1CSXA

Replacements in a conserved leucine cluster in the hydrophobic heme pocket of cytochrome c
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
107
Chain Sequence
TEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWDENNMSEYLTNPKYIPGTKMAFGGLKKEKDRNDSITYLKKATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C
publication title Replacements in a conserved leucine cluster in the hydrophobic heme pocket of cytochrome c.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport(heme protein)
total genus 33
structure length 107
sequence length 108
ec nomenclature
pdb deposition date 1994-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1csxA00
1CRGA 4L3HA 1KIBA 3RLMA 2ZBOA 2B0ZB 1FHBA 2CXBA 4NFGB 2JQRA 1KYOD 4FA1A 4H0KA 5CIHB 2C9XB 3CX5D 4H0JA 1N50A 3H1KD 3SXTA 3L4OA 1I5TA 1N90A 1K3HA 4QAOA 1CIGA 5DF5A 1ZZHA 1CTZA 2V08A 1YEBA 1YTCA 1N15A 1H31B 2YCCA 1KB0A 1FOCA 2V07A 2A06D 1NTZD 3HQ6A 3RN1A 2VHDA 2BCNB 1EB7A 1KX2A 1SQVD 1S6VB 4EIFA 1HJ4A 1CEDA 1CRHA 1YNRA 1WEJF 4FAVA 2HV4A 2GC7D 1M6ZA 1MG2D 1I54A 3WFEC 1A8CA 1H1OA 2GB8B 3C2CA 3VNWA 4JCGA 1CTJA 2BH5X 1AOQA 4FA4A 1DIIC 1CYJA 1DW0A 1GIWA 4WQDA 1C6OA 1FI7A 1HROA 1LFMA 4AANA 2AI5A 1FCDC 2JTIB 1I8PA 2D0WA 1H9YA 1I6DA 4V2KA 5CIBB 2C1DB 3L4MA 5DFSA 1WVEC 4FANA 1VYDA 1BL9A 2N3YA 1FI9A 3O5CA 3WFCC 1KX7A 1CTYA 5KAIV 2DVHA 3O20A 1H32B 1CSXA 1H33B 1BE3D 1HCMA 3CWBD 1QYZA 3CYTI 3H1HD 5CIFB 4LJIA 4L3GA 4UB6V 1CO6A 2N18B 1NMIA 3H1JD 1L0LD 4MU8A 4WQCA 4XYDB 2PCCB 4J20A 1E2RA 3OCDA 5B6QA 1RAQA 2D0SA 1F1FA 2DGEA 2I8FA 2QJYB 3L71D 5KAFV 4EIEA 3CP5A 1YFCA 2C8SA 3ZCFA 1BGYD 5IY51 2XTSB 3TYIA 3MK7B 1IZL0 3RN0A 1C6RA 2OZ1B 3CXHD 4WQ7A 2AXTV 3NWVA 1PPJD 2C1DA 2CE1A 1HRCA 4WQ8A 1SQBD 1CHJA 4EICA 2EXVA 1JDLA 1H32A 4PD4D 1NMLA 2CA3B 2FWLA 2N3BA 1C2RA 1CXAA 3HQ9A 3HQ8A 5CYTR 1GDVA 3H1LD 1GKSA 2ZZS1 3PH2B 1NNOA 2IBZD 2BPBB 5GTIV 4WQ9A 1YEAA 1I8OA 3WC8A 1KYOW 1CXCA 3SWSA 3BCCD 1H9XA 3A0HV 1I6EA 3CX5W 1HZUA 3VYMA 1SQPD 1DIQC 1YICA 4WQAA 4AAOA 3HQ7A 1CHHA 5E79V 2B4ZA 4IL6V 155CA 3NBSA 3ORVA 1J3SA 1CIEA 3O0RC 1M70A 1MZ4A 2OZ1A 2MHMA 1HJ3A 3WUIA 1P84D 1QL3A 1U74B 1C52A 2YQBA 1U75B 3OA8B 1QN2A 3NBTA 3ZIYA 2CE0A 1R0QA 4Q5PA 5EXQA 5KLIB 2MTAC 1H31A 1L9BC 3PXWA 2C2CA 4Y5RA 4GYDA 4UB8V 4N0KA 1CIHA 1ETPA 3M97X 1LC1A 1LS9A 3WFBC 1A56A 1FJ0A 1CIFA 2PCBB 2QJKB 2B10B 5B5EV 2FRCA 1GQ1A 5C0ZA 3A0BV 5CIGB 3L75D 1HH7A 1COTA 2BCCD 3ZOYA 1AKKA 1CRIA 2GC4D 2FYNB 2GIWA 1DW1A 2FYUD 1YCCA 1OCDA 3PXTA 4FA9A 2CA4B 1LMSA 1QKSA 2C1UA 4AAMA 1MG3D 2C1VA 1L0ND 1GU2A 1PP9D 1CORA 5DJQC 4EIDA 1C7MA 3OA8A 1DW2A 1W2LA 3SJLA 1NU1D 3ZOOA 1EZVD 4O1QA 1CYCA 1AOFA 1CHIA 3X39A 2LIRA 3L74D 1AYGA 1BCCD 1RZ6A 1H33A 1IO3A 4DY9A 4PWAA 4AALA 2ZONG 1B7VA 1OAEA 2B12B 3PXSA 5KKZB 4FA5A 3JBTB 2N9JA 5DJQB 1NIRA 1RAPA 3A9FA 3RMZA 1KV9A 2ZXYA 1N9CA 4K3IA 1CCRA 351CA 1DT1A 1E8EA 1L9JC 4GEDB 1CNOA 2ORLA 4YE1A 1SQQD 2ZOOA 4PW9B 1CC5A 3CXHW 1SQXD 4O1WA 3ZBMA 2QJPB 1S5LV 2YK3A 1CCHA 1K3GA 3WFDC 4RSZA 4WQBA 1C75A 2BGVX 1CSUA 2PACA 3DR0A 3OCDB 1DW3A 3SVWA 4U3FD 4PJ0V 4KMGA 3ZOWA 2BH4X 1W5CT 1C2NA 5CIEB 3DP5A 1QL4A 3VRDA 1NTMD 1RZ5A 1E29A 1GJQA 3L70D 1DVHA 3CU4A 3H1ID 2N9IA 3SLEA 1CSVA 1CYIA 2L4DA 1CRYA 1ZRTD 1M60A 2YIUB 3WU2V 5GTHV 1CRCA 1I55A 2B11B 1KB9D 5CIDB 1IRWA 2N18C 5AURA 4WQEA 5TISV 1F1CA 1HJ5A 2LITA 5CICB 4P4QB 1CRJA 5H2FV 1C6SA 3O1YA 4AX3A 4FB1A 1LC2A 1A2SA 3DMIA 5B66V 3TGUD 3KZIV 1CSWA 3L72D 5C9MA 4XXLA 1IRVA 5KLVD 2AIUA 3MK7C 451CA 1YIQA 4D6TD 1NTKD 1DVVA 2BLFB 1FI3A 1IQCA 4L1QA 1HZVA 3ZOXA 3L73D
chains in the Genus database with same CATH superfamily
1CRGA 4L3HA 1KIBA 3RLMA 2ZBOA 2B0ZB 1FHBA 2CXBA 4NFGB 2JQRA 1KYOD 4FA1A 4H0KA 5CIHB 2C9XB 3CX5D 4H0JA 1N50A 3H1KD 3SXTA 3L4OA 1I5TA 1N90A 1K3HA 4QAOA 1CIGA 5DF5A 1ZZHA 1CTZA 2V08A 1YEBA 1YTCA 1N15A 1H31B 2YCCA 1KB0A 1FOCA 2V07A 2A06D 1NTZD 3HQ6A 3RN1A 2VHDA 2BCNB 1EB7A 1KX2A 1SQVD 1S6VB 4EIFA 1HJ4A 1CEDA 1CRHA 1YNRA 1WEJF 4FAVA 2HV4A 2GC7D 1M6ZA 1MG2D 1I54A 3WFEC 1A8CA 1H1OA 2GB8B 3C2CA 3VNWA 4JCGA 1CTJA 2BH5X 1AOQA 4FA4A 1DIIC 1CYJA 1DW0A 1GIWA 4WQDA 1C6OA 1FI7A 1HROA 1LFMA 4AANA 2AI5A 1FCDC 2JTIB 1I8PA 2D0WA 1H9YA 1I6DA 4V2KA 5CIBB 2C1DB 3L4MA 5DFSA 1WVEC 4FANA 1VYDA 1BL9A 2N3YA 1FI9A 3O5CA 3WFCC 1KX7A 1CTYA 5KAIV 2DVHA 3O20A 1H32B 1CSXA 1H33B 1BE3D 1HCMA 3CWBD 1QYZA 3CYTI 3H1HD 5CIFB 4LJIA 4L3GA 4UB6V 1CO6A 2N18B 1NMIA 3H1JD 1L0LD 4MU8A 4WQCA 4XYDB 2PCCB 4J20A 1E2RA 3OCDA 5B6QA 1RAQA 2D0SA 1F1FA 2DGEA 2I8FA 2QJYB 3L71D 5KAFV 4EIEA 3CP5A 1YFCA 2C8SA 3ZCFA 1BGYD 5IY51 2XTSB 3TYIA 3MK7B 1IZL0 3RN0A 1C6RA 2OZ1B 3CXHD 4WQ7A 2AXTV 3NWVA 1PPJD 2C1DA 2CE1A 1HRCA 4WQ8A 1SQBD 1CHJA 4EICA 2EXVA 1JDLA 1H32A 4PD4D 1NMLA 2CA3B 2FWLA 2N3BA 1C2RA 1CXAA 3HQ9A 3HQ8A 5CYTR 1GDVA 3H1LD 1GKSA 2ZZS1 3PH2B 1NNOA 2IBZD 2BPBB 5GTIV 4WQ9A 1YEAA 1I8OA 3WC8A 1KYOW 1CXCA 3SWSA 3BCCD 1H9XA 3A0HV 1I6EA 3CX5W 1HZUA 3VYMA 1SQPD 1DIQC 1YICA 4WQAA 4AAOA 3HQ7A 1CHHA 5E79V 2B4ZA 4IL6V 155CA 3NBSA 3ORVA 1J3SA 1CIEA 3O0RC 1M70A 1MZ4A 2OZ1A 2MHMA 1HJ3A 3WUIA 1P84D 1QL3A 1U74B 1C52A 2YQBA 1U75B 3OA8B 1QN2A 3NBTA 3ZIYA 2CE0A 1R0QA 4Q5PA 5EXQA 5KLIB 2MTAC 1H31A 1L9BC 3PXWA 2C2CA 4Y5RA 4GYDA 4UB8V 4N0KA 1CIHA 1ETPA 3M97X 1LC1A 1LS9A 3WFBC 1A56A 1FJ0A 1CIFA 2PCBB 2QJKB 2B10B 5B5EV 2FRCA 1GQ1A 5C0ZA 3A0BV 5CIGB 3L75D 3D0WA 1HH7A 1COTA 2BCCD 3ZOYA 1AKKA 1CRIA 2GC4D 2FYNB 2GIWA 1DW1A 2FYUD 1YCCA 1OCDA 3PXTA 4FA9A 2CA4B 1LMSA 1QKSA 2C1UA 4AAMA 1MG3D 2C1VA 1L0ND 1GU2A 1PP9D 1CORA 5DJQC 4EIDA 1C7MA 3OA8A 1DW2A 1W2LA 3SJLA 1NU1D 3ZOOA 1EZVD 4O1QA 1CYCA 1AOFA 1CHIA 3X39A 2LIRA 3L74D 1AYGA 1BCCD 1RZ6A 1H33A 1IO3A 4DY9A 4PWAA 4AALA 2ZONG 1B7VA 1OAEA 2B12B 3PXSA 5KKZB 4FA5A 3JBTB 2N9JA 5DJQB 1NIRA 1RAPA 3A9FA 3RMZA 1KV9A 2ZXYA 1N9CA 4K3IA 1CCRA 351CA 1DT1A 1E8EA 1L9JC 4GEDB 1CNOA 2ORLA 4YE1A 1SQQD 2ZOOA 4PW9B 1CC5A 3CXHW 1SQXD 4O1WA 3ZBMA 2QJPB 1S5LV 2YK3A 1CCHA 1K3GA 3WFDC 4RSZA 4WQBA 1C75A 2BGVX 1CSUA 2PACA 3DR0A 3OCDB 1DW3A 3SVWA 4U3FD 4PJ0V 4KMGA 3ZOWA 2BH4X 1W5CT 1C2NA 5CIEB 3DP5A 1QL4A 3VRDA 1NTMD 1RZ5A 1E29A 1GJQA 3L70D 1DVHA 3CU4A 3H1ID 2N9IA 3SLEA 1CSVA 1CYIA 2L4DA 1CRYA 1ZRTD 1M60A 2YIUB 3WU2V 5GTHV 1CRCA 1I55A 2B11B 1KB9D 5CIDB 1IRWA 2N18C 5AURA 4WQEA 5TISV 1F1CA 1HJ5A 2LITA 5CICB 4P4QB 1CRJA 5H2FV 1C6SA 3O1YA 4AX3A 4FB1A 1LC2A 1A2SA 3DMIA 5B66V 3TGUD 3KZIV 1CSWA 3L72D 5C9MA 4XXLA 1IRVA 5KLVD 2AIUA 3MK7C 451CA 1YIQA 4D6TD 1NTKD 1DVVA 2BLFB 1FI3A 1IQCA 4L1QA 1HZVA 3ZOXA 3L73D
chains in the Genus database with same CATH topology
1CRGA 4L3HA 1KIBA 3RLMA 2ZBOA 2B0ZB 1FHBA 2CXBA 4NFGB 2JQRA 1KYOD 4FA1A 4H0KA 5CIHB 2C9XB 3CX5D 4H0JA 1N50A 3H1KD 3SXTA 3L4OA 1I5TA 1N90A 1K3HA 4QAOA 1CIGA 5DF5A 1ZZHA 1CTZA 2V08A 1YEBA 1YTCA 1N15A 1H31B 2YCCA 1KB0A 1FOCA 2V07A 2A06D 1NTZD 3HQ6A 3RN1A 2VHDA 2BCNB 1EB7A 1KX2A 1SQVD 1S6VB 4EIFA 1HJ4A 1CEDA 1CRHA 1YNRA 1WEJF 4FAVA 2HV4A 2GC7D 1M6ZA 1MG2D 1I54A 3WFEC 1A8CA 1H1OA 2GB8B 3C2CA 3VNWA 4JCGA 1CTJA 2BH5X 1AOQA 4FA4A 1DIIC 1CYJA 1DW0A 1GIWA 4WQDA 1C6OA 1FI7A 1HROA 1LFMA 4AANA 2AI5A 1FCDC 2JTIB 1I8PA 2D0WA 1H9YA 1I6DA 4V2KA 5CIBB 2C1DB 3L4MA 5DFSA 1WVEC 4FANA 1VYDA 1BL9A 2N3YA 1FI9A 3O5CA 3WFCC 1KX7A 1CTYA 5KAIV 2DVHA 3O20A 1H32B 1CSXA 1H33B 1BE3D 1HCMA 3CWBD 1QYZA 3CYTI 3H1HD 5CIFB 4LJIA 4L3GA 4UB6V 1CO6A 2N18B 1NMIA 3H1JD 1L0LD 4MU8A 4WQCA 4XYDB 2PCCB 4J20A 1E2RA 3OCDA 5B6QA 1RAQA 2D0SA 1F1FA 2DGEA 2I8FA 2QJYB 3L71D 5KAFV 4EIEA 3CP5A 1YFCA 2C8SA 3ZCFA 1BGYD 5IY51 2XTSB 3TYIA 3MK7B 1IZL0 3RN0A 1C6RA 2OZ1B 3CXHD 4WQ7A 2AXTV 3NWVA 1PPJD 2C1DA 2CE1A 1HRCA 4WQ8A 1SQBD 1CHJA 4EICA 2EXVA 1JDLA 1H32A 4PD4D 1NMLA 2CA3B 2FWLA 2N3BA 1C2RA 1CXAA 3HQ9A 3HQ8A 5CYTR 1GDVA 3H1LD 1GKSA 2ZZS1 3PH2B 1NNOA 2IBZD 2BPBB 5GTIV 4WQ9A 1YEAA 1I8OA 3WC8A 1KYOW 1CXCA 3SWSA 3BCCD 1H9XA 3A0HV 1I6EA 3CX5W 1HZUA 3VYMA 1SQPD 1DIQC 1YICA 4WQAA 4AAOA 3HQ7A 1CHHA 5E79V 2B4ZA 4IL6V 155CA 3NBSA 3ORVA 1J3SA 1CIEA 3O0RC 1M70A 1MZ4A 2OZ1A 2MHMA 1HJ3A 3WUIA 1P84D 1QL3A 1U74B 1C52A 2YQBA 1U75B 3OA8B 1QN2A 3NBTA 3ZIYA 2CE0A 1R0QA 4Q5PA 5EXQA 5KLIB 2MTAC 1H31A 1L9BC 3PXWA 2C2CA 4Y5RA 4GYDA 4UB8V 4N0KA 1CIHA 1ETPA 3M97X 1LC1A 1LS9A 3WFBC 1A56A 1FJ0A 1CIFA 2PCBB 2QJKB 2B10B 5B5EV 2FRCA 1GQ1A 5C0ZA 3A0BV 5CIGB 3L75D 1HH7A 1COTA 2BCCD 3ZOYA 1AKKA 1CRIA 2GC4D 2FYNB 2GIWA 1DW1A 2FYUD 1YCCA 1OCDA 3PXTA 4FA9A 2CA4B 1LMSA 1QKSA 2C1UA 4AAMA 1MG3D 2C1VA 1L0ND 1GU2A 1PP9D 1CORA 5DJQC 4EIDA 1C7MA 3OA8A 1DW2A 1W2LA 3SJLA 1NU1D 3ZOOA 1EZVD 4O1QA 1CYCA 1AOFA 1CHIA 3X39A 2LIRA 3L74D 1AYGA 1BCCD 1RZ6A 1H33A 1IO3A 4DY9A 4PWAA 4AALA 2ZONG 1B7VA 1OAEA 2B12B 3PXSA 5KKZB 4FA5A 3JBTB 2N9JA 5DJQB 1NIRA 1RAPA 3A9FA 3RMZA 1KV9A 2ZXYA 1N9CA 4K3IA 1CCRA 351CA 1DT1A 1E8EA 1L9JC 4GEDB 1CNOA 2ORLA 4YE1A 1SQQD 2ZOOA 4PW9B 1CC5A 3CXHW 1SQXD 4O1WA 3ZBMA 2QJPB 1S5LV 2YK3A 1CCHA 1K3GA 3WFDC 4RSZA 4WQBA 1C75A 2BGVX 1CSUA 2PACA 3DR0A 3OCDB 1DW3A 3SVWA 4U3FD 4PJ0V 4KMGA 3ZOWA 2BH4X 1W5CT 1C2NA 5CIEB 3DP5A 1QL4A 3VRDA 1NTMD 1RZ5A 1E29A 1GJQA 3L70D 1DVHA 3CU4A 3H1ID 2N9IA 3SLEA 1CSVA 1CYIA 2L4DA 1CRYA 1ZRTD 1M60A 2YIUB 3WU2V 5GTHV 1CRCA 1I55A 2B11B 1KB9D 5CIDB 1IRWA 2N18C 5AURA 4WQEA 5TISV 1F1CA 1HJ5A 2LITA 5CICB 4P4QB 1CRJA 5H2FV 1C6SA 3O1YA 4AX3A 4FB1A 1LC2A 1A2SA 3DMIA 5B66V 3TGUD 3KZIV 1CSWA 3L72D 5C9MA 4XXLA 1IRVA 5KLVD 2AIUA 3MK7C 451CA 1YIQA 4D6TD 1NTKD 1DVVA 2BLFB 1FI3A 1IQCA 4L1QA 1HZVA 3ZOXA 3L73D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CRG A;  4L3H A;  1KIB A;  3RLM A;  2ZBO A;  2B0Z B;  1FHB A;  2CXB A;  4NFG B;  2JQR A;  1KYO D;  4FA1 A;  4H0K A;  5CIH B;  2C9X B;  3CX5 D;  4H0J A;  1N50 A;  3H1K D;  3SXT A;  3L4O A;  1I5T A;  1N90 A;  1K3H A;  4QAO A;  1CIG A;  5DF5 A;  1ZZH A;  1CTZ A;  2V08 A;  1YEB A;  1YTC A;  1N15 A;  1H31 B;  2YCC A;  1KB0 A;  1FOC A;  2V07 A;  2A06 D;  1NTZ D;  3HQ6 A;  3RN1 A;  2VHD A;  2BCN B;  1EB7 A;  1KX2 A;  1SQV D;  1S6V B;  4EIF A;  1HJ4 A;  1CED A;  1CRH A;  1YNR A;  1WEJ F;  4FAV A;  2HV4 A;  2GC7 D;  1M6Z A;  1MG2 D;  1I54 A;  3WFE C;  1A8C A;  1H1O A;  2GB8 B;  3C2C A;  3VNW A;  4JCG A;  1CTJ A;  2BH5 X;  1AOQ A;  4FA4 A;  1DII C;  1CYJ A;  1DW0 A;  1GIW A;  4WQD A;  1C6O A;  1FI7 A;  1HRO A;  1LFM A;  4AAN A;  2AI5 A;  1FCD C;  2JTI B;  1I8P A;  2D0W A;  1H9Y A;  1I6D A;  4V2K A;  5CIB B;  2C1D B;  3L4M A;  5DFS A;  1WVE C;  4FAN A;  1VYD A;  1BL9 A;  2N3Y A;  1FI9 A;  3O5C A;  3WFC C;  1KX7 A;  1CTY A;  5KAI V;  2DVH A;  3O20 A;  1H32 B;  1CSX A;  1H33 B;  1BE3 D;  1HCM A;  3CWB D;  1QYZ A;  3CYT I;  3H1H D;  5CIF B;  4LJI A;  4L3G A;  4UB6 V;  1CO6 A;  2N18 B;  1NMI A;  3H1J D;  1L0L D;  4MU8 A;  4WQC A;  4XYD B;  2PCC B;  4J20 A;  1E2R A;  3OCD A;  5B6Q A;  1RAQ A;  2D0S A;  1F1F A;  2DGE A;  2I8F A;  2QJY B;  3L71 D;  5KAF V;  4EIE A;  3CP5 A;  1YFC A;  2C8S A;  3ZCF A;  1BGY D;  5IY5 1;  2XTS B;  3TYI A;  3MK7 B;  1IZL 0;  3RN0 A;  1C6R A;  2OZ1 B;  3CXH D;  4WQ7 A;  2AXT V;  3NWV A;  1PPJ D;  2C1D A;  2CE1 A;  1HRC A;  4WQ8 A;  1SQB D;  1CHJ A;  4EIC A;  2EXV A;  1JDL A;  1H32 A;  4PD4 D;  1NML A;  2CA3 B;  2FWL A;  2N3B A;  1C2R A;  1CXA A;  3HQ9 A;  3HQ8 A;  5CYT R;  1GDV A;  3H1L D;  1GKS A;  2ZZS 1;  3PH2 B;  1NNO A;  2IBZ D;  2BPB B;  5GTI V;  4WQ9 A;  1YEA A;  1I8O A;  3WC8 A;  1KYO W;  1CXC A;  3SWS A;  3BCC D;  1H9X A;  3A0H V;  1I6E A;  3CX5 W;  1HZU A;  3VYM A;  1SQP D;  1DIQ C;  1YIC A;  4WQA A;  4AAO A;  3HQ7 A;  1CHH A;  5E79 V;  2B4Z A;  4IL6 V;  155C A;  3NBS A;  3ORV A;  1J3S A;  1CIE A;  3O0R C;  1M70 A;  1MZ4 A;  2OZ1 A;  2MHM A;  1HJ3 A;  3WUI A;  1P84 D;  1QL3 A;  1U74 B;  1C52 A;  2YQB A;  1U75 B;  3OA8 B;  1QN2 A;  3NBT A;  3ZIY A;  2CE0 A;  1R0Q A;  4Q5P A;  5EXQ A;  5KLI B;  2MTA C;  1H31 A;  1L9B C;  3PXW A;  2C2C A;  4Y5R A;  4GYD A;  4UB8 V;  4N0K A;  1CIH A;  1ETP A;  3M97 X;  1LC1 A;  1LS9 A;  3WFB C;  1A56 A;  1FJ0 A;  1CIF A;  2PCB B;  2QJK B;  2B10 B;  5B5E V;  2FRC A;  1GQ1 A;  5C0Z A;  3A0B V;  5CIG B;  3L75 D;  1HH7 A;  1COT A;  2BCC D;  3ZOY A;  1AKK A;  1CRI A;  2GC4 D;  2FYN B;  2GIW A;  1DW1 A;  2FYU D;  1YCC A;  1OCD A;  3PXT A;  4FA9 A;  2CA4 B;  1LMS A;  1QKS A;  2C1U A;  4AAM A;  1MG3 D;  2C1V A;  1L0N D;  1GU2 A;  1PP9 D;  1COR A;  5DJQ C;  4EID A;  1C7M A;  3OA8 A;  1DW2 A;  1W2L A;  3SJL A;  1NU1 D;  3ZOO A;  1EZV D;  4O1Q A;  1CYC A;  1AOF A;  1CHI A;  3X39 A;  2LIR A;  3L74 D;  1AYG A;  1BCC D;  1RZ6 A;  1H33 A;  1IO3 A;  4DY9 A;  4PWA A;  4AAL A;  2ZON G;  1B7V A;  1OAE A;  2B12 B;  3PXS A;  5KKZ B;  4FA5 A;  3JBT B;  2N9J A;  5DJQ B;  1NIR A;  1RAP A;  3A9F A;  3RMZ A;  1KV9 A;  2ZXY A;  1N9C A;  4K3I A;  1CCR A;  351C A;  1DT1 A;  1E8E A;  1L9J C;  4GED B;  1CNO A;  2ORL A;  4YE1 A;  1SQQ D;  2ZOO A;  4PW9 B;  1CC5 A;  3CXH W;  1SQX D;  4O1W A;  3ZBM A;  2QJP B;  1S5L V;  2YK3 A;  1CCH A;  1K3G A;  3WFD C;  4RSZ A;  4WQB A;  1C75 A;  2BGV X;  1CSU A;  2PAC A;  3DR0 A;  3OCD B;  1DW3 A;  3SVW A;  4U3F D;  4PJ0 V;  4KMG A;  3ZOW A;  2BH4 X;  1W5C T;  1C2N A;  5CIE B;  3DP5 A;  1QL4 A;  3VRD A;  1NTM D;  1RZ5 A;  1E29 A;  1GJQ A;  3L70 D;  1DVH A;  3CU4 A;  3H1I D;  2N9I A;  3SLE A;  1CSV A;  1CYI A;  2L4D A;  1CRY A;  1ZRT D;  1M60 A;  2YIU B;  3WU2 V;  5GTH V;  1CRC A;  1I55 A;  2B11 B;  1KB9 D;  5CID B;  1IRW A;  2N18 C;  5AUR A;  4WQE A;  5TIS V;  1F1C A;  1HJ5 A;  2LIT A;  5CIC B;  4P4Q B;  1CRJ A;  5H2F V;  1C6S A;  3O1Y A;  4AX3 A;  4FB1 A;  1LC2 A;  1A2S A;  3DMI A;  5B66 V;  3TGU D;  3KZI V;  1CSW A;  3L72 D;  5C9M A;  4XXL A;  1IRV A;  5KLV D;  2AIU A;  3MK7 C;  451C A;  1YIQ A;  4D6T D;  1NTK D;  1DVV A;  2BLF B;  1FI3 A;  1IQC A;  4L1Q A;  1HZV A;  3ZOX A;  3L73 D; 
#chains in the Genus database with same CATH topology
 1CRG A;  4L3H A;  1KIB A;  3RLM A;  2ZBO A;  2B0Z B;  1FHB A;  2CXB A;  4NFG B;  2JQR A;  1KYO D;  4FA1 A;  4H0K A;  5CIH B;  2C9X B;  3CX5 D;  4H0J A;  1N50 A;  3H1K D;  3SXT A;  3L4O A;  1I5T A;  1N90 A;  1K3H A;  4QAO A;  1CIG A;  5DF5 A;  1ZZH A;  1CTZ A;  2V08 A;  1YEB A;  1YTC A;  1N15 A;  1H31 B;  2YCC A;  1KB0 A;  1FOC A;  2V07 A;  2A06 D;  1NTZ D;  3HQ6 A;  3RN1 A;  2VHD A;  2BCN B;  1EB7 A;  1KX2 A;  1SQV D;  1S6V B;  4EIF A;  1HJ4 A;  1CED A;  1CRH A;  1YNR A;  1WEJ F;  4FAV A;  2HV4 A;  2GC7 D;  1M6Z A;  1MG2 D;  1I54 A;  3WFE C;  1A8C A;  1H1O A;  2GB8 B;  3C2C A;  3VNW A;  4JCG A;  1CTJ A;  2BH5 X;  1AOQ A;  4FA4 A;  1DII C;  1CYJ A;  1DW0 A;  1GIW A;  4WQD A;  1C6O A;  1FI7 A;  1HRO A;  1LFM A;  4AAN A;  2AI5 A;  1FCD C;  2JTI B;  1I8P A;  2D0W A;  1H9Y A;  1I6D A;  4V2K A;  5CIB B;  2C1D B;  3L4M A;  5DFS A;  1WVE C;  4FAN A;  1VYD A;  1BL9 A;  2N3Y A;  1FI9 A;  3O5C A;  3WFC C;  1KX7 A;  1CTY A;  5KAI V;  2DVH A;  3O20 A;  1H32 B;  1CSX A;  1H33 B;  1BE3 D;  1HCM A;  3CWB D;  1QYZ A;  3CYT I;  3H1H D;  5CIF B;  4LJI A;  4L3G A;  4UB6 V;  1CO6 A;  2N18 B;  1NMI A;  3H1J D;  1L0L D;  4MU8 A;  4WQC A;  4XYD B;  2PCC B;  4J20 A;  1E2R A;  3OCD A;  5B6Q A;  1RAQ A;  2D0S A;  1F1F A;  2DGE A;  2I8F A;  2QJY B;  3L71 D;  5KAF V;  4EIE A;  3CP5 A;  1YFC A;  2C8S A;  3ZCF A;  1BGY D;  5IY5 1;  2XTS B;  3TYI A;  3MK7 B;  1IZL 0;  3RN0 A;  1C6R A;  2OZ1 B;  3CXH D;  4WQ7 A;  2AXT V;  3NWV A;  1PPJ D;  2C1D A;  2CE1 A;  1HRC A;  4WQ8 A;  1SQB D;  1CHJ A;  4EIC A;  2EXV A;  1JDL A;  1H32 A;  4PD4 D;  1NML A;  2CA3 B;  2FWL A;  2N3B A;  1C2R A;  1CXA A;  3HQ9 A;  3HQ8 A;  5CYT R;  1GDV A;  3H1L D;  1GKS A;  2ZZS 1;  3PH2 B;  1NNO A;  2IBZ D;  2BPB B;  5GTI V;  4WQ9 A;  1YEA A;  1I8O A;  3WC8 A;  1KYO W;  1CXC A;  3SWS A;  3BCC D;  1H9X A;  3A0H V;  1I6E A;  3CX5 W;  1HZU A;  3VYM A;  1SQP D;  1DIQ C;  1YIC A;  4WQA A;  4AAO A;  3HQ7 A;  1CHH A;  5E79 V;  2B4Z A;  4IL6 V;  155C A;  3NBS A;  3ORV A;  1J3S A;  1CIE A;  3O0R C;  1M70 A;  1MZ4 A;  2OZ1 A;  2MHM A;  1HJ3 A;  3WUI A;  1P84 D;  1QL3 A;  1U74 B;  1C52 A;  2YQB A;  1U75 B;  3OA8 B;  1QN2 A;  3NBT A;  3ZIY A;  2CE0 A;  1R0Q A;  4Q5P A;  5EXQ A;  5KLI B;  2MTA C;  1H31 A;  1L9B C;  3PXW A;  2C2C A;  4Y5R A;  4GYD A;  4UB8 V;  4N0K A;  1CIH A;  1ETP A;  3M97 X;  1LC1 A;  1LS9 A;  3WFB C;  1A56 A;  1FJ0 A;  1CIF A;  2PCB B;  2QJK B;  2B10 B;  5B5E V;  2FRC A;  1GQ1 A;  5C0Z A;  3A0B V;  5CIG B;  3L75 D;  3D0W A;  1HH7 A;  1COT A;  2BCC D;  3ZOY A;  1AKK A;  1CRI A;  2GC4 D;  2FYN B;  2GIW A;  1DW1 A;  2FYU D;  1YCC A;  1OCD A;  3PXT A;  4FA9 A;  2CA4 B;  1LMS A;  1QKS A;  2C1U A;  4AAM A;  1MG3 D;  2C1V A;  1L0N D;  1GU2 A;  1PP9 D;  1COR A;  5DJQ C;  4EID A;  1C7M A;  3OA8 A;  1DW2 A;  1W2L A;  3SJL A;  1NU1 D;  3ZOO A;  1EZV D;  4O1Q A;  1CYC A;  1AOF A;  1CHI A;  3X39 A;  2LIR A;  3L74 D;  1AYG A;  1BCC D;  1RZ6 A;  1H33 A;  1IO3 A;  4DY9 A;  4PWA A;  4AAL A;  2ZON G;  1B7V A;  1OAE A;  2B12 B;  3PXS A;  5KKZ B;  4FA5 A;  3JBT B;  2N9J A;  5DJQ B;  1NIR A;  1RAP A;  3A9F A;  3RMZ A;  1KV9 A;  2ZXY A;  1N9C A;  4K3I A;  1CCR A;  351C A;  1DT1 A;  1E8E A;  1L9J C;  4GED B;  1CNO A;  2ORL A;  4YE1 A;  1SQQ D;  2ZOO A;  4PW9 B;  1CC5 A;  3CXH W;  1SQX D;  4O1W A;  3ZBM A;  2QJP B;  1S5L V;  2YK3 A;  1CCH A;  1K3G A;  3WFD C;  4RSZ A;  4WQB A;  1C75 A;  2BGV X;  1CSU A;  2PAC A;  3DR0 A;  3OCD B;  1DW3 A;  3SVW A;  4U3F D;  4PJ0 V;  4KMG A;  3ZOW A;  2BH4 X;  1W5C T;  1C2N A;  5CIE B;  3DP5 A;  1QL4 A;  3VRD A;  1NTM D;  1RZ5 A;  1E29 A;  1GJQ A;  3L70 D;  1DVH A;  3CU4 A;  3H1I D;  2N9I A;  3SLE A;  1CSV A;  1CYI A;  2L4D A;  1CRY A;  1ZRT D;  1M60 A;  2YIU B;  3WU2 V;  5GTH V;  1CRC A;  1I55 A;  2B11 B;  1KB9 D;  5CID B;  1IRW A;  2N18 C;  5AUR A;  4WQE A;  5TIS V;  1F1C A;  1HJ5 A;  2LIT A;  5CIC B;  4P4Q B;  1CRJ A;  5H2F V;  1C6S A;  3O1Y A;  4AX3 A;  4FB1 A;  1LC2 A;  1A2S A;  3DMI A;  5B66 V;  3TGU D;  3KZI V;  1CSW A;  3L72 D;  5C9M A;  4XXL A;  1IRV A;  5KLV D;  2AIU A;  3MK7 C;  451C A;  1YIQ A;  4D6T D;  1NTK D;  1DVV A;  2BLF B;  1FI3 A;  1IQC A;  4L1Q A;  1HZV A;  3ZOX A;  3L73 D; 
#chains in the Genus database with same CATH homology
 1CRG A;  4L3H A;  1KIB A;  3RLM A;  2ZBO A;  2B0Z B;  1FHB A;  2CXB A;  4NFG B;  2JQR A;  1KYO D;  4FA1 A;  4H0K A;  5CIH B;  2C9X B;  3CX5 D;  4H0J A;  1N50 A;  3H1K D;  3SXT A;  3L4O A;  1I5T A;  1N90 A;  1K3H A;  4QAO A;  1CIG A;  5DF5 A;  1ZZH A;  1CTZ A;  2V08 A;  1YEB A;  1YTC A;  1N15 A;  1H31 B;  2YCC A;  1KB0 A;  1FOC A;  2V07 A;  2A06 D;  1NTZ D;  3HQ6 A;  3RN1 A;  2VHD A;  2BCN B;  1EB7 A;  1KX2 A;  1SQV D;  1S6V B;  4EIF A;  1HJ4 A;  1CED A;  1CRH A;  1YNR A;  1WEJ F;  4FAV A;  2HV4 A;  2GC7 D;  1M6Z A;  1MG2 D;  1I54 A;  3WFE C;  1A8C A;  1H1O A;  2GB8 B;  3C2C A;  3VNW A;  4JCG A;  1CTJ A;  2BH5 X;  1AOQ A;  4FA4 A;  1DII C;  1CYJ A;  1DW0 A;  1GIW A;  4WQD A;  1C6O A;  1FI7 A;  1HRO A;  1LFM A;  4AAN A;  2AI5 A;  1FCD C;  2JTI B;  1I8P A;  2D0W A;  1H9Y A;  1I6D A;  4V2K A;  5CIB B;  2C1D B;  3L4M A;  5DFS A;  1WVE C;  4FAN A;  1VYD A;  1BL9 A;  2N3Y A;  1FI9 A;  3O5C A;  3WFC C;  1KX7 A;  1CTY A;  5KAI V;  2DVH A;  3O20 A;  1H32 B;  1CSX A;  1H33 B;  1BE3 D;  1HCM A;  3CWB D;  1QYZ A;  3CYT I;  3H1H D;  5CIF B;  4LJI A;  4L3G A;  4UB6 V;  1CO6 A;  2N18 B;  1NMI A;  3H1J D;  1L0L D;  4MU8 A;  4WQC A;  4XYD B;  2PCC B;  4J20 A;  1E2R A;  3OCD A;  5B6Q A;  1RAQ A;  2D0S A;  1F1F A;  2DGE A;  2I8F A;  2QJY B;  3L71 D;  5KAF V;  4EIE A;  3CP5 A;  1YFC A;  2C8S A;  3ZCF A;  1BGY D;  5IY5 1;  2XTS B;  3TYI A;  3MK7 B;  1IZL 0;  3RN0 A;  1C6R A;  2OZ1 B;  3CXH D;  4WQ7 A;  2AXT V;  3NWV A;  1PPJ D;  2C1D A;  2CE1 A;  1HRC A;  4WQ8 A;  1SQB D;  1CHJ A;  4EIC A;  2EXV A;  1JDL A;  1H32 A;  4PD4 D;  1NML A;  2CA3 B;  2FWL A;  2N3B A;  1C2R A;  1CXA A;  3HQ9 A;  3HQ8 A;  5CYT R;  1GDV A;  3H1L D;  1GKS A;  2ZZS 1;  3PH2 B;  1NNO A;  2IBZ D;  2BPB B;  5GTI V;  4WQ9 A;  1YEA A;  1I8O A;  3WC8 A;  1KYO W;  1CXC A;  3SWS A;  3BCC D;  1H9X A;  3A0H V;  1I6E A;  3CX5 W;  1HZU A;  3VYM A;  1SQP D;  1DIQ C;  1YIC A;  4WQA A;  4AAO A;  3HQ7 A;  1CHH A;  5E79 V;  2B4Z A;  4IL6 V;  155C A;  3NBS A;  3ORV A;  1J3S A;  1CIE A;  3O0R C;  1M70 A;  1MZ4 A;  2OZ1 A;  2MHM A;  1HJ3 A;  3WUI A;  1P84 D;  1QL3 A;  1U74 B;  1C52 A;  2YQB A;  1U75 B;  3OA8 B;  1QN2 A;  3NBT A;  3ZIY A;  2CE0 A;  1R0Q A;  4Q5P A;  5EXQ A;  5KLI B;  2MTA C;  1H31 A;  1L9B C;  3PXW A;  2C2C A;  4Y5R A;  4GYD A;  4UB8 V;  4N0K A;  1CIH A;  1ETP A;  3M97 X;  1LC1 A;  1LS9 A;  3WFB C;  1A56 A;  1FJ0 A;  1CIF A;  2PCB B;  2QJK B;  2B10 B;  5B5E V;  2FRC A;  1GQ1 A;  5C0Z A;  3A0B V;  5CIG B;  3L75 D;  1HH7 A;  1COT A;  2BCC D;  3ZOY A;  1AKK A;  1CRI A;  2GC4 D;  2FYN B;  2GIW A;  1DW1 A;  2FYU D;  1YCC A;  1OCD A;  3PXT A;  4FA9 A;  2CA4 B;  1LMS A;  1QKS A;  2C1U A;  4AAM A;  1MG3 D;  2C1V A;  1L0N D;  1GU2 A;  1PP9 D;  1COR A;  5DJQ C;  4EID A;  1C7M A;  3OA8 A;  1DW2 A;  1W2L A;  3SJL A;  1NU1 D;  3ZOO A;  1EZV D;  4O1Q A;  1CYC A;  1AOF A;  1CHI A;  3X39 A;  2LIR A;  3L74 D;  1AYG A;  1BCC D;  1RZ6 A;  1H33 A;  1IO3 A;  4DY9 A;  4PWA A;  4AAL A;  2ZON G;  1B7V A;  1OAE A;  2B12 B;  3PXS A;  5KKZ B;  4FA5 A;  3JBT B;  2N9J A;  5DJQ B;  1NIR A;  1RAP A;  3A9F A;  3RMZ A;  1KV9 A;  2ZXY A;  1N9C A;  4K3I A;  1CCR A;  351C A;  1DT1 A;  1E8E A;  1L9J C;  4GED B;  1CNO A;  2ORL A;  4YE1 A;  1SQQ D;  2ZOO A;  4PW9 B;  1CC5 A;  3CXH W;  1SQX D;  4O1W A;  3ZBM A;  2QJP B;  1S5L V;  2YK3 A;  1CCH A;  1K3G A;  3WFD C;  4RSZ A;  4WQB A;  1C75 A;  2BGV X;  1CSU A;  2PAC A;  3DR0 A;  3OCD B;  1DW3 A;  3SVW A;  4U3F D;  4PJ0 V;  4KMG A;  3ZOW A;  2BH4 X;  1W5C T;  1C2N A;  5CIE B;  3DP5 A;  1QL4 A;  3VRD A;  1NTM D;  1RZ5 A;  1E29 A;  1GJQ A;  3L70 D;  1DVH A;  3CU4 A;  3H1I D;  2N9I A;  3SLE A;  1CSV A;  1CYI A;  2L4D A;  1CRY A;  1ZRT D;  1M60 A;  2YIU B;  3WU2 V;  5GTH V;  1CRC A;  1I55 A;  2B11 B;  1KB9 D;  5CID B;  1IRW A;  2N18 C;  5AUR A;  4WQE A;  5TIS V;  1F1C A;  1HJ5 A;  2LIT A;  5CIC B;  4P4Q B;  1CRJ A;  5H2F V;  1C6S A;  3O1Y A;  4AX3 A;  4FB1 A;  1LC2 A;  1A2S A;  3DMI A;  5B66 V;  3TGU D;  3KZI V;  1CSW A;  3L72 D;  5C9M A;  4XXL A;  1IRV A;  5KLV D;  2AIU A;  3MK7 C;  451C A;  1YIQ A;  4D6T D;  1NTK D;  1DVV A;  2BLF B;  1FI3 A;  1IQC A;  4L1Q A;  1HZV A;  3ZOX A;  3L73 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...