3S2HH 1HNWQ 1Q86C 4JI5Q 1LT6D 1WD0A 4XYOA 1E7ZA 4R4IA 4PMCA 4V0BA 4E6IA 1WJJA 1I4HA 2ZXOA 5E7NA 3MC0B 1UEAB 2VL6A 4DU9A 1CSPA 1GOZA 4JI8L 4ZKBB 1PH6A 3HKSA 3JAMc 3KFUA 4DUYQ 4RKBA 2E2DC 1H9MA 4KY7A 4XDXA 3KLWA 1OO9B 3OTOL 3EA6A 3EFXD 5IWAQ 1A62A 4L5RC 3OW2A 3RMHA 3TP8A 4NB3A 4IUUA 3NWTA 1SNPA 1U4LA 2Q8IB 5CC4A 3PIO3 4J6HA 2PQAB 1FNUA 1FNWA 5FO8B 5JAVA 4DR2L 1SE2A 1QVCA 2UUCQ 2B2WC 1KABA 2L12A 2OWOA 4ME3A 5FLMH 1IW7D 1LTRD 1Z6HA 4YWLA 1TIID 1PRTC 4R9WA 5EKLA 4JI3L 4TKOB 3H3VC 3TS2A 1SFOH 3AYHB 5L37A 1JR0D 1MSGA 2KA7A 3I55A 3RNUA 1HNXL 1DJRD 5CV5A 3A7AB 1KNAA 2JEAI 1X3EA 1F9QA 2FINB 2KOLA 1B3QA 1B53A 3J81c 1TWGH 2L11A 2YU9H 5HY6A 3TZDA 1H9JA 1NR2A 4LF4L 4RCOA 2UUBL 3NQTA 4AQYQ 1S40A 3MXNA 3HRZC 4K5XA 3T1HL 1N36Q 4JBKA 1I4PA 2K33A 4K8IA 5AJ3Q 2A19A 2F0MA 2Z6BA 4A3FG 1V43A 3TP5A 2YTYA 3KJOA 3ULJA 4BA1I 1O7LA 4P71A 4G7OC 4DUZL 2F4IA 4YWKA 3I8ZA 1LTLA 2Y0SE 4C3HB 1QVFA 1B3AA 4JI5L 4ZRZA 3SK4A 4KD4A 3NQIA 4C3HH 2HQLA 2YTVA 5KYIA 3G4SA 4DXFA 2A73B 3G71A 3R2IA 2Z8LA 1EQVA 2A74C 5IT9E 5JJLA 4DPGA 1JB7A 4DAYB 1EYGA 1SE3A 2EQSA 4N9TA 5FK9C 4IJLA 1VQAA 2I5LX 1PTOC 1HH2P 5JEAJ 1PTOB 5C4XG 5C44G 4YHHL 2Z0SA 1RHPA 1PVOA 1F77A 3KBXA 4IQZA 3T13A 1Y69U 2CWPA 2JXMB 1IHZA 1X3GA 1CFMA 1N34L 2A6HC 2MHVA 4HIMA 4HMIA 4BY1G 3SDZA 1NMFA 1SMYD 3BZCA 4ILWA 5E4XA 4ID6A 3GTJB 4B9WA 5FLMG 4K0KQ 3KF8A 4OWXB 3D31A 2R7ZG 5AFWA 1V9PA 2JA7G 1NBWA 1HR0L 3KF8B 1A15A 2VUMH 5DM63 4NPSA 5A2QE 3A0JA 4DK1A 2B39A 4GKJL 1KDAA 3U9SA 3STBC 1B8AA 4JW0A 5M5XH 4EQ5A 3K7AB 3LNNA 4QB4A 4LFBQ 1KLGD 3NK9A 4LF9L 2KCMA 4ZUJA 4A3GG 3FP9A 4HIKA 1N9WA 1TXYA 1Z7TA 1QVGA 1NMGA 1XNQL 3A8IE 3T51B 3BU2A 5I2XA 1C8CA 4L5QA 1XYIA 1XMQQ 1X9NA 5K5PA 1EWCA 1VQEA 2KHIA 3NEMA 1CKNB 4RCNA 4RGNA 5GAEC 3I4MG 3MWYW 3VA5A 5IP7H 2K5WA 1K3RA 4XYQA 3PIOA 4BY1B 5IY0A 3J81j 4KY6A 4PMBA 3L7ZC 2LKVA 1CA6A 4NXNL 3DM3A 4GOPA 4CKCA 2EYOA 3Q24A 1A0IA 3PO3G 4PZ8A 2CHBD 4R1JA 2L55A 2QA4A 1VQFA 1LTAD 3W3AA 2BE5D 1VS0A 2ICEC 1NTGA 1EWHA 1IKMA 1Y8OB 3HOVB 1OXXK 2HCCA 5CBEE 3S17B 5EKKA 4GS3A 1HFNA 1B70B 4JI3Q 1DOKA 5IT9c 2UUAL 3J7AF 4HSVA 1DXMA 1E2WA 3B6YA 1GUSA 4Q0FA 2AWOA 4LUZA 5IYDG 1SMYC 4A3BB 1VDZA 1YITA 3W1BA 3BZKA 5IYBH 1AZQA 1LACA 1RTNA 2WV6D 4HJ9A 2XWJB 5AJ3L 1QZGA 3AMUA 4C3JH 1K0SA 3M3YB 2QF7A 1BUVT 1TY0A 1QOHA 2L1BA 4C2MB 2QEJC 2F0HA 3K57A 1X65A 5LL6S 2BOSA 3I4NH 4A4IA 1HZCA 2HUGA 3EN2A 5C3EB 4OWTB 1FJGQ 1ET9A 4DV1Q 3ICEA 2WKCA 4XQJA 3UDXA 3S1MB 2KENA 2NVTB 2PZTA 3V05A 4BXXG 2KVMA 1D5MC 2PCFB 4DXGA 4R8IA 2WB1G 1LV9A 1E1OA 3CKIB 3N6RA 4IPCA 3JC66 4OXPA 3T1YL 2UUBQ 3CC2A 3PUXA 1XMOL 3CC4A 4A75A 3A8JE 4KMUC 2DY8A 3DXJC 4KJNA 4JI2Q 5IGCA 1BNZA 1STHA 5C5LA 1J8IA 1PH5A 1QE6A 2JEBI 2KEDA 4HTHA 4A3GB 1VQGA 2JA9A 5IP9G 3MZ5A 2D5DA 2WP8J 2NTTA 1WTHA 2EZVA 2B2TC 4L8JA 4JBMA 1YHBA 5J3BA 2WAQE 4DN4M 4OL7A 4YHHQ 1Q12A 1WI5A 5IGGA 1D5XC 1FVIA 1STEA 3AB9A 1FD7D 2I5HA 3WOFA 1N33L 4FP5D 4DAMA 1KIXA 3AU7A 4OIKA 3J81L 2WIIB 1CZGA 1DOLA 2QEXA 1SYGA 1SYBA 1SE8A 4X3KA 1YNJD 5FLXL 5EPKA 1O7ZA 1HNXQ 4JI1Q 2MFIA 2JSOA 2A69C 2FFKB 4O2DA 3L0OA 4GN5A 3QR8A 4GOPC 3U50C 1CTMA 1PYSB 3F1ZA 4YCUA 3SK5A 2F3IA 4ZK9B 1YJNA 1LUZA 5F2DA 2FJ2A 5E4WC 1JJGA 3GTOH 3K7UC 1L0WA 5ELNA 2N78A 2A6EC 2KHSA 1VQKA 3ULLA 4KN4C 3S1RB 4POGA 2VS1A 1VQPA 1ZKOA 4DV5Q 3HZXA 3MA2B 3HKZG 4DV0L 4JI7Q 3GDEA 2K5HA 2MO1A 1SNDA 3KOJA 4C56C 1DYQA 4DV5L 1XTCD 5EAYA 3HOYH 2RCNA 3UDIA 3I56A 3IFDA 1Y1VH 2NYZD 3W1GA 2MNAA 2R92B 1IXRA 2MJ8A 3NTIA 4B3SQ 4DV3L 1F9RA 2EJGC 2K05A 5C3EG 1A2UA 1TWFB 3FKIH 1EY6A 4EGVA 4GLXA 1JC7A 1RODA 1YI2A 2RA4A 2X69A 1LT4D 4TQUS 4ZUIA 1KTKA 3V2TA 4A3IH 2IL8A 1PH3A 2SEBD 2JA7H 1B9MA 3HOWB 4A3CH 2XWBB 1TT2A 1MI2A 2B2VA 2QDLA 4DR5L 4G7ZC 4K6LA 4RGTA 4RHSA 3DM1A 5CV8A 4DNIA 4NMZA 3H09A 1EFWA 1X32A 1YNND 1XNRQ 2F4VL 2CW0D 1YJWA 1EUJA 2EYMA 3J80L 2G9DA 1IBML 1RD9D 1EYDA 1S5ED 4KV6A 4DV7L 4UPAA 4GLAC 2NUCA 2L15A 1F2ZA 1CSQA 2JE6I 1SE4A 2IPKD 1EYCA 3RZOB 2Q2UA 1Q3LA 3FDTA 4H44C 1JQYD 3RN2A 1BOSA 1WTXA 3H94A 5JJKA 1C4QA 2CFMA 5E1FA 1YIJA 5J39A 3A8KE 1H9KA 1X3PA 3CU7A 2Z6KC 4MZ9A 2WAQG 4DV1L 4BXXH 1SBBB 1VQ6A 3FHWA 5GQOA 4A3KG 4WORA 1KAAA 3MVVA 3QO2A 1SSOA 5CYUA 1GKHA 1Y8PB 2IW3A 1HQRD 4A3GH 4A3IG 3K7AH 2GVAA 2NVXB 1J6QA 3M9BA 3SK6A 3GTMH 1CKMA 4KJOA 3STBD 1VQJA 1B9NA 5GAHC 2RHSB 2WACA 1KRTA 5KEEA 2KECA 1GUOA 3CRKC 1HTPA 2O2LD 2B8GA 3HEJA 3I2ZA 3GTMB 2K03A 3KK7A 3S16H 3HOUB 2R93H 5T1GA 4FF4A 1Z9FA 2B2WA 2ZTDA 3BVGA 3DHQA 3NP8A 4IZ8A 3J80E 1EY4A 2NVYB 4G7HC 1Y14B 2R7FA 4JI0Q 4JG2A 4DV4Q 2PI2A 4BY1H 3UDFA 2NTSA 1I6HB 3S1NH 1I4RA 3NBIA 1IBLQ 4KLKA 1Y1WB 2EYPA 3G7LA 3TBIB 1UAPA 1D1KA 1S3OA 2UXDL 2NZOA 5I2YA 2D9UA 1UE7A 5C44H 1K8AC 3FPPA 4BBRH 4KHPQ 1IL8A 4NXML 3PUZA 1ENFA 3SVMA 3HFZB 4GN3B 1F2YA 1CQVA 3S2DH 5IGDA 3E9HA 5IYCH 1F9PA 1R4QB 1EIYB 1TR5A 3TDQA 4RG1A 3ER0A 4J1MA 5IT9L 5I6WA 4XXEA 1QUQA 1MIUA 4QIWB 1TS3A 2YV5A 4LMQD 2FHTA 2IHEA 4HCEA 1PFMA 2PZWA 4QIWE 3C2PA 1Q8IA 1LO5D 2F03A 1BXTA 1YJ9A 2BA0A 5EBCA 4P72A 3MHBA 3JAML 2RCFA 3HP3A 3KBGA 5JPNC 4DR1L 5IP9H 4FF1A 3S14H 2KJXA 1EZ6A 5I9PA 3FKIG 2K14A 1OXUA 3GTKH 3SXHA 1SRUA 5C3EH 1ZXTA 5GAGC 3K0XA 3T4AC 5DM73 1L0XB 2JN4A 3D8GA 1D2BA 5LL6X 2K4KA 3ONAB 1JOQA 1E3PA 1A3VA 4DUYL 4NP5A 2F0TA 4CJ0B 1ASYA 2LXKA 4LW1A 4OEMB 1RDPD 5ELDA 3CPFA 4FXDA 4NKLA 4A3KH 1PA6A 4LF5Q 3KYHC 3MXNB 4JPBW 1GO3E 3EBEA 3RUZA 4DFAA 4JI7L 2N55A 2FXQA 4FDBA 4BBSG 2VB3X 1A8VA 5EGTA 2GN5A 1XJVA 3ITPA 4AYBB 4KY5A 2PPBC 2MUYA 4G57A 1B2TA 3EQLC 1B44D 5A35A 3F2CA 3A74A 3PCOB 1PZJD 1QB5D 1VQBA 1TS5A 1AEXA 3GP7A 1BF4A 4PG3A 1QUQB 3GTLH 1KL9A 3T16A 1Z47A 1F2MA 4EQNA 5M3MB 2EXZA 1IYJB 4J8QA 4M1UB 2IX1A 2JA8G 2GVBA 4JI1L 2P5ZX 2UU9Q 3HG9A 3QJYA 4JBWA 3HOXG 1T5EA 5KYLA 4HEDA 3FPUB 1IZ6A 1R9TB 3C46A 4ZKCB 2EIFA 4QL5A 2NN6I 1YHQA 4PQXA 4JV5L 3J81E 2CW0C 2JA6B 1LABA 1NR4A 1WFQA 4C1NI 1EU3A 1K83H 2HT1A 2KCTA 4A3JG 5EPLA 1OXVA 1VQDA 4IOAA 3LWEA 3VDYA 1K9MC 4J15A 2R93B 4DR4Q 2DY7A 4DK3C 1QILA 3NUCA 4BS9A 2N3SA 4OX9Q 3URYA 3Q6SA 3EROA 1FGUA 1SR3A 4AYBE 3D3RA 4H02A 5CMDA 3SHLA 1WCMH 1STYA 1CZWA 4DAPA 4Y7NH 2K50A 1Q1EA 1PFSA 1NSNS 5IE8A 2SNMA 2AKWB 2HIVA 1H9RA 4DAVA 1WYDA 3KDFB 2UUCL 4CKEA 3I4MB 3A54A 3DWQA 4CGYB 2VQEQ 3PO2G 3NELA 1HNZQ 2R92H 5H1SE 1EQTA 1N33Q 1QNUA 1TWCB 4X3UA 5IWAL 3H0GG 4IUTA 1GUTA 4O1NA 3OIPA 1KDCA 4DR7L 1GHKA 5JJZA 2KHJA 3CCLA 2BE5C 5FKAC 5C4JH 3IL8A 3JAME 2Z4HA 1NY4A 1MSHA 4EQOA 1X55A 3HOWG 4OONA 5DLQE 4QY7A 4AQYL 4A3DB 1MKHA 4JI0L 4O0AA 2CCZA 3NWSA 4P74A 2H4OA 2RVLA 4X65Q 1VQ8A 3GTPB 4KHZA 3OWFA 4K0KL 4K6DA 4HJ7A 2Z4IA 4R4CA 5JEAH 5CV7A 3Q23A 4AYBG 1KRSA 3D0FA 3GQBA 1SAPA 2B2YC 4OO1I 4DKAC 3TS0A 3KF6B 1K8OA 2JA5B 1EY9A 4IPGA 2F0FA 1ENAA 4LF8L 2E2IB 1NNXA 3K5LA 2RSOA 2C5CA 3BJUA 1IKLA 1TQOA 1GUWA 1GD7A 1K8MA 2K5DA 2L5TA 5CR3A 1UNSA 2ZJRA 5LMNQ 2UXBQ 3S1QH 4N8X1 3CAMA 3AEVA 4TVAB 4AH6A 2Q2TA 3BDCA 4CDEC 3J7AV 3ND8A 2UXBL 4C3IH 2AUKA 4F88A 3I3CA 3CXCA 2B2TA 1C0AA 1JMCA 4JOIA 1PH4A 2F1MA 4GNXA 2SOBA 5IGFA 3X3NA 1LTTD 3AFQA 2F0GA 4KN7C 4QUFA 3NBHB 2C35B 3I73A 2E5LL 5JVH3 1WD1A 1G51A 1P16A 1PYBA 3IFTA 2E5LQ 4CDFC 4U673 2ZM6Q 3RZDH 2XN9C 2VUMG 5C0XI 1QZHA 1EYAA 4LK1C 2LS01 5BR8Q 3K8AA 4H0LC 2R7ZH 3CQZH 1EWIA 1TU2B 3L9AX 1PRTD 4ZAIA 1BCPB 2CQOA 1HZ9A 1SMXA 4F7XA 2O5IC 2R7ZB 2B29A 2NN6G 1KQSA 2AMCB 3H0GH 3CMEA 4P73A 3BVMA 1SROA 4BBSH 3RLOA 5KIXA 2ENBA 1BVSA 4RKLA 2PQAA 1IYUA 1WTWA 5NUCA 2PZUA 2XNAC 1STNA 1VQ9A 3BZDB 4C3IG 2JQOA 4B9XA 3M4OH 5C0XH 1GHJA 4DAYA 1TKWB 4A3MB 1K28A 5FOBB 2NVQH 4FNFA 4LFBL 3I91A 1PTOF 2RKSA 2OTJA 1PTOH 4JI4L 2G9HD 1S5BD 1CUKA 3PUVA 2BDNA 4HIDA 1TWHH 4WRDA 1SN8A 3I4NB 4ODGA 4RH6A 3K59A 5FJ8G 2E2HB 1L2FA 2ZTCA 4HJ5A 4XQNA 4MIUA 1HFGA 3OTOQ 2KBNA 3R3OA 2JA5G 4A76A 3NE5B 1H9SA 5GROA 1T5XD 2HQEA 2E76C 1G2SA 2LSSA 4B3TL 2BH2A 2XSCA 3FKIB 4CKBA 2WINB 4A3FH 1E2ZA 4RAUC 1RL2A 5M3FB 3AFPA 3I72A 1RKNA 1GUNA 4C3IB 3HOWH 2YTXA 1S5CD 4LF6L 4ABNA 3OMGA 1EU4A 1G6PA 1S5DD 2D0PA 4AIMA 4A3KB 4OIJA 3NXWA 1I94L 1E22A 1M4VA 1XWEA 5C6AA 1S72A 1TWGB 1GUGA 4I7ZC 2EYFA 1I94Q 3CC7A 3CCQA 1PH7A 4A3EG 1Q7YC 1D8LA 2UXDQ 2HD3A 3UE0A 2PYKA 4XTCS 4LNQA 4A3EH 2EE1A 2KQ3A 1VQNA 5CGKA 4APVA 2A68C 1J5EL 1Y1WH 1D7QA 1WVLA 3OOCA 2IX0A 3EIVA 2EYHA 4KKUA 4POFA 1J9OA 2OXPA 2V1CC 3E9IA 4GLVB 3R8BA 1XNQQ 3BG3A 1MJEA 4X65L 4DK6C 5EKIA 1X3QA 3DEOA 4CJ2C 1SNOA 1VQLA 4B3ML 1U9RA 4HN7A 2ALYB 1N36L 4MTKA 1Q90A 3VYTA 2DGYA 1BO0A 3I4LA 2DNCA 3QG1A 3OYYA 4KKSA 2HHHL 1CQFA 5CORA 4DF7A 4R4QA 1WTQA 5FJ8H 1U4PA 3P7JA 2G5DA 1RIPA 3OIQA 1P8LA 3CMAA 3U4ZA 3A7LA 4UHVA 1I6VC 1Q81C 4F8MA 3KLSX 1AH9A 5LHY1 2QGQA 4Z9CB 1WTRA 1O80A 4QJFA 5BR8L 3MXPA 1QJOA 1SXTA 1HTLD 5M5WB 1JE5A 1B50A 2VY3A 4RA8A 1Y1WG 3CCEA 4FYDA 2NZ1D 1C48A 1U4MA 3SK8A 3FEWX 5FO7B 3F2UA 2GA4B 4M8AA 2R92G 3S2HB 3MAQA 1X54A 2BA1A 2AQ1B 3PO2H 1ESRA 1JCKB 4G4KA 4S3SA 2PNRC 2QKIC 3NPPA 1L1OA 1VQ5A 2VXWA 2CKZB 4OELB 4A93G 3HOVG 1WCMG 5I9OA 1V8QA 3RD4A 5K36G 1L1OB 3QB3A 3F2BA 3IRBA 2XRQD 1H9SB 1ICFB 2O4XA 1AZPA 4N9PA 4QF4A 3KUPA 3TEHB 2IX3A 1BBXC 4FF2A 2NBFA 3MFGA 4A3JH 3HOYG 2A5HA 4DR3Q 3NENA 1HRJA 1I4QA 1Q1BA 3T1YQ 2VB2X 2NVYH 5LMUL 2WB1E 4GN4B 3VR3A 1XMOQ 4OWWB 3IKJA 3D6WA 2D2CC 2E2IH 4QUCA 2JA5H 3DMUA 1E1TA 3S1NB 4A3FB 4CBVA 1LM0A 4DV6L 1WTPA 5CV9A 4IPHA 3UDGA 3GTKB 4IJHA 3OSOA 1JICA 1D5ZC 3S24A 1BKBA 3ERSX 4DV6Q 5TSSA 5IGBA 4B3SL 4YCWA 3K81C 5CV4A 1HCZA 4IUQA 3H6MA 3AQQA 4DNTB 4X3TA 2C9OA 3BYTB 2CWAA 2E2JB 3PO3B 2XIWA 2PNHA 2RQXA 4LFAQ 3M3YH 1RTOA 4ALPA 3SE0A 4WJWA 5C4HA 3A55A 4K8JA 4NXMQ 2DJFC 4IPDA 5J22A 2D62A 4GZYC 4HR7B 4X64L 3MFYA 1W2BA 1EFID 4IFDI 2I07B 1QG7A 2CVRA 2MO0A 4B3RQ 4DV7Q 1DGSA 4LF8Q 2NVTH 1SEBD 5M3MG 2B8FA 3H91A 3KF6A 4UP8A 3MEHA 1GM5A 5C4JB 1YVCA 1PH9A 1EIHA 3S2DB 4CDCC 1ZEQX 2RDFA 2RBMA 4IURA 4A3LH 3ND9A 1SYCA 2Y0SB 3PGZA 2JA7B 3DLLA 1HHVA 1V1PA 2VW9A 4DV2L 3K6OA 4A3DH 2JA6G 4UP7A 4NW2A 1VMPA 1JOOA 2FMMA 1GVPA 4UDUC 3SR1A 3VR6A 5JOBA 1LTSD 4C3JB 2AHOB 4BY7B 4DR1Q 2H1EA 1ET6A 4V190 1STAA 1EIGA 4A3MH 1IL2A 1K3BC 2PO4A 3GD7A 4BY7H 2TMPA 4L5TA 1IBLL 3RZOH 1CKNA 4IFDG 4L5SA 1XX8A 1NE3A 1V1OA 1I5FA 2DNEA 1PXUA 1LTBD 3E0JA 3VR2A 4UAIA 4IUPA 1HZBA 2F0DA 2LFNA 4X62L 4DR5Q 2RF4A 2JYOA 2K28A 4KTAA 1X3FA 4X66L 1KLUD 4X3SA 3UE1A 1EL0A 1EEFD 1G2TA 1VQMA 3PMFA 3HOZG 3CCSA 4PZ7A 1HR0Q 5M3FH 3HOXH 3CCMA 1RJTA 3GTOB 4LFAL 2L4NA 1JT8A 5ISRA 1NJIC 2PW7A 2RSNA 3KDFA 4LJZC 3U4VA 2ICIA 2AQ3B 2KUMA 3CCUA 3TQYA 2UXCQ 1BBUA 4CDDC 2MP1A 2PW5A 1PLFA 3X3MA 1Y1VG 1PYWD 4HIOA 4KHPL 1ESFA 3BYYB 3FRPB 4Y7NB 3VYSA 4A3EB 3BVZA 4RHRA 3D4DA 3GTJH 2PMZB 3JAMi 3CP0A 1HQMC 5IGEA 3CQZB 5IP7G 1EY7A 2DUDA 2Z9HA 4JOIC 4LF9Q 2ZXRA 2AWNA 5KGUA 3E0EA 2PMZE 2PQEA 1HUMA 3CF5A 2ES2A 2QW7A 5IODA 4BA2I 3WOEA 5M5YH 2BDOA 4B08A 1QWYA 5C4XB 4XIGS 3WDNA 3GTQH 1F9SA 1ONLA 5CV6A 3DEPA 4PNYA 1HNWL 4TRDA 4PZ6A 4ZYSA 3H3VH 3IAYA 4A93B 1VF5C 1FR3A 2HCIA 3T56B 1SNQA 2OQ0A 2QDBA 2R7DA 3KJPA 1HNZL 3EVQA 1L0YB 1QCBD 2L0CA 4LF5L 2K1BA 3MEFA 1K0RA 3P1HA 1H95A 3HOYB 3H3VI 1TWHB 5JEAG 3HOZH 3CCJA 3NTKA 3CCRA 4IUVA 3I4OA 2ZT9C 1LTGD 3GTGB 1PH2A 4DGZA 1NAPA 3P75A 4P75A 3RZDB 1JOKA 3PUYA 2B3GA 4YCVA 1JJ2A 2F0WA 5A2QL 1SNCA 2MQHA 4ULLA 2OTLA 1C7YA 1Q8KA 1G6ZA 4NDXA 1KHIA 3S17H 5IIFA 5D3DA 4Q5VA 2LMCB 4LFCQ 2B63H 3J80i 4GNXB 1FJGL 1ILQA 3OW7A 3H0GB 5BN5A 1YNNC 3SEBA 2J0TD 5M9OA 4B3MQ 3VR4A 4IUNA 3L3OC 1UE1A 2O5JC 1G8ZD 2HDLA 2NVXH 3LGJA 3P20A 1KXLA 2EDGA 3F2DA 1J5EQ 3PIPA 2UXCL 3PV0A 3PUWA 1UE5A 3MXGA 3NHHA 5LMNW 3PIP3 1LT5D 4JI2L 1CT1D 2JJQA 4K14A 1D6EC 1AFPA 4MHEA 4JI8Q 3GO5A 3U58A 1W6JA 1CKOA 2A8VA 4XQQA 3C1FA 2R6GA 1CM9A 3H15A 2WFWA 1X6OA 1XPOA 4IOCA 2K75A 5HGTA 4PMWA 5I4DA 1FGBD 4DUZQ 1JORA 1B1ZA 5C44B 4A3BG 2EY6A 3TMEA 4OO1H 3HOVH 2OT2A 4DK0A 3HOUG 2XTIA 1PH8A 4LF6Q 1E24A 2VQEL 5M5YB 1VMCA 1SNMA 2XRSD 5EQ0A 1UE6A 4UY8C 3TZUA 4KKTA 2F0SA 4X66Q 2EPBA 3NBHA 1HJPA 2F3WA 1ZYRD 3CCVA 4JI6L 1BQQT 2X6GA 1BDOA 1N34Q 1SYEA 2JA8H 2EY5A 2L9HA 2OEOA 3F8TA 3DWAA 1K83B 1RF2D 3S16B 1O78A 3M4OB 3PO3H 4RFBA 2M9VA 4KK7A 4O42A 1PTOD 2MPMA 4ZQ3A 1MJCA 1VQIA 4RGMA 1O7YA 2Q8TA 2A68D 4Y52H 2LY7A 3E5SA 5M5WH 2WB1B 4DNRB 1ILPA 4JV5Q 3ZJYC 3J7YW 5EJWA 3I4MH 3FVQA 1I3QB 4EVOA 3G48A 1SFOB 3PF4A 3LX0A 3K0YA 3Q22A 2EJFC 1BCPC 1TWCH 2K6AA 2J4XA 4DV2Q 1G91A 4YWMA 4DR6Q 1LLRD 5EPJA 4MNOA 1STGA 2K5QA 3O13A 3RLFA 2F0VA 4OO1G 1MD2D 2HHHQ 2DJGC 2VNUD 4JI4Q 3ULPA 1HZAA 4DV0Q 1ASZA 4HMJA 1TVXA 5HURA 5LMNL
chains in the Genus database with same CATH topology
2HHHL 5GAHC 3JAMc 3KFUA 4DUYQ 2RHSB 4R4QA 1KRTA 1HR0W 3I2ZA 5FJ8H 4WJ3M 3KLWA 3G6EA 3CMAA 1RIPA 1P8LA 3OTOL 3S16H 4JYAQ 2R93H 3U4ZA 5IWAQ 1Z9FA 2EXDA 1A62A 2ZTDA 2UUAQ 5GADC 3OW2A 1Q81C 4L5RC 1AH9A 2QGQA 1Y14B 4NB3A 2R7FA 5FLXc 4JI0Q 4JG2A 4DV4Q 1YNXA 2PI2A 4QJFA 5BR8L 4BY1H 3UDFA 3J81i 1U0LA 3S1NH 1IBLQ 2PQAB 4KLKA 1JE5A 4LUVA 4DR2L 1QVCA 1L1OC 2UUCQ 2VY3A 1S3OA 2OWOA 4ME3A 2UXDL 2NZOA 5FLMH 2ZJPA 2A1AA 2LXJA 4YWLA 1Y1WG 1UE7A 5C44H 3HKZE 1K8AC 4NXNQ 3CCEA 4BBRH 4KHPQ 4JI3L 4NXML 2HIXA 3TS2A 1W3SA 3PUZA 1SFOH 3AYHB 2R92G 2B63G 3HFZB 4GN3B 3S2DH 1X54A 3E9HA 4QQBX 5IYCH 2BA1A 3I55A 4HJAA 3RNUA 1HNXL 1EIYB 3PO2H 1TWAH 4LFCL 2JEAI 4RG1A 3ER0A 1X3EA 4LF7Q 1L1OA 1YEZA 1VQ5A 2IY5B 2Q2HA 3J81c 1TWGH 1QUQA 1MIUA 2CKZB 5HY6A 2YU9H 4A93G 2YV5A 4LF4L 3HOVG 1WCMG 2E2JH 2UUBL 4AQYQ 2IHEA 1S40A 5K36G 1L1OB 2I5MX 2Z6KA 3IRBA 3F2BA 1PV4A 3J80c 1N36Q 3T1HL 4JBKA 4QIWE 4B3RL 4LF4Q 4DR3L 3TEHB 5AJ3Q 2OQKA 2A19A 1VQCA 4A3JH 4A3FG 1YJ9A 1V43A 1N8RC 2BA0A 3HOUH 4A3CG 4WJ4A 2YTYA 3HOYG 4DR3Q 3NENA 3KJOA 4P72A 1Q1BA 3ULJA 3T1YQ 4BA1I 2NVYH 5LMUL 2WB1E 4GN4B 1XMOQ 4OWWB 4DR1L 4P71A 5IP9H 4DUZL 3S14H 2E2IH 4YWKA 3FKIG 2JA5H 2K14A 1OXUA 3GTKH 1LTLA 1SRUA 2Y0SE 5C3EH 1E1TA 4JCVE 5GAGC 1QVFA 3K0XA 4JI5L 1LM0A 4DV6L 2K4KA 4IPHA 3UDGA 2N49A 4IJHA 4C3HH 1E3PA 2HQLA 4DUYL 2YTVA 3S24A 1BKBA 5C0XG 3G4SA 3ERSX 2F52A 1ASYA 4DV6Q 2LXKA 3G71A 1EIFA 4LW1A 4B3SL 3CPFA 4YCWA 4A3KH 1PA6A 4LF5Q 3KYHC 3K81C 3MXNB 5JJLA 2IHFA 1GO3E 3EBEA 4DPGA 1JB7A 4DAYB 1EYGA 2EQSA 4JI7L 2FXQA 4FDBA 4IJLA 4BBSG 1A8VA 3AQQA 1VQAA 2I5LX 2GN5A 1HH2P 1XJVA 3RN5A 2ZM6L 2E8GA 4GKKL 5JEAJ 5C4XG 2CWAA 5C44G 4YHHL 1IBKL 2Z0SA 2PNHA 1PVOA 3S15H 4LFAQ 3M3YH 3CPWA 5IYCG 4ALPA 2CWPA 3F2CA 2ID0A 3A74A 2HT1A 3PCOB 1X3GA 3S1RH 2E2HH 1N34L 4B3TQ 3CW2C 1BBWA 4HIMA 1VQBA 4NXMQ 4BBRG 4IPDA 4PG3A 4BY1G 1NMFA 1I3QH 3BZCA 2D62A 1QUQB 2Q2IA 2ATWA 1X56A 4X64L 3GTLH 1KL9A 5FLMG 1Z47A 4K0KQ 4R4OA 1W2BA 4IFDI 1IYJB 4OWXB 3D31A 2R7ZG 2IX1A 2JA8G 2GVBA 4JI1L 2MO0A 1V9PA 4B3RQ 2UU9Q 4DV7Q 2JA7G 3HOXG 4JBWA 1NBWA 1DGSA 1HR0L 4LF8Q 3GTGH 2NVTH 3KF8B 5M3MG 2VUMH 3KF6A 1Q46A 1IZ6A 4UP8A 4NPSA 1GM5A 1YVCA 1PH9A 3A0JA 2EIFA 2RHQB 4QL5A 2NN6I 4GKJL 1YHQA 4X6AH 4JV5L 3STBC 1B8AA 4A3LH 5M5XH 4EQ5A 2K5VA 3PGZA 4LF7L 4A3BH 4LFBQ 3DLLA 2VW9A 1WFQA 4DV2L 2K52A 2KCMA 4LF9L 4A3DH 2JA6G 4A3GG 4UP7A 3FP9A 2PI2E 1K83H 1GVPA 2KCTA 4A3JG 2D0OA 1N9WA 4HIKA 1OXVA 1TXYA 1VQDA 1QVGA 1NMGA 3CC2A 1XNQL 4IOAA 3VDYA 1K9MC 3GTPH 3T1HQ 4J15A 1VQ7A 3M7NA 3BU2A 2VQFQ 4L5QA 4DR4Q 4DK3C 1XMQQ 1UEBA 2AHOB 1M1KC 2N3SA 4DR1Q 1X9NA 1JJCB 2OCEA 2I0QA 4A3MH 1FGUA 1SR3A 1VQEA 2KHIA 3NEMA 1CKNB 4H02A 4AYBE 1WCMH 5GAEC 2ASBA 3GD7A 4Y7NH 3I4MG 2K50A 1Q1EA 5IP7H 4BY7H 1PFSA 4JC0A 5IE8A 4L5TA 1IBLL 3RZOH 1CKNA 4IFDG 4L5SA 1K3RA 2AKWB 3PIOA 2HIVA 1I6HH 5IY0A 1WYDA 2VZAA 3KDFB 3J81j 1YBYA 2UUCL 1NE3A 2VQEQ 3S1MH 3PO2G 3NELA 1HNZQ 4X62Q 3L7ZC 1XPRA 4NXNL 1I5FA 3DM3A 4GOPA 5H1SE 2R92H 1N33Q 5IWAL 3H0GG 1A0IA 1HZBA 3PO3G 2IT1A 4PZ8A 4X62L 4DR5Q 4DR7L 4R1JA 2RF4A 2QA4A 1VQFA 4A3DG 1VS0A 1X3FA 2KHJA 3CCLA 1NTGA 4X66L 1R9TH 1EQRA 5C4JH 3UE1A 1OXXK 1NY4A 1VQMA 4GS3A 1B70B 4JI3Q 5IT9c 1X55A 3HOZG 2UUAL 3HOWG 4OONA 3CCSA 5DLQE 1AE3A 4QY7A 4PZ7A 3B6YA 4AQYL 1MKHA 5M3FH 1HR0Q 2AWOA 4LUZA 5IYDG 3HOXH 1EQQA 4O0AA 3CCMA 4JI0L 1U5KA 2CCZA 4P74A 1YITA 3W1BA 4X65Q 1VQ8A 3BZKA 5IYBH 4LFAL 4HJ9A 2ZJQA 4KHZA 4IFDJ 5M3FG 5AJ3L 1NJIC 5IYDH 1JT8A 1QZGA 4HJ7A 3KDFA 3U4VA 4K0KL 4R4CA 4C3JH 4QGUA 3CCUA 3TQYA 1Q82C 4LWCA 2UXCQ 1BBUA 2N8NA 1KRSA 4AYBG 3D0FA 1FL0A 1XNRL 2F4VQ 4OO1I 4DKAC 3TS0A 3KF6B 1Y1VG 4HIOA 4KHPL 1X65A 3I4NH 4A4IA 1T9HA 3RLNA 1HZCA 3EN2A 4IPGA 3GTJH 2YYZA 3JAMi 4LF8L 4OWTB 3L2PA 1FJGQ 3W5OA 3CP0A 4DV1Q 4GNXC 4MTNA 3ICEA 5IP7G 2DUDA 4JOIC 1N32L 4LF9Q 3BJUA 3UDXA 2AWNA 2KENA 3E0EA 2PMZE 2JK8A 5HGQA 4BXXG 3CF5A 1A63A 1GD7A 2ZJRA 2ES2A 2UXBQ 5LMNQ 1LYLA 3S1QH 3CAMA 2WB1G 4BA2I 1E1OA 5M5YH 4DR4L 1VQHA 3JC66 4IPCA 4JBJA 4OXPA 4R4TA 4TVAB 4AH6A 3T1YL 1OTCA 5LMUQ 3PUXA 2Q2TA 4OX9L 1XMOL 2UXBL 4XIGS 3CC4A 4C3IH 4DR2Q 4A75A 3GTQH 4JI2Q 1O7IA 3CXCA 1HNWL 4PZ6A 4RMFA 1PH5A 1C0AA 1JMCA 3H3VH 3M4QA 1WOCA 2JEBI 1SLJA 4JOIA 1PH4A 1VQGA 4GNXA 2JA9A 2OQ0A 5IP9G 2R7DA 3KJPA 2WP8J 3M4PA 2Y0SG 3A5UA 1AE2A 1HNZL 3PSIA 2JA6H 1YHAA 3AFQA 1I50H 4JBMA 4GOPB 3NBHB 2C35B 1YHBA 2E5LL 4LF5L 3MEFA 1K0RA 1H95A 5J3BA 4A3LG 2WAQE 1G51A 3H3VI 4YHHQ 1IBKQ 1P16A 3A5ZB 1PYBA 1Q12A 1WI5A 1FVIA 5JEAG 2E5LQ 2I5HA 1N33L 2ZM6Q 3HOZH 3RZDH 3CCJA 4DAMA 5M3MH 5C0XI 1KIXA 2VUMG 1QZHA 3CCRA 3I4OA 1PH2A 5IYBG 1PH1A 4DV4L 2ZTEA 3K8AA 4P75A 5BR8Q 2R7ZH 3PUYA 3CQZH 4EX5A 2B3GA 2QEXA 1EWIA 4YCVA 1N32Q 1SE8A 2CQOA 1VQ4A 2XGTA 1JJ2A 4JI6Q 1HZ9A 1SMXA 3CD6A 2MQHA 2OTLA 1C7YA 2B29A 1Q8KA 2NN6G 1HNXQ 4JI1Q 1G291 2AMCB 1KHIA 2MFIA 3H0GH 4P73A 3CMEA 1KQSA 4O2DA 4GKKQ 3L0OA 3S17H 4GN5A 1KC8C 1SROA 4LFCQ 3TRZA 4GOPC 2B63H 3U50C 3J80i 4GNXB 1FJGL 3RLOA 1OXSC 4BBSH 4HJ8A 1PYSB 3F1ZA 4YCUA 1BVSA 2F3IA 2PQAA 4KI0A 1YJNA 1UWVA 4GKJQ 2VQFL 1LUZA 1VQ9A 4B3MQ 5C4XH 2JQOA 1KD1C 1JJGA 3GTOH 1UE1A 3K7UC 4UP9A 1L0WA 3PF5A 2NVXH 3LGJA 5ELNA 1KXLA 2N78A 3M4OH 3F2DA 1J5EQ 3PIPA 2UXCL 3PV0A 3PUWA 4X64Q 1UE5A 1VQKA 3ULLA 5LMNW 2NVQH 5ELOA 1K73C 4POGA 4LFBL 2VS1A 1VQPA 4JI2L 3AEVA 2OTJA 2JJQA 4DV5Q 4JI4L 1B7YB 3HKZG 4DV0L 4BY7G 4JI7Q 3GDEA 2K5HA 4JI8Q 1CUKA 1VCIA 2MO1A 3GO5A 3PUVA 3KOJA 1TWHH 1CKOA 1XTDA 1OXTA 4HIDA 4JYAL 1SN8A 4DV5L 4A3MG 2A8VA 5EAYA 4DR6L 3HOYH 2RCNA 3U58A 3UDIA 3I56A 5JJIA 2R6GA 1Y1VH 3W1GA 5FJ8G 3H15A 1L2FA 2MNAA 2ZTCA 1IXRA 2WFWA 4HJ5A 4B3SQ 1X6OA 5C3EG 4DV3L 1XPOA 3OTOQ 2K75A 2KBNA 4IOCA 3FKIH 2JA5G 4A76A 5GROA 4GLXA 4PMWA 3RR5A 1YI2A 1M90C 1K8GA 3SGIA 2LSSA 4DUZQ 4DV3Q 4TQUS 4B3TL 4A3IH 2BH2A 4YY3L 1PH3A 3I4NG 3WWVA 3J7ZC 4A3BG 2JA7H 3HOVH 3HOUG 2XTIA 4A3FH 4A3CH 1PH8A 4LF6Q 1E24A 1RL2A 3I7FA 2VQEL 4YY3Q 3M85A 3AFPA 1UE6A 4UY8C 4X66Q 3HOWH 2YTXA 1HJPA 2UU9L 4LF6L 3CCVA 2NZHA 4JI6L 1V1QA 1G6PA 4DR5L 2D0PA 4AIMA 4DR7Q 1N34Q 2UUBQ 4A93H 2JA8H 4DNIA 1I94L 1E22A 1S72A 3F8TA 1EFWA 1PHJA 1VQOA 1XNRQ 4OX9Q 2F4VL 1YJWA 1EUJA 3PO3H 1I94Q 1IBML 3CC7A 3CCQA 4IO9A 1PH7A 4A3EG 4DV7L 1Q7YC 1YZ6A 1D8LA 2UXDQ 4UPAA 3UE0A 3Q8DA 4GLAC 4C2MH 1MJCA 2K5NA 1VQIA 1KAWA 2L15A 4XTCS 4LNQA 4A3EH 3J7A5 1CSQA 1EOVA 2JE6I 1IBMQ 1VQNA 3K80C 4Y52H 4APVA 1J5EL 5M5WH 1Y1WH 2H5XA 1D7QA 4JV5Q 1XMQL 2Q2UA 2BH8A 1IL2A 2IX0A 3ZJYC 3TREA 3RN2A 3EIVA 1C9OA 3I4MH 5JJKA 4POFA 2CFMA 1YIJA 1TWFH 3G48A 2R93G 3PF4A 3E9IA 2V1CC 2Z6KC 4MZ9A 2WAQG 4DV1L 4GLVB 5C0XJ 4BXXH 1XNQQ 1TWCH 4LUOA 1VQ6A 3FHWA 5GQOA 4X65L 4A3KG 4DK6C 4DV2Q 1MJEA 1XPUA 3S2HH 4YWMA 4DR6Q 1HNWQ 1Q86C 4B3ML 4JI5Q 1VQLA 4MNOA 3RLFA 1GKHA 1E7ZA 4R4IA 2ALYB 4OO1G 1N36L 4A3GH 1WJJA 4A3IG 2HHHQ 3K7AH 2VNUD 5E7NA 4JI4Q 3ULPA 1HZAA 2DGYA 2GVAA 2VL6A 4DV0Q 1ASZA 1CSPA 1J6QA 3M9BA 4JI8L 3GTMH 3OYYA 1CKMA 1PH6A 3STBD 5LMNL 1VQJA 3HKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH L;  5GAH C;  3JAM c;  3KFU A;  4DUY Q;  2RHS B;  4R4Q A;  1KRT A;  1HR0 W;  3I2Z A;  5FJ8 H;  4WJ3 M;  3KLW A;  3G6E A;  3CMA A;  1RIP A;  1P8L A;  3OTO L;  3S16 H;  4JYA Q;  2R93 H;  3U4Z A;  5IWA Q;  1Z9F A;  2EXD A;  1A62 A;  2ZTD A;  2UUA Q;  5GAD C;  3OW2 A;  1Q81 C;  4L5R C;  1AH9 A;  2QGQ A;  1Y14 B;  4NB3 A;  2R7F A;  5FLX c;  4JI0 Q;  4JG2 A;  4DV4 Q;  1YNX A;  2PI2 A;  4QJF A;  5BR8 L;  4BY1 H;  3UDF A;  3J81 i;  1U0L A;  3S1N H;  1IBL Q;  2PQA B;  4KLK A;  1JE5 A;  4LUV A;  4DR2 L;  1QVC A;  1L1O C;  2UUC Q;  2VY3 A;  1S3O A;  2OWO A;  4ME3 A;  2UXD L;  2NZO A;  5FLM H;  2ZJP A;  2A1A A;  2LXJ A;  4YWL A;  1Y1W G;  1UE7 A;  5C44 H;  3HKZ E;  1K8A C;  4NXN Q;  3CCE A;  4BBR H;  4KHP Q;  4JI3 L;  4NXM L;  2HIX A;  3TS2 A;  1W3S A;  3PUZ A;  1SFO H;  3AYH B;  2R92 G;  2B63 G;  3HFZ B;  4GN3 B;  3S2D H;  1X54 A;  3E9H A;  4QQB X;  5IYC H;  2BA1 A;  3I55 A;  4HJA A;  3RNU A;  1HNX L;  1EIY B;  3PO2 H;  1TWA H;  4LFC L;  2JEA I;  4RG1 A;  3ER0 A;  1X3E A;  4LF7 Q;  1L1O A;  1YEZ A;  1VQ5 A;  2IY5 B;  2Q2H A;  3J81 c;  1TWG H;  1QUQ A;  1MIU A;  2CKZ B;  5HY6 A;  2YU9 H;  4A93 G;  2YV5 A;  4LF4 L;  3HOV G;  1WCM G;  2E2J H;  2UUB L;  4AQY Q;  2IHE A;  1S40 A;  5K36 G;  1L1O B;  2I5M X;  2Z6K A;  3IRB A;  3F2B A;  1PV4 A;  3J80 c;  1N36 Q;  3T1H L;  4JBK A;  4QIW E;  4B3R L;  4LF4 Q;  4DR3 L;  3TEH B;  5AJ3 Q;  2OQK A;  2A19 A;  1VQC A;  4A3J H;  4A3F G;  1YJ9 A;  1V43 A;  1N8R C;  2BA0 A;  3HOU H;  4A3C G;  4WJ4 A;  2YTY A;  3HOY G;  4DR3 Q;  3NEN A;  3KJO A;  4P72 A;  1Q1B A;  3ULJ A;  3T1Y Q;  4BA1 I;  2NVY H;  5LMU L;  2WB1 E;  4GN4 B;  1XMO Q;  4OWW B;  4DR1 L;  4P71 A;  5IP9 H;  4DUZ L;  3S14 H;  2E2I H;  4YWK A;  3FKI G;  2JA5 H;  2K14 A;  1OXU A;  3GTK H;  1LTL A;  1SRU A;  2Y0S E;  5C3E H;  1E1T A;  4JCV E;  5GAG C;  1QVF A;  3K0X A;  4JI5 L;  1LM0 A;  4DV6 L;  2K4K A;  4IPH A;  3UDG A;  2N49 A;  4IJH A;  4C3H H;  1E3P A;  2HQL A;  4DUY L;  2YTV A;  3S24 A;  1BKB A;  5C0X G;  3G4S A;  3ERS X;  2F52 A;  1ASY A;  4DV6 Q;  2LXK A;  3G71 A;  1EIF A;  4LW1 A;  4B3S L;  3CPF A;  4YCW A;  4A3K H;  1PA6 A;  4LF5 Q;  3KYH C;  3K81 C;  3MXN B;  5JJL A;  2IHF A;  1GO3 E;  3EBE A;  4DPG A;  1JB7 A;  4DAY B;  1EYG A;  2EQS A;  4JI7 L;  2FXQ A;  4FDB A;  4IJL A;  4BBS G;  1A8V A;  3AQQ A;  1VQA A;  2I5L X;  2GN5 A;  1HH2 P;  1XJV A;  3RN5 A;  2ZM6 L;  2E8G A;  4GKK L;  5JEA J;  5C4X G;  2CWA A;  5C44 G;  4YHH L;  1IBK L;  2Z0S A;  2PNH A;  1PVO A;  3S15 H;  4LFA Q;  3M3Y H;  3CPW A;  5IYC G;  4ALP A;  2CWP A;  3F2C A;  2ID0 A;  3A74 A;  2HT1 A;  3PCO B;  1X3G A;  3S1R H;  2E2H H;  1N34 L;  4B3T Q;  3CW2 C;  1BBW A;  4HIM A;  1VQB A;  4NXM Q;  4BBR G;  4IPD A;  4PG3 A;  4BY1 G;  1NMF A;  1I3Q H;  3BZC A;  2D62 A;  1QUQ B;  2Q2I A;  2ATW A;  1X56 A;  4X64 L;  3GTL H;  1KL9 A;  5FLM G;  1Z47 A;  4K0K Q;  4R4O A;  1W2B A;  4IFD I;  1IYJ B;  4OWX B;  3D31 A;  2R7Z G;  2IX1 A;  2JA8 G;  2GVB A;  4JI1 L;  2MO0 A;  1V9P A;  4B3R Q;  2UU9 Q;  4DV7 Q;  2JA7 G;  3HOX G;  4JBW A;  1NBW A;  1DGS A;  1HR0 L;  4LF8 Q;  3GTG H;  2NVT H;  3KF8 B;  5M3M G;  2VUM H;  3KF6 A;  1Q46 A;  1IZ6 A;  4UP8 A;  4NPS A;  1GM5 A;  1YVC A;  1PH9 A;  3A0J A;  2EIF A;  2RHQ B;  4QL5 A;  2NN6 I;  4GKJ L;  1YHQ A;  4X6A H;  4JV5 L;  3STB C;  1B8A A;  4A3L H;  5M5X H;  4EQ5 A;  2K5V A;  3PGZ A;  4LF7 L;  4A3B H;  4LFB Q;  3DLL A;  2VW9 A;  1WFQ A;  4DV2 L;  2K52 A;  2KCM A;  4LF9 L;  4A3D H;  2JA6 G;  4A3G G;  4UP7 A;  3FP9 A;  2PI2 E;  1K83 H;  1GVP A;  2KCT A;  4A3J G;  2D0O A;  1N9W A;  4HIK A;  1OXV A;  1TXY A;  1VQD A;  1QVG A;  1NMG A;  3CC2 A;  1XNQ L;  4IOA A;  3VDY A;  1K9M C;  3GTP H;  3T1H Q;  4J15 A;  1VQ7 A;  3M7N A;  3BU2 A;  2VQF Q;  4L5Q A;  4DR4 Q;  4DK3 C;  1XMQ Q;  1UEB A;  2AHO B;  1M1K C;  2N3S A;  4DR1 Q;  1X9N A;  1JJC B;  2OCE A;  2I0Q A;  4A3M H;  1FGU A;  1SR3 A;  1VQE A;  2KHI A;  3NEM A;  1CKN B;  4H02 A;  4AYB E;  1WCM H;  5GAE C;  2ASB A;  3GD7 A;  4Y7N H;  3I4M G;  2K50 A;  1Q1E A;  5IP7 H;  4BY7 H;  1PFS A;  4JC0 A;  5IE8 A;  4L5T A;  1IBL L;  3RZO H;  1CKN A;  4IFD G;  4L5S A;  1K3R A;  2AKW B;  3PIO A;  2HIV A;  1I6H H;  5IY0 A;  1WYD A;  2VZA A;  3KDF B;  3J81 j;  1YBY A;  2UUC L;  1NE3 A;  2VQE Q;  3S1M H;  3PO2 G;  3NEL A;  1HNZ Q;  4X62 Q;  3L7Z C;  1XPR A;  4NXN L;  1I5F A;  3DM3 A;  4GOP A;  5H1S E;  2R92 H;  1N33 Q;  5IWA L;  3H0G G;  1A0I A;  1HZB A;  3PO3 G;  2IT1 A;  4PZ8 A;  4X62 L;  4DR5 Q;  4DR7 L;  4R1J A;  2RF4 A;  2QA4 A;  1VQF A;  4A3D G;  1VS0 A;  1X3F A;  2KHJ A;  3CCL A;  1NTG A;  4X66 L;  1R9T H;  1EQR A;  5C4J H;  3UE1 A;  1OXX K;  1NY4 A;  1VQM A;  4GS3 A;  1B70 B;  4JI3 Q;  5IT9 c;  1X55 A;  3HOZ G;  2UUA L;  3HOW G;  4OON A;  3CCS A;  5DLQ E;  1AE3 A;  4QY7 A;  4PZ7 A;  3B6Y A;  4AQY L;  1MKH A;  5M3F H;  1HR0 Q;  2AWO A;  4LUZ A;  5IYD G;  3HOX H;  1EQQ A;  4O0A A;  3CCM A;  4JI0 L;  1U5K A;  2CCZ A;  4P74 A;  1YIT A;  3W1B A;  4X65 Q;  1VQ8 A;  3BZK A;  5IYB H;  4LFA L;  4HJ9 A;  2ZJQ A;  4KHZ A;  4IFD J;  5M3F G;  5AJ3 L;  1NJI C;  5IYD H;  1JT8 A;  1QZG A;  4HJ7 A;  3KDF A;  3U4V A;  4K0K L;  4R4C A;  4C3J H;  4QGU A;  3CCU A;  3TQY A;  1Q82 C;  4LWC A;  2UXC Q;  1BBU A;  2N8N A;  1KRS A;  4AYB G;  3D0F A;  1FL0 A;  1XNR L;  2F4V Q;  4OO1 I;  4DKA C;  3TS0 A;  3KF6 B;  1Y1V G;  4HIO A;  4KHP L;  1X65 A;  3I4N H;  4A4I A;  1T9H A;  3RLN A;  1HZC A;  3EN2 A;  4IPG A;  3GTJ H;  2YYZ A;  3JAM i;  4LF8 L;  4OWT B;  3L2P A;  1FJG Q;  3W5O A;  3CP0 A;  4DV1 Q;  4GNX C;  4MTN A;  3ICE A;  5IP7 G;  2DUD A;  4JOI C;  1N32 L;  4LF9 Q;  3BJU A;  3UDX A;  2AWN A;  2KEN A;  3E0E A;  2PMZ E;  2JK8 A;  5HGQ A;  4BXX G;  3CF5 A;  1A63 A;  1GD7 A;  2ZJR A;  2ES2 A;  2UXB Q;  5LMN Q;  1LYL A;  3S1Q H;  3CAM A;  2WB1 G;  4BA2 I;  1E1O A;  5M5Y H;  4DR4 L;  1VQH A;  3JC6 6;  4IPC A;  4JBJ A;  4OXP A;  4R4T A;  4TVA B;  4AH6 A;  3T1Y L;  1OTC A;  5LMU Q;  3PUX A;  2Q2T A;  4OX9 L;  1XMO L;  2UXB L;  4XIG S;  3CC4 A;  4C3I H;  4DR2 Q;  4A75 A;  3GTQ H;  4JI2 Q;  1O7I A;  3CXC A;  1HNW L;  4PZ6 A;  4RMF A;  1PH5 A;  1C0A A;  1JMC A;  3H3V H;  3M4Q A;  1WOC A;  2JEB I;  1SLJ A;  4JOI A;  1PH4 A;  1VQG A;  4GNX A;  2JA9 A;  2OQ0 A;  5IP9 G;  2R7D A;  3KJP A;  2WP8 J;  3M4P A;  2Y0S G;  3A5U A;  1AE2 A;  1HNZ L;  3PSI A;  2JA6 H;  1YHA A;  3AFQ A;  1I50 H;  4JBM A;  4GOP B;  3NBH B;  2C35 B;  1YHB A;  2E5L L;  4LF5 L;  3MEF A;  1K0R A;  1H95 A;  5J3B A;  4A3L G;  2WAQ E;  1G51 A;  3H3V I;  4YHH Q;  1IBK Q;  1P16 A;  3A5Z B;  1PYB A;  1Q12 A;  1WI5 A;  1FVI A;  5JEA G;  2E5L Q;  2I5H A;  1N33 L;  2ZM6 Q;  3HOZ H;  3RZD H;  3CCJ A;  4DAM A;  5M3M H;  5C0X I;  1KIX A;  2VUM G;  1QZH A;  3CCR A;  3I4O A;  1PH2 A;  5IYB G;  1PH1 A;  4DV4 L;  2ZTE A;  3K8A A;  4P75 A;  5BR8 Q;  2R7Z H;  3PUY A;  3CQZ H;  4EX5 A;  2B3G A;  2QEX A;  1EWI A;  4YCV A;  1N32 Q;  1SE8 A;  2CQO A;  1VQ4 A;  2XGT A;  1JJ2 A;  4JI6 Q;  1HZ9 A;  1SMX A;  3CD6 A;  2MQH A;  2OTL A;  1C7Y A;  2B29 A;  1Q8K A;  2NN6 G;  1HNX Q;  4JI1 Q;  1G29 1;  2AMC B;  1KHI A;  2MFI A;  3H0G H;  4P73 A;  3CME A;  1KQS A;  4O2D A;  4GKK Q;  3L0O A;  3S17 H;  4GN5 A;  1KC8 C;  1SRO A;  4LFC Q;  3TRZ A;  4GOP C;  2B63 H;  3U50 C;  3J80 i;  4GNX B;  1FJG L;  3RLO A;  1OXS C;  4BBS H;  4HJ8 A;  1PYS B;  3F1Z A;  4YCU A;  1BVS A;  2F3I A;  2PQA A;  4KI0 A;  1YJN A;  1UWV A;  4GKJ Q;  2VQF L;  1LUZ A;  1VQ9 A;  4B3M Q;  5C4X H;  2JQO A;  1KD1 C;  1JJG A;  3GTO H;  1UE1 A;  3K7U C;  4UP9 A;  1L0W A;  3PF5 A;  2NVX H;  3LGJ A;  5ELN A;  1KXL A;  2N78 A;  3M4O H;  3F2D A;  1J5E Q;  3PIP A;  2UXC L;  3PV0 A;  3PUW A;  4X64 Q;  1UE5 A;  1VQK A;  3ULL A;  5LMN W;  2NVQ H;  5ELO A;  1K73 C;  4POG A;  4LFB L;  2VS1 A;  1VQP A;  4JI2 L;  3AEV A;  2OTJ A;  2JJQ A;  4DV5 Q;  4JI4 L;  1B7Y B;  3HKZ G;  4DV0 L;  4BY7 G;  4JI7 Q;  3GDE A;  2K5H A;  4JI8 Q;  1CUK A;  1VCI A;  2MO1 A;  3GO5 A;  3PUV A;  3KOJ A;  1TWH H;  1CKO A;  1XTD A;  1OXT A;  4HID A;  4JYA L;  1SN8 A;  4DV5 L;  4A3M G;  2A8V A;  5EAY A;  4DR6 L;  3HOY H;  2RCN A;  3U58 A;  3UDI A;  3I56 A;  5JJI A;  2R6G A;  1Y1V H;  3W1G A;  5FJ8 G;  3H15 A;  1L2F A;  2MNA A;  2ZTC A;  1IXR A;  2WFW A;  4HJ5 A;  4B3S Q;  1X6O A;  5C3E G;  4DV3 L;  1XPO A;  3OTO Q;  2K75 A;  2KBN A;  4IOC A;  3FKI H;  2JA5 G;  4A76 A;  5GRO A;  4GLX A;  4PMW A;  3RR5 A;  1YI2 A;  1M90 C;  1K8G A;  3SGI A;  2LSS A;  4DUZ Q;  4DV3 Q;  4TQU S;  4B3T L;  4A3I H;  2BH2 A;  4YY3 L;  1PH3 A;  3I4N G;  3WWV A;  3J7Z C;  4A3B G;  2JA7 H;  3HOV H;  3HOU G;  2XTI A;  4A3F H;  4A3C H;  1PH8 A;  4LF6 Q;  1E24 A;  1RL2 A;  3I7F A;  2VQE L;  4YY3 Q;  3M85 A;  3AFP A;  1UE6 A;  4UY8 C;  4X66 Q;  3HOW H;  2YTX A;  1HJP A;  2UU9 L;  4LF6 L;  3CCV A;  2NZH A;  4JI6 L;  1V1Q A;  1G6P A;  4DR5 L;  2D0P A;  4AIM A;  4DR7 Q;  1N34 Q;  2UUB Q;  4A93 H;  2JA8 H;  4DNI A;  1I94 L;  1E22 A;  1S72 A;  3F8T A;  1EFW A;  1PHJ A;  1VQO A;  1XNR Q;  4OX9 Q;  2F4V L;  1YJW A;  1EUJ A;  3PO3 H;  1I94 Q;  1IBM L;  3CC7 A;  3CCQ A;  4IO9 A;  1PH7 A;  4A3E G;  4DV7 L;  1Q7Y C;  1YZ6 A;  1D8L A;  2UXD Q;  4UPA A;  3UE0 A;  3Q8D A;  4GLA C;  4C2M H;  1MJC A;  2K5N A;  1VQI A;  1KAW A;  2L15 A;  4XTC S;  4LNQ A;  4A3E H;  3J7A 5;  1CSQ A;  1EOV A;  2JE6 I;  1IBM Q;  1VQN A;  3K80 C;  4Y52 H;  4APV A;  1J5E L;  5M5W H;  1Y1W H;  2H5X A;  1D7Q A;  4JV5 Q;  1XMQ L;  2Q2U A;  2BH8 A;  1IL2 A;  2IX0 A;  3ZJY C;  3TRE A;  3RN2 A;  3EIV A;  1C9O A;  3I4M H;  5JJK A;  4POF A;  2CFM A;  1YIJ A;  1TWF H;  3G48 A;  2R93 G;  3PF4 A;  3E9I A;  2V1C C;  2Z6K C;  4MZ9 A;  2WAQ G;  4DV1 L;  4GLV B;  5C0X J;  4BXX H;  1XNQ Q;  1TWC H;  4LUO A;  1VQ6 A;  3FHW A;  5GQO A;  4X65 L;  4A3K G;  4DK6 C;  4DV2 Q;  1MJE A;  1XPU A;  3S2H H;  4YWM A;  4DR6 Q;  1HNW Q;  1Q86 C;  4B3M L;  4JI5 Q;  1VQL A;  4MNO A;  3RLF A;  1GKH A;  1E7Z A;  4R4I A;  2ALY B;  4OO1 G;  1N36 L;  4A3G H;  1WJJ A;  4A3I G;  2HHH Q;  3K7A H;  2VNU D;  5E7N A;  4JI4 Q;  3ULP A;  1HZA A;  2DGY A;  2GVA A;  2VL6 A;  4DV0 Q;  1ASZ A;  1CSP A;  1J6Q A;  3M9B A;  4JI8 L;  3GTM H;  3OYY A;  1CKM A;  1PH6 A;  3STB D;  5LMN L;  1VQJ A;  3HKS A; 
#chains in the Genus database with same CATH topology
 1I50 B;  2A6H D;  1HR0 W;  4WJ3 M;  3G6E A;  5C3W A;  4JYA Q;  1PMR A;  2EXD A;  2UUA Q;  3C3L A;  3OHX C;  5GAD C;  4HSP A;  4A3J B;  1CI3 M;  2NWG A;  3BS1 A;  5FLX c;  1YNX A;  3LWU A;  3J81 i;  2SNS A;  1U0L A;  1MHW C;  1EOT A;  3QOL A;  4LUV A;  1ZYR C;  4XT3 B;  2M00 A;  2F3V A;  1JWU D;  1L1O C;  3S1Q B;  1WTV A;  5DNF A;  2DN8 A;  2K7V A;  2ZJP A;  2VUM B;  1BR9 A;  2A1A A;  2LXJ A;  5KNC A;  3HKZ E;  4NXN Q;  5J1Z A;  4C1N K;  2OF1 A;  2B2U A;  2N88 A;  2I46 A;  2HIX A;  1RCV D;  1W3S A;  4FXK C;  4HCS A;  5ELF A;  2B63 G;  1DOM A;  3BDL A;  2Q8R E;  4QQB X;  1MBY A;  4HJA A;  1S4Z A;  1TWA H;  1MGS A;  1Y8N B;  4LAA A;  3T53 B;  4LFC L;  4IFD H;  4LF7 Q;  1YEZ A;  2IY5 B;  2Q2H A;  2F0P A;  2JA8 B;  1PRT F;  2E2J H;  4C3H G;  5ELB A;  2R61 A;  2I5M X;  2Z6K A;  1IYV A;  3VA7 A;  3J80 c;  1PV4 A;  4B3R L;  4LF4 Q;  4DR3 L;  1WCM B;  2OQK A;  4FXG C;  1VQC A;  4A3C G;  1N8R C;  3HOU H;  4RWS C;  4WJ4 A;  1M8A A;  1I4X A;  1EY5 A;  1S5F D;  4EQP A;  2EVB A;  2FMC A;  5FO9 B;  4JK1 C;  4JCV E;  3K58 A;  4QCL A;  2K32 A;  1IW7 C;  5M5X B;  2N49 A;  5BN4 A;  5KNB A;  4H7B A;  5C0X G;  2F52 A;  1AW7 A;  1EIF A;  2EYL A;  1EZ8 A;  1A3U A;  2F0J A;  2IHF A;  1JE4 A;  3NTH A;  4QMG A;  3PO2 B;  2MGS A;  3RN5 A;  2ZM6 L;  2E8G A;  2EY2 A;  3K5M A;  4GKK L;  1V1P B;  2M2L A;  1GXD C;  2F0K A;  2AQ2 B;  1IBK L;  2F0N A;  3S15 H;  1ENC A;  3CPW A;  5IYC G;  5KRU A;  1A6X A;  4L6T B;  2CH4 W;  1D1I A;  2ID0 A;  5FLX E;  2E2H H;  3QIA A;  3S1R H;  4B3T Q;  2F0L A;  3CW2 C;  1BBW A;  2E75 C;  2WAQ B;  2ZXP A;  4BBR G;  1SYD A;  4OHJ A;  5BN3 A;  1I3Q H;  3NSW A;  5COY A;  2Q2I A;  2ATW A;  4K5W A;  1X56 A;  3EJI A;  4R4O A;  1VF7 A;  4CHT B;  5JPM C;  2IJ0 A;  3E6Z X;  1CK1 A;  3HGB A;  3G6J B;  3GTG H;  3UI2 A;  2B2V C;  1Q46 A;  3R2T A;  1QNK A;  2RHQ B;  4X6A H;  2NB0 A;  1TS4 A;  3TP7 A;  4DA2 A;  3HKZ B;  2K5V A;  4LF7 L;  1DM0 B;  1KNE A;  4I65 A;  4A3B H;  3A56 A;  1A2T A;  2K52 A;  2CH4 A;  3PQI A;  1F2L A;  1TY2 A;  2PI2 E;  2TSS A;  5EBD A;  2D0O A;  3GV3 A;  1LTI D;  4RGO S;  1EY0 A;  3GTP H;  3T1H Q;  1VQ7 A;  3M7N A;  2VQF Q;  1UEB A;  1M1K C;  2KCN A;  2I0Q A;  1JJC B;  2OCE A;  4YIJ A;  3VR5 A;  1PFB A;  2ASB A;  5ELE A;  1EY8 A;  5IOC A;  3M4Y A;  5G3L F;  4JC0 A;  1I6H H;  3TP6 A;  2VZA A;  1YBY A;  4TSS A;  3S1M H;  4X62 Q;  1A3T A;  1PRT B;  4IN3 A;  2JP1 A;  4XT1 B;  1XPR A;  1HA5 A;  4KHV A;  4U68 A;  1JB3 A;  2IT1 A;  4FF3 A;  2F0E A;  4A3D G;  4ZCK A;  2B2U C;  1R9T H;  2E74 C;  1EQR A;  3TSS A;  2KCC A;  1HPC A;  3I90 A;  3GV6 A;  1B4O A;  2KEE A;  1AE3 A;  1EQQ A;  1U5K A;  3E3X A;  2R3Z A;  5D65 A;  5IYD H;  2ZJQ A;  4IFD J;  5M3F G;  3HOX B;  4QGU A;  3QWN A;  5CBA E;  2NVQ B;  1Q82 C;  3KLR A;  4LWC A;  2N8N A;  1PZK D;  1FL0 A;  1XNR L;  2F4V Q;  3DUZ A;  1ICW A;  1T9H A;  3RLN A;  3GTL B;  2YYZ A;  1NUC A;  3L2P A;  3W5O A;  1STB A;  4GNX C;  1Y1V B;  2RDG A;  4MTN A;  4I7A A;  4BBR B;  1N32 L;  1NCV A;  4FO2 A;  4H13 C;  2RDH A;  3OMC A;  2JK8 A;  2SDF A;  5HGQ A;  1A63 A;  2Z1C A;  1WTO A;  1DD2 A;  1LYL A;  1I4G A;  4BBS B;  4MN3 A;  3W2D A;  1SJH D;  4DR4 L;  1VQH A;  1PDQ A;  4JBJ A;  4R4T A;  4PV1 C;  3Q0A A;  1OTC A;  5LMU Q;  4OX9 L;  4BWG B;  2K04 A;  4DR2 Q;  1O7I A;  1U4R A;  3D4R A;  5DEH A;  1EEI D;  4RMF A;  3CHB D;  4ME5 A;  3M4Q A;  1WOC A;  2A6E D;  1SLJ A;  2B2Y A;  3S15 B;  1SJE D;  1XXG A;  2NN6 H;  3M4P A;  2Y0S G;  3A5U A;  1AE2 A;  1E0B A;  3PSI A;  1HXY D;  2J7Z A;  2QIL A;  4R8N A;  1YHA A;  2JA6 H;  1I50 H;  4GOP B;  5C5M A;  3TN2 A;  4A3L G;  3ZYY X;  1IBK Q;  2EY1 A;  3A5Z B;  3MXU A;  4C3J G;  5M3M H;  5K36 H;  4HAE A;  5IYB G;  1PH1 A;  1CHP D;  4DV4 L;  5JVG 3;  2EJM A;  1AP0 A;  2AUJ D;  2ZTE A;  3OPO A;  4EX5 A;  1JWM D;  3S9W A;  3VYR A;  1VQ4 A;  4JI6 Q;  2XGT A;  4K2K A;  3S14 B;  3CD6 A;  1BCP F;  4F87 A;  1UUP A;  2A69 D;  1G29 1;  4WFN 3;  4GKK Q;  3U9O A;  1R4P B;  2XVS A;  1KC8 C;  1DCZ A;  3TRZ A;  1OXS C;  4HJ8 A;  3D6C A;  4KI0 A;  2F0I A;  1UWV A;  4GKJ Q;  2VQF L;  1HUN A;  2B63 B;  5C4X H;  4KD3 A;  1KD1 C;  4UP9 A;  1TWA B;  3PF5 A;  5DAU A;  2EYJ A;  3V96 A;  1II3 A;  5D3I B;  3ERQ A;  4X64 Q;  2K01 A;  3KLS A;  3VYU A;  1CA5 A;  3QOJ A;  5ELO A;  1K73 C;  4L63 B;  4IAL A;  5KND A;  1PFN A;  1KDB A;  1B7Y B;  2BCO A;  3R93 A;  4BY7 G;  1VCI A;  4JYA L;  1XTD A;  1OXT A;  2HDM A;  1FYC A;  4A3M G;  1SDF A;  4DR6 L;  1YNJ C;  5JJI A;  1SYF A;  2QCP X;  5D14 A;  2WKD A;  5T1I A;  3RR5 A;  4K2L A;  1M90 C;  1K8G A;  3SGI A;  4DV3 Q;  1W6K A;  2IWH A;  4YY3 L;  3I4N G;  3MTS A;  3WWV A;  3J7Z C;  2F0O A;  3I70 A;  1E2V A;  1FNV A;  5ELC A;  3N52 A;  3I7F A;  3GTQ B;  3C1E A;  3FMC A;  4YY3 Q;  3D4W A;  3M85 A;  1DON A;  1ML0 D;  2UU9 L;  3M7G A;  2F0Q A;  2NZH A;  1V1Q A;  4DR7 Q;  1PZI D;  2YU9 B;  4A93 H;  5G3L D;  1AN8 A;  2EOT A;  1LT3 D;  1PHJ A;  1VQO A;  3OWE B;  3HS0 C;  4N8F A;  3K5N A;  4IO9 A;  1DZ1 A;  1YZ6 A;  3Q8D A;  4C2M H;  1HA6 A;  2K5N A;  1KAW A;  4JVZ A;  2CQA A;  3J7A 5;  1EOV A;  2V4D A;  1IBM Q;  1CHQ D;  3HOZ B;  3K80 C;  4CJ1 B;  2H5X A;  4OGQ C;  1GJX A;  1XMQ L;  2BH8 A;  1JWS D;  4K5V A;  3TRE A;  3CRL C;  2X6L A;  1C9O A;  5E3F A;  1TWF H;  4ZLT F;  2R93 G;  1TS2 A;  5C4Z A;  2F0U A;  4FVM A;  5I6Y A;  5C0X J;  3BDO A;  4LUO A;  3DWP A;  5C3X A;  1N32 Q;  4P2C B;  3K5O A;  1BCP D;  4A3I B;  1XPU A;  3S2H H;  1HNW Q;  1Q86 C;  4JI5 Q;  1LT6 D;  1WD0 A;  4XYO A;  1E7Z A;  4R4I A;  4PMC A;  4V0B A;  4E6I A;  1WJJ A;  1I4H A;  2ZXO A;  5E7N A;  3MC0 B;  1UEA B;  2VL6 A;  4DU9 A;  1CSP A;  1GOZ A;  4JI8 L;  4ZKB B;  1PH6 A;  3HKS A;  3JAM c;  3KFU A;  4DUY Q;  4RKB A;  2E2D C;  1H9M A;  4KY7 A;  4XDX A;  3KLW A;  1OO9 B;  3OTO L;  3EA6 A;  3EFX D;  5IWA Q;  1A62 A;  4L5R C;  3OW2 A;  3RMH A;  3TP8 A;  4NB3 A;  4IUU A;  3NWT A;  1SNP A;  1U4L A;  2Q8I B;  5CC4 A;  3PIO 3;  4J6H A;  2PQA B;  1FNU A;  1FNW A;  5FO8 B;  5JAV A;  4DR2 L;  1SE2 A;  1QVC A;  2UUC Q;  2B2W C;  1KAB A;  2L12 A;  2OWO A;  4ME3 A;  5FLM H;  1IW7 D;  1LTR D;  1Z6H A;  4YWL A;  1TII D;  1PRT C;  4R9W A;  5EKL A;  4JI3 L;  4TKO B;  3H3V C;  3TS2 A;  1SFO H;  3AYH B;  5L37 A;  1JR0 D;  1MSG A;  2KA7 A;  3I55 A;  3RNU A;  1HNX L;  1DJR D;  5CV5 A;  3A7A B;  1KNA A;  2JEA I;  1X3E A;  1F9Q A;  2FIN B;  2KOL A;  1B3Q A;  1B53 A;  3J81 c;  1TWG H;  2L11 A;  2YU9 H;  5HY6 A;  3TZD A;  1H9J A;  1NR2 A;  4LF4 L;  4RCO A;  2UUB L;  3NQT A;  4AQY Q;  1S40 A;  3MXN A;  3HRZ C;  4K5X A;  3T1H L;  1N36 Q;  4JBK A;  1I4P A;  2K33 A;  4K8I A;  5AJ3 Q;  2A19 A;  2F0M A;  2Z6B A;  4A3F G;  1V43 A;  3TP5 A;  2YTY A;  3KJO A;  3ULJ A;  4BA1 I;  1O7L A;  4P71 A;  4G7O C;  4DUZ L;  2F4I A;  4YWK A;  3I8Z A;  1LTL A;  2Y0S E;  4C3H B;  1QVF A;  1B3A A;  4JI5 L;  4ZRZ A;  3SK4 A;  4KD4 A;  3NQI A;  4C3H H;  2HQL A;  2YTV A;  5KYI A;  3G4S A;  4DXF A;  2A73 B;  3G71 A;  3R2I A;  2Z8L A;  1EQV A;  2A74 C;  5IT9 E;  5JJL A;  4DPG A;  1JB7 A;  4DAY B;  1EYG A;  1SE3 A;  2EQS A;  4N9T A;  5FK9 C;  4IJL A;  1VQA A;  2I5L X;  1PTO C;  1HH2 P;  5JEA J;  1PTO B;  5C4X G;  5C44 G;  4YHH L;  2Z0S A;  1RHP A;  1PVO A;  1F77 A;  3KBX A;  4IQZ A;  3T13 A;  1Y69 U;  2CWP A;  2JXM B;  1IHZ A;  1X3G A;  1CFM A;  1N34 L;  2A6H C;  2MHV A;  4HIM A;  4HMI A;  4BY1 G;  3SDZ A;  1NMF A;  1SMY D;  3BZC A;  4ILW A;  5E4X A;  4ID6 A;  3GTJ B;  4B9W A;  5FLM G;  4K0K Q;  3KF8 A;  4OWX B;  3D31 A;  2R7Z G;  5AFW A;  1V9P A;  2JA7 G;  1NBW A;  1HR0 L;  3KF8 B;  1A15 A;  2VUM H;  5DM6 3;  4NPS A;  5A2Q E;  3A0J A;  4DK1 A;  2B39 A;  4GKJ L;  1KDA A;  3U9S A;  3STB C;  1B8A A;  4JW0 A;  5M5X H;  4EQ5 A;  3K7A B;  3LNN A;  4QB4 A;  4LFB Q;  1KLG D;  3NK9 A;  4LF9 L;  2KCM A;  4ZUJ A;  4A3G G;  3FP9 A;  4HIK A;  1N9W A;  1TXY A;  1Z7T A;  1QVG A;  1NMG A;  1XNQ L;  3A8I E;  3T51 B;  3BU2 A;  5I2X A;  1C8C A;  4L5Q A;  1XYI A;  1XMQ Q;  1X9N A;  5K5P A;  1EWC A;  1VQE A;  2KHI A;  3NEM A;  1CKN B;  4RCN A;  4RGN A;  5GAE C;  3I4M G;  3MWY W;  3VA5 A;  5IP7 H;  2K5W A;  1K3R A;  4XYQ A;  3PIO A;  4BY1 B;  5IY0 A;  3J81 j;  4KY6 A;  4PMB A;  3L7Z C;  2LKV A;  1CA6 A;  4NXN L;  3DM3 A;  4GOP A;  4CKC A;  2EYO A;  3Q24 A;  1A0I A;  3PO3 G;  4PZ8 A;  2CHB D;  4R1J A;  2L55 A;  2QA4 A;  1VQF A;  1LTA D;  3W3A A;  2BE5 D;  1VS0 A;  2ICE C;  1NTG A;  1EWH A;  1IKM A;  1Y8O B;  3HOV B;  1OXX K;  2HCC A;  5CBE E;  3S17 B;  5EKK A;  4GS3 A;  1HFN A;  1B70 B;  4JI3 Q;  1DOK A;  5IT9 c;  2UUA L;  3J7A F;  4HSV A;  1DXM A;  1E2W A;  3B6Y A;  1GUS A;  4Q0F A;  2AWO A;  4LUZ A;  5IYD G;  1SMY C;  4A3B B;  1VDZ A;  1YIT A;  3W1B A;  3BZK A;  5IYB H;  1AZQ A;  1LAC A;  1RTN A;  2WV6 D;  4HJ9 A;  2XWJ B;  5AJ3 L;  1QZG A;  3AMU A;  4C3J H;  1K0S A;  3M3Y B;  2QF7 A;  1BUV T;  1TY0 A;  1QOH A;  2L1B A;  4C2M B;  2QEJ C;  2F0H A;  3K57 A;  1X65 A;  5LL6 S;  2BOS A;  3I4N H;  4A4I A;  1HZC A;  2HUG A;  3EN2 A;  5C3E B;  4OWT B;  1FJG Q;  1ET9 A;  4DV1 Q;  3ICE A;  2WKC A;  4XQJ A;  3UDX A;  3S1M B;  2KEN A;  2NVT B;  2PZT A;  3V05 A;  4BXX G;  2KVM A;  1D5M C;  2PCF B;  4DXG A;  4R8I A;  2WB1 G;  1LV9 A;  1E1O A;  3CKI B;  3N6R A;  4IPC A;  3JC6 6;  4OXP A;  3T1Y L;  2UUB Q;  3CC2 A;  3PUX A;  1XMO L;  3CC4 A;  4A75 A;  3A8J E;  4KMU C;  2DY8 A;  3DXJ C;  4KJN A;  4JI2 Q;  5IGC A;  1BNZ A;  1STH A;  5C5L A;  1J8I A;  1PH5 A;  1QE6 A;  2JEB I;  2KED A;  4HTH A;  4A3G B;  1VQG A;  2JA9 A;  5IP9 G;  3MZ5 A;  2D5D A;  2WP8 J;  2NTT A;  1WTH A;  2EZV A;  2B2T C;  4L8J A;  4JBM A;  1YHB A;  5J3B A;  2WAQ E;  4DN4 M;  4OL7 A;  4YHH Q;  1Q12 A;  1WI5 A;  5IGG A;  1D5X C;  1FVI A;  1STE A;  3AB9 A;  1FD7 D;  2I5H A;  3WOF A;  1N33 L;  4FP5 D;  4DAM A;  1KIX A;  3AU7 A;  4OIK A;  3J81 L;  2WII B;  1CZG A;  1DOL A;  2QEX A;  1SYG A;  1SYB A;  1SE8 A;  4X3K A;  1YNJ D;  5FLX L;  5EPK A;  1O7Z A;  1HNX Q;  4JI1 Q;  2MFI A;  2JSO A;  2A69 C;  2FFK B;  4O2D A;  3L0O A;  4GN5 A;  3QR8 A;  4GOP C;  3U50 C;  1CTM A;  1PYS B;  3F1Z A;  4YCU A;  3SK5 A;  2F3I A;  4ZK9 B;  1YJN A;  1LUZ A;  5F2D A;  2FJ2 A;  5E4W C;  1JJG A;  3GTO H;  3K7U C;  1L0W A;  5ELN A;  2N78 A;  2A6E C;  2KHS A;  1VQK A;  3ULL A;  4KN4 C;  3S1R B;  4POG A;  2VS1 A;  1VQP A;  1ZKO A;  4DV5 Q;  3HZX A;  3MA2 B;  3HKZ G;  4DV0 L;  4JI7 Q;  3GDE A;  2K5H A;  2MO1 A;  1SND A;  3KOJ A;  4C56 C;  1DYQ A;  4DV5 L;  1XTC D;  5EAY A;  3HOY H;  2RCN A;  3UDI A;  3I56 A;  3IFD A;  1Y1V H;  2NYZ D;  3W1G A;  2MNA A;  2R92 B;  1IXR A;  2MJ8 A;  3NTI A;  4B3S Q;  4DV3 L;  1F9R A;  2EJG C;  2K05 A;  5C3E G;  1A2U A;  1TWF B;  3FKI H;  1EY6 A;  4EGV A;  4GLX A;  1JC7 A;  1ROD A;  1YI2 A;  2RA4 A;  2X69 A;  1LT4 D;  4TQU S;  4ZUI A;  1KTK A;  3V2T A;  4A3I H;  2IL8 A;  1PH3 A;  2SEB D;  2JA7 H;  1B9M A;  3HOW B;  4A3C H;  2XWB B;  1TT2 A;  1MI2 A;  2B2V A;  2QDL A;  4DR5 L;  4G7Z C;  4K6L A;  4RGT A;  4RHS A;  3DM1 A;  5CV8 A;  4DNI A;  4NMZ A;  3H09 A;  1EFW A;  1X32 A;  1YNN D;  1XNR Q;  2F4V L;  2CW0 D;  1YJW A;  1EUJ A;  2EYM A;  3J80 L;  2G9D A;  1IBM L;  1RD9 D;  1EYD A;  1S5E D;  4KV6 A;  4DV7 L;  4UPA A;  4GLA C;  2NUC A;  2L15 A;  1F2Z A;  1CSQ A;  2JE6 I;  1SE4 A;  2IPK D;  1EYC A;  3RZO B;  2Q2U A;  1Q3L A;  3FDT A;  4H44 C;  1JQY D;  3RN2 A;  1BOS A;  1WTX A;  3H94 A;  5JJK A;  1C4Q A;  2CFM A;  5E1F A;  1YIJ A;  5J39 A;  3A8K E;  1H9K A;  1X3P A;  3CU7 A;  2Z6K C;  4MZ9 A;  2WAQ G;  4DV1 L;  4BXX H;  1SBB B;  1VQ6 A;  3FHW A;  5GQO A;  4A3K G;  4WOR A;  1KAA A;  3MVV A;  3QO2 A;  1SSO A;  5CYU A;  1GKH A;  1Y8P B;  2IW3 A;  1HQR D;  4A3G H;  4A3I G;  3K7A H;  2GVA A;  2NVX B;  1J6Q A;  3M9B A;  3SK6 A;  3GTM H;  1CKM A;  4KJO A;  3STB D;  1VQJ A;  1B9N A;  5GAH C;  2RHS B;  2WAC A;  1KRT A;  5KEE A;  2KEC A;  1GUO A;  3CRK C;  1HTP A;  2O2L D;  2B8G A;  3HEJ A;  3I2Z A;  3GTM B;  2K03 A;  3KK7 A;  3S16 H;  3HOU B;  2R93 H;  5T1G A;  4FF4 A;  1Z9F A;  2B2W A;  2ZTD A;  3BVG A;  3DHQ A;  3NP8 A;  4IZ8 A;  3J80 E;  1EY4 A;  2NVY B;  4G7H C;  1Y14 B;  2R7F A;  4JI0 Q;  4JG2 A;  4DV4 Q;  2PI2 A;  4BY1 H;  3UDF A;  2NTS A;  1I6H B;  3S1N H;  1I4R A;  3NBI A;  1IBL Q;  4KLK A;  1Y1W B;  2EYP A;  3G7L A;  3TBI B;  1UAP A;  1D1K A;  1S3O A;  2UXD L;  2NZO A;  5I2Y A;  2D9U A;  1UE7 A;  5C44 H;  1K8A C;  3FPP A;  4BBR H;  4KHP Q;  1IL8 A;  4NXM L;  3PUZ A;  1ENF A;  3SVM A;  3HFZ B;  4GN3 B;  1F2Y A;  1CQV A;  3S2D H;  5IGD A;  3E9H A;  5IYC H;  1F9P A;  1R4Q B;  1EIY B;  1TR5 A;  3TDQ A;  4RG1 A;  3ER0 A;  4J1M A;  5IT9 L;  5I6W A;  4XXE A;  1QUQ A;  1MIU A;  4QIW B;  1TS3 A;  2YV5 A;  4LMQ D;  2FHT A;  2IHE A;  4HCE A;  1PFM A;  2PZW A;  4QIW E;  3C2P A;  1Q8I A;  1LO5 D;  2F03 A;  1BXT A;  1YJ9 A;  2BA0 A;  5EBC A;  4P72 A;  3MHB A;  3JAM L;  2RCF A;  3HP3 A;  3KBG A;  5JPN C;  4DR1 L;  5IP9 H;  4FF1 A;  3S14 H;  2KJX A;  1EZ6 A;  5I9P A;  3FKI G;  2K14 A;  1OXU A;  3GTK H;  3SXH A;  1SRU A;  5C3E H;  1ZXT A;  5GAG C;  3K0X A;  3T4A C;  5DM7 3;  1L0X B;  2JN4 A;  3D8G A;  1D2B A;  5LL6 X;  2K4K A;  3ONA B;  1JOQ A;  1E3P A;  1A3V A;  4DUY L;  4NP5 A;  2F0T A;  4CJ0 B;  1ASY A;  2LXK A;  4LW1 A;  4OEM B;  1RDP D;  5ELD A;  3CPF A;  4FXD A;  4NKL A;  4A3K H;  1PA6 A;  4LF5 Q;  3KYH C;  3MXN B;  4JPB W;  1GO3 E;  3EBE A;  3RUZ A;  4DFA A;  4JI7 L;  2N55 A;  2FXQ A;  4FDB A;  4BBS G;  2VB3 X;  1A8V A;  5EGT A;  2GN5 A;  1XJV A;  3ITP A;  4AYB B;  4KY5 A;  2PPB C;  2MUY A;  4G57 A;  1B2T A;  3EQL C;  1B44 D;  5A35 A;  3F2C A;  3A74 A;  3PCO B;  1PZJ D;  1QB5 D;  1VQB A;  1TS5 A;  1AEX A;  3GP7 A;  1BF4 A;  4PG3 A;  1QUQ B;  3GTL H;  1KL9 A;  3T16 A;  1Z47 A;  1F2M A;  4EQN A;  5M3M B;  2EXZ A;  1IYJ B;  4J8Q A;  4M1U B;  2IX1 A;  2JA8 G;  2GVB A;  4JI1 L;  2P5Z X;  2UU9 Q;  3HG9 A;  3QJY A;  4JBW A;  3HOX G;  1T5E A;  5KYL A;  4HED A;  3FPU B;  1IZ6 A;  1R9T B;  3C46 A;  4ZKC B;  2EIF A;  4QL5 A;  2NN6 I;  1YHQ A;  4PQX A;  4JV5 L;  3J81 E;  2CW0 C;  2JA6 B;  1LAB A;  1NR4 A;  1WFQ A;  4C1N I;  1EU3 A;  1K83 H;  2HT1 A;  2KCT A;  4A3J G;  5EPL A;  1OXV A;  1VQD A;  4IOA A;  3LWE A;  3VDY A;  1K9M C;  4J15 A;  2R93 B;  4DR4 Q;  2DY7 A;  4DK3 C;  1QIL A;  3NUC A;  4BS9 A;  2N3S A;  4OX9 Q;  3URY A;  3Q6S A;  3ERO A;  1FGU A;  1SR3 A;  4AYB E;  3D3R A;  4H02 A;  5CMD A;  3SHL A;  1WCM H;  1STY A;  1CZW A;  4DAP A;  4Y7N H;  2K50 A;  1Q1E A;  1PFS A;  1NSN S;  5IE8 A;  2SNM A;  2AKW B;  2HIV A;  1H9R A;  4DAV A;  1WYD A;  3KDF B;  2UUC L;  4CKE A;  3I4M B;  3A54 A;  3DWQ A;  4CGY B;  2VQE Q;  3PO2 G;  3NEL A;  1HNZ Q;  2R92 H;  5H1S E;  1EQT A;  1N33 Q;  1QNU A;  1TWC B;  4X3U A;  5IWA L;  3H0G G;  4IUT A;  1GUT A;  4O1N A;  3OIP A;  1KDC A;  4DR7 L;  1GHK A;  5JJZ A;  2KHJ A;  3CCL A;  2BE5 C;  5FKA C;  5C4J H;  3IL8 A;  3JAM E;  2Z4H A;  1NY4 A;  1MSH A;  4EQO A;  1X55 A;  3HOW G;  4OON A;  5DLQ E;  4QY7 A;  4AQY L;  4A3D B;  1MKH A;  4JI0 L;  4O0A A;  2CCZ A;  3NWS A;  4P74 A;  2H4O A;  2RVL A;  4X65 Q;  1VQ8 A;  3GTP B;  4KHZ A;  3OWF A;  4K0K L;  4K6D A;  4HJ7 A;  2Z4I A;  4R4C A;  5JEA H;  5CV7 A;  3Q23 A;  4AYB G;  1KRS A;  3D0F A;  3GQB A;  1SAP A;  2B2Y C;  4OO1 I;  4DKA C;  3TS0 A;  3KF6 B;  1K8O A;  2JA5 B;  1EY9 A;  4IPG A;  2F0F A;  1ENA A;  4LF8 L;  2E2I B;  1NNX A;  3K5L A;  2RSO A;  2C5C A;  3BJU A;  1IKL A;  1TQO A;  1GUW A;  1GD7 A;  1K8M A;  2K5D A;  2L5T A;  5CR3 A;  1UNS A;  2ZJR A;  5LMN Q;  2UXB Q;  3S1Q H;  4N8X 1;  3CAM A;  3AEV A;  4TVA B;  4AH6 A;  2Q2T A;  3BDC A;  4CDE C;  3J7A V;  3ND8 A;  2UXB L;  4C3I H;  2AUK A;  4F88 A;  3I3C A;  3CXC A;  2B2T A;  1C0A A;  1JMC A;  4JOI A;  1PH4 A;  2F1M A;  4GNX A;  2SOB A;  5IGF A;  3X3N A;  1LTT D;  3AFQ A;  2F0G A;  4KN7 C;  4QUF A;  3NBH B;  2C35 B;  3I73 A;  2E5L L;  5JVH 3;  1WD1 A;  1G51 A;  1P16 A;  1PYB A;  3IFT A;  2E5L Q;  4CDF C;  4U67 3;  2ZM6 Q;  3RZD H;  2XN9 C;  2VUM G;  5C0X I;  1QZH A;  1EYA A;  4LK1 C;  2LS0 1;  5BR8 Q;  3K8A A;  4H0L C;  2R7Z H;  3CQZ H;  1EWI A;  1TU2 B;  3L9A X;  1PRT D;  4ZAI A;  1BCP B;  2CQO A;  1HZ9 A;  1SMX A;  4F7X A;  2O5I C;  2R7Z B;  2B29 A;  2NN6 G;  1KQS A;  2AMC B;  3H0G H;  3CME A;  4P73 A;  3BVM A;  1SRO A;  4BBS H;  3RLO A;  5KIX A;  2ENB A;  1BVS A;  4RKL A;  2PQA A;  1IYU A;  1WTW A;  5NUC A;  2PZU A;  2XNA C;  1STN A;  1VQ9 A;  3BZD B;  4C3I G;  2JQO A;  4B9X A;  3M4O H;  5C0X H;  1GHJ A;  4DAY A;  1TKW B;  4A3M B;  1K28 A;  5FOB B;  2NVQ H;  4FNF A;  4LFB L;  3I91 A;  1PTO F;  2RKS A;  2OTJ A;  1PTO H;  4JI4 L;  2G9H D;  1S5B D;  1CUK A;  3PUV A;  2BDN A;  4HID A;  1TWH H;  4WRD A;  1SN8 A;  3I4N B;  4ODG A;  4RH6 A;  3K59 A;  5FJ8 G;  2E2H B;  1L2F A;  2ZTC A;  4HJ5 A;  4XQN A;  4MIU A;  1HFG A;  3OTO Q;  2KBN A;  3R3O A;  2JA5 G;  4A76 A;  3NE5 B;  1H9S A;  5GRO A;  1T5X D;  2HQE A;  2E76 C;  1G2S A;  2LSS A;  4B3T L;  2BH2 A;  2XSC A;  3FKI B;  4CKB A;  2WIN B;  4A3F H;  1E2Z A;  4RAU C;  1RL2 A;  5M3F B;  3AFP A;  3I72 A;  1RKN A;  1GUN A;  4C3I B;  3HOW H;  2YTX A;  1S5C D;  4LF6 L;  4ABN A;  3OMG A;  1EU4 A;  1G6P A;  1S5D D;  2D0P A;  4AIM A;  4A3K B;  4OIJ A;  3NXW A;  1I94 L;  1E22 A;  1M4V A;  1XWE A;  5C6A A;  1S72 A;  1TWG B;  1GUG A;  4I7Z C;  2EYF A;  1I94 Q;  3CC7 A;  3CCQ A;  1PH7 A;  4A3E G;  1Q7Y C;  1D8L A;  2UXD Q;  2HD3 A;  3UE0 A;  2PYK A;  4XTC S;  4LNQ A;  4A3E H;  2EE1 A;  2KQ3 A;  1VQN A;  5CGK A;  4APV A;  2A68 C;  1J5E L;  1Y1W H;  1D7Q A;  1WVL A;  3OOC A;  2IX0 A;  3EIV A;  2EYH A;  4KKU A;  4POF A;  1J9O A;  2OXP A;  2V1C C;  3E9I A;  4GLV B;  3R8B A;  1XNQ Q;  3BG3 A;  1MJE A;  4X65 L;  4DK6 C;  5EKI A;  1X3Q A;  3DEO A;  4CJ2 C;  1SNO A;  1VQL A;  4B3M L;  1U9R A;  4HN7 A;  2ALY B;  1N36 L;  4MTK A;  1Q90 A;  3VYT A;  2DGY A;  1BO0 A;  3I4L A;  2DNC A;  3QG1 A;  3OYY A;  4KKS A;  2HHH L;  1CQF A;  5COR A;  4DF7 A;  4R4Q A;  1WTQ A;  5FJ8 H;  1U4P A;  3P7J A;  2G5D A;  1RIP A;  3OIQ A;  1P8L A;  3CMA A;  3U4Z A;  3A7L A;  4UHV A;  1I6V C;  1Q81 C;  4F8M A;  3KLS X;  1AH9 A;  5LHY 1;  2QGQ A;  4Z9C B;  1WTR A;  1O80 A;  4QJF A;  5BR8 L;  3MXP A;  1QJO A;  1SXT A;  1HTL D;  5M5W B;  1JE5 A;  1B50 A;  2VY3 A;  4RA8 A;  1Y1W G;  3CCE A;  4FYD A;  2NZ1 D;  1C48 A;  1U4M A;  3SK8 A;  3FEW X;  5FO7 B;  3F2U A;  2GA4 B;  4M8A A;  2R92 G;  3S2H B;  3MAQ A;  1X54 A;  2BA1 A;  2AQ1 B;  3PO2 H;  1ESR A;  1JCK B;  4G4K A;  4S3S A;  2PNR C;  2QKI C;  3NPP A;  1L1O A;  1VQ5 A;  2VXW A;  2CKZ B;  4OEL B;  4A93 G;  3HOV G;  1WCM G;  5I9O A;  1V8Q A;  3RD4 A;  5K36 G;  1L1O B;  3QB3 A;  3F2B A;  3IRB A;  2XRQ D;  1H9S B;  1ICF B;  2O4X A;  1AZP A;  4N9P A;  4QF4 A;  3KUP A;  3TEH B;  2IX3 A;  1BBX C;  4FF2 A;  2NBF A;  3MFG A;  4A3J H;  3HOY G;  2A5H A;  4DR3 Q;  3NEN A;  1HRJ A;  1I4Q A;  1Q1B A;  3T1Y Q;  2VB2 X;  2NVY H;  5LMU L;  2WB1 E;  4GN4 B;  3VR3 A;  1XMO Q;  4OWW B;  3IKJ A;  3D6W A;  2D2C C;  2E2I H;  4QUC A;  2JA5 H;  3DMU A;  1E1T A;  3S1N B;  4A3F B;  4CBV A;  1LM0 A;  4DV6 L;  1WTP A;  5CV9 A;  4IPH A;  3UDG A;  3GTK B;  4IJH A;  3OSO A;  1JIC A;  1D5Z C;  3S24 A;  1BKB A;  3ERS X;  4DV6 Q;  5TSS A;  5IGB A;  4B3S L;  4YCW A;  3K81 C;  5CV4 A;  1HCZ A;  4IUQ A;  3H6M A;  3AQQ A;  4DNT B;  4X3T A;  2C9O A;  3BYT B;  2CWA A;  2E2J B;  3PO3 B;  2XIW A;  2PNH A;  2RQX A;  4LFA Q;  3M3Y H;  1RTO A;  4ALP A;  3SE0 A;  4WJW A;  5C4H A;  3A55 A;  4K8J A;  4NXM Q;  2DJF C;  4IPD A;  5J22 A;  2D62 A;  4GZY C;  4HR7 B;  4X64 L;  3MFY A;  1W2B A;  1EFI D;  4IFD I;  2I07 B;  1QG7 A;  2CVR A;  2MO0 A;  4B3R Q;  4DV7 Q;  1DGS A;  4LF8 Q;  2NVT H;  1SEB D;  5M3M G;  2B8F A;  3H91 A;  3KF6 A;  4UP8 A;  3MEH A;  1GM5 A;  5C4J B;  1YVC A;  1PH9 A;  1EIH A;  3S2D B;  4CDC C;  1ZEQ X;  2RDF A;  2RBM A;  4IUR A;  4A3L H;  3ND9 A;  1SYC A;  2Y0S B;  3PGZ A;  2JA7 B;  3DLL A;  1HHV A;  1V1P A;  2VW9 A;  4DV2 L;  3K6O A;  4A3D H;  2JA6 G;  4UP7 A;  4NW2 A;  1VMP A;  1JOO A;  2FMM A;  1GVP A;  4UDU C;  3SR1 A;  3VR6 A;  5JOB A;  1LTS D;  4C3J B;  2AHO B;  4BY7 B;  4DR1 Q;  2H1E A;  1ET6 A;  4V19 0;  1STA A;  1EIG A;  4A3M H;  1IL2 A;  1K3B C;  2PO4 A;  3GD7 A;  4BY7 H;  2TMP A;  4L5T A;  1IBL L;  3RZO H;  1CKN A;  4IFD G;  4L5S A;  1XX8 A;  1NE3 A;  1V1O A;  1I5F A;  2DNE A;  1PXU A;  1LTB D;  3E0J A;  3VR2 A;  4UAI A;  4IUP A;  1HZB A;  2F0D A;  2LFN A;  4X62 L;  4DR5 Q;  2RF4 A;  2JYO A;  2K28 A;  4KTA A;  1X3F A;  4X66 L;  1KLU D;  4X3S A;  3UE1 A;  1EL0 A;  1EEF D;  1G2T A;  1VQM A;  3PMF A;  3HOZ G;  3CCS A;  4PZ7 A;  1HR0 Q;  5M3F H;  3HOX H;  3CCM A;  1RJT A;  3GTO B;  4LFA L;  2L4N A;  1JT8 A;  5ISR A;  1NJI C;  2PW7 A;  2RSN A;  3KDF A;  4LJZ C;  3U4V A;  2ICI A;  2AQ3 B;  2KUM A;  3CCU A;  3TQY A;  2UXC Q;  1BBU A;  4CDD C;  2MP1 A;  2PW5 A;  1PLF A;  3X3M A;  1Y1V G;  1PYW D;  4HIO A;  4KHP L;  1ESF A;  3BYY B;  3FRP B;  4Y7N B;  3VYS A;  4A3E B;  3BVZ A;  4RHR A;  3D4D A;  3GTJ H;  2PMZ B;  3JAM i;  3CP0 A;  1HQM C;  5IGE A;  3CQZ B;  5IP7 G;  1EY7 A;  2DUD A;  2Z9H A;  4JOI C;  4LF9 Q;  2ZXR A;  2AWN A;  5KGU A;  3E0E A;  2PMZ E;  2PQE A;  1HUM A;  3CF5 A;  2ES2 A;  2QW7 A;  5IOD A;  4BA2 I;  3WOE A;  5M5Y H;  2BDO A;  4B08 A;  1QWY A;  5C4X B;  4XIG S;  3WDN A;  3GTQ H;  1F9S A;  1ONL A;  5CV6 A;  3DEP A;  4PNY A;  1HNW L;  4TRD A;  4PZ6 A;  4ZYS A;  3H3V H;  3IAY A;  4A93 B;  1VF5 C;  1FR3 A;  2HCI A;  3T56 B;  1SNQ A;  2OQ0 A;  2QDB A;  2R7D A;  3KJP A;  1HNZ L;  3EVQ A;  1L0Y B;  1QCB D;  2L0C A;  4LF5 L;  2K1B A;  3MEF A;  1K0R A;  3P1H A;  1H95 A;  3HOY B;  3H3V I;  1TWH B;  5JEA G;  3HOZ H;  3CCJ A;  3NTK A;  3CCR A;  4IUV A;  3I4O A;  2ZT9 C;  1LTG D;  3GTG B;  1PH2 A;  4DGZ A;  1NAP A;  3P75 A;  4P75 A;  3RZD B;  1JOK A;  3PUY A;  2B3G A;  4YCV A;  1JJ2 A;  2F0W A;  5A2Q L;  1SNC A;  2MQH A;  4ULL A;  2OTL A;  1C7Y A;  1Q8K A;  1G6Z A;  4NDX A;  1KHI A;  3S17 H;  5IIF A;  5D3D A;  4Q5V A;  2LMC B;  4LFC Q;  2B63 H;  3J80 i;  4GNX B;  1FJG L;  1ILQ A;  3OW7 A;  3H0G B;  5BN5 A;  1YNN C;  3SEB A;  2J0T D;  5M9O A;  4B3M Q;  3VR4 A;  4IUN A;  3L3O C;  1UE1 A;  2O5J C;  1G8Z D;  2HDL A;  2NVX H;  3LGJ A;  3P20 A;  1KXL A;  2EDG A;  3F2D A;  1J5E Q;  3PIP A;  2UXC L;  3PV0 A;  3PUW A;  1UE5 A;  3MXG A;  3NHH A;  5LMN W;  3PIP 3;  1LT5 D;  4JI2 L;  1CT1 D;  2JJQ A;  4K14 A;  1D6E C;  1AFP A;  4MHE A;  4JI8 Q;  3GO5 A;  3U58 A;  1W6J A;  1CKO A;  2A8V A;  4XQQ A;  3C1F A;  2R6G A;  1CM9 A;  3H15 A;  2WFW A;  1X6O A;  1XPO A;  4IOC A;  2K75 A;  5HGT A;  4PMW A;  5I4D A;  1FGB D;  4DUZ Q;  1JOR A;  1B1Z A;  5C44 B;  4A3B G;  2EY6 A;  3TME A;  4OO1 H;  3HOV H;  2OT2 A;  4DK0 A;  3HOU G;  2XTI A;  1PH8 A;  4LF6 Q;  1E24 A;  2VQE L;  5M5Y B;  1VMC A;  1SNM A;  2XRS D;  5EQ0 A;  1UE6 A;  4UY8 C;  3TZU A;  4KKT A;  2F0S A;  4X66 Q;  2EPB A;  3NBH A;  1HJP A;  2F3W A;  1ZYR D;  3CCV A;  4JI6 L;  1BQQ T;  2X6G A;  1BDO A;  1N34 Q;  1SYE A;  2JA8 H;  2EY5 A;  2L9H A;  2OEO A;  3F8T A;  3DWA A;  1K83 B;  1RF2 D;  3S16 B;  1O78 A;  3M4O B;  3PO3 H;  4RFB A;  2M9V A;  4KK7 A;  4O42 A;  1PTO D;  2MPM A;  4ZQ3 A;  1MJC A;  1VQI A;  4RGM A;  1O7Y A;  2Q8T A;  2A68 D;  4Y52 H;  2LY7 A;  3E5S A;  5M5W H;  2WB1 B;  4DNR B;  1ILP A;  4JV5 Q;  3ZJY C;  3J7Y W;  5EJW A;  3I4M H;  3FVQ A;  1I3Q B;  4EVO A;  3G48 A;  1SFO B;  3PF4 A;  3LX0 A;  3K0Y A;  3Q22 A;  2EJF C;  1BCP C;  1TWC H;  2K6A A;  2J4X A;  4DV2 Q;  1G91 A;  4YWM A;  4DR6 Q;  1LLR D;  5EPJ A;  4MNO A;  1STG A;  2K5Q A;  3O13 A;  3RLF A;  2F0V A;  4OO1 G;  1MD2 D;  2HHH Q;  2DJG C;  2VNU D;  4JI4 Q;  3ULP A;  1HZA A;  4DV0 Q;  1ASZ A;  4HMJ A;  1TVX A;  5HUR A;  5LMN L; 
#chains in the Genus database with same CATH homology
 2HHH L;  5GAH C;  3JAM c;  3KFU A;  4DUY Q;  2RHS B;  4R4Q A;  1KRT A;  1HR0 W;  3I2Z A;  5FJ8 H;  4WJ3 M;  3KLW A;  3G6E A;  3CMA A;  1RIP A;  1P8L A;  3OTO L;  3S16 H;  4JYA Q;  2R93 H;  3U4Z A;  5IWA Q;  1Z9F A;  2EXD A;  1A62 A;  2ZTD A;  2UUA Q;  5GAD C;  3OW2 A;  1Q81 C;  4L5R C;  1AH9 A;  2QGQ A;  1Y14 B;  4NB3 A;  2R7F A;  5FLX c;  4JI0 Q;  4JG2 A;  4DV4 Q;  1YNX A;  2PI2 A;  4QJF A;  5BR8 L;  4BY1 H;  3UDF A;  3J81 i;  1U0L A;  3S1N H;  1IBL Q;  2PQA B;  4KLK A;  1JE5 A;  4LUV A;  4DR2 L;  1QVC A;  1L1O C;  2UUC Q;  2VY3 A;  1S3O A;  2OWO A;  4ME3 A;  2UXD L;  2NZO A;  5FLM H;  2ZJP A;  2A1A A;  2LXJ A;  4YWL A;  1Y1W G;  1UE7 A;  5C44 H;  3HKZ E;  1K8A C;  4NXN Q;  3CCE A;  4BBR H;  4KHP Q;  4JI3 L;  4NXM L;  2HIX A;  3TS2 A;  1W3S A;  3PUZ A;  1SFO H;  3AYH B;  2R92 G;  2B63 G;  3HFZ B;  4GN3 B;  3S2D H;  1X54 A;  3E9H A;  4QQB X;  5IYC H;  2BA1 A;  3I55 A;  4HJA A;  3RNU A;  1HNX L;  1EIY B;  3PO2 H;  1TWA H;  4LFC L;  2JEA I;  4RG1 A;  3ER0 A;  1X3E A;  4LF7 Q;  1L1O A;  1YEZ A;  1VQ5 A;  2IY5 B;  2Q2H A;  3J81 c;  1TWG H;  1QUQ A;  1MIU A;  2CKZ B;  5HY6 A;  2YU9 H;  4A93 G;  2YV5 A;  4LF4 L;  3HOV G;  1WCM G;  2E2J H;  2UUB L;  4AQY Q;  2IHE A;  1S40 A;  5K36 G;  1L1O B;  2I5M X;  2Z6K A;  3IRB A;  3F2B A;  1PV4 A;  3J80 c;  1N36 Q;  3T1H L;  4JBK A;  4QIW E;  4B3R L;  4LF4 Q;  4DR3 L;  3TEH B;  5AJ3 Q;  2OQK A;  2A19 A;  1VQC A;  4A3J H;  4A3F G;  1YJ9 A;  1V43 A;  1N8R C;  2BA0 A;  3HOU H;  4A3C G;  4WJ4 A;  2YTY A;  3HOY G;  4DR3 Q;  3NEN A;  3KJO A;  4P72 A;  1Q1B A;  3ULJ A;  3T1Y Q;  4BA1 I;  2NVY H;  5LMU L;  2WB1 E;  4GN4 B;  1XMO Q;  4OWW B;  4DR1 L;  4P71 A;  5IP9 H;  4DUZ L;  3S14 H;  2E2I H;  4YWK A;  3FKI G;  2JA5 H;  2K14 A;  1OXU A;  3GTK H;  1LTL A;  1SRU A;  2Y0S E;  5C3E H;  1E1T A;  4JCV E;  5GAG C;  1QVF A;  3K0X A;  4JI5 L;  1LM0 A;  4DV6 L;  2K4K A;  4IPH A;  3UDG A;  2N49 A;  4IJH A;  4C3H H;  1E3P A;  2HQL A;  4DUY L;  2YTV A;  3S24 A;  1BKB A;  5C0X G;  3G4S A;  3ERS X;  2F52 A;  1ASY A;  4DV6 Q;  2LXK A;  3G71 A;  1EIF A;  4LW1 A;  4B3S L;  3CPF A;  4YCW A;  4A3K H;  1PA6 A;  4LF5 Q;  3KYH C;  3K81 C;  3MXN B;  5JJL A;  2IHF A;  1GO3 E;  3EBE A;  4DPG A;  1JB7 A;  4DAY B;  1EYG A;  2EQS A;  4JI7 L;  2FXQ A;  4FDB A;  4IJL A;  4BBS G;  1A8V A;  3AQQ A;  1VQA A;  2I5L X;  2GN5 A;  1HH2 P;  1XJV A;  3RN5 A;  2ZM6 L;  2E8G A;  4GKK L;  5JEA J;  5C4X G;  2CWA A;  5C44 G;  4YHH L;  1IBK L;  2Z0S A;  2PNH A;  1PVO A;  3S15 H;  4LFA Q;  3M3Y H;  3CPW A;  5IYC G;  4ALP A;  2CWP A;  3F2C A;  2ID0 A;  3A74 A;  2HT1 A;  3PCO B;  1X3G A;  3S1R H;  2E2H H;  1N34 L;  4B3T Q;  3CW2 C;  1BBW A;  4HIM A;  1VQB A;  4NXM Q;  4BBR G;  4IPD A;  4PG3 A;  4BY1 G;  1NMF A;  1I3Q H;  3BZC A;  2D62 A;  1QUQ B;  2Q2I A;  2ATW A;  1X56 A;  4X64 L;  3GTL H;  1KL9 A;  5FLM G;  1Z47 A;  4K0K Q;  4R4O A;  1W2B A;  4IFD I;  1IYJ B;  4OWX B;  3D31 A;  2R7Z G;  2IX1 A;  2JA8 G;  2GVB A;  4JI1 L;  2MO0 A;  1V9P A;  4B3R Q;  2UU9 Q;  4DV7 Q;  2JA7 G;  3HOX G;  4JBW A;  1NBW A;  1DGS A;  1HR0 L;  4LF8 Q;  3GTG H;  2NVT H;  3KF8 B;  5M3M G;  2VUM H;  3KF6 A;  1Q46 A;  1IZ6 A;  4UP8 A;  4NPS A;  1GM5 A;  1YVC A;  1PH9 A;  3A0J A;  2EIF A;  2RHQ B;  4QL5 A;  2NN6 I;  4GKJ L;  1YHQ A;  4X6A H;  4JV5 L;  3STB C;  1B8A A;  4A3L H;  5M5X H;  4EQ5 A;  2K5V A;  3PGZ A;  4LF7 L;  4A3B H;  4LFB Q;  3DLL A;  2VW9 A;  1WFQ A;  4DV2 L;  2K52 A;  2KCM A;  4LF9 L;  4A3D H;  2JA6 G;  4A3G G;  4UP7 A;  3FP9 A;  2PI2 E;  1K83 H;  1GVP A;  2KCT A;  4A3J G;  2D0O A;  1N9W A;  4HIK A;  1OXV A;  1TXY A;  1VQD A;  1QVG A;  1NMG A;  3CC2 A;  1XNQ L;  4IOA A;  3VDY A;  1K9M C;  3GTP H;  3T1H Q;  4J15 A;  1VQ7 A;  3M7N A;  3BU2 A;  2VQF Q;  4L5Q A;  4DR4 Q;  4DK3 C;  1XMQ Q;  1UEB A;  2AHO B;  1M1K C;  2N3S A;  4DR1 Q;  1X9N A;  1JJC B;  2OCE A;  2I0Q A;  4A3M H;  1FGU A;  1SR3 A;  1VQE A;  2KHI A;  3NEM A;  1CKN B;  4H02 A;  4AYB E;  1WCM H;  5GAE C;  2ASB A;  3GD7 A;  4Y7N H;  3I4M G;  2K50 A;  1Q1E A;  5IP7 H;  4BY7 H;  1PFS A;  4JC0 A;  5IE8 A;  4L5T A;  1IBL L;  3RZO H;  1CKN A;  4IFD G;  4L5S A;  1K3R A;  2AKW B;  3PIO A;  2HIV A;  1I6H H;  5IY0 A;  1WYD A;  2VZA A;  3KDF B;  3J81 j;  1YBY A;  2UUC L;  1NE3 A;  2VQE Q;  3S1M H;  3PO2 G;  3NEL A;  1HNZ Q;  4X62 Q;  3L7Z C;  1XPR A;  4NXN L;  1I5F A;  3DM3 A;  4GOP A;  5H1S E;  2R92 H;  1N33 Q;  5IWA L;  3H0G G;  1A0I A;  1HZB A;  3PO3 G;  2IT1 A;  4PZ8 A;  4X62 L;  4DR5 Q;  4DR7 L;  4R1J A;  2RF4 A;  2QA4 A;  1VQF A;  4A3D G;  1VS0 A;  1X3F A;  2KHJ A;  3CCL A;  1NTG A;  4X66 L;  1R9T H;  1EQR A;  5C4J H;  3UE1 A;  1OXX K;  1NY4 A;  1VQM A;  4GS3 A;  1B70 B;  4JI3 Q;  5IT9 c;  1X55 A;  3HOZ G;  2UUA L;  3HOW G;  4OON A;  3CCS A;  5DLQ E;  1AE3 A;  4QY7 A;  4PZ7 A;  3B6Y A;  4AQY L;  1MKH A;  5M3F H;  1HR0 Q;  2AWO A;  4LUZ A;  5IYD G;  3HOX H;  1EQQ A;  4O0A A;  3CCM A;  4JI0 L;  1U5K A;  2CCZ A;  4P74 A;  1YIT A;  3W1B A;  4X65 Q;  1VQ8 A;  3BZK A;  5IYB H;  4LFA L;  4HJ9 A;  2ZJQ A;  4KHZ A;  4IFD J;  5M3F G;  5AJ3 L;  1NJI C;  5IYD H;  1JT8 A;  1QZG A;  4HJ7 A;  3KDF A;  3U4V A;  4K0K L;  4R4C A;  4C3J H;  4QGU A;  3CCU A;  3TQY A;  1Q82 C;  4LWC A;  2UXC Q;  1BBU A;  2N8N A;  1KRS A;  4AYB G;  3D0F A;  1FL0 A;  1XNR L;  2F4V Q;  4OO1 I;  4DKA C;  3TS0 A;  3KF6 B;  1Y1V G;  4HIO A;  4KHP L;  1X65 A;  3I4N H;  4A4I A;  1T9H A;  3RLN A;  1HZC A;  3EN2 A;  4IPG A;  3GTJ H;  2YYZ A;  3JAM i;  4LF8 L;  4OWT B;  3L2P A;  1FJG Q;  3W5O A;  3CP0 A;  4DV1 Q;  4GNX C;  4MTN A;  3ICE A;  5IP7 G;  2DUD A;  4JOI C;  1N32 L;  4LF9 Q;  3BJU A;  3UDX A;  2AWN A;  2KEN A;  3E0E A;  2PMZ E;  2JK8 A;  5HGQ A;  4BXX G;  3CF5 A;  1A63 A;  1GD7 A;  2ZJR A;  2ES2 A;  2UXB Q;  5LMN Q;  1LYL A;  3S1Q H;  3CAM A;  2WB1 G;  4BA2 I;  1E1O A;  5M5Y H;  4DR4 L;  1VQH A;  3JC6 6;  4IPC A;  4JBJ A;  4OXP A;  4R4T A;  4TVA B;  4AH6 A;  3T1Y L;  1OTC A;  5LMU Q;  3PUX A;  2Q2T A;  4OX9 L;  1XMO L;  2UXB L;  4XIG S;  3CC4 A;  4C3I H;  4DR2 Q;  4A75 A;  3GTQ H;  4JI2 Q;  1O7I A;  3CXC A;  1HNW L;  4PZ6 A;  4RMF A;  1PH5 A;  1C0A A;  1JMC A;  3H3V H;  3M4Q A;  1WOC A;  2JEB I;  1SLJ A;  4JOI A;  1PH4 A;  1VQG A;  4GNX A;  2JA9 A;  2OQ0 A;  5IP9 G;  2R7D A;  3KJP A;  2WP8 J;  3M4P A;  2Y0S G;  3A5U A;  1AE2 A;  1HNZ L;  3PSI A;  2JA6 H;  1YHA A;  3AFQ A;  1I50 H;  4JBM A;  4GOP B;  3NBH B;  2C35 B;  1YHB A;  2E5L L;  4LF5 L;  3MEF A;  1K0R A;  1H95 A;  5J3B A;  4A3L G;  2WAQ E;  1G51 A;  3H3V I;  4YHH Q;  1IBK Q;  1P16 A;  3A5Z B;  1PYB A;  1Q12 A;  1WI5 A;  1FVI A;  5JEA G;  2E5L Q;  2I5H A;  1N33 L;  2ZM6 Q;  3HOZ H;  3RZD H;  3CCJ A;  4DAM A;  5M3M H;  5C0X I;  1KIX A;  2VUM G;  1QZH A;  3CCR A;  3I4O A;  1PH2 A;  5IYB G;  1PH1 A;  4DV4 L;  2ZTE A;  3K8A A;  4P75 A;  5BR8 Q;  2R7Z H;  3PUY A;  3CQZ H;  4EX5 A;  2B3G A;  2QEX A;  1EWI A;  4YCV A;  1N32 Q;  1SE8 A;  2CQO A;  1VQ4 A;  2XGT A;  1JJ2 A;  4JI6 Q;  1HZ9 A;  1SMX A;  3CD6 A;  2MQH A;  2OTL A;  1C7Y A;  2B29 A;  1Q8K A;  2NN6 G;  1HNX Q;  4JI1 Q;  1G29 1;  2AMC B;  1KHI A;  2MFI A;  3H0G H;  4P73 A;  3CME A;  1KQS A;  4O2D A;  4GKK Q;  3L0O A;  3S17 H;  4GN5 A;  1KC8 C;  1SRO A;  4LFC Q;  3TRZ A;  4GOP C;  2B63 H;  3U50 C;  3J80 i;  4GNX B;  1FJG L;  3RLO A;  1OXS C;  4BBS H;  4HJ8 A;  1PYS B;  3F1Z A;  4YCU A;  1BVS A;  2F3I A;  2PQA A;  4KI0 A;  1YJN A;  1UWV A;  4GKJ Q;  2VQF L;  1LUZ A;  1VQ9 A;  4B3M Q;  5C4X H;  2JQO A;  1KD1 C;  1JJG A;  3GTO H;  1UE1 A;  3K7U C;  4UP9 A;  1L0W A;  3PF5 A;  2NVX H;  3LGJ A;  5ELN A;  1KXL A;  2N78 A;  3M4O H;  3F2D A;  1J5E Q;  3PIP A;  2UXC L;  3PV0 A;  3PUW A;  4X64 Q;  1UE5 A;  1VQK A;  3ULL A;  5LMN W;  2NVQ H;  5ELO A;  1K73 C;  4POG A;  4LFB L;  2VS1 A;  1VQP A;  4JI2 L;  3AEV A;  2OTJ A;  2JJQ A;  4DV5 Q;  4JI4 L;  1B7Y B;  3HKZ G;  4DV0 L;  4BY7 G;  4JI7 Q;  3GDE A;  2K5H A;  4JI8 Q;  1CUK A;  1VCI A;  2MO1 A;  3GO5 A;  3PUV A;  3KOJ A;  1TWH H;  1CKO A;  1XTD A;  1OXT A;  4HID A;  4JYA L;  1SN8 A;  4DV5 L;  4A3M G;  2A8V A;  5EAY A;  4DR6 L;  3HOY H;  2RCN A;  3U58 A;  3UDI A;  3I56 A;  5JJI A;  2R6G A;  1Y1V H;  3W1G A;  5FJ8 G;  3H15 A;  1L2F A;  2MNA A;  2ZTC A;  1IXR A;  2WFW A;  4HJ5 A;  4B3S Q;  1X6O A;  5C3E G;  4DV3 L;  1XPO A;  3OTO Q;  2K75 A;  2KBN A;  4IOC A;  3FKI H;  2JA5 G;  4A76 A;  5GRO A;  4GLX A;  4PMW A;  3RR5 A;  1YI2 A;  1M90 C;  1K8G A;  3SGI A;  2LSS A;  4DUZ Q;  4DV3 Q;  4TQU S;  4B3T L;  4A3I H;  2BH2 A;  4YY3 L;  1PH3 A;  3I4N G;  3WWV A;  3J7Z C;  4A3B G;  2JA7 H;  3HOV H;  3HOU G;  2XTI A;  4A3F H;  4A3C H;  1PH8 A;  4LF6 Q;  1E24 A;  1RL2 A;  3I7F A;  2VQE L;  4YY3 Q;  3M85 A;  3AFP A;  1UE6 A;  4UY8 C;  4X66 Q;  3HOW H;  2YTX A;  1HJP A;  2UU9 L;  4LF6 L;  3CCV A;  2NZH A;  4JI6 L;  1V1Q A;  1G6P A;  4DR5 L;  2D0P A;  4AIM A;  4DR7 Q;  1N34 Q;  2UUB Q;  4A93 H;  2JA8 H;  4DNI A;  1I94 L;  1E22 A;  1S72 A;  3F8T A;  1EFW A;  1PHJ A;  1VQO A;  1XNR Q;  4OX9 Q;  2F4V L;  1YJW A;  1EUJ A;  3PO3 H;  1I94 Q;  1IBM L;  3CC7 A;  3CCQ A;  4IO9 A;  1PH7 A;  4A3E G;  4DV7 L;  1Q7Y C;  1YZ6 A;  1D8L A;  2UXD Q;  4UPA A;  3UE0 A;  3Q8D A;  4GLA C;  4C2M H;  1MJC A;  2K5N A;  1VQI A;  1KAW A;  2L15 A;  4XTC S;  4LNQ A;  4A3E H;  3J7A 5;  1CSQ A;  1EOV A;  2JE6 I;  1IBM Q;  1VQN A;  3K80 C;  4Y52 H;  4APV A;  1J5E L;  5M5W H;  1Y1W H;  2H5X A;  1D7Q A;  4JV5 Q;  1XMQ L;  2Q2U A;  2BH8 A;  1IL2 A;  2IX0 A;  3ZJY C;  3TRE A;  3RN2 A;  3EIV A;  1C9O A;  3I4M H;  5JJK A;  4POF A;  2CFM A;  1YIJ A;  1TWF H;  3G48 A;  2R93 G;  3PF4 A;  3E9I A;  2V1C C;  2Z6K C;  4MZ9 A;  2WAQ G;  4DV1 L;  4GLV B;  5C0X J;  4BXX H;  1XNQ Q;  1TWC H;  4LUO A;  1VQ6 A;  3FHW A;  5GQO A;  4X65 L;  4A3K G;  4DK6 C;  4DV2 Q;  1MJE A;  1XPU A;  3S2H H;  4YWM A;  4DR6 Q;  1HNW Q;  1Q86 C;  4B3M L;  4JI5 Q;  1VQL A;  4MNO A;  3RLF A;  1GKH A;  1E7Z A;  4R4I A;  2ALY B;  4OO1 G;  1N36 L;  4A3G H;  1WJJ A;  4A3I G;  2HHH Q;  3K7A H;  2VNU D;  5E7N A;  4JI4 Q;  3ULP A;  1HZA A;  2DGY A;  2GVA A;  2VL6 A;  4DV0 Q;  1ASZ A;  1CSP A;  1J6Q A;  3M9B A;  4JI8 L;  3GTM H;  3OYY A;  1CKM A;  1PH6 A;  3STB D;  5LMN L;  1VQJ A;  3HKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...