1CT8A

Catalytic antibody 7c8 complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
ELVMTQTPATLSVTPGDSVSLSCRASQSVSNKLHWYQQKSHESPRLLIKFASQSIPGIPSRFSGSGSGSDFTLSINSVETEDFGIYFCHQTHGRPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diverse structural solutions to catalysis in a family of antibodies.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 7C8 FAB FRAGMENT; SHORT CHAIN
total genus 51
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 1999-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ct8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ct8A01
5H8DA 3MRFB 3L6FA 5I0DA 5FB8B 3HZKA 4NN5C 1BIHA 1L6ZA 1WZKA 3RNQB 4BH8A 1MCWM 1S78D 1Q9LA 1T6WA 1J5OH 1JGLL 12E8L 5DJZA 4PTTB 3ULUC 1A6PA 3OHXB 5GS1C 1BOGB 3MNVA 1X4XA 3BXNA 5E8EB 1LQSR 5CHNB 4Q6IC 2ADFH 5D7LA 3GSRB 4LLDB 4P23B 4G3YH 5HHMD 3ZT6A 3RKDC 1MFNA 1F97A 2EE3A 1OGTA 1IAOA 4NO0D 4HMEA 5E6IA 3P4LA 3PP3H 4D0CB 1YEIH 1MIMH 3KXFB 3HPLB 1CLYL 5KVGL 4JKMA 4P3DB 3I2CL 1CK0H 5IV2A 3CVIL 3SCMC 4TUJA 1XR8A 2BNRB 3U4AA 4YBQD 4X6EB 5D7IE 4JY5L 2B20A 1EO8L 3BRFA 5FYLH 2GYSA 5GGQH 4XP6H 2D2OA 4FOMA 3GI9H 1YEGL 2CUMA 1WC7B 3WD5H 4XVTH 1T5XA 4NQCE 3P0YL 2BDNL 4HWZA 4H25B 3LEXB 5ID0B 1F4AA 2XQBH 2YD9A 4G8GE 4YFEA 1HKLH 4KROD 3WIIL 5C3TA 4FFZL 4F3FB 1RUPH 2JF1A 2L7UA 1AXTH 3EYQC 2GY5A 3QUKA 4JRYD 5HY9A 3OAZK 2PETA 5DEGA 1IEBB 4FQXD 4MX7B 2Q8BH 1PG7L 1UH3A 1B2WL 4CNIB 4UB0H 4HH9B 2WP3O 1S7XA 1KC5L 2R2HA 3MUGA 3LPFA 4POZD 2AXGA 2FX7H 5HGAB 5EPMB 2NY4D 4PGEA 1BQHA 4WI7A 3L5XH 4L3AA 1MJ8H 5J6HA 2AJXL 5BS0B 4D0BA 1U41A 4WUKL 4EDXB 5EORH 1IGFH 3NBNA 3HMWH 3PL6A 2FIRT 3B2UC 3PNWB 5IVXA 1RUKL 4OZGB 4LIQE 1IKNC 3VXPB 1DEEA 2I5YL 4N0FB 4PPTA 3FFCA 4QRRE 5J8OA 3D9AH 4LLVB 3IU4H 2DBLL 1W2KT 1V3MA 3LZFL 4LPUA 3FMGL 3TNMB 5ADOH 4YDLC 3L7FB 3ZDYE 3OAYK 1T1ZA 1QZ1A 4PJHF 1XGYH 2CK0H 2HYMA 1QUNA 1MY5A 5GJTH 1DBKL 4P5TD 3RDTD 5DVLA 3MV7B 2XA3A 3UJTL 2R29L 1VA9A 1I7TA 1NBZA 3MCG1 4R96B 5C0EB 4IRSD 5ESQA 2VSDA 5D5ME 1TJGL 3P73B 5GRUH 5EFIB 2W9EL 1H5BC 4OD3L 3O9WA 1A02N 4GAFB 5DZNA 2Q8BL 4CN4A 4P2CG 2EXWD 4BUGA 2V7NA 3GHBH 3VD5A 4J3SA 4EDWL 3D2UA 2KZ1B 2P8MA 3L3GA 2N7AA 3C6SB 4I9WD 3CH1B 2VXQH 3PGCA 3QPQC 2WQRA 4JHWH 4HMDA 1INQB 1CQYA 4HWBA 1WBXA 4QHUB 3CC5B 1UFUA 4K94H 1HXYA 4PB9L 5F7YC 4QRPE 4ZPVA 4MJIE 4AG4H 1KULA 1JUFA 3QHZL 3FQWB 4KVCH 3DUUA 2GCYB 2OMBA 3ARTA 2OTUB 1ZHNB 3HPJB 3V6FA 4ZNEA 4OLUL 5KN5B 4M1DL 3ZKNC 2H32H 4ZD3L 4YXLH 1UB5A 3EO9H 3PWNB 1IM9A 1RZ7L 1VFUA 4TNWK 5HYJB 3L1OL 5BO1L 2RIKA 4LLMA 4J7RA 1JV5A 2ZPKH 1C5DA 1NFIB 5T3XH 4Z5RB 5KSBA 5EO0B 3HR5A 3DROB 4IDLA 1EFXD 4Z9KB 3N1MC 3FB5B 2P7TB 3B9EA 1JZ3A 3M17A 5LJYH 5JPMB 3ZYZA 4CADB 1JN6A 5E08L 4NO2B 4X80H 1PYWB 1SEQL 1JYVA 1ETZB 2J6EA 3GKWL 5ICXA 2UUDK 3KYNA 3TPKA 5IMMA 3QPXH 2Y7QA 4XP4H 3NCMA 3O6KH 2X4TB 5DURD 5D70H 3QI9C 1VKXB 5LCVH 4NZRH 2DIBA 2DM2A 4OIIH 5EU6B 1GAFL 3ULUH 5D8JH 2CJUH 2A6DB 1E4XH 3S35X 1LDPH 4JG1L 4LKCA 4QRRD 5E0QA 5EZIL 1SJHA 1CL7H 4ZXBB 5DMKA 4FRWA 3RL2A 2PYEA 4JFZL 3CFBB 4N5ED 5I1DA 4R6UA 2FECI 2XTJD 4XZUB 1MVUB 5F97E 3GSWB 2YD2A 1KPVA 3HI6H 5IHBA 1RULH 2J8UA 3QNXA 1P1ZA 1FDLL 1KPUB 2GK0A 4M00A 4DGYH 2E7MA 1FP5A 4K7PY 3UTSB 5CLWA 4OBSA 4F58H 5TQ2L 5IM7A 1IGTB 4CMHC 4OZ4A 1IFHL 3MRMB 4Z95L 1HSAB 4ZYKB 1FYTD 2C7UB 4LRIA 3UYOD 3RZCA 1QSEB 4OAWA 2L4OA 4P49A 1N0XH 1QRNB 3FZUD 4OFYD 5CLTA 1DQDH 4I3SL 1AH1A 5SX4H 3U7YL 1CFTA 4LNVA 3STZB 4JQVA 4GJTB 3QIUA 3OKMB 2Y9RT 1OLLA 1MI5E 1UM4L 4WUUB 1WF5A 4PJ8A 3RHWK 4WW1A 2IPUG 3OGCA 3T2OA 3JV5A 2Q86A 4KZEL 1P4IH 2EIZA 1HEZA 4BSVB 2GAZA 1FNEB 4N5UA 4ISVA 4XBEH 4MA3B 1MWAA 3FZUC 1BP3B 4G8GD 4OZHA 4PG9A 4DKAA 4ELME 4OBRA 4Y4KB 3MCKA 5D2LA 3WBDA 1EEYA 1T7ZA 3MRCA 3IFNL 2O5YL 1NFDF 1PQZA 3ARRA 4PGJA 4PRDB 1AC6A 1I9IL 1WIOA 4LDOB 5J12B 1A7QH 1ZSDB 2AJVL 3OAUH 3ZMRA 4WY7H 4EOWH 4MNHB 1NQBA 1T04A 4M02A 3S9DB 4D9LL 3QHFL 1N4XH 3HNVH 3MRLB 4QY8A 4R7NA 1A8JH 4U7KA 3HI1B 3OMZA 2D7OA 3VWKA 3MODH 2R1WA 3HUJE 2I9TA 4ZSOE 3U0TA 5CFHA 3FQUA 1J8HB 1UWXH 4Z76A 1D5ZB 3BYTA 4IOIA 4OJFL 3O2WH 3SJVE 5IESL 1W72A 2EE2A 5IHUL 2EIBA 3ARGD 2KQNA 3TVMD 1IKFL 2MNUA 4NDMB 2FIKA 3QUZD 3QO1B 2J4WL 4J8RB 2MSPA 1P7QD 1OGAD 2ZCHL 4L4VE 5BZWB 4JFFE 2HWZL 1DLFH 4GS7B 3UJJH 1AHWA 1ZGLP 1RFDH 2BX5A 5ALCL 1I3GH 3MCLL 1G7HB 1NBVH 4Q0XH 4DKFH 3CSBA 4UBDD 4ZPTA 1X9QA 5JORB 4NJAL 2G5BB 1CDGA 1WGOA 5HYQA 3IFPA 3DUSB 4H26B 3OKEA 4JM2C 4L3CB 4MSWB 5DJCA 1UWGH 2D03L 4ELKA 1HQRB 5K9QG 2CDEB 3D3VE 4OGZA 3X13B 3VDCA 4YXHH 2X9WA 2VDOH 2VLRB 4HWUA 1IQWH 1TITA 3K80A 2VQ1B 3Q6FB 3F58L 4MWFB 5T5NG 4E9LA 4HKJB 2HFEB 3ZTNL 5C0DB 5JW5A 1ZVSB 1EUUA 4NQDB 4PREB 5DZLA 3O6ML 3UYPA 2XOTA 4N1EA 1M05B 2ESVA 1OARL 2APFA 2ZUWA 3LN5A 2BY3A 2BVUA 5B3NA 2PW1B 4QRSB 1J12A 3FO1B 4TSAL 1KIQB 4KHXH 3M45A 4HC1H 3FO0H 4UDUB 3BFOA 1CGYA 1C5CL 1JHTA 4UOW1 4PJ7A 1KJVA 1P4BH 3PXHA 1T1YB 5DSCA 3KPSB 1QFPA 4WFGE 4L8CA 2R4RL 3F12B 2RAMA 2LTQB 1KTRL 1KLUB 2VXQL 4JHWL 4WFFE 5F1SA 1UZ6F 4PBXA 4M8QB 1KPRB 2AV7A 5KOMC 4Y8DC 1Q9WA 2BC4B 4XAKE 1SM3H 3U82B 1CE6B 5CP7B 5FGBC 3PWPA 5SWZB 3TO2B 2CK0L 3HRPA 4JFHE 3UJIL 4AEHL 1BD2A 1YPZB 2XTLA 3OXSB 3SDAD 5GGTH 4FFZH 1A22B 5DD1H 4ZAKB 5F9WB 3VXTB 3PWLA 3MXWH 3TCXA 5F6HJ 2A9NH 3GI8L 1U0QA 3QG7H 2W9EH 4LCWE 4EUPH 4ENED 2JKXA 3VFUA 3N9GL 1E6OH 2FHFA 3QXWA 5T3ZL 5T1KA 4GW1B 2VXVL 3NCEB 2ZKHH 5JHDB 3A6BL 5EBGA 2R15A 3OF6A 4NUJA 1LO3H 3KHOA 1OB1A 2VUYA 2H41A 3O4OC 3UTTE 4JKWA 4KTDL 3MV8E 3TFKC 2HRLA 3RY6A 1UT9A 3F58H 3UTPE 4XP9L 3SY0B 1NEZA 1MCOL 3P9LB 1BVLA 4S1RL 3MBEA 1X5FA 5IB1B 4GH7B 2WV3A 4MD4A 4OLYL 2ZSVA 5BS0E 2NTSP 2VLJA 3U6RA 2VE6A 3PE9A 4OF6A 1JHKH 4JDTH 4UQ3B 4XNUH 1F3RB 5JOPD 1QEWB 4PY7A 4M1CC 1L9MA 5LXGH 4HGWB 3NCFB 3H7BB 3AC0A 5DGQA 1RZGA 3RKPA 4DGIH 2XZCH 4RX4D 1S7XB 4OCRL 3MNWB 5IOPA 4D8PB 3S3JA 1W0YT 1LNUB 4CKVX 3MRDB 4XPHL 2Q7YB 4MJIB 4NC2B 1X6NA 1L6XA 4GKSB 4BM7A 1FC2D 4NIKB 5IJVB 4EDXA 4OZIF 4AEHH 4EVNA 3PP3K 4JVPA 5KG9A 2QKIA 3OJVC 1ZLSL 1ACYH 3K2UH 1XF5A 2APTA 3K1KC 1MREH 1G7QA 5CBEA 1MREL 5F1KC 5EUOB 3B5GA 5GGRA 4H20L 3BEVB 1F58L 1BFVH 1LE9A 5B3JE 1D7FA 3ARDD 3EJZC 4N0FA 3U46B 5J1AA 4FQXC 1HIML 1KNOB 2J12B 4HIHA 1ZA3A 3CH8A 2E9WA 1WJ3A 3F65A 2EH7L 1FBIL 5SWSA 4IRJC 2DD8L 3TCLB 4DOHE 4EI5B 1Q9OA 3CVHL 4G7VH 5I1EL 1YN7A 3GBMH 4XP6L 3RU8L 5FYJH 1UXWA 4GUPB 3LHPL 1I7TB 3KPRA 1OF2B 3D25A 3MSPA 1U8OB 3MJ6A 2FZ3A 5JA9A 4S2SB 4WO4C 4OCRH 1T1WB 5C08D 2IANA 3W5NA 3EGSA 5B4MC 5B8CB 4N0UA 1PEWA 1CIUA 2VH5L 3V5HB 5DD3H 5IMLA 4PGDA 4JJ5B 5F21B 12E8H 4LNRB 2DQIH 1BPVA 4C56E 3IJSB 2YPKA 4N8VA 1A7PH 1DN0B 2ED8A 5FA4B 2X4UA 4WU7B 3V4PH 1DVFD 3OSKA 4TN9A 3D2UD 2J8UF 2Z91B 4DAGL 3HG1A 1YEKL 1AO7B 3ARFA 5BVJA 1AGBA 5I18H 3EKCA 4ZUTA 4Z77A 5JDJA 3WN5B 3Q5OA 4JR9L 3B3IA 1D5IH 3WS3B 3CDGB 2OSLB 3OJMB 3TN0C 1WZMA 4OCWH 2GCYA 3FTGA 4IS6A 1K5NB 3OV6A 1KB9K 1JGDB 3NFPB 5D2NE 1RJCA 2V17H 2NY3C 5L9DH 5CMAB 1BREA 4NT6B 4PJEE 4QGYA 1C12A 4ELMF 1I1AA 4QXGL 4AIOA 2JJSA 5FYLL 5IW3A 1JNNL 2ZCHH 4M6AA 2DI8A 5DD6B 1CDHA 3P3YA 3QG6A 5JXED 3TYGL 5CSZB 3P0YH 1IARB 3S34H 4XVTL 4UTAL 5F89A 3VXOA 1H3GA 3CCHB 1JN6B 4NO2A 4I0PD 5ISZE 4XVUD 1FFQA 1VGKA 1MCQA 1U8KB 5T1LB 5FF6A 4PJAA 1WBZB 1IAII 3MLPA 1R5IB 4YWGL 4KTEH 3OX8A 3IETB 4AENA 4M61B 5DEZA 3AREC 3P2TA 3MLTB 4U1MB 2GY7B 5E5MB 4WW2A 3VGDA 5SX5H 5JZ7D 2Q6WB 1FFPB 3QFDA 5JQ6H 3J7HA 4HIIB 4G6JL 4LP5A 4X7SH 2VDOL 4BK4A 3WE6A 2MTPA 1FRGH 3B43A 4K7FA 5GSRB 1B88A 2DQCH 1P4LB 4PLJD 1A6AB 5DI8A 2OZ4L 2P5WB 1G6RL 2D3VA 3CFBA 4Z7QE 4I18B 3FQXB 3QDMA 4XZUA 4EUPA 3INUH 3QEQB 4Z7WF 4C55A 3TA3B 5EB9A 1MCEA 1I9RH 2NY3B 5D1QA 5I8CB 5HI5D 5IBUG 3U30B 1TCMA 3KPPB 3WFHA 3CFKB 5EOTB 4M1CD 5D7KD 4HSQA 1P5VA 3C9NA 4LLYB 3FB6A 3MRMA 3NZHL 1F90L 1ZXQA 2V7HA 5IMOB 2FSEB 2VAAB 5ANMA 3CSGA 5E6IC 4GRWF 4PY8I 2CO7B 2HT4D 5E99H 2UYLB 3S37X 4FA8A 2D7QA 2VDPH 3SHSA 3IDMA 2DI7A 4P9HL 3HCVA 2R9HD 4P9HH 4FXGB 1MCPL 2G2RA 3MRGB 4FZEL 1C5BH 2WSKA 3KYMB 5TPWH 4GOSA 1KG0A 4PJIF 5T33L 3WO3B 3R1GH 4P2OB 3C8HA 5I73B 4B5EA 5DQ9B 1KIRA 5GGTL 4ODUA 5ABDE 4H8WC 1FNAA 1TJIH 4G6MH 4JG0H 5FXCH 1TJIL 4JG0L 3LEYH 4M5ZH 1DUYB 4BSVA 2NY7L 1EEUA 5HGBB 1Z6JT 5K9OB 4G9FA 5AAMA 4KPHL 1U42A 1O7VA 3MLYL 4OD3H 4MA3A 2EE6A 3HUJB 2PCPA 1MHCB 3RVTD 4G42B 3QI9A 3KYKL 1F11B 5IT2H 1OHQA 4K23L 1HHIA 5LCVL 3C5ZB 2C9AA 3BH8B 3D6GA 3RIFF 1RZKH 1EERB 2ZUSA 4KJQC 2CUHA 3GSQB 1P84J 2AJSL 4C83A 3RVUD 3FOMB 1S7RB 3QULB 4XB8A 4IOSD 1FVCB 3C8KB 5ESVB 4PJCB 2QADD 3U7WL 2F19H 5CEZL 1E4XL 1LK2B 3MGOA 4HPYL 3BPOB 5EZJA 3CPLB 3MOBH 5J11C 1KJ2B 3TNNA 1U3ZA 1KJMA 2F53E 4IRZH 3W0WA 1YJDH 3T0EC 5IBTH 3DX9B 2R1WB 3LCYA 1NAMB 5F9JA 3NGBB 5HHPA 5D1ZC 1KFAH 4RAUB 3ZKXB 5A2JH 1MEXH 3NZHH 1M4KA 3EHBD 3REVB 1A0QL 5E2JA 3FT3A 4LVHB 2NCMA 3PHSA 4X6DE 1NC4D 1N7ML 4JANB 3S98A 3HNSL 1M7DA 2Y6SC 3KPNB 4PJ8D 3QH3B 3JUYA 2A77H 2CMRH 1U58A 3LB6C 4PJBA 2UY7A 2K7QA 2VDKH 3BDBA 3OJ2C 3CX2A 3U2SB 1I1FA 3E2HC 5MI0B 4PJEF 4X8XA 1CF8H 2O5XL 1QBLH 2X7LB 3S5LG 2HT3D 3QRGH 5DVOA 5D93C 2BCKB 3VGGA 4M3KB 4NQUA 2R0ZH 3O6FB 5GRJL 4KI5D 2X05A 1C08A 1U8NB 3GHBL 2ZOLB 3OJDB 3BISA 2OI9C 1HHHB 4JO3H 1WFTA 3K1DA 2HN7B 4OQTH 2F54A 1JPGB 3R4DA 1IGCH 1I3RA 3VFRA 3DXAB 3P77A 3V4VH 5DVNA 4U1IB 4B53A 4ZFOA 5TDNB 4QLRA 4R7DA 4P0DA 3BW9A 2HFEA 3MJ9A 2QR0B 4XNQA 2R0KH 4D9RE 5D7JB 1S9XB 4K94L 4KK9D 4KMTH 3W11C 3RWGB 5C6WH 1UH4A 3I75B 2PO6D 4Z7UB 4ONOA 5DVMA 3WLBA 4IMKC 2LABA 1R3JB 3VXRE 2AERT 4WCYH 3WUWG 3G5VA 4G8EB 4XRCA 5I1CH 5BV7L 1FHGA 2DQTH 2R2BB 3VA2C 2ORBL 4U05A 2LU4A 4QHMA 2RGSA 1YNKH 1EEZB 3VW3H 1EXUB 4L9LB 5I6XC 5INCB 3SDXE 4MA7H 4UI2A 4EZMA 4KUZH 5FV1L 3MLWL 5E9DA 2VABA 4UDTB 5C71A 1DQDL 3VMOA 2P47B 1P2CB 4HZLB 3S37L 3RWJA 3BZ4A 5FM8A 1BF8A 1X4ZA 1FJ1B 4HUVA 4GBXD 3BP4B 3UBXA 4XCNB 5J57B 1LO4H 5CJQH 1N26A 4ZQKA 4R2GC 3BP5A 3WIHH 3OKOB 1IBGL 1SMAA 3L7EB 2HMID 4XBGB 2HLAB 4FQXB 3IDIB 2JCCB 2NY1B 3I6KA 1KTLA 1U91A 3B9KA 3DETD 4O2EB 5MEND 5F44A 2VZUA 1J5OL 1W8NA 1LO0L 5IQ9A 1MFDH 3H9HB 5DJZB 1B90A 2GJ6B 3U83A 3RUGE 2AKRB 4Y5VA 1PZ5A 1O0VA 3P9MB 1I9IH 2BDNH 2FO4A 2XG5A 3H9ZA 1YN6B 3BVNB 2XQBL 4ODTL 5BS0D 4JLRB 1LO2H 2CRIA 3GSRA 4HAGA 1I3UA 4LLDA 1BIIB 4PY7B 4OF7A 5E95B 1I75A 2P5EE 1KCLA 1KCKA 4Y5YC 3BRDA 1AGEA 3QFJD 3QDJD 1G6RA 1T0NB 3QXDA 2BMKA 4KHXL 3MRDA 4U6VH 4K7PH 3S96A 2H8PB 1ZAGA 2R56H 3GHEL 4QXGH 3RGVC 2D7TH 3S5LA 1KXTB 4DZ8A 4CN6A 1R3KB 2LU7A 1JFQL 2J7LA 2RHEA 1EO7A 5KSUB 2YMXH 4X4XA 4LHQB 4ZTOH 4FQQB 4NWUH 4G8IA 4I0CC 2BY2A 4AYFA 4YGAB 1A3QA 1Q38A 4PRBB 4E41B 5GGRB 1M71A 3L3JB 3OTTA 3WEXB 1L0YA 4O2CB 3CDYA 1CG9A 4BQCA 5HPOA 3T0DA 1MAKA 4JKPL 4JQIH 3VXQA 4YHNB 1T4KB 5T3ZE 2VLLB 5MHSE 2WIMA 1KYOJ 3ARDA 3RGHA 3U36A 3V7MA 3GIZH 5I16A 1G9MC 4R4BB 1FVEB 2BY0A 5F7DA 3V9FA 4Y19A 4X9GA 4EXPX 1N2RA 1GXEA 4JFDE 1AIFB 4ODTH 3KPRB 4PJAF 3TT3L 3UBXG 4XVUC 4M48L 4ZODA 1HKFA 2VDRL 1B0RB 3E6FB 4PRHB 1BM3H 3TM6A 3RTQD 1WQVT 2AQ2A 2P5WE 2H1PH 1R0AL 4Y4HC 1BFTA 3KYAA 4OKVA 2ZWLT 3ECBB 2BSRA 4X6BA 3T3MF 1AR1C 1OM3H 2X9YA 3HE7C 1HHJB 2E3VA 3ULUF 4XNMA 5D7LB 4LHUD 4D9RD 2Z91A 1IVLA 4XPHH 2ED7A 5ADOL 4YHYC 5F8QC 1SM3L 4K7PX 2D4DA 1HINL 3CNKA 1LILA 1RZ8A 2FDBP 4D0CA 3KJ6L 2YOCA 1T83C 4NKMB 1W72H 5E4EC 1NFDE 1AY1H 5FIEA 5FOBA 2EYSB 1SYSA 1AKJB 4P59H 5AWNH 4PJXE 1QYGH 3C6LA 3EJYC 5CZXD 1JP5A 4QOKD 4U1JA 5C0NC 5DD5H 5ALBL 1P9MC 4LF3A 5GQBA 5KS9F 4NQVB 1CICB 5CGYD 1A7OH 4X99B 5EU6D 1JTPA 3O6FC 5FGSA 4PJ5D 5E2WH 1VB9A 5DS8A 4GRLC 4LCUB 4Z0XB 4JHAL 4X7TB 4Y5XA 3ZYOA 4XPAL 1FPTL 4FS0A 3DVGA 4Z78A 3H9SA 2XZQL 3K4AA 3VFOB 4UQ2B 3G04B 4YHPA 4QRQA 5C0CB 5DMYA 4JRXE 4Y4KC 3WNOA 3ULSA 2BVPB 1CXLA 4GLRI 1HDMA 1ZVYA 4MX7A 3IAQA 5D72L 2EEAA 5FA3A 2DI9A 4PYHA 2Q6WA 2EC9U 4ZS6C 4UT6H 3QQ9C 2OTUA 2AXGB 3H3PL 5CJXA 4YPGB 3WE6B 3PWJA 1DP0A 4PGEB 1KB5B 4TSBL 3R0NA 2VDPL 4PJDB 4FQIL 4RWHA 4TQEL 4OI8A 5CCKL 1FLTX 2HVKA 1QRND 1CD9B 5HHNA 4R3SA 2D0GA 1T1XA 2NX5B 3UJIH 2X4OB 4HF5L 4YDKL 4HF5H 4RIRB 2ATPB 1IE5A 2UUDH 1A1OB 3QO0A 5D7SL 5CKGA 1R3IH 3MZTA 1QBLL 2ADIB 3X12A 3KPSE 5F9OL 4OLXH 4OV6F 1NKOA 4QO1A 1F00I 4MQTB 5C0IB 1CD1B 4I13B 4HS6A 5J56B 2GFBA 7FABL 3VXRD 3SJVB 2NXYD 1KCVH 2BSTA 2DMBA 4ZOEA 1UB6B 3P4MB 2P46B 1RJYB 3RGVB 3SOBH 3LS5L 4MQ7A 3ZTJG 4TVPE 3F7VB 3BZEB 4Y4KD 1BZ7B 4JM2F 4KK8C 1CFVH 3QSKB 3FONB 5L2KD 4S1QH 4ZS7L 4P2OA 1N5YL 1RUMH 2A6DA 5D1QD 4Y4FC 1P9MA 1C1EH 3MV7A 3VFPA 3WS6A 4X7CC 4B7LA 2DQDH 3QP3A 2MJWA 4KKNA 1XCTA 5A3IC 1SY6A 3GMMA 4HG4K 3DX6A 3DGGB 3VGAC 5KSVB 4G9FB 3O9WB 3ZDZE 2HJFB 1F6LL 3DX7B 3L3IA 4C59B 4KI5E 3DNKA 4XX1E 3CSPA 3QI9B 3ESVF 3MA9L 4FQ1L 2DQTL 4BH7B 1T6VN 1CDUA 4LFHD 4QWWD 5GSVA 3FN3A 5EZLB 4PJ8C 3L1OH 3QUZB 3QUMH 4ZYKA 4EN3B 5LGJB 4FXKB 4GXVH 4JZJC 1CFTB 1OP9A 2OXHA 2W65B 4X9BA 3OKMA 2V2TB 4FMFA 4RAUA 4Z7QF 5HHXH 4LQFL 2QHRL 2HVJA 5DVKA 5I17A 2JK5A 1TMCB 3CVIH 4NZUH 5LQBL 3R06A 5IESH 3Q3GB 4Y4HD 1UB5B 4LAQL 3BPNC 2VDNH 4TVPH 3LH2H 3MC0A 2VL5B 4O00A 4OZHB 4PG9B 3Q2CA 5C09A 3VFMB 3IXAB 4PJ9B 4L3EB 4PJBB 3MRCB 4FQCL 2GI7A 4RQQA 4JFZH 2P7TA 2DDQH 3CD4A 3HE6C 5GHWH 3RWIB 4CADA 2P44B 4YDJB 4WY7L 2XG4A 1QLFB 5SWZE 4JFQA 4TRPL 3T0ED 1OSZB 3X14A 4PRHD 4R26L 3DVFA 3MRHA 4IMLB 1PFCA 3IFLL 3ZKND 5CJ5A 3R8QA 2D03H 2IPKB 3DIFA 2QJDA 2Y4SA 2BRRL 1IGIL 4P2QA 1WVZA 5H35B 2AGJL 4XC3L 1CL7I 5F7KC 4Y4FD 1A4JA 1FYTA 4Z76B 3IB4A 3NFNA 1A4KA 1CZ8L 4ZXBA 1HN1A 2H6PB 2XN9B 4P4RA 2IGFL 4XPBL 3W0WD 2O5ZH 2XQYG 3DSFH 4BZYA 3NPSC 3TBWB 1U9KA 4J23A 3AAZB 4LARL 4Y4FA 1KPVB 1DLFL 1EUTA 3I75A 4PRID 1UM4H 4WHYG 3VRIA 1RZIB 4V1DA 3O8XC 5I75B 4MDJB 2OLDA 2IPTH 4P2YA 4I3GA 1YYLL 1QBML 5D7IA 1OSPL 4J1UA 5C08E 1IGTA 4GRLA 5HD8C 2EDBA 1E0OB 1EXUA 1TCRA 4L9LA 1QR4A 3LOWA 2HFFB 4X6DF 1IAKA 5MEOB 3T77A 1EO8H 2AEIT 4YR6B 1JNNH 1EBAA 2OR9H 4PBVC 4OCSH 4JAMA 1K85A 5GS3A 5AG8A 1P2CA 1JGEA 1BLNA 1CS6A 3OR7A 4MA8L 4FQJH 5IUSA 2VYRE 2AJVH 3OAUL 2VITB 1NGPL 4FFVC 2BNUB 1K4CB 1IC7L 2QEJA 3MV9E 3V0WL 5HHOD 1NUDA 1BZ9A 2Q86B 3QIWB 4ZFFA 2XKNA 3ZL4H 5I76B 2DB8A 1ZVSA 3CXDL 2X4NB 4RFNB 1FNEA 2ZOKA 4ISVB 5F72S 1LD9B 3RAJL 3WJJA 4WHTB 5E1AA 5LBSH 2V9TA 4FQXA 5GZND 2AQ1A 2VZ3A 4WENB 3MJ7B 4GFTB 1U8LA 4OQ1A 2CLZB 3L5WA 4X7SL 1YQVH 1A7OL 3H9HA 3LKPA 3O45B 1CZ8H 2EDFA 1PQZB 1D9KD 2P8PB 5EUKA 4N0CC 1P7QA 4JFOB 3ZT7A 3CMOH 4OZGF 4YBQC 4P99A 3V2AR 3OKNB 1K8DA 3FFDA 2FNBA 3H7LA 2AJYH 4NWUL 5B22A 2HRPH 4NQTA 1DQJB 4PG2A 1JHKL 4JDTL 1B4JL 3GBNH 4CU7A 4OZFH 3TO2A 1U3YA 4HULB 1EHXA 3Q6GH 2OK0H 4A6YA 5E2UL 3GSOA 1AGEB 4PJFE 4MXQD 1CTOA 5E94B 1XZ0B 1OPGH 4DUWA 3ARFC 4HIJB 1IGJA 1A0QH 2P5ED 3KVQA 3V6ZB 3P40A 4H1LH 4RA3A 3WDJA 4WTWA 4KVNL 1T22B 4QRRB 3NIFF 1K8IB 2LAGB 2YBRB 4Y16C 1I7RA 5A43C 1P7KA 3CXDH 1NEZG 4H20H 2X4QA 1JNHA 4M7ZC 5T3XD 4Q2ZA 4HPOH 3LVEA 1A9BB 4HPOL 3H8NA 3QWOB 5HYJD 4KHTL 4MSWA 1U8HA 3O8XD 4P48A 2BERA 4HGWA 1CGUA 4H0IA 5D70L 1AP2A 3SGEI 4LBEA 2KZWA 5IR1B 1EFXB 1ZS8B 4NJ9L 5EOQH 3KAAA 3LSOB 1WUNT 1U8MB 5CZVL 3VWJB 3FT4A 3BEWB 5GGVL 3VXMB 3L9RB 5GS2D 5GPRA 2DL2A 4TTDD 1L7TL 4JZNB 4MZ3A 3VXSE 2Q7YA 3NACH 5ISZB 3IXTB 5C6TL 2EECA 1T83A 3U4EB 2QKIB 1JZ8A 1NDGA 4WUUE 1CD0A 2EDRA 1G7QB 4M4RA 4ZAKC 3T1WA 3VFGH 1ORQA 4XCEB 5TE6H 3RIAF 5T3ZH 2NW3A 1SMOA 4DVRH 1FO0H 2DTMH 4HFUL 4LPVA 2YC1B 1FG2B 5J1AB 4O4YH 2FGWL 4I5BB 4Y16B 4IJ3B 5SWSB 5BVPL 1LGVA 1Q9WB 2BC4A 3NAAL 3UYRL 3QA3B 4Z18A 5CP7A 3VD7A 1IT9L 5D9SA 1V7ML 1ZLVH 4F2MA 4TTGA 4NQEB 1JF1B 5FYJL 2X4PB 1DFBH 4M93C 4TVSa 3AVEA 4YHKL 3KPLA 4XNXL 1GVIA 1OTTD 3QT2A 3RQ3A 3TWCL 4JO1L 5DFWH 1QFHA 3ARGC 1IBGH 5I19L 3DV6B 4ZUVB 1UWEH 2AEQL 2HFGL 3ZE1E 4U1JB 3BUTA 1HK6A 1K3ZA 5EBMA 3SCMA 1JGUH 2ICES 4DTGL 3P0VL 5E70A 3EOAA 5AZEL 2WZPD 25C8H 2H26A 4JCMA 1T7VA 3HZKB 4MXQC 4BH8B 4FQIH 5IMLB 1NEZB 4UTBL 1TQCC 4UAOC 1K6QL 5EIIA 2F74B 4M1GH 4G9DB 4LLQB 2X4RA 1YMMB 3MNVB 4KY1L 2BVTA 5ELIA 4QHNA 1AXIB 4GG6E 1Y6MR 1G7IA 2HMIC 4YHPB 1AO7A 5IFAL 3MLZL 3B3IB 4F8QA 3U4BL 1PLGH 1G9NL 4Q9QL 4RMRA 2YEZA 5IVZB 3HZVB 3QQ4B 4NWTL 1J0YA 1W8OA 1GJIA 4KKBC 2V9RA 5AZ2H 4O51B 2OJZL 2PKDA 1F2XK 1WSST 3HA0A 4X6EA 3EYUL 4XC1H 3BN9D 1MOEA 3O3BA 3BWAB 1MLCA 1MIEL 1ITBB 4KMQA 2E7CA 4ERSH 1DQLH 3OB0K 4ONFH 1NBQA 1K2DA 4JPKH 4RIRA 1I9RL 1RFDL 5CBEB 1HCFX 1NCBH 3UEZA 4OLZH 1MPAH 1A3RL 3KDMA 4CUCA 1N3NB 4HWZB 4LVNC 2JCCF 5EZOH 4HH8A 2VB5A 4X5LA 3DVNA 4U0RC 2NNAB 3F7QA 1FYHB 2Y06H 2Y1VA 2XWBB 4RISL 4HLJA 4WVRA 3S36L 2ZG1A 2BSSB 5DK0B 3ZE1F 3K74B 2VERN 1RUQL 3QUXB 3GSUB 3D39A 3LQAC 4EI5A 3BJLA 5HPMA 2VZVA 2BVEA 3JTSA 4MDIB 3BUYB 1VHPA 1B4RA 2VISB 1PG7X 4MXWH 1EIBA 3GRWA 4GW4A 1OAQH 1DBJL 4ZS6D 3OKLB 2O5ZL 3DSFL 4FHBD 5FUCC 4D9LH 3MYJB 4R4FH 1A9EA 3ARBB 5TDPA 1P6FA 5DFVC 1J1OH 1MRCL 3MODL 3P30H 1ZT4A 5HHXL 2HT3C 1ZTXH 4DN3L 2EKSA 3EGSB 2VLRD 1VCAA 2ZUYA 1HYSD 5F7EL 3VDBA 4K23H 4EEEA 4XPTL 2KPNA 2PXYD 1Z9SA 3DXAE 5BRZA 2VXTL 2VNCA 1MJ7H 1BAFL 5JIIA 1KV3A 2F19L 5CEZH 3DETC 4M62L 2DYPB 2EICA 3ARFB 4L4VD 4M62H 1AGBB 4Z77B 3UTQA 3OKKA 2N7BA 1YY9D 3D0LA 1YPZE 1OCWL 1QFOA 5E7FA 2WUBH 4XVJH 4YAQA 3W81A 5IBTL 4BA8A 1FIGL 4WEMB 1NBZB 4KJPD 3L6FB 1WLHA 1MEXL 3QWRA 5ICZA 3GEWB 1BQUA 2XFXB 2NY7H 4R0LA 1Q0YH 1YEJH 5JW4Q 2YRLA 3QUYC 2V7NB 1MHCA 1F11A 1FAKT 3BGFC 1AR2A 1RURH 1CFVL 5T3XL 3GSNB 5HGDA 5EU4B 4OGYH 2PUQT 4TOYL 4HFWA 1FVCA 4IRJB 4EI5C 1QLFA 3CH1A 4ZMAT 5T1LA 3PGCB 5I2IB 1FLRH 2HAZA 4S1DD 2DOCA 2NXZB 4P3DA 1IM3A 3IJHB 5L88H 5I66A 3JWDH 4NZRL 4AQ1B 3BPOC 3DUUB 1T66D 3TBYB 1PX3A 1CBVL 5EU3A 3RY4A 1Q1JL 3STBA 1A6UH 2R9HC 2BHZA 3FO2A 3BD5A 3G5YA 1CL7L 2LVEA 4JDZA 2V2WB 1XF3B 5D1XA 3AAZA 3SKMA 1UZ6E 2Z4QA 3VRIB 3HI6L 3VRLF 2FGZA 2Z92A 4ALAL 2PYFA 4R8WH 3VD9A 3ZE0E 4LCWA 3MV9B 1YNTB 2V2XA 4OFIA 1OAUH 1WZ1L 3QB7C 3TN0A 2X9XA 2JJVA 4M43L 2QTEA 4LLYA 4XNYL 5BW7A 2DKSA 1YEJL 2YKLH 7FABH 2R2HB 2FSEA 3BGFB 3QEUB 3S8WA 2O61A 4DOHB 5A16B 1TFHA 1VFOA 5GRVK 4Y2DB 4GG8A 3W2DL 2IQAA 1V05A 4OTXL 1I3RB 1TNNA 2YN3A 4M5YH 4NFCA 4DUXA 4L8SA 3WL9B 5IB3A 2X42A 2IJ0C 2DMKA 2MKLC 5CGTA 5JW4R 5HYIA 4U1IA 3LHPH 3VMPA 1C1EL 2EDXA 3ZE2F 2GJZB 2I07B 5B38B 3SKNA 4M7LH 3WS6C 3BP6A 3BPCA 3E8UH 4Q7DA 4G6KH 3NZ8A 4MNGE 5IKCA 2L7JA 5C07E 1B6UA 1JGUL 4H0GA 4LCIH 2GK0B 2Y36H 1KYOK 5LGHL 4PJFB 5FHBH 4LRNL 1R5VB 5J6GB 5IHLB 5TQ2H 5DHVA 3GSQA 4J3WA 4PRAA 1CU4L 2EZ0D 3LN9A 4TQEH 3MJ9L 3EBAA 3ALWA 1T1ZB 2XV6B 4JFDB 3V4PL 2FYYB 5HHOA 2LVCA 3MRRA 1F4WL 1H3TA 3QCTL 4OFDA 2ZG2A 3DOSA 5L8JB 5IJKC 4JR9H 3BZ4B 5KS9B 3HB3C 5I71C 4GRLD 3FL7A 1BFVL 1GGTA 4I18C 5HHPB 1IQDB 2K9UA 2XY2A 5DRWA 1CGSH 3S4SA 2X70A 1QRNE 4U31A 2Z31D 5HJ3A 1DVFB 1AGCB 3BP5B 4JCLA 3CFDA 5L9DL 3EO0B 5AUMB 2EH7H 2WAHA 3IDNB 2AK4E 1MCIA 2PW2A 2JIXA 1UZ8B 3HTLX 3RWEB 1M7DB 3TBTB 3HFMH 4QXUL 4K3JH 4NQXA 2NY4C 1D5XB 1BQLH 4DWHA 3B9KB 5T3ZD 1U92B 5JMRA 5L2JA 3QJFB 1WBXB 2BXZA 5TFSH 1YEGH 5TE4L 3JV6B 1TVHA 1I8KB 4K8RL 1PEZA 2AJZB 5K9JH 1I7RB 3ARSA 4UNVA 2NY0B 1QSVA 1ZEAL 3P9MA 1H8SA 1ZEAH 3FQWA 3QEQE 4NJAH 3VXNB 2OTWB 2IANE 1WIPA 4GMSH 4PP1C 4YWGH 2EXYD 4W6YB 3RJQB 2XWTA 4PJ5E 5JR1H 2EDDA 4JRXB 2NXYC 1JPGA 4MA1B 1CXKA 2C4FT 4E42B 1B2WH 3QYCA 3U0TB 3IRPX 5HYJA 1G84A 1T0MA 3OAZH 4G6JH 2OI9B 1GGIH 5FEBA 5HVHC 3WSQH 4Z5RA 4KGJA 3R0MA 4UBDC 3AM8C 3MRNA 2FIKB 4DZ8B 3SKUD 1NL0H 3QFJA 4R4FL 4LL9A 5BZWA 2MHAA 1DFBL 4M4PA 4NRXA 4RFNC 1BVKB 3LRHA 5EWIH 1BM3L 3KLDA 3E3QC 4Y5YB 2YZ1A 1S3KL 1XGUB 5ICYB 4ODWA 1QR1A 2B4CC 4P5MA 2VR9A 4HEPG 5INCA 2Y5EA 5ILTL 5IEHB 3IFPB 5HHQA 5CINL 3ES6A 1ZWIB 3G6AA 1CXIA 3U79A 1QSFB 2VABB 4I77H 3IDUA 2AEPL 5C9JB 2LU3A 3M8OH 5ITFB 2I60L 4GO6B 2BVYA 5F7DB 1FJ1A 3GSWA 4U2YA 4OCYH 2VIRA 2J8UB 4Z7UF 5BJTA 1YPZF 3SDCB 2EXYC 1IEHA 1KB5H 3RNKA 3K8LA 2ZCKL 3B2VH 4IMKA 2B5IB 3KYOA 5DC0A 3SEPA 1F13A 2COQA 4APQB 2O26U 2OZ4A 4WI5A 1SJEB 1TLKA 1NKRA 3FN0L 4OZ4B 32C2B 3EOAB 2AGJH 2H26B 4AT6B 1MUJB 1LO3L 3FO0L 1JPSH 1DBML 3N06B 4KTDH 3RDTB 2GJ6A 1FZJB 4X9HA 1JHTB 2GHWB 2F74A 5KJRH 3TFKD 5DEFB 3U7WH 5E5RB 3ET9F 4JQXA 5IVOA 3QIUB 1OTSC 1LEGA 2C1PB 2C4FU 2Y5TB 4PJ8B 3UMTA 1H3XA 3DGCR 1CDIA 3VXUA 2VDML 1ED3B 1NANH 2B0SL 1XH3B 2Z35B 4FFYH 1RPQA 2X5PA 1RZJH 3NPZB 4QT5B 4K3DH 3ZDXE 5GGSY 3BT2H 4JREB 4WFEE 5F6HI 2CXGA 4NKDB 2ICCA 4OCXL 5KVMC 2QADB 3E2HB 2W0KA 2J8UE 2EYSA 2YPLE 2OTPA 1RY7B 3L95A 3VGAB 4LSSH 1Q1JH 3O3EB 1LHZA 4O58H 3KWWB 3HMXL 3H9YA 1KJ3L 4L4TE 4CW1B 1A6TA 2MMXA 3O3BB 1MLCB 4YHOL 3TH2T 1R3KA 5EUOF 5L6YH 2EZ0C 4F7PA 5MP6L 2APBA 1IQWL 2QHLA 1G1CA 3CLEL 4FQHA 1MCLA 1JWUB 1D5MB 4LPTA 3O0RL 1CCZA 3AGVA 3K2UL 3SY0A 5CEZD 4WWKA 5DS8B 1FG9C 5AAWA 3HI1A 1M7XA 3L3JA 5IB1A 4PRPD 1K9TA 2QL1A 2XWBA 3U6RB 3MLUL 4LVOB 4HCRL 3SGDH 3ULVD 3T0AA 5GRZA 3QUYD 3C2AL 3H7BA 1HDMB 2FJHA 2G75A 3QO1A 4Q58C 4MYWB 1WAAA 3K2MC 3N1QC 4WRLA 1XCQA 3QISA 5CEYB 2EKJA 3BESR 1LNUA 4HDIB 3IDXH 1RJLA 4L29B 4YHML 5IIEB 4NUGH 1VADB 4OZGE 4U0QB 4PJDA 4MJIA 4OF3A 3D3VD 1MF2H 1T1XB 4NQCB 1QHPA 5EA0H 3C08H 1FIGH 2Q20A 4PJIB 2FATL 1RU9L 3DUSA 5I1CL 4X6DA 2BJML 1OAUL 1XR9A 5HVWA 3ECBA 1HQRA 4RMVA 4E0RB 5BRZB 2DF3A 4YXLL 4ZD3H 1NMAH 5KSAC 4XPGH 3GDBA 3UTZB 5D1QC 1TZHB 4D0DB 3I3DA 1HSBA 3RVUC 3P4MA 3RGVA 4UMGA 1AI1L 4MQ7B 3GJFH 4HKJA 4PJ9D 4U2ZA 4OF0A 3H9SD 5HYFA 1LK3L 2C3WA 4P5KA 2HKHH 2UZXB 1RK1B 4M6OL 4XNXH 1DDHB 4L4VA 2D31A 1OF2A 4GW5B 4NM4H 3MROA 3E8UL 5GRJH 2DLTA 2G9HB 3C6LB 3ULUE 1BVZA 4NQDD 4HK3J 3MRBA 3W9EA 1OTSD 3WFCL 4I2XA 4DTGH 4XBPB 1OP5H 3MFGB 4Z7OF 4Z7UE 4LEOA 4M03A 1GAFH 5DQJA 2Y23A 2PYEE 4N0UB 2OP4H 4KK6C 1LDPL 1IMHC 2A6KA 1NGQH 2NLJA 4OI9A 3HI5L 3IS0X 4Z0XA 1CE6A 3DVGB 4LU5H 2YA0A 5KOVC 4Z78B 1DN0A 1TVDA 3CK0L 3KR3H 4P5TC 2ARJA 2M26A 2VR5A 4KRPB 4UOW0 3GIVB 3TH3T 1CYGA 1H0DA 2CRZA 3O3AB 5I2IA 3RPKA 1SYVB 4X98B 3BIKA 2R8SL 3HG1B 5C0CA 1CIDA 1U8PB 1IJ9A 1UWXK 2AXJA 2IQ9L 2OL3L 3RVVD 4Q9QH 3U4BH 1MFCL 1AJ7L 1KF9B 2W60A 4ZUUA 4IS6B 1U8IA 3VXSB 5FB8A 3QNYB 1NUFA 4LPCA 1PD6A 4NZJA 3MLWH 5CMAA 3W9DA 1KJ2L 4JFFD 4WV1C 1C7TA 5JW4M 2ZUUA 4JZOA 1JPFB 4IHOA 1F5WA 1ZGLM 2YMXL 4HUUB 1PSKH 5C09B 2X4OA 2PYFB 2JLLA 4GBXA 3EOBA 3HE6D 2ATPA 1QEWA 4W68A 3S34L 4OLVL 4HV8A 2PTTB 4JREC 1P4IL 5E8PB 2APWA 1INEH 1RZGB 5F89B 3CZJA 3DBXB 4IM8A 3VXOB 3LRGA 4URTB 4G6FB 5JW4N 3GJEA 3EOTH 1EHNA 1VGKB 5JNYB 4YUEL 3PHOB 1Z5LA 4JFEE 1WBZA 3N1GC 5D2LE 3KXFA 4ODSL 4HS3B 1S9VB 5IW1B 4BSWB 4UV4L 3CFIC 1EJOH 3WV0A 3S36X 4ODHH 4ODHL 4WHYH 4MAYB 4JDVB 1C5BL 4FZEH 4OGAC 2HTLD 3T2NL 2Z93B 1X7QB 1ND0B 1A6AA 2GJZA 2I07A 5DI8B 5B38A 2H6PA 4FG6C 3TT3H 4GQPH 2NTFB 3DGGA 5KSVA 1DE4B 3QDMB 1TJGH 2VWEE 1NGWB 1SJVA 3BZFB 1J1XH 1U8QB 3TZVB 3UAJC 4LLWB 4L1DA 1I4FA 1QFUH 1MFCH 4ETQA 4MCYA 4F3FA 5KSAB 5I8CA 4BFEA 1ZA3B 5JHLL 3WFHB 1NC4A 4TVPD 2AJ3B 3WJLA 3IF1B 2I5YH 1D6EA 4PRIA 1UCBL 2P5EB 5DRXA 4KJWD 5I30L 1MJJA 4K71B 1MI5B 1REIA 2V7HB 3UZEA 1IAKB 5MEOA 2GTWA 3MUGB 1AR1D 4AM0B 1JNLL 1YEFH 2FYYA 1CICD 3LKQB 1XGTB 2AI0H 3IVKB 3D48R 3L5HA 5A3ID 4EQ2A 3THML 3VH8G 2NY5C 2VZTA 3PV7A 3DX8A 1BLNB 2VOTA 4RA0C 3CSYB 3SPVA 1ZLUK 2VITA 3CVHA 3KJ6H 4ELMB 2BNUA 4F7MA 4YO0B 2EC8A 4PJHB 4ZFFB 2XXCB 3RNQA 3BQUB 4KXZH 1I9JH 4FTVA 1AGFA 1AXSA 5HGHA 5EO9B 3REWB 3TO4C 2DQFA 2IAMA 3GI8H 1UZ8A 3MLVH 1TQBB 4KPHH 4POUB 4QXTA 5F7LB 2DLIA 1XFPA 5DD5L 5ALBH 2P24A 4PGCA 4UUJA 1OTUC 5FKPA 1YMHA 5JQ6L 3QIBD 4NQXB 4X9IA 1EHLL 3BXNB 2Z31A 3MJ7A 1GGIL 4WTXA 5L2JB 2CLZA 1H3PL 5CGYC 3LKPB 3O45A 5BVJB 1KTKE 2GITB 1MHHA 1N0LA 1S9WB 3LY6A 1JI2A 4LAJH 1A1NB 4PLKC 2FEEL 1F3DH 1WFOA 3MGOB 1MHPL 5ISZD 1K8DB 1CGWA 2XZQH 3CIQA 3CPLA 3V6BR 4I0KA 2R4SH 4OZIA 2B0SH 2R69L 3TNNB 4LSQL 3N0PB 4LSQH 4MQSB 4PJFF 2YPLD 1JRHI 2OK0L 4XXDA 4WI8A 5C0AE 2HJKA 5FUOH 2VLKE 4LEXL 4HZAA 4WFED 3WCYA 2SEBB 2ZUVA 3FT3B 1C8PA 1FZOA 1ZT7A 4HC1A 2BNQA 2R2CA 5HHME 1SEBA 1G9EA 5SWSD 4M93B 5MP6H 3THMH 2I60H 1XGYL 1NCAL 1J0ZA 1BVKA 4XPFL 4V1DB 3QDGA 1DQTA 4GT7A 5HTSA 4DEPB 3AFLA 4Z8FL 4HUXA 1QSZA 2FATH 3QDHA 2DRUA 2YBRA 4YHIA 1FN4A 1OAKL 1MAJA 1WIUA 5LAXB 1XIWB 5LVEA 2XKUA 4RCAA 3Q1SH 1R5WA 2IAMC 3MLUH 3UZQA 2BCKA 1FFPA 5FYKU 1I8LC 2WBWB 3QFDB 3BZDA 5DD0H 1C08B 5MENE 5HGAA 4XGZB 5SWQB 2E8ZA 8CGTA 1N0XL 4F15B 3DJ9A 5GGUB 5BS0A 5I1EH 3VFRB 5CAYB 4AY0A 3SGJC 1RUML 5IWLC 2VIRB 3BPNB 1N5YH 3FT4B 5E6YA 3VXMA 2HRPL 4LLMB 3FAWA 4C57C 3HNTH 1OAYL 5DMIL 1ZLWH 1RHHB 4MGXA 1N59B 4PB9H 3CFKA 3TC9A 3UROR 2WW8A 5INDB 4F7TA 4LKXB 2CIIB 1FC1A 4JPIA 5JHDE 3ULVC 3KLHC 3FB6B 5DMJB 1J8HE 1PYWA 3FFCB 3OXRA 5J0BA 5E03A 5IMOA 3QIWC 3MFFB 4EJ1C 2QSCH 1MCFA 2GT9B 3L5WB 3H3PH 2YK1H 4G8EA 5DYOB 4X0KA 4PLKD 3TPUB 4P46A 3NIDF 1LO0H 3VMNA 1F6AA 2BNRE 3HNSH 3KYMA 5F9AC 3R8BB 3AS1A 3BKYL 4OZFA 2VZOA 5DQ9A 2DQJL 4ODUB 5T5NF 3O4LE 2VDKL 4G7YL 3MBED 1XIWC 4UT9L 1GGYA 1NL0L 1C7SA 3P73A 4U3XA 2Y07L 2DM3A 1MVUA 2DKUA 1L9NA 1OW0C 3IRZA 1MFEH 3RZWA 1ES0A 3W11D 2R0ZL 3QNXB 1KPUA 1CLYH 1I1CA 4NCC1 3WIFB 3I2CH 4I48B 1G6VK 3WNMA 1TQCB 4QXUH 5E8OA 3I50L 4MNQD 2HLAA 3C6SA 2DN7A 2ZJSL 4OTXH 35C8L 3EDFA 1KTLB 3MV7E 2H2SC 2ZZUT 3BDYH 1JWUA 2C7UA 4QRRA 4H88L 1ZGLA 4X6CE 1QSEA 4XWGL 4K8RH 4F7EA 5ITBL 1AHWC 2CH8A 1MFBL 2HLFD 1YMMA 3CDCA 1XT5A 2X4QB 1JUFB 5J1SC 1NAMA 3X3FH 5F9JB 1S7TB 4JRYE 1KTDA 3B2VL 3MYZA 4N0UE 4WHCA 3TIDA 1T20B 5LGHH 3VFGL 3BKJH 3MREA 4NNPH 1IGIH 2FJHB 3WXVL 5DQDL 1EFXA 4CMMB 2JJUA 4MNQE 3MJ9H 3EJZD 2AK1H 3ROLB 4U1KA 1N6QH 4F7CA 1U58B 3HZYB 1FZKB 4PV8A 3I02A 5A2KH 1GZQA 2BOBB 3UCRA 3L3HB 3PWUA 3ME0A 3L5XL 2NY1C 3M17B 1VEPA 1LK3H 4WI3A 1N8ZB 2UZIL 3BAEL 2X7LA 5DMGD 4LARH 2AJUL 4QCIA 2ZP0T 2QQKL 3ESUF 1FNSL 4WIQA 5EWIL 4J4PD 2AXFB 4PJIA 5F71A 2FBJL 4HUWB 1NBVL 3JTTA 4Q0XL 5FO7B 2FWOA 5CD3B 4KZEH 1LEIB 1VGEH 5JDSB 1GPOL 1T3FB 4ZUWB 3VE0B 3QUMA 1GOGA 3BT2L 1OSPH 1BEYH 3V5DA 2HN7A 1WITA 5IMKA 1J0KA 3RIAK 1SY6L 2IAND 5HD8D 5C07D 1NDMB 2CUIA 1ORSB 4MAUH 2DQEL 1GZPB 1IAIH 1MFDL 5DK3A 5F1NA 3RL1B 3LZFH 3GGWB 1EJ6A 1XGPA 5DURB 5TE4H 2FX9H 4XNQB 1HZHL 1KEML 4QHLB 1F8TL 1F4YL 4Y19B 4KKLD 3WLBB 4OD2B 3D39D 1P1ZB 3ELAT 1AIFA 4X7EC 1BJ1J 2D7NA 3TIEB 4O9HL 2C3HA 3GMPA 3UTSA 4BKLB 4Z7VA 1A9EB 4LCCC 4RGOH 5JORA 3SCMB 4QHMB 5E00B 2DIJA 3MLYH 4F9PC 3MRIA 2EDEA 3C60B 1O7SA 1HHKA 3SGKC 4U1NB 2A6KB 3FCTB 3MA7A 2XNAB 2BSRB 5I30H 3C5JA 2CDGB 4X6BB 4O02L 1WFUA 3QRFM 3WO4C 2X4RB 5B21A 2GQHA 3STZA 2BY1A 3UZVB 4TOYH 3JV0A 4HUVB 1I1RA 4P4KA 4XHQA 4TNVK 4JB9H 5JXEA 1G7IB 5I15H 2VQ1A 1LEKA 3MCLH 4QRPB 4DQOH 1HEZB 4XCCH 4NKOA 1JPTL 2V6HA 3L7EA 2YUXA 3EOTL 2CIKB 1QA9B 4LIQL 4NKMA 3T0XA 3PDOA 5FECA 1Z9OA 1RUQH 4CVZB 3FO1A 3UPRB 4A2MA 1NCCH 1EJOL 4UDUA 3PHQB 1HYSC 1KJVB 4K9EC 4PGBA 3VD3A 2KH2B 1YN6A 3DRTA 4LLUA 2JB5L 1IGMH 2D9QB 5T33H 1K2DB 4X99A 1T7WA 4NN7C 2A77L 2AV7B 3KDMB 1TNMA 4S1RH 4LCUA 2W0PA 1MELA 1V3LA 1KB9J 2I9TB 1VENA 5C0GA 1MCBA 1YYML 3PHOA 1I3VA 2FH8A 4HCRH 1D5ZA 5I73C 5IHZA 3SOBL 1IM3B 3IJHA 3ULSB 5HPMB 4KJWC 5D72H 1F4HA 2PXYA 4RGND 5E8NB 3S5LB 1E6JH 3EHBC 5FA3B 3CVHH 3D1MC 4G7VL 4Z6AT 3KXFD 3WUWA 1QTYT 4HPYH 4JN2B 4MJ5B 2AI0L 4JFYA 1SVZA 2UWEE 2UVEA 3MYJA 4R4ND 3TVMB 2V2WA 4HIEB 4E41A 3VRLE 5E8DH 5HHNB 2MKWA 4KMLB 1M71B 3DMMC 1NGWA 3BZFA 2Z9TA 3RUGA 4Y8AA 4N9OB 2IADB 4DGYL 2AVGA 3FHQA 5L8LB 3VXQB 3X3GH 3ARBC 3T4AA 4ELKB 2XA8H 1V3KA 2ED9A 4E41D 5GRVL 2JB6B 2P5EA 2EE9A 5DRXB 3N1FC 5C0IA 4N68A 1FVEA 1YEHH 1KLFA 1TXKA 2H9GB 2FX8H 2XZZA 3NIDE 1F3JB 1TTGA 4ZSOA 1AFVL 2PO6B 1YY8B 3A67H 4BZ1L 3IVKA 2F5BH 4KAQH 1WV7T 3CLFH 1BZ7A 5B4MD 5IJVA 2E7LA 4L8SB 3WL9A 3E6FA 1P84K 1XGRA 1ZHBB 5IB3B 1U3HB 3FHAA 5KG9B 1LO4L 43CAA 1XF5B 3QAZC 3SKNB 2XFXA 4R0LB 4CU6A 2QV2A 5KVDH 1AGFB 1AXSB 1CDYA 4G5ZH 5I19H 1LP9B 4L9DA 3BEVA 1PW3A 4G43B 2FB4L 3JV4A 3D87B 5E6ID 1T1YA 4TYUA 5GGSA 3G6JA 1JHLH 1PX4A 5DK2B 3ETBF 5EU7E 4BH7A 1CDJA 4A6YL 1DQML 5D71H 3RWCB 1SBSH 5J6GA 2DLGA 1Z2KA 1LMKA 1X5XA 3GSNA 3WMSA 3NFSH 4XMLL 5EU4A 5FAAA 5A2LH 4LSUH 1OTTC 4P9MH 4F57H 4M7KH 5E8DL 1NSNH 3E3QE 3U1SL 1UJTA 5I1AB 3X3FL 1F6FB 4G7YH 5TJWK 2WIIB 3OKDB 1J0JA 1AKJA 5D7SH 4HX1B 3IDGA 3TN0D 1NMBL 4XI5D 5I66B 4XXDB 4J4PC 2H32A 2HJKB 4Z0BL 3SDXA 1RV6X 4LCCA 1MFEL 1IGYA 3ILQC 4F58L 4POYA 5ACZB 4LPWA 3VW3L 1OB1B 3S4SB 1CICA 1YNLH 5DRNB 3PGFH 3FO2B 5HHMB 1AKJD 5JIHA 3IDYB 2DQCL 5I1KL 3O41B 2JIXB 3DHJA 4JDZB 3CMGA 3DARA 3A6CH 3G08B 1MFAH 1FO0A 1IEAA 1QG3A 5FCUL 4YHLH 5FM5O 2B2XH 4YHLL 4JQXC 5CHNA 4QF1A 2J6EH 5JOPE 3G04A 4OLVH 1YNTA 5M7QA 3QEGL 2IMNA 4HWEL 4W6XB 3EYVA 3QBTB 1PGRB 4OZHE 3PWPE 3QEHA 2Y06L 3AY4C 3SCMD 2VC2H 4J2XA 1K5NA 5E2VL 4DJMA 5GS0H 4PS4L 5KAQF 6FABH 6FABL 1WTLA 2DJUA 3DYPA 5H35A 4JO4H 1U95A 5GS1A 4NNYB 5AD0A 2ICWB 3PQYA 4QRTA 5ESAB 3I9GL 5BV7B 3DYMA 3T0BA 1A4KB 3MZGB 1TDQA 2XN9A 4M6NH 4HK0B 2YHGA 2I24N 1FL5B 5D1ZB 4LSDA 3TBWA 1JF5A 2W9LA 3LKNA 4NQDE 3PXJA 4LVEA 5DHVH 1JWMB 3OXRB 4NO0B 1QFUL 2V5SA 3H9SE 3CX5K 2CKBL 3V0VB 4R2GB 1H3WM 1Z3GL 4UT7H 1R5IA 2BSTB 2XRAL 4WFFD 1Z3GH 4UT7L 1R5VA 1RJYA 2LE9A 5DYOA 4MLIA 5F7EH 4WFGD 3PGFL 1N6UA 1DBMH 3JWOH 1F6AB 3BGMA 2BNRD 5CWSA 5F3BA 4ODXB 1S7WB 2V5TA 2KL6A 4HCRA 4I77L 2YWZA 1P4LA 4JAMB 1S78C 1R6VA 3WD5L 5K9JL 2CR6A 4MA8H 1EAPA 4EUPB 3KJ4B 3KNBA 3VH8A 4CVXB 3N1PC 1X44A 1IAMA 2VZSA 3VRJA 3MXWL 2X70B 2Q1EA 4P59L 4WTZA 5AWNL 5I76A 2PW2B 1FNFA 5C9KA 2C4XA 1QVOA 3ARFD 1PG7H 4TUKL 4P2RE 4XMKH 3O9WD 4XMKL 1T03L 4PG2C 1U92A 4UILL 1UM6H 4FXKA 4PGZA 4IRSB 2C5DC 1S7UB 4ZUTB 2XT1B 1U93A 4MJ4A 2MOVA 5HYSA 4FN0A 4JM2A 2Z8VC 3UXFA 3C09C 4OLYH 3FFDB 1KCSL 1KIRB 2HT4C 3TIDB 4RDQG 1NH6A 1T20A 4XTRD 1BQSA 1QBMH 3MREB 4N8VG 4LVHC 4PB0L 3NABL 4HC1L 5HI4C 1KBGH 3NCYP 4EIGB 5H37H 1F90H 3QXAA 5J89A 4DKEL 3SJVD 3NIGE 4PP1D 4G42A 4HXBH 4YPJA 1IGJB 1RAMA 3IXAA 4HLZG 1ZLVK 4ZTPL 4L3EA 1HHIB 1RIUL 3TBVA 3BH8A 2H3NB 4L1HA 3IDYC 1HYRC 4NO5B 3RWIA 2J5LC 4FFVD 2JB5H 1LK2A 1WK0A 3O6LL 5FF6B 2AXFA 3DTXB 4PJAB 2FD6H 4P2OD 4RDQF 1KJ2A 4L3ED 2BVQA 4XAKD 2ZSWB 4N8PA 4M61A 1WISA 4RGMB 1J7VR 4QTIL 3HG1E 2DWEA 1DUZA 4JY6A 2A6JB 3V6OA 5JZ7C 4OGXH 2J2ZA 3N9GH 3LD8B 1A9BA 1FYTB 2FX8L 2NW2B 4WWKD 4K7FB 5GSRA 1QSED 4ZFOL 1N64L 5D5MF 1IRAY 3UDWA 4W6WB 1UM6L 3WFDH 1AI1H 1S5HB 2R1YA 2JTDA 5IW6B 3AY4A 3UC0L 2VLJE 1J8HD 4PJHE 5D7JC 1Q72L 3VWJA 2BP3A 4L29A 1MHPH 1HWHB 2APXA 4U7MA 4QRUA 1C5DB 3S35L 4O5LL 3UTTB 3T3PE 1FV1B 1OAYH 1RI8A 1JPTH 4Z7VB 1UWEL 2AEQH 2X1OA 4NQCA 3U4EA 3H2WA 1E4WL 1GHFH 2B39A 4K3HA 1ETZA 1GGCL 4BUHA 5ANMB 4L9LC 3C60A 3WKNA 5I6XB 1CFBA 3EZJB 2UYLA 4HMCA 3LQAH 4G8FA 4KI5C 1QO3B 2WANA 4YLQT 5J4MA 2KKQA 3GNMH 2P4AB 2BXYA 5I75C 4LRIC 4F37F 4P4KB 1UC6A 1NANI 1H3UA 4D0DA 3O6LH 1BWWA 1BZ9B 5I18L 1EGJA 3QI9D 2UY6A 4KJYB 1DUYA 5I1DB 5ENWA 2GIYA 3RPIA 2X1WL 2IQ9H 3RWGA 1MQKL 1RK1A 3PDOB 1DDHA 2VAJA 2PCPB 1VFMA 3EFDH 3QXVA 5SWSE 3NIFE 3MROB 4KDVA 4OM1H 3E1F1 4ZOAA 5D2NB 4C56B 1A6TB 5FKAA 5CIPH 2OJEA 2WNGA 4NRZB 3SDDB 3W2DH 2D7TL 3VWKD 1P7QB 4JFOA 4TVPL 5AZEH 4GRWH 4S1QL 5TFSL 2RQ8A 3BKCH 2YUZA 1MRFL 1T0PB 4QGTA 2R0KL 2I9LB 3L5IA 4JKLA 1CFQB 5GHWL 2F5AH 3D85B 4QHKI 1INEL 4A6YB 1RULL 1YQ2A 4LSTH 4QHNB 1CD8A 4NN6B 1E4WH 1GHFL 4RISH 3LKOB 5IHZB 3JWOC 2ITCB 5I1LB 1CVSC 1BBJB 1TTFA 3BKJL 2ZUXA 1YJDC 5D5MA 2GAZB 5DDHB 1S5IH 4NKQB 3FAXA 5D7IF 2PNDA 3HZVA 3QQ4A 4BK5A 3KPNA 5HHOE 4HDIA 5TGBB 1U8IB 2RB8A 4S1DC 5JIKA 1IKFH 3ARPA 5M95B 1QSFE 1FQ9C 4GKNB 4PR5B 1OP5K 4BFBD 3BWAA 4IHOB 2MQCA 4JO2L 2FO4B 1JMZA 4PY8J 1ADQH 5EBWA 3G6DL 1B9ZA 1TVBA 3I6GB 4JLRA 3DUHA 4PJBF 4GBXB 3ZLQC 2PR4H 4FNLH 1BFOB 1A3RH 1U8NA 2QHRH 4XWOC 3T4AB 1S7SB 4OZHF 5KZCD 3RZCC 2PTTA 1S9YB 2VKWA 4HXAL 5GS0C 5IR1A 2ITDB 3GJEB 2YD5A 3DVNB 4KKAD 2VZ1A 1NUNB 1FGNH 1AQKH 5I8KL 5F3HA 1OGAA 5HDBE 1FNHA 5E99L 3PF2A 5C0AD 2DQEH 1VSCA 2QADC 5MENB 2J5LB 4WGVB 4JY4A 5FV2A 2RFXA 5DHYB 1WTGT 3PIQA 4MDIA 3EOYG 4J8RA 4N1HB 3I9GH 1EFQA 1S9XA 1BJ8A 4PJEB 2NY6D 3EDDA 4FQJL 4NC0B 1FE8L 2WP3T 1SVCP 5F70A 4LASL 3MRPA 4IIQA 2D31B 5B8CC 4FQQA 4GW4B 3MV11 3FRUB 1RUPL 2LV4A 3WHXB 3LEYL 4M5ZL 7CGTA 4P2QE 1DE4A 3ARBA 2G5BA 2QQLL 3NA4A 2MPAH 3IS1X 1FCGA 4OLEA 3HC0B 2H1PL 1R0AH 5JHLH 3C09B 1K4DA 3KYKH 5IT2L 4XPTH 4ZUSB 3BHBA 1VFBB 1H3PH 2NLJB 3EIFA 2EDJA 1YC8A 1MJJB 4BELD 2EYRA 4F2MB 1JF1A 3OF6D 2UZIH 3BP4A 1HQ4A 5L8KB 1I7ZA 3DV4A 1NLBH 2EC9T 3AREA 4AIZA 2IALA 2HP4A 3VGBA 3T2PA 4P2RB 4DQOL 1CWVA 4TPRH 3SDXB 2NY2B 3SPVB 3ARWA 3T0EA 3VFSA 3T0VA 2NY5H 4U3CA 2PW1A 3EYFB 5JO5B 5C0BE 4UT6L 4P2QD 4M1DH 1J0HA 4H0HB 4S0TD 3BMWA 1F02I 4PJ7B 1N7MH 3KLHD 4LLQA 2FX9L 4D9QE 2F58L 4HJGA 4RAHA 4YHYB 1WZLA 3V52H 1UH2A 3ULVE 3SDAA 2WWKO 4RZCB 4YIQB 4M6NL 4WEUD 4NZDA 3V8CA 1A1NA 4X80L 3N85L 1YYMH 4PJ7F 5E08H 5CEZE 2ZUQB 3FN0H 2MFNA 3GSVB 5GIRB 3QXDB 1X5HA 4K8RD 4Y2DC 1ZT1B 4G80A 3QWQB 1I8MB 3LN4B 1NFKA 4GS7C 4Z7NF 1KENL 1DL7H 2AJSH 2ICWA 4WO4D 1XMWA 1Z9LA 4HQQL 5KSUA 5J13B 4CL7A 4U1SB 4YHMH 2Q8AH 5BXFB 3IDXL 3HS0A 3QCVH 1X7QA 4HKBB 3QZWB 4LHJB 1NPUA 4LHUB 4KZDH 1KN2H 1SEBB 1FL5A 1UADC 1XF3A 5D1XB 1JZ2A 4X4ZA 3MBEB 3H9SB 5A2FA 4FXLA 4YBLB 4YDVB 3QHZH 1I4FB 4OGAD 2VE6B 4LGPB 3LPWA 2BNQD 2HKFL 4KDWA 1R3LA 4YHNA 4LCWB 2X89A 2E6JA 2AJ3A 2YK1L 1JE6A 2J3SA 2BVPA 4OGXL 2DM7A 4O58L 3BUYA 4LK4A 1Q0XL 2R0LH 2OYPA 1T03H 4ZDHA 3H6JA 1S7WA 4FFWC 3EJJX 2FL5B 3BKYH 2O61B 4PJBE 4MNQB 5A16A 5KAQG 4DGVH 4GAJL 1G7JB 1G1YA 4CAGA 3D69B 2AABH 5T1DL 1EAPB 3KNBB 3UPCA 1B0RA 5DHXB 4YFLF 1PDKA 3SKOA 5KVFH 4LPYA 5KVFL 4YO0A 3VXRB 1MSPA 5IF0A 4GAYB 3T3ME 2VLRE 4G6AC 3WNLA 4PTUA 1A1OA 3BPCB 2F54E 4OKVB 1WAAE 1NMCB 1ZLUH 1ULVA 2DQFB 2IAMB 3BN9C 5EUOA 3WNNA 2ADIA 3X12B 4OCMC 4DN4L 1KENH 5C7XH 4AIXA 1F3DJ 3TEUA 4AMKH 1A6VH 4DKDC 4N0RA 2JCCE 2Q7NA 3TO4B 1FIEA 2ADGB 3PL6D 4IRSA 1L7TH 1MHHB 3HI5H 3NFSL 4XMLH 3NCYS 5C92A 4P9ML 4F57L 1CT8B 3U7AA 2CLVB 3FONA 1RZ8B 3D3VA 2ADFL 4KY1H 4PRPE 3QDGD 3JBG7 1HH9A 1AQDA 3WJLC 1F4WH 4YNYB 1A2YA 1MCRA 3MRRB 3D25B 2VTFA 5ICZB 1XCTB 5F96H 4QOKE 3V0AC 2QQNH 5KS9A 3MTRA 3F5WA 3H42L 1HHGB 1PLGL 5EC1A 3WN5C 5KTEH 3AROA 4FFWD 5C8JA 2VO5A 4JFPB 1RZFL 2WMPA 2B7DT 2SEBA 1DVFA 4OI7A 4LFHG 1WWWX 1ZT7B 3QUXD 4V2BA 5B8CA 2QQQA 3O2WL 3EO0A 3TBVB 2G60L 5FM4A 5GSVB 5IBLD 3MX0A 4X7TA 4Y5XB 4NO5A 4X7DC 3EO1A 3HZMB 4PP2A 4KH2A 4P4KC 5JUEH 4R4NC 4ZFZB 1YUHA 5JUEL 3UJJL 1OTUD 4XVSH 3HMXA 4M6OH 4S0SD 2XICA 2ZSWA 4QRQB 4X4ME 2NY2C 2VQTA 1DUZB 2Z31C 3NIGF 2ENSA 2DBJA 4AEFA 5ADPH 4ONHA 2H45A 3P0GB 2PTUA 3FT2B 4BQBA 1I1AD 3O4OB 3VXNA 3DWTA 3DMMD 3T1FA 2W91A 2IBZY 2EDNA 5DLML 4Y1AE 2B4CH 4TUOB 4UIKH 1A6VL 2KBGA 4MAUL 5SWQA 1JGLH 3R06B 1S5HA 2R1YB 3VGFA 5IW6A 3MLXL 4LSPH 4LOUC 3B6SB 1NGYA 3SKMB 3QUML 1U8JA 4MQXD 4GG6A 4JGUA 5FYLE 1FE8H 5C0CE 3RUGF 4QRUB 1J05A 2DLEA 1FL6A 4Z7WE 4EOWL 1IC7H 2YPVH 4XP5L 3QO0B 4XP5H 1N59A 3L3HA 2V2XB 3QCUL 2ZCKH 3LB6D 4EUPG 3WHE1 1UG9A 1CFNB 4H5SA 3SN6N 3P30L 2CKBH 3QR2A 4TTDC 1EO5A 4LQFH 1J86A 1UEYA 3D18B 3SJVA 1OSZA 3X14B 5FGCB 4MJ6A 4XCFL 2DICA 3MRHB 3OX8B 4IMLA 1F42A 4X0KB 3TPUA 1XGUA 1FSKB 2R1XA 2IQAB 3BPLB 4PJGE 5GISH 4JFFA 2VXTH 3QDMD 3FQNB 5IEHA 3KPRE 43C9B 2ZCLL 3ZZ1A 3ES6B 3I6LE 5F7FA 1A47A 2DDQL 1G9MH 4P4RB 4X4YA 4HW6A 2EDOA 4QHLA 3U0PB 4LSVL 3IDJB 3DO7B 4LGSB 2XACC 4HKZB 4JE4B 5CIPA 4I0PB 4JGMA 5T1LD 3TVMC 3G6JF 4ZOBA 3WIFA 3GMNB 5JA8B 4C56A 2YS4A 5FKAB 1Q94B 2QQLH 4XC3H 2D4FA 1LP9E 5E00A 1TZIA 1UQSB 3BI9X 4KI1A 5M94B 4YHZH 1ADQA 4RGNB 5FYJE 5EOCJ 3MXVL 4JFDA 3T77B 3LKSB 5LGJA 3UTSD 5HHOB 4JHBA 3T8XA 1KOAA 3MA7B 1QP1A 1DBJH 4YXKL 4GLRH 4U1HB 3GK8L 3INUL 5GZOC 2XIDA 4PJGB 1FH5L 3RHWF 1NFDB 2HT2C 1CR9L 2WBJA 2C1PA 2NX5E 1S9KC 1IGFL 4XNUL 4QXWA 1A14L 2HVJB 3VXUB 5I17B 3X17A 1AGCA 4H8WH 4HJ0D 2ITCA 3SKJL 2XKNB 4PRIE 1V3JA 2E6QA 3IDNA 2XXMB 5E2UH 5DDHA 2EO9A 5FO8B 2X1PA 1KFAL 5IB5A 3ZTJH 3B9VA 4NKDA 1NBYB 2CO6B 1OD7A 4RFEB 2FLRT 1OM3L 1A3LL 1U8LB 1A6UL 3VFMA 3UPRA 2RR3A 4NUGL 4ACPA 4PR5A 3MRQA 3AU1B 3CXHJ 4ZNEE 3U0WH 4K3EL 5DUPH 2JJTC 4ORGA 4BJLA 3PJSA 2FR4A 1GGUA 5ESVA 5EU5A 1YDPB 3CLEH 4LSVH 3I6GA 4HUWA 5D7LE 1T3FA 1T2QL 4O2FA 3QNZA 3RAJH 3VG9C 2IG2H 4BQ6A 3FOLB 1H5BA 4MMXC 5DMGC 2R0LL 3EYSL 2VXVH 4GKZB 3T09A 3QIBA 3TLRA 3REVA 4WFHE 3NFNB 3C2AH 5DD0L 3RL1A 3GGWA 4OQTL 1DL7L 1QOKA 5BVPH 1D9KA 1FL3A 1WBYA 4PJXB 4YDIL 4FZ8L 4PJEA 1OQOA 4DFIA 2DQGL 2CJUL 3JZ7A 3QDJB 4D94A 1OWWA 4OZIE 5C0BD 4OD2A 1AD0B 1T22A 3MJGX 2GSIB 3RTQC 3SE9L 5J06A 2WBJC 1VACA 1ZVHA 4C54A 1RZJL 3P4OA 2VLKA 2N1KA 4OIBA 5C0JA 5L88L 3HE7B 4LSTL 2F54D 4RFOH 4YZFF 3MRIB 1CQKA 1R24B 1JHLL 1JMXA 4D3CL 1A6ZA 3PGDA 5FHBL 4YR6A 1QLEL 4U1NA 5GGTA 1S8DB 2VH5H 4XHJC 2AK4D 3FO9A 5F93C 2XNAA 3SE4A 3LQZA 4C4KO 2GUOA 3AMLA 2C1OB 1I1YB 2F8OA 4DVRL 3G5XA 1ZS8A 2R2EA 5ETUA 4M7KL 1RIVL 3F7RA 4ZSOB 2PO6A 4AIZB 3IU3B 3U9UA 5FUZL 2IALB 4YDKH 2AABL 2VSCA 2FD6L 3RNKB 4UT9H 5TH2B 3V79C 5DJ6A 2Y07H 15C8H 5CZXC 1LD9A 2KDGA 32C2A 3ZT5A 5F88B 5TDOA 1CGSL 1NCWH 5FOJA 5FECB 1J9CT 1NDGB 1MUJA 1W0VA 4Q97A 3CJJA 4TULL 3BPLC 5JOFB 5LQBH 3CZFA 5J9PB 2F53D 4NJ9H 4U49A 5EOQL 1EEZA 2ZJSH 2ESVD 5HVGB 5LWYL 4I2XB 1H3VA 5IBLC 2YC1A 3EAKA 3QDAA 4KK6D 4MHHG 1Q72H 1WWCA 4WGWB 4P57B 3EZ8A 4K9EL 4WHDA 3DLQR 3TYGH 1EVUA 5ITBH 1P69B 4FP8H 5DF0A 3OR6A 3HNTL 4FQ2H 2ADJA 4UTAH 3RWJB 4CDGC 2BSED 1UA6L 2D0HA 3GSXB 1NCDH 5C0RH 3SGKA 4WJ5A 5D7LD 2X4PA 3UBXB 3QHFH 2JJSC 1RU9H 1XZ0A 1KCRL 3ROOA 1EZVY 3HRZA 1NMCC 5D7KE 5B39B 1BX2A 5SWZD 4MD5A 3QQ3B 4CW1A 3QIUC 5DQDH 1E27A 4XPGL 2Y72A 3PG2A 2CPCA 2MCPL 3IT8D 4F7PB 2W60B 4ZUUB 3WUWB 3IDIA 2EEBA 5F1IA 1MCSA 4R90L 1IKNA 4QOKB 4NZTH 1WC7A 3O3DA 5J3HD 4G3YL 1A7NL 5HYSG 2YD7A 2GJ6E 3G5ZA 3TZVC 3G08A 5IB4B 1JK8B 3KPMA 3RKDD 1JNHB 4JRXD 4YDVA 4ONFL 1KEGL 2IBGA 3QJHB 1ZHKB 4G6AD 3G6DH 4GRWE 1R3LB 4X83A 2KUTA 3QUKB 2YSSB 3FB8B 3SDCC 4XCFH 1D5BA 3VGHA 4AJ0A 2BZDA 1BEYL 4ZDHB 1AQKL 5EG6C 5CEYA 2IBZX 2YD3A 3WDIA 4WTZG 1U8MA 1CDBA 1RJLB 2X89D 4UV4H 3BYYA 3L9RA 4LQ1A 1JNLH 1YEFL 1IAIL 4JRYB 5DRZB 2H8PA 1BF2A 3GMQA 3QQNA 1KN4H 3NCJL 4XH2B 2A6IB 4LSUL 5ISZA 3K4ZA 4DVBB 5GS1B 3LEVH 4CU8A 1Y6KR 4X4XB 1NCDL 3IAPA 1JWSA 3BQUC 3PNWA 4P23D 1A6WL 1M7IB 1EA9C 1A6WH 4HKXA 1KCRH 1RK0B 5KSBE 2FJGA 4RBPH 2E8YA 3Q5TA 3WXVH 1JWMA 2OQJA 4TUKH 4LLWA 2MPAL 1CG9B 1BMGA 4HJJH 2ESVE 5CBAB 1OD9A 3Q5YA 4I3RH 4Y19D 5JPNA 1HSBB 2ADGA 3KPRD 4YE4L 4Q6YA 3JWOL 1N6QL 5I1KH 4NQSA 5IHUH 3QDME 3SDCD 3IF1A 1FNGA 3GBLA 3QA3A 5I16B 4KXZI 4OSUH 4R4BA 1EDQA 1MI5A 2CLVA 1A21A 2NXYB 2X6MA 4AM0A 1PSKL 2AJYL 5FDWB 5IVNA 1RD6A 4L8DA 4OLZL 3ZHDA 1JTOA 2NY6C 3JWNC 1KCUL 2H32B 3G9VA 3V7AG 5EBMB 4H1LB 2YWYA 3W9EB 4ELMA 4XBPA 4KK5C 2YXMA 1LWRA 1Z9MA 2C26A 3ABZA 2ZNWA 3B9DA 2CLRA 3QUYA 4LSPL 5EIIB 3EO9L 4HAFA 4YXHL 1YMHB 3RFZC 3LKRB 3GIVA 4A2LA 1H0DB 1F8TH 2XPGB 4P5TA 1INQA 1NGPH 4YGVA 4LASH 1RMFL 4EI6A 4MS8D 3QCUH 5H37G 4Z8FH 1S9WA 4G6ML 4Y88A 3OQ3B 3PDDA 3TT1H 4YAQB 2NMSA 4M43H 3L3OB 5C3LD 5KSBF 5LXGL 1ZHNA 1Y18A 1RZKC 2PO6C 1UKSA 3HG1D 5EC2B 3RTQB 3VG0H 3TA3C 4WFHD 4JM2D 1PAMA 2B5IC 1NGYB 4O02H 3V4VL 3MOAH 5EU7C 1MCNA 2JJWA 2ZCLH 2ERJC 3D0VB 5C2BL 5GGVH 5EU6E 4JFEB 5C2BH 1FZOB 3GM8A 5KVEL 5E4IA 4I1NB 4PD4K 1N3NA 5CSBA 2XY1A 2AS5M 1MF2L 1CFNA 4TPRL 1ACYL 1ZMYA 3DMMA 5F7NC 1N5AB 3SE8H 3K7UA 2E9IA 1DTUA 2Y36L 3KLAA 1NAKH 3QUXA 1FORH 4L4TA 2BJMH 3MR9A 1Q0YL 3EYOB 4LRNH 4L8SC 2DWEB 2NY4B 1JGVH 4M6ML 4R9HA 1EHLH 3DSNA 2DTML 4HFUH 5HSFA 4N1CA 4U6TA 4NC1C 4LKCB 4WU5A 5IFJA 1JYNA 1WWAX 4XP9H 1M1SA 2HVKB 4YC2B 2DQGH 5GGUA 1V7MH 2DWDB 3BD3A 2EIEA 3IDJA 5TDPB 3PUCA 4U6HA 1I85C 1W0WB 2IPUK 5CJQL 1MQKH 1UM5H 3QZWG 1NGXA 4JZJB 2DQDL 2P5WD 4C58B 5D6DC 5CEXA 3SKJH 4PJ7E 4HWBL 5INDA 1EX0A 4G5ZL 4B41A 4F7TB 4YJZL 5C0CD 1IL1B 1UYWH 2FB4H 1E6JL 3VA6A 4AMKL 1HSAA 4KKAC 5FYJD 1HCVA 1CBVH 1AE6H 4PV9B 4KJPC 5D8JL 3RZCB 1XGTA 4Q9CA 3RVWC 2DYPA 1S7UA 4P46B 5CJ8A 4F9LA 4XX1G 3ISWA 4U1HA 3BD4A 1QQDA 3NA9L 5F7MC 4LU5L 3NACL 1IC5L 3A0OA 4RRPA 4PJ9C 4WUUA 3MV8D 4LCYA 5MHSD 3MPCA 4GXVL 4X5WA 3T08A 3HNVL 2FO1A 3L3KB 4XXCC 2P1YA 1T2QH 3RRQA 5EO9A 3REWA 1E4KA 3WJJC 2XA8L 3NZ8B 2EDYA 5J1TC 2A83A 4HT1L 1FZMA 4UUJB 1NCWL 4KQ4H 2H2PD 3MV8A 4NN7B 5SV4A 1KUMA 5IG7A 1YNLL 4Q6IB 2C3XA 4OLWH 1EEYB 1N64H 4WV1B 5BCAA 1LDSA 4LAQH 5D2NA 2H3NA 1PJ9A 1YECH 1BOYA 2GITA 1T80A 4U4BA 3I50H 4PRAB 4ORGB 2OJEB 4S11A 5SV3A 3SDDA 3U30C 3MMEB 1BWMA 3IKCB 5T5FH 3RVWD 4XMPL 1J10A 4MD0A 4MAYC 1NC2A 1TTUA 4QTHA 5FO9A 4ZXBD 1CI5A 1Z0MA 4P3CL 3ULVL 4D2NA 1SQ2N 2YA2A 1S7TA 1ACZA 3X11B 4RGMC 4G8GA 1CGTA 5JLZB 1NC2D 2NW2A 3IFLH 2B4CL 4KC3B 5HJ3B 3F62A 3WIHA 4LMQI 3WFZA 5TF1L 2F8XC 4HEME 3BO8B 5TQ0L 1CVRA 2YXFA 4Y1AD 1HILA 3K46A 5MERA 2QSQA 2JJTA 3UTPD 2W38A 4ZXBC 4R90H 4OCYL 1AD0A 2DLFH 4EXKA 2OZ4H 1CXHA 4PJ9A 3RI5K 3LQMA 4YXKH 3UTTA 2RCSH 4HUXB 2YRZA 3I02B 1OAXH 1TVHB 1I8KA 4RQQB 3P4OB 3MLZH 4JO2H 4YHIB 2DKMA 5F96L 1QBAA 5EORL 2HTKC 4L4JA 1E4KC 5DJ8A 1MLBA 5HYQB 4JFQB 4V1DD 1X5LA 4KQ4L 4H8WL 1R24A 1BFOA 4DN3H 4L3CA 2FWOB 5D6CB 5CD3A 1S7SA 4JGJA 1S8DA 4KKLC 3W82A 4WWID 4G8FB 4Y2DA 3VE0A 2GUOB 5GRWA 1ZV5A 4GG8B 1WCBA 2ITDA 3OBAA 4P2QB 3G5XB 4UU9B 4HHAA 5ETUB 2DBLH 1NDMA 1G7PB 5CINH 1HWGB 4OF5A 2N4IA 1E4JA 3GI9L 1GZPA 5I15L 1XGPB 3MRNB 4YZFE 4K8RC 4ONGL 4Y2DD 3PIQB 2BNQE 4PREA 5K59F 1MPAL 3RPIB 1H15A 1MQ8A 4HUMB 1M05A 3FQTB 3IJYA 3T65A 3WIIH 5DXWA 5EZOL 5F88A 5TDOB 3MRPB 4JPVL 1RZIA 4QRSA 2IH1B 5SX5K 3GMLB 2BVOA 3TIEA 5E9DD 3VDAA 3S36H 3GMPB 1I9JL 4BKLA 4Y5YA 4RGOL 3IAGC 5IROA 4E5XA 4P5MB 4Y19E 2X44D 1KLGB 3PV6B 1X5ZA 1Q9KA 2HFFA 2NQCA 2VXUH 2YUVA 4WO4B 5C1MB 4NFDA 3MOQA 1T2JA 5E2WL 2P45B 5I1GH 5KJRL 3OR6B 4OSUL 5C9JA 2YPVL 2CDGA 1G6RH 2K1MA 1Y0LA 1M6OB 4WUKH 3V95A 1I7ZB 3DV4B 4FNLL 2R69H 1BBJA 3CFDB 3PWPD 5AUMA 4FQLL 4JPWH 1IILE 4PB0H 2NY5L 2F53A 1IC4H 1MRDH 1ZKAA 2CIKA 4EN3C 4LEXH 1V8HA 3DI3B 5T1KB 4GW1A 5JHDA 3ARED 1KGCE 3N50A 3FN9A 2RBLA 2E6PA 4XXCA 2ICWI 4XNZC 5I9QC 1ZGLB 3WFEL 2CK2A 3EW3B 4F7EB 1BGXH 3P9LA 4UIMB