1CT8A

Catalytic antibody 7c8 complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
ELVMTQTPATLSVTPGDSVSLSCRASQSVSNKLHWYQQKSHESPRLLIKFASQSIPGIPSRFSGSGSGSDFTLSINSVETEDFGIYFCHQTHGRPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7C8 FAB FRAGMENT; SHORT CHAIN
publication title Diverse structural solutions to catalysis in a family of antibodies.
pubmed doi rcsb
molecule tags Immune system
total genus 51
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 1999-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ct8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ct8A01
4LCUB 4PS4H 3QRGL 3MACL 1UM4H 3AREC 3T08A 5EU6A 5B3JF 4JO4L 1A7QH 4CU8A 5HDBE 4R96B 1KIQA 2ZOKA 3LB6D 5LQBH 3S37X 3T8XA 5IIEB 5I76A 2NY0C 4RZCB 2G60L 2P5WD 1RQ5A 2VXSH 4HUWB 1CFVH 2NZ9D 5D1QA 3QXAA 4N0FA 1QLFB 3GKWH 2HFFB 2X4RB 1OSPL 4YO0A 4PJGB 5A16B 5SV3A 1QSVA 2DTMH 3BEWB 3TJEL 5IWLA 1H15B 4QYOB 3B9KB 3NFSL 3HG1E 5I8OL 1D5BA 4M93C 4NC1E 4OLZH 1BBJB 3FL7A 5IGXL 4AJ0A 2RR3A 1EEYA 4AL8H 2EO1A 4LDOB 1NDGA 1KT2B 1M7IB 1FZMA 3WO4B 2VRAA 1K2DB 3GGWB 1E6JL 2FD6L 4EDXA 1F90L 1I1CA 3IRPX 5B8CC 1EHLL 2XKSA 4HXAH 4JRYA 3TBTA 2A6JA 1U2CA 1HHHA 4IDJH 3S5LA 1E4XI 3X14A 2HVKA 4L8CB 3FOMB 4XXCA 3RL1A 4GRLB 1FPTL 4HUUB 5MEPB 5IT2H 4HHAB 4B7IA 4HJJH 2A9ML 3DPBA 3ARYA 4MAYB 1A6TA 4WCYH 4I8DA 4OGXH 3FONA 4Y19B 1A9EB 1HEZA 2AJXH 2Q76B 1UA6H 4NPYB 4XP1H 5GZOD 1EPFA 4JO1L 3SQOL 4JM2F 4PRHE 5CJ8A 5EIIB 2WSKA 3IJYB 4KKBD 3RVUD 3MNZA 3MA9H 1MIMH 1FNFA 1G0DA 3SGKC 5JMRA 2R4SH 2I07A 1OB1A 5J13C 4Z7VF 1PG7W 2F8XC 1YNKH 3MV01 5HSFA 2DMBA 4YPJA 1LEKB 4WDIB 5IBLC 4EBQL 1JZ4A 4B50A 4X6DB 3D39A 5KS9B 1CXHA 2NX5E 5FA4A 1WBYB 3ARFD 3LHPH 1CT8B 1T04A 4M43H 1H5BC 2W59A 1YEKL 4HWUA 5DVLA 3TV3H 1BZ9A 5IW1A 4Z7WA 4LLWA 4ZAKA 3AREB 2AV1B 2Z92B 4OCXL 5AG9A 1M71B 2X4SB 4QHMA 4LRIA 2IBBA 3C5ZC 3AXLA 4TRPH 1U8KB 5C07E 1XIWC 3T77B 4HFUL 3TYFB 5FO9A 1MCPH 2H26B 1OAYL 3O81A 5FIEA 4NN7B 5I1KH 3P0VL 3O2WL 4JAMB 4XMPL 4J7RA 4W6YB 4P2QD 2PTUA 1EGJH 1O0VA 4OFYA 1MNUH 5JO5B 4OGZA 1WBZB 1PDKA 2FCBA 4KJYA 1EO8L 3VG0L 3KYMA 1L7IH 3HMXH 4HKZB 4PP1D 4DAGH 4FXGA 1C8PA 4HUVB 1EAJA 4M93B 4FHBD 1CIUA 1CLYH 4Y5VA 4PUBH 5F3BB 1I1YB 2ITDA 1NJ9A 2O5XH 4MNHB 4A6YH 3HNSL 2FL5A 3P11L 2ADFH 5GGRB 1D6VL 3BESR 1J87A 5T3XH 1HILB 1MHEA 3BAEL 4QRQB 5MENA 2YA2A 5AAMA 5KSBE 1P1ZB 3U0TB 1MWAA 5E0QA 4Q7DA 1KIUA 1T20A 4F33B 3GSNL 3LIZL 1FG9C 5JHDE 4L8SA 1WITA 2BZDA 4XP4H 5GIRA 4LLAA 1ETZB 3ULVF 3SDAC 5TE6H 1IAIM 1I8MB 3PWNB 3GJFK 1FVDB 4GAFB 1AJ7H 1KELH 4DCQB 3R8BB 1CXFA 4XZUA 3PP3H 2DL9A 4H88L 1PQZB 4WUUE 4K7PX 3SKUD 4BH7B 4P5MA 4WY7H 5E8NA 5FFLA 3P30L 3SN6N 3QUMA 4PTTA 1JUFA 2AKRA 3O3AB 3W2DL 2D9QB 4CBPA 1VGEH 4E41A 1I1AD 1YNTB 4QWWD 2DN7A 1KYOJ 5J1AB 1KB9J 3BD4A 2BC4B 4LRNH 5J13B 1JWSA 4QLRA 1FO0B 1MREH 5FGBA 5FECA 3L3OA 4WJ5B 1JMXA 4GRLD 1UKQA 4QNPE 5HGHB 5T1MA 3LQZB 3CLEH 3GM8A 3EOYG 4YPGB 3NABH 4Y4KA 5EPMA 4ZOEA 2ZUXA 5DJDB 3CFDB 4Y19D 3GSOA 1V7MH 5EA0L 4XC1H 3TBWA 2NMSA 3SEPA 1MJUL 2F54A 4FQQB 5CP3A 2YSSB 3OV6A 1BVZA 1V5JA 4WV1C 3FN0L 4OD1L 3C5ZB 1B4RA 1XIWB 1QA9B 4D9QD 4ELME 2AEPH 4P9ML 4YHMH 3KPRE 4RAVA 3LN4B 5IR1B 4QT5A 4NM8L 3U1SL 1KCRH 1A6AA 5C0GA 4P46C 2DYPB 5JHLH 2ATKB 1SMOA 5F9JB 1IILE 35C8H 4ZQKB 4L1DA 5TJWK 4NZRH 4UTBH 4JJ5A 4F7MB 5AD0B 1JGEB 1J1OL 4NO0B 3K81A 1QPPA 4XBPB 1CE6B 3IXAA 4G42B 3V6FA 4MDJB 4XBGB 3L5WB 5T3XE 1E4XH 3K2UH 4M48L 4ZO7A 3U0WH 5A1AA 4PRIE 3IGAA 4TVPH 2R8SL 3G6DH 3KPPB 1Z2KA 3PHSA 2VWEE 5KSAC 4X98B 3QDJB 1QSED 1SEQL 4TNVK 4WFHD 3RJQB 1KTRL 4O5LH 3SKJL 5EN2B 3G6AA 4QY8A 5BV7H 1HSAB 3D2UB 3BDYH 3U9PH 4PBWD 1RURH 3P0YL 5FF6A 1R6VA 3CVHA 1GL4B 2ESVA 1FYTE 4G7VH 3RZWA 4O2EB 4GKSB 4LFHG 5GJTH 3RWFA 3SDAB 4XCFL 3RUGF 4P57A 3UC0H 1IAII 4GUPA 1H0DB 1KG0B 3S37L 5GS0D 1J05B 2OMBA 2ZSVB 2VERN 5HYJE 3LKOA 4CN6A 1D5ZA 4YDIL 4GW1B 1V7NH 1EXUB 3UZEA 1ZE3C 4G9DB 2FR4A 4M5ZH 5DEZA 2XACC 3IU3A 4NKMB 1OWRM 5EFIA 1NMAH 1Q72L 4Z78A 4KFZC 1CD1A 1D5MB 2XTJD 4RAHA 2DKUA 4WWKD 3TP4A 4TSBL 4X6CB 2I9TB 2NTFB 5GSVA 1ES0A 1R3IH 1UEYA 2PCPB 5JPNB 5T1KD 1MAML 4JFFE 1QSFE 1RU9L 5TE7L 5A2LH 2UYLA 3FCTA 5L7XL 3GO1H 3FRPA 5DJ2B 3WSQH 1FFOB 4MWFB 2HJKA 3QDMD 1QFPA 5EOCJ 5I16B 3QUZC 4HWBL 3MO1B 1D6EA 2VITB 3FO2A 5CSZB 4K94L 3FO0H 1H3PH 1IRAY 3SDYH 3ZYZA 3CK0L 1CE1H 3AS3A 4PJFB 2FLRT 4KMTH 4RRPG 2OX5A 1A7RL 1YEDA 4JM2C 1LE5B 3MCLH 3MUZ1 3MRGA 1JI1A 4H8WH 3QEHB 2R29L 4BZ2L 2B5IC 5DQ9A 1V3LA 2Y6SC 1VERA 3P0GB 5CZXC 3QXWA 4X7SL 1PKQA 1Q1JH 3ORJA 2DLFL 3UYRL 4OGAC 4HWZB 1FZKB 1GZPA 4P46B 4HS3A 3DMMC 3VD5A 3VGFA 4QHKJ 4QHLB 3V0AC 1U3HC 3U4EB 1J0YA 2AJ3A 5I15H 2LTQC 1C7TA 3QA3B 3L95A 4D9RD 2FX7L 3W0WA 3QQ3B 3CSGA 4XPHL 1ZHKA 3MLRL 4M02A 2YD6A 1KTLA 5E2JA 3WDHA 4TVPE 3OAYH 1HK6A 1INQB 2E7BA 3HFML 4NKIH 4TULL 4JFOB 1NCAL 5KSAB 3O8XD 1NGQL 4LSVL 4LNVA 2AJUH 2J12B 1S3KH 4GAGH 3HNTL 5H94A 5FO8B 3SKNA 3VDCA 3PXJA 2CJUH 3O11A 3G08A 2J6EL 4FQXC 3VCLA 3E6FB 4GRWH 1U8OA 5KBNC 1A4KB 4X9IA 1ZGLB 5FUOL 2DYPD 5C0JA 1T21B 1KB5H 3V95A 2BVYA 1N4XH 3NFNA 5DEFA 5CZVH 1XGRA 2QL1A 3QEUB 2ARJA 1DN0B 5CJXC 5CLWA 4I4WA 1LNUB 3TBYB 3F58L 1GGYA 3ARZA 3E0GA 4KMQA 4ZUSB 3BH8B 2F8OA 1PZUB 1JZ8A 4MB5A 3VXUB 3BI9X 2GSIB 3F65A 4QGYA 3HCVB 3CH1A 4R4BA 1IL1B 3O4LB 4CRPA 2BX5A 4Y5YA 3O4OC 4FQCH 4X9FA 4NNYB 5I73C 4PJ8C 3QDJD 4QRPA 3NACL 2DQFA 3WUZA 3L5JA 1BVLB 4JFYB 3CXDL 5DUML 3S6CA 3QQ9C 2D7NA 4LKXB 2FH8A 4HPOH 2IFFH 4HS8L 3ZTNH 3MPCA 1CFNA 1TXKA 5J0BA 1CLZL 5BO1L 3B9EA 4FQ2H 1SBSL 4PRBA 2BDNH 3WJLA 1EBPA 3DURA 3BZEB 1Q9WB 3MOBH 4ZNEA 5EO9B 1R24A 3T0EC 3GNMH 1FVEB 3ULVC 3JV4A 1BOGB 3ILQD 1CCZA 3S9DB 1FL3B 4M61B 4LIQL 4TSCH 5ADPL 1NUFA 2WV3A 2EDBA 3QUZB 3IJHB 3VXOB 3VFOB 4OUUB 4HDIB 2GT9A 4TNVF 5C09E 3WBDA 1KJ3L 2G75B 5F96L 3H9SE 1YDPB 1Z9MA 4KVCH 5MHSE 4JM2B 4XTRD 1RZGB 5JQHC 5KW9L 4YFDB 3FQUB 4Z7QF 3DTXA 2B5IB 1S7RB 2QV2A 1ZLUK 3ZE2F 5ACZA 1NL0L 1X44A 3MMEB 4K7PL 2QQKL 3DMMB 4XB8A 3BRFA 3RL2A 1EJ6A 2VDQL 3AY4C 3QFJD 2MMXA 1AQKL 1U3HB 2DF3A 3PWPA 2LTQB 3ZHKA 4R8WH 1I1FB 5AZEL 3B8SA 4Q9CA 4G7YH 4J6RH 2FBJL 3FRUA 1OTUC 4M9OA 1IQDB 2PUQT 4PTUA 4QHUA 1W72H 4K8RC 2OL3H 4HD9A 3FB7A 1DL7L 2EDHA 1FAIH 1HQRA 2EEAA 5GGSA 1I9JL 3EZJB 1ZSDA 3U46B 2YPLE 4MA3A 1N3NA 2AV7B 1T5XB 2B1HH 4YXHH 2OS7A 2H1PL 5EIQA 3QUXB 3VD4A 5GISL 5F8QC 1IAIH 2CKNA 2FSEB 3SDDC 4OTXL 5BS0B 4ALAH 3LY6A 4OLUH 2P43B 1DANU 5F89A 4TUJB 2AXGB 4PGBA 4ODTL 3TH4T 2APTA 3UTTB 1D5IH 3OKMB 1JZ5A 4LL9A 4XC3H 5ALCL 1ONQA 3QIUC 5I75B 3RBGA 4JFDE 1LO4H 3ZKNC 4OAWB 3PWLA 4U6XA 2GJ6E 3FT4A 1OCWL 2QHRL 1IC4H 3K4ZA 2CKBL 1A1NA 5BOPA 5I18L 5C0RL 4PJCB 1WIOA 3U79A 8FABB 3U7YL 4IOSD 3O4OB 4MD5B 5I73B 4PJ8B 4GQ9L 2Z31C 4Z95L 4EIGB 2X4TB 1A4JA 3ARDD 2DD8L 4Y5XA 2V17H 3MRMB 2W60A 1T1WA 3LQAL 2EYRA 4HUKB 3EJJX 5HHPA 4GBXD 2DQTL 4NT6B 1M7XA 4P48A 3GSQB 2FATL 4NRYA 4OCSL 1N5AB 1CDYA 4FOMA 4H5SB 4DKEL 1XF1A 2ICEA 3S7GA 3HG1A 2E9IA 4M7JL 3WFCH 4HKBB 3O3DB 4F9PA 1DFBL 2QSTA 4KRPC 1T0MB 2D7TH 5GS2D 2X70A 3LEXB 5I1CL 1I7UB 1NBQA 3BX7C 3MRDA 3O4LD 1UJTA 1TJHL 2UWEA 3FQRB 1DUZA 5CIPA 4UT6L 2PXYC 1I85A 3OJMB 5E4IA 4IRJC 2ZOLA 4KK8D 5IB4A 3TLRA 5E6IB 4I0PB 2V2WA 2YD8A 3QPQD 3E2HB 5TQ0L 4UT9H 3W9DA 3BHBA 2BVUA 3BXNA 3D0VB 5DEGA 2Y72A 3K0WA 4X5WB 4KUZH 4NQSA 3H7BA 4BFIB 2HMIC 3RPIB 4NM4H 1MFAL 2E5EA 3RU8H 2VZOA 2BSED 1G7LA 2YKLH 1GZQA 4DGIH 1AO7E 3U2SA 2GFBB 4MXQC 4JANB 3TWCL 3CDCA 5TQ2H 3MBXL 4NGHH 5L8JB 4MJ5B 2IPUK 4PRHA 1ZVHA 3F6LA 1XR9B 4DVRH 1B90A 3FT3A 3X3FH 2B1AL 3L3JB 4GS7C 5F7EH 2DQGH 5ISZD 4FQJL 5BRZD 3SDDB 4U3HA 4HV8A 2E6QA 2LU3A 5CZXD 2ICES 5C0DB 5DYOA 4DZ8A 1DANT 3MRRA 1F13A 4KY1L 3I02B 5E8EA 2CK0H 3Q6GL 5EZJB 3WHXA 4PG2A 2KQNA 1TCRA 4LPYA 4U1IA 2DBLH 2FO4B 2NW3B 2W9LA 3QIUB 2HKHH 2WIIB 3O6FC 4PYGA 2CDEA 3ABZA 2E3VA 3EOAA 5EH1A 5CD3B 5CJ5A 1S7XB 3KLAB 2QADB 5KVGL 1IAKB 3U83A 5F72S 4CJ1A 5SX5H 2CDFB 2DQCL 5F7DB 1RHHB 4KK9C 3TT3H 4BSVA 4OUOA 1BGXL 1T6VN 2JB5L 4C58B 4ZFFB 3GSUB 5L2KE 4UDUB 3QUXD 1X6LA 3GMQA 1UWEL 4BQ9A 1QRND 3BZ4B 5C07A 5BS0D 1QHOA 3TCXA 4MS8C 4Z0BH 5SWSD 2W0FA 1MFNA 3HRZB 3UEZA 4Q9RL 4PJEE 3FO9B 5IF0B 2JK5B 4WW2F 3TO4D 4KUCD 3E3QC 1LK2A 3NCYP 1BREA 2FZ3B 4BFGA 1MVUB 3RUGB 2FJFA 2HWZH 3MUHL 1IQWL 2O61A 3P77A 1AD0A 5DO2C 5I30H 3C6LA 1J10A 3AROA 3P9MA 4NWUH 4X9HA 4XI5D 3ZDZF 4IOIB 4R4NC 3CLFH 1ZT7A 1A6ZB 2R2HB 4OQTH 4PJ5E 1AR1D 3VU2A 2GY7B 2X7LA 2PXYB 5LCVH 3DX7A 5D1QD 4G8GE 1P4IH 4IRJB 1XR8B 2OBGA 3MRPA 1G7PB 3IFPA 3KVQA 3UDWC 4JHWL 3FAXA 5KSBA 2DKMA 3L6FA 3SE3C 2VOTA 4OBRA 1F3DJ 2V7HA 5H35B 2GTWB 5E2WL 5JHDA 5I8EA 5ID0B 4HQQH 1LE9B 4HK3N 3UJJL 2F19H 1QO3B 5IMMB 1CXIA 2IFGA 4OKDA 3D18A 2GUOB 3ULUH 5DF0A 2P5EB 3RDTA 3VXSE 5DHVA 1SM3L 3BKMH 3ARUA 4RGND 3OMZA 4P23B 5AZ2H 1U93A 2ORBL 3N50A 3FMGL 4WUUA 5D71L 3UTSB 2FB4L 1CFSB 4JM4L 2OJEA 4JRYD 5JOFA 1WCQA 2ADJA 4YZFE 4BSWB 3C08H 1BQHB 4F8TA 3BYYA 4GS7B 3RIFK 5DRWB 5E6ID 1GH7A 2CIKB 1T2JA 4I0PD 3WS3A 1U8JA 4UTAL 4X5XB 2W07A 3UTOA 4WTZA 1AC0A 1G7QA 1KBGH 1FV1A 3GJFB 1JNHB 2KL6A 1TQBC 4G80A 3Q3GA 4Z18A 3D87B 2IG2H 1CGYA 3AU1A 1DBML 3O2VH 3O6FB 4P2RB 1NCWL 3V6ZA 2GTZA 5J11C 3QUYC 3NZHH 4EUPA 3ZKQD 2CSPA 4GO6B 1UB5B 4W68A 5I1DB 5EUKB 1KACB 3UP1A 4PRPD 1QNZH 5IMKA 3HZVB 3W5NA 1AKJB 1X5JA 4MAUH 4IRSA 5C6TL 1OP9A 4YHIA 3ZTJG 2AS5M 3VW3L 3OJ2C 3DIFB 4P0DA 3RWJB 3AB0C 5D2NC 4XNMA 3SDDD 4PG9B 4LSUH 4ELMA 2DQEL 4U6YB 3BH9B 4X4XB 3KPRA 3PIQA 4P59H 3ALWA 5FHBL 3U4BH 2Z93A 3BSZL 4LSPH 1UQSA 4F7PA 4K9EH 3O6LL 3HMXA 4G6MH 2PW2A 4JN1H 4JQXA 3QIUD 2K1MA 3LKQA 4OF3A 3R06B 1OT2A 4QTIL 2QADD 2XWTB 4GSDL 1S5HB 4LP5A 4NO5B 3MJ6A 4U7KA 3G5XB 1UT9A 3VXMB 4A6YA 4J3TA 3CSYB 2K7QA 1HHJB 1D9KB 4PJHE 4PGCA 2P4AB 5DQDL 3RTQB 3QHZH 1Y18A 2D31A 5HHXL 5C08B 1R3LB 4PRIA 4G43A 1HE7A 2CH8A 5CJOL 4DEPC 1S7VA 3LPWA 3DECA 4HH9A 4R0LA 3RPKA 2E7MA 1ZHBA 2NQCA 5HHVL 3FQNB 4O58H 3FFDB 1J5OL 3PWVB 3EYQC 2ICWI 2Q8BL 4FZ8H 5CP7A 4QF1B 3REVA 1A3LH 1DEEB 1I3VA 4AQOA 1DQLL 3MBEA 2QQLH 3BIKB 5FUZH 4BH8A 5EU7E 4JFPB 3CC5B 5I71C 3GI8H 3JUZA 1FYTA 5DRZB 5K9JL 5GZND 1NLBH 4Z7OF 1A0QH 4MA7H 5AG8A 3RNKB 1IGJA 4EIZC 5JORA 2XN9E 2O5YL 1DJSA 1NBVL 5IKCA 2ZJSH 2ZP0T 1T2XA 5HYJA 1MCIA 2X4OB 4MD4A 5HHNA 3HMWH 3JWDL 3LEVL 4P2OC 5BMFL 4B41A 1BVKA 4JO3H 4LSSL 2VC2L 4UILH 2YN3A 2ADGA 2AW2A 2ZKHL 4ZUUB 4XPTL 3U0PA 1HZHL 4LLMB 3CCHB 3ZYJA 4PJXF 5CEXA 5EZIL 5EU3B 4Q9QL 3MRCA 1P6AB 5HI4C 4WO4C 4XHJC 1Z9LA 4ZUVB 4K3DH 1TCMA 3CVIH 3HRPA 4MQSB 5D7LE 1TQBB 5LGJA 2Q7NA 3O3BA 4ZFOB 5ICXA 2HMID 5LGHH 4PJ7B 1QSFA 1ZOXA 5CEZD 1P2CA 3VRJA 1GRWA 3BZFA 5GGUA 1T89A 1U8MA 2C3VA 5J11B 3QUYB 1EHNA 1SY6H 5E2UH 3MJ7A 4UDTB 4OD2B 3ILPB 4P23D 4L3AA 3QWQB 2VZUA 1NGYB 1VACA 4G6FD 5FCUH 3WN5A 4HWEH 2DI8A 2R1WB 3UTSD 2XICA 2HYMA 3L3DB 4F58L 1JHKL 4YXLH 3K1KC 4NBZB 1CD8A 3AB0B 5D2NB 4L4TB 1ACYL 3BO8B 1GOGA 4ELKB 5ADOL 1W0VA 3I6GB 3SPVA 1T1ZB 1CZ8L 5HDQH 1IAOA 1WEJL 3FFCB 4UQ3A 5IMLB 2VISA 4FTVB 3BIAX 4Y4FA 1LK3H 4R97B 1JFQH 4QHNB 4P2RD 1DQMH 2OSLB 1KB9K 5GJSH 3D3VD 1FFPB 3CLEL 1KTDA 4GG8B 3H42H 4JFZH 3HN3A 4MHHG 1AKJD 3RIFF 5F1KC 1I8IA 1CK0H 2BOBA 1MI5E 1C08B 2G5BA 2ZUYA 3PHQA 4ISVB 5DJCB 1FN4A 1KEMH 1KJVA 4DEPB 5IOPA 5IJKC 4XNQA 5K9OB 5FOBA 4RMUA 2BMKB 4OT1H 4LQFH 3SCMB 4Z0XB 5CUSL 4I5BB 1G84A 2CUHA 1X5IA 2J8OA 3ZKMC 4TNWK 2ZCLL 4NUGH 4RWYH 1TVDA 4Q6IC 4DGYH 3F12B 4Y4HD 5I71B 2QSVA 3MV9E 1G6RH 2LABA 4ZYKA 2NXYD 3OKKB 1IGYA 4KI5F 3QG6A 3CSPA 1JGDB 1C5BH 3X12B 3D85A 2A9NL 3KHOA 3MLTA 2C9AA 1KN4H 4ODUB 3KS0H 3L7FB 1N7MH 1D9KD 3HE6D 3OF6A 3AGVA 3C60C 1UC6A 3RTQD 3L5XH 3NCJL 4LLQA 4P2OB 3AMLA 5I8CA 5HJ3B 1BECA 5F9OH 2X89A 1DBJH 3F5WA 1N6UA 5H37H 4MDIB 2IAMC 1I9EA 4I13B 3QO1A 2BVPB 5SWZB 3QI9C 2A6DA 1DE4A 1E4KA 4WO4B 4XPFL 2BSSB 1U8PA 1KLFA 4ZS7H 4BK5A 4G6AC 2O5ZH 3RY6A 3FN3A 3ARWA 3NZ8A 1MRFH 1NFIA 2EDYA 3MR9B 2V6HA 4FMKA 1S9XB 4JY5H 5HI3C 3OKOB 1ZLWH 5C3LD 4RIRA 4ETQA 5DGRA 1U6AL 2WAHA 1JGUH 4J3OC 3VGDA 1BIIA 1MFBL 2D2OA 5C09A 2BNQB 1BAFL 2R1XA 4F7CA 3KPMA 3ZTJH 4YXKH 5D1ZA 5D5MF 3IDJA 3U36A 5DLML 5CGYC 1GAFH 2BNRB 3TNMB 3GMMA 1FC2D 1VFMA 2JLLA 2VMFA 1OF2B 3MC0A 4LEXL 4XMLH 1AR2A 4F9LC 2YBRB 4XPGL 4XVTL 3STLA 2PW1B 3DX6B 5IG7B 4HLZG 5F8RC 4XXDB 5CINL 2R0ZL 3DXAD 3SKOB 2DLTA 3OAZH 5C0FA 3C2AH 3BQUC 1EFXD 5DUPH 3RRQA 5IBTH 5HHMD 5EUOF 4HZAA 3BT2L 2HJFB 3VFSB 4G3YH 4HJ0D 4I48B 3PWUA 3V9FA 4DZBA 5IW3A 5CHNB 4JDTL 1RJYB 4NO2B 4JZJA 2YPLA 4I18C 4M6OH 3ULSB 4WI6A 3QEQB 4F7EA 2P8LB 3EYVB 1BFOB 4OZHF 3I6KA 2WINA 5I1IH 3MLVH 3FFCD 4Q74A 4FTVD 4H0HB 1NGWB 1EMTH 1KB5A 1QBLH 4N0CD 4ODVH 4PPTA 4Q6IB 2UZXB 3KNBA 3WLBB 3D1MC 1ULVA 1RUAL 5ESAB 1YN6A 2FIRT 1CG9B 3ROOB 5HVHC 2EZ0C 3MYJA 1OAKL 4QRRB 3VGHA 2IH1A 4WW2B 5JQ6L 3UTZB 2QKIA 2OR9H 2VDKH 3B5GA 3MODH 2OTPA 5MP6L 2FX9L 3QZWG 3HC3L 4U1HA 3IF1A 4JFDA 1CXKA 3M17A 2GJ6A 1AGFA 3C60B 4HSQA 5IFAH 3HZYA 4OZFG 3GHEL 4P9HH 1VADA 1OGAB 3E8UH 4LSTL 1K4DB 3BN9C 1B0GA 1H3VA 3L3KA 1DBAH 1AE6L 1F6AB 2BOCB 5C0CD 3SCMD 2P5WE 1FZOB 1YY9D 4UIMA 2CGRL 3GMPA 3QZWB 1MCRA 3QI9B 2HT3D 5JW5B 5EG6C 3HAEG 1KGCD 2NR6C 5HD8C 2EH8L 4WENB 1IFHL 5E9DD 5HI5D 3N1QC 2J7LA 4OZFB 2EXYD 4MSWA 3BP5A 4PRNA 3UBXI 4CN4A 4QOKB 4FFZH 4KQ3L 3LPFA 3TBSA 3Q6FA 5FHAH 1C5CL 1JPSL 1VKXA 5JW4M 1HDMA 2A2QT 15C8L 2NLJA 1GGCL 3GEWB 5C0AB 2F58H 5DZOA 3RGVA 3HAEB 1A1OB 3B2UD 3WXWL 5J6HB 2GJZA 3N85L 3LKPB 4DFIA 2M2DA 3T1FB 2HN7B 2I9LA 4TNWF 1FO0L 4HF5L 5C92A 2ADIA 5E6YA 5GHWL 1RJLA 3L3GA 4Z9KB 4PGDB 1A6VL 1KF9B 3F7QA 1P4LB 4X6BA 5SWZD 1WISA 1KLUA 1Y0LA 5HI4D 4RNRA 3VRLF 2NW2A 2ZPKL 4JDVB 5FCSH 1RZ8B 5KSVB 3T4AA 4O51A 5C0IB 1YYMH 5HVWA 5IJVB 5T5NG 1NUGA 1SJHB 5HGDB 1G9MC 3V5KA 1CDHA 3Q2CA 4OV5B 3RP1A 3Q1SL 5A2JH 1QOKA 2M1KA 1F6FB 5DFVC 1UG9A 3OB0H 1AO7A 1GOHA 2EXWD 3HC0A 2QEJA 3QCUH 2VZ1A 4LPUA 1KJMA 3CDGB 2AXFA 4I18B 1NFDF 3TO2A 2CXGA 4MZ2A 3BRDA 4W4OA 3PGDA 3RKDC 5BVPL 4NJAH 1AI1H 2IPUG 1YN7A 2V5MA 3HC4L 3HE7C 3PWPD 3QULA 2A83A 4ORGA 1OM3H 4L9LA 3H8NA 2NY1C 5HVHB 1UEMA 1RUKL 1B2WH 1JPGA 2BJML 4PD4J 2QJDA 3A6CH 4KK5D 4ZUWA 43CAB 3MRJA 1NAMH 2Y7QA 2YPKB 4U1LB 1UJ3C 1I4FB 4YAQB 3E6HB 1F5WA 3EHBC 4J3VA 4Z5RA 1XH3A 5EU4B 3NH7H 1PG7H 5C7XH 1T3FB 2J88L 4JFXA 1AHWA 1KJ2B 1DLFH 3WIIH 4WI4A 4L4VB 5KVEH 5L2KA 1RIHL 1OAXL 1L6ZA 4PGEB 5ITBH 3QWRD 3WO3B 4ODWB 3DUSA 4YGAB 1ZT1B 5HGBB 4HIHA 4UAOC 2PTTB 4FFYH 5DD3H 1T66D 4DN4H 5T3ZD 4P2QE 4H1LA 5DD1H 4PJEA 2VZ3A 3R1GH 4O02H 4ZO8A 2FIKB 1FE8L 3K4AA 5C0BB 2NXZC 4NCC1 4HX1A 3KPLB 1A1MB 4UBDC 3I9GL 1UVQB 4WU5B 3CFBB 1A14H 1K3IA 3VXPB 1DBBL 3TVMD 3TIDB 3RI5K 5FYKD 2FWOA 3K8MA 2G9HB 2B4CC 2CLVA 3Q5TA 1T1YB 3WFHB 3TIEA 5E99H 2ATPB 3GHBL 1HHGB 1XGUA 4PJ5A 3F7YB 1M4KA 4O9HH 5DHXB 3WIHL 4CADA 3TZVD 3LMJL 1I7RB 2HLFD 4G8GA 4NZDA 1SQ2N 1REIA 5JMOC 1T03H 4MZ3A 4P99A 4R9HA 2HFEA 2HG5A 4FQPA 3D0LA 2YD1A 4PJGE 2WWKO 4OLVH 4W70A 1HHIA 1HCFX 2IPTL 5GRXG 4YDKH 5IVZB 5I6XC 1A6WL 3ARQA 6FABL 3WIFA 2RFXA 1UKSA 2FJGA 1ZLUH 2N1KA 1RZJH 4CW1B 3UTQB 4L29B 1JRHI 3H6JA 4LCIL 3AMKA 5BZWB 5GS0H 3EOBB 2AK1L 3EDEA 3VXSA 4EJ1C 3OKNB 3MV11 4XNYH 3MYZA 3VXRB 3PWJB 5DA4A 1AD9B 5ICZA 4PB9H 1WFTA 3QIWC 2NY5L 5FGSA 2BVTA 5J1SC 4CMHC 3RWEA 5BW7A 2NY3C 3FO1B 2VXUL 4POYA 1D7FA 4KDTC 3QFDB 4OCWH 1FFQA 4PJDF 5HY9B 1C12A 1MY5A 3QJHB 3HE7B 2E27L 3WFDL 5GRZA 3DV4A 2NY1B 3EUUA 3A6BH 2R0KH 3D25A 3O6KH 5DT1L 1TJIH 3KR3H 1NGZA 1BM3L 1IGFL 4Y19E 1TENA 1UJ3B 5EC2A 2ERJC 2DRUA 5D8JH 2IADA 4PFEA 2CMRL 4NHUB 3LDBC 4TUKH 1IGCL 1AXSA 3SOBL 4ODSH 2CIIB 1BPVA 4JVPA 2D03L 2EC8A 2AGJL 4UT7L 1LD9B 3H9HA 2GW5A 4NSKB 4NO3A 3DSNA 1MFCH 2VLJB 4AIXA 5J9PA 4D9QE 3VFVA 3R4DA 2R0LH 1TIUA 2PNDA 4IHOB 3RIAF 3BJ91 5GRUL 4OIIH 1G9NH 4OD3L 1UXWB 3PP4L 1MCBA 4K3EL 1QBBA 3BWUC 5IMOA 4UV4L 1T7XA 4LARL 1DDHB 1FJ1B 4DKFL 2EZ0D 5CGMA 5KS9E 5I8KH 1LDSA 5IROA 1K6QL 1CD0A 1N8ZB 4P3DB 1AIFB 4QRTB 1TZHA 1YEGH 2DJ4A 1QFUL 4V2CB 4PJ9A 1YA5A 7FABL 1A7NH 1OD9A 4X6FA 2PR4L 4YDJB 2X4QA 1R5WA 1UM6L 4BFEA 4WFHE 2P7TB 5I19H 3C6SA 4GW4B 2IANB 1HXMB 3MRHB 1H3UA 1XCQA 1JPFA 3C87A 1RUPL 3S34L 1IC5H 1G7JB 1OLLA 3CFEA 5GGQH 1EX0A 4LCCC 5T1LA 3GSVA 4NQDD 5FYLD 3T0DA 4LU5H 1OW0A 2KQMA 2EE9A 1U8QB 1Q9LB 2X4UA 4Z7NF 5I6XB 1YEHH 1YPZB 1FAKT 1T22B 3C6LD 1K8IA 3J7HA 2A74A 3KDMB 5EOTB 3RWDA 4S2SA 1OAUH 2XN9A 2Y5TB 4XXCC 4QKXB 3I85A 1DUYB 3WL9B 2PO6B 5GGSY 2Y25A 2CDGB 4GG6E 4FXKA 4KJQC 1D5XB 5D2LF 1HWGB 4GW5B 5JDSB 3BMVA 3ZDXE 3QIWB 4P4KD 2CKBA 4JPIB 2XTJE 1YY8B 4CMHB 4DN3L 2NY3B 4O2FB 5D5MB 2MSPA 3O9WB 1IEAB 1T6WA 3EYUL 2YEZA 3HI6H 5LAXA 25C8H 5E7FA 4LOUC 4V1DB 5TH2B 4R7NB 1Z5LA 2XY1A 2IPKA 5D7LA 2BY2A 3DX9A 3EJZD 5B4MD 2AJYH 3T3MF 1M6OB 3H3PH 4KGJA 3QDME 2JIXB 4IIQC 3ROLA 1CGSH 3RI5F 2Q7YB 4R7DA 2GK0B 5IQ9B 2F19L 5AYUH 2JCCE 3O2DH 1NCNA 2ERJB 3W39A 4D2NA 1HKFA 1BZ7B 2JKXA 3LDBB 5JLZA 1I3GH 3STZA 3MLYH 2GI7A 3VXRD 1LILA 2NY7L 5MERA 1I7ZB 2WBJA 3OGCA 2EDLA 5CZKA 3ECBA 3I3EA 4CMMA 3PL6A 2ED7A 2EIBA 3SBWA 4NQCA 5F7KC 3DROA 2SEBB 3NAAH 5E2VH 4YHOH 4ZAKC 3V4PL 2XWBB 2A6IA 5EU6B 5FUCC 2VE6A 3VFRA 3PDOA 4FABH 4LRIC 3LSOA 5IB1A 2CRMA 2OZ4H 3T8XB 3VWKB 4ONHB 5I76B 4ZO6A 5LGKA 4OLXH 3U82B 3ELAT 4D9RE 4R3SA 3UROR 1O7VA 4ZTOL 1N0XL 4CU6A 1GGUA 4XVUD 3IVKB 1B0RA 2GK2A 3FQWA 5DZNA 4MQ7B 3CFCL 5D6DA 2R2EA 3MUGA 2H8PA 2A6KA 1ZWIB 4X5LA 1D5BB 1MI5A 3JVGA 3OKLA 1NSNL 3X11B 4Y5VC 4G6JL 3TA3D 1EEYB 3GMRB 4EOWL 4KI1A 1TVBA 3Q5YA 1JRHH 4M6AA 3B9VA 1YEJH 4LCCB 3ULVL 3CGTA 5HGAA 1JF1B 4JN2A 4M7KH 1IAMA 4H0GA 4JKPH 3KLDA 4XVSH 3C9NA 5DA0B 1EEZA 3A67H 4O2CA 3MV9A 3ARBC 3TBTB 1CICD 4OM0H 4UZGA 4KMLB 5AEAA 1HHHB 4F3FB 4KI5D 2M26A 3X14B 1FYHB 5J1TC 2HVKB 3MXWH 1DQQA 4L8SC 3TT1L 3RL1B 1HKLH 4NNPH 1MCLA 4RWHA 2GHWB 4EI5A 2X40A 2HJLB 2NY2B 4FNLL 2VKXA 1PLGL 3QDJE 1A6TB 5DK2A 1U9KA 3V5HB 1ROWA 1N5YL 1RJZA 5C0EB 4PJIE 2VDLL 1MQKL 5E08L 4A2LA 1JNNL 3OJVC 4AIZA 1CU4H 3TN0A 4K2UH 1AQDB 1AGEB 3L1OL 1YUHA 4XVJL 3MLSL 5INDB 4NFBA 2P42B 4ENEC 1ZK9A 1WT5A 1EA9C 2ILLA 3HA0A 3DX8A 4FZ8L 1ZANH 1FL6B 1Z3GL 4K8RL 1MF2L 3MNZB 2R0WH 5HYJD 1R0AL 5BOZG 4Q2ZA 2Z0BA 4IIQB 2E9JA 2OTUB 3HR5A 1YEFH 3FB8B 3LKRB 1INEH 1BOYA 2EIEA 3CPLA 3UYOD 5EZLA 2PO6D 1LP9F 2ZNXA 3OXSA 1YECH 4LGSB 2V7NA 3D39B 4Y4KC 2HTKD 4M7LH 5FA4B 4LLUA 3D69A 1T04B 3VH8G 1HYSD 1E28A 5IW1B 4Z7WB 3O9WD 4NP4H 3HLAB 2XQBL 1NBZA 4MCYA 3T3PF 5KAQG 5DD6B 3QFJE 4CJ0A 1RMFH 4AG4H 4YK4C 1N0LA 2MPAL 3SDCA 4WUKH 4YHPA 2IALA 3VH8B 4WTWA 2J3SA 1NKRA 1PYWA 4OCMC 4PRAA 4Y2DD 5D70L 4LPWA 1AY1H 3NCFB 4AEIL 1S9VA 4I3GA 3KYMB 5D6CA 1KN2L 4DW2L 2A0LD 1TPXC 4RMQA 1AGDB 4LAQH 3CXHK 2JE8A 3RZCA 2HT2C 5KANI 4IJ3B 1F8TL 3RWHA 3B5TA 2AXHA 4NRZA 4PR5A 4YR6B 2VLKD 4Y4FD 1ZA3A 4X9GA 4P5TA 4YBHA 1V8HA 2YPVH 4S0TD 2QSCH 4X7CC 5HDBF 1X4ZA 1GGBL 1LO2H 2CLZA 3RY5A 4MJIB 1OQXA 1MHEB 2XFXA 2P8PB 3VWKD 5MENB 4EN3A 1L9NA 4HC1H 3PQYB 1AFVL 1G7IA 1SJEA 2X41A 3ARBB 1GIGL 1U8NA 3DVNA 1NCCL 1SJVA 4FQHA 4L8SB 3KXFB 5GIRB 1MHHA 5ENWA 1NUNB 3VI3F 3HI1A 1KCKA 1T83A 4NN6C 1IGTA 3BGAA 4IEFB 4J4PD 5C71A 1FP5A 2Y5EA 2VL4A 5KVFL 1AGBB 5B3JE 1JE6A 1AP2A 1W8OA 1DN2A 4LASL 4XZUB 4S1RH 4QCIB 4D3CL 1S78C 2CLRA 4GMTH 3VFTA 3D6GA 2XIDA 3ES6A 2CRYA 1ZTXH 5TF1H 3QUMB 1MOEA 1BEYL 2AKRB 5K9KB 2ZUSA 1UXSA 3FB6A 3RAJL 4XAWH 1MJJA 1X4XA 3S36H 3OF6D 2AEWA 4QHKI 2YHGA 4M1DH 1F58H 2Z35A 5JA9A 2Y06L 3O0RL 2KPNA 3VXUE 4N8CH 4IOFC 1C5BL 3WHE0 2BSRA 3O4LE 2NY2D 3PGCA 2KBGA 1GJIA 5IEHA 3STBA 1DTUA 4ZFZA 1CL7I 1FZJA 3C2SA 1VPOH 4OSUL 3OR6B 5CILH 2AJSH 5EZOL 1OARH 2XWJA 3JV6A 3GSOB 3TYGL 1YQVL 4F80A 1QR1B 1EERB 3LN9A 1HYRC 4U05A 4YWGH 3ZE1F 4NUJA 3CZJA 1VHPA 3THMH 3SY0A 4YHYC 1MJ7L 3P4NA 4PJDB 1E27A 1YMMD 5B38A 5E8DL 4KKCC 4QT5B 1S7SA 1ZLSL 1NCUA 1T2QL 2ICWA 1LO3L 3BKJH 2DWDB 1RZFL 5F7UA 3EYSH 5BVJA 1AH1A 3VFWB 1CVSC 4H25B 1CIDA 4JR9L 1TPXB 1G7MA 3CMGA 4XWGL 4JJ5B 4N90D 4AEHH 1PEWA 5ELIA 4H20H 5GGTL 4UIKL 4JRXB 2AERT 5ESVA 5BRZE 1XF5A 3O45A 5JDJA 3IXAB 1FLTX 2APXA 5FGCE 4R2GC 1U0QA 2A73A 3V6OE 3CAFA 2YN5A 3LN5A 2W9DH 4L5FL 3R0NA 4M62L 5EBWA 2YMXH 4NZTH 4Z7VE 3RA7L 4EXPX 1SMAA 4AENB 1IGIL 2WIMA 4C54A 2C3WA 4QY8B 2AJVL 2AVGA 1I8KB 4FG6D 4LVNB 5EWIH 1F4YL 3ARFA 2BFVL 2A1WH 1A3RL 2ESVB 3LS4L 4NN6B 3WNPA 4KVNH 4P57B 1FRGL 3CZFA 3VA2C 5D72L 2HLAA 1AXIB 4Z77A 5IB3A 1QRNE 1RIVL 2ZSWA 3LS5H 5BS0E 1EJOH 5JW3L 1NFKA 3QXDA 5SWSE 2EDDA 3GMOB 4U4BA 2AI0L 5BJTA 2FR4B 1MEXH 3FRPG 2W9EH 2F5AH 2KH2B 3MGOA 3IU3B 4MJID 4P2QA 5LXGH 4YNYB 1J0ZA 1PX3A 3PQYD 4E5XA 2GQHA 3ZE0F 1XAUA 4NCC2 3ARBD 4PLJD 4M6ML 5DK0A 5GSVB 4NOFA 1H8SA 3QO0A 4B5EA 5KJRH 1MHPH 5DMIL 3KXFD 4WNQA 5FA3A 1F00I 2GSGA 2IEPA 4KTDH 4RGMC 5LWYL 4LCUA 3WJLC 3KPSB 3GRWL 4KU1A 1TQCC 4NKQB 3QR2A 2BVQB 5D2LB 4HFWB 4R96A 3NA9L 4ZFOL 5KN5B 1JYVA 1A9BB 4RZCA 4X99A 1IT9L 4HUWA 4NWTH 1DEDA 1LO0H 4JY6B 4OKVB 4YHYB 4ONGH 2DM4A 4Y16B 4DTGL 2HFFA 2X4RA 1CLOL 4K55A 4PJGA 5A16A 3MRGB 3KYKH 1ORSA 2WMPA 5E5MA 1TZGH 3CU1A 4KAQL 5DQ9B 1H15A 3ULVE 2B0SH 1CS6A 1NCDH 4PBXA 4UNTA 5F88A 1BBJA 5FK9A 4RGNE 3LEYL 3GIZH 2WWMC 1KT2A 3K2MC 4MXVF 1M7IA 1K2DA 2X10A 3GGWA 5EOQH 3IDIB 2VZVA 1RZKH 2AJ3B 4JRYE 2XNAA 4YHLL 5DJ8A 3W0WB 1MWAH 1ZHKB 5DR5L 1KTLB 4TTDD 1W2KT 1IMHC 1I1RA 1U3ZA 4R2GB 2HT4D 2Y07H 4ZOBA 1RK1A 4L8CA 1KUMA 3MNWB 3LKNA 1AXTH 2DLHA 5EOCH 2VXQL 4GRLA 3SKNB 3CMOL 1JGVH 3O11B 1GPOL 1NAMA 1P4BH 4MAYA 5CEZH 4XRCB 5ETUB 1BBDH 4JKLA 4JGMA 1QLEL 4Y19A 2Q76A 4NPYA 4PRPE 3RWCA 2ICWJ 3ARGD 4KDWA 2V2TA 1A6UL 1QSZA 2YC1A 5EIIA 4JRXD 1YYLL 1WV7T 3GMNB 2X9WA 2APWA 3DI2B 5FM8A 2ZUTA 3CFKB 1GGIL 2P8MA 5CJQH 4YIQA 4RA0C 4I3RH 4U6VL 3MLZH 4P4RB 2EYTB 4QRPB 2DQFB 3V8OA 4Y5XC 1CL7H 4WDIA 4GXVH 3QNYA 5KS9A 2XPGA 2ZCHL 4GMSH 2YS4A 4KTEL 1YJDH 1L7TH 1WBYA 2LAGB 1CFNB 3GSXA 5LBSH 3LV3A 4BA8A 2I60H 2GEEA 1EHXA 4PRBB 4JO2L 5CP3H 4ZUTB 3IFLH 4JPVH 4Z7UF 3B5HA 1R24B 3AREA 1TQCB 4NC0B 1M71A 2AAVA 1X7QB 5KTEL 5FYJD 4F9PC 3EFDL 1U8KA 4NC1C 4KKAC 1E4WH 3T77A 4ZTPL 5KG9B 1MCHA 4NZUL 5DD5H 3TYFA 4MMZC 4M7LT 2H26A 4PP2A 3BJLA 3NCMA 3OAYK 1IC7H 4Y2OA 3MGTA 4NKOA 5DWUL 5BQ7A 4QRSA 4D9LL 4LVOB 2EIDA 4GKNA 4Z8FL 1DBKH 2XRAH 1ZHLB 4KQ4L 1U42A 1QHPA 3QQ4A 4MNQD 1WBZA 1J8KA 5JW4N 4JKMA 1XF4A 3SHSA 3RVVD 4WRLA 5TGBB 2YZ8A 4R90L 2B2XL 3RUGE 1FH5H 4HPYH 3QHFH 4HUVA 5ACZB 2BXYA 1KV3A 2ZCKH 4OJFL 3ETBF 5L88L 3PGFH 4UV7H 2IBZY 2E7LA 5F3BA 1I1YA 3KPSD 2YUXA 1OL0A 4OFDA 1LP9B 4G8GD 5GGRA 2W0PA 2XA8L 4XPBH 2XXMB 2VDRL 3FRUB 2VZSA 4QRQA 3S35H 2JB6B 3HI5H 5F7HA 3U0TA 4WWKA 3CVHH 4MMXC 4F33A 2BVOA 2HKFH 1F97A 1ZSDB 4U49A 1CDBA 4Y16D 5T1KA 2UZIH 3BE1H 1ETZA 4QXUL 1U3YA 5CEZE 1VDGA 3DGCR 3LRSA 1I8MA 3PWNA 2I24N 3I50L 2VXVH 3AC0A 3QDMA 1EHAA 3JWOL 4Y89A 1LVEA 1T0NB 1QKZH 2JCCA 4NQUA 2N7AA 4PG2C 1PQZA 2OK0H 3UTSE 3VFNB 4AEEA 3UBXA 1PVHA 3KG5A 3O3AA 3PWLB 4HUXB 4U6XB 5T3ZL 1YNTA 1I3UA 1FDLL 4R2GD 5IW6A 5J1AA 4DK6A 1A7PL 4RX4D 3T2PA 1PX4A 2VR4A 5T1DL 5CD5D 4JKKA 4YDLC 4WJ5A 5DI8B 1J8HB 4Y5XB 4KPHL 1CF8L 1QBAA 1T1WB 4P2RE 3AFLA 5L6YL 5E94A 4YBQC 4HT1L 4GXUM 4OZ4B 2C3HA 1BQUA 3D3VE 5DJDA 1J1XL 5HGGS 3KJ4C 1NC4D 4WI3A 4M4RA 4F7TB 1HIML 4FQQA 4HKXA 2YSSA 4D0BB 5JIKA 3CUPA 4QXTB 3HUJF 4JG0H 2UY6A 1KFAH 3O8XA 4IMLA 3C5ZA 4GH7B 3O6MH 1QA9A 1FNGB 3TJHC 1MCSA 2R2BB 3LN4A 2EDNA 1EV2E 5IR1A 1RULH 3DGGA 4YQXL 3MRDB 5JXAH 1UACH 4YX2L 1VENA 2XT1B 4PB0L 5CIPB 2DYPA 1SJXA 2XI9A 1LDPH 1A7OL 4XWOC 3BP7B 4L3CB 5D1XB 4XCNB 5F9JA 3VG9C 4Q0XL 1BQLH 1MPAH 3MRIB 4ZQKA 4TQEH 2V2WB 1T7WA 3AS2A 4F7MA 3BXNB 3VGAB 1UH4A 4NO0A 2DQDL 2PYEB 3GI9H 4XBPA 2DTSA 4MDJA 3L5WA 4X80H 4X7DC 1GGTA 4QO1A 5E2TH 4C4KO 3KPPA 2EDRA 3BKCL 4G8EA 1G7LB 1S5IH 3QDJA 4V2BA 4U6HB 1GZQB 5GGVL 4EXKA 1WZ1H 3RDTC 1HHKA 4PJIA 4I9WD 1IGMH 5EN2A 4PLKD 3S36X 1RPQA 2UVEA 3D2UA 4N0UB 2CR3A 3EYFA 1BFTA 1MJ8H 3MLUL 4PRHB 2JJSA 3V0WL 1KCVL 1BF8A 4O2EA 4KHTL 5DVNA 3SDAA 4HV8B 2FECI 5DURD 1KG0A 4DZ8B 5FKAB 5E8EB 5DMGC 1MAKA 3PXHA 3BDBA 4GW1A 4U1IB 2R39A 1EXUA 1FG2B 2VSCA 5C2BL 4M1CD 2CDEB 4G9DA 3HR6A 1VFUA 1X5ZA 4NKMA 2EO9A 2JELL 2NX5B 3UPRB 3OHXB 1F2XK 3QG7H 1JBJA 5IHUL 2WQRA 4Z7QE 2I9TA 2NTFA 3WS6C 3L3HA 2BRRH 2PYFB 1IE5A 1N64H 2NY4D 3ZE2E 3B3IB 3WIHA 5JPNA 4IM8A 3SKMA 4YDLB 1UZ8A 2OZ4A 1YEIH 3GMQB 4GRWF 3DXAE 1HH6A 4JREC 3JTTB 5EO0A 2Q8AL 3NMEA 1DSFH 2VB5A 3NTCH 3QFJA 4FQIH 2W0FB 1FFOA 4MWFA 1SEBB 1FLRH 4U7SA 1H3GA 2YUVA 4K3HA 2VR5A 1KJ2L 5HHME 3MZTA 2APVA 4KV5F 4LKCA 4FQLL 2VDNH 2XZAH 3KJ4B 3IDUA 4K7FB 3WHE1 3SDXF 3ARSA 3QJFA 4JQXC 4XP9H 1LK2B 4YBLC 3EO9L 5ILTL 1WICA 4NQCD 1WFOA 1T4KA 1ZA6A 3KYNB 1A2YB 2AEIT 2FJFB 5TPWH 1PKQE 1LE5A 1MCEA 3MLWL 3QEHA 3CX5K 1AD0B 3FFCE 3P9MB 5TDOB 1I75A 4M9PA 4FTVE 5T33L 3HKFA 2WQ8A 3DVFA 4HCRL 4HWZA 1FZKA 2X7LB 4JPKH 5FO7B 1J8HD 2VWEC 3DX7B 4R0LC 3VG9B 4F57H 1HCVA 3U4EA 1FORL 4KHXH 4AZ8A 2RGSA 3QA3A 3GBMH 3MBEC 4HIIA 2V7HB 5JHDB 4NN5C 4RFEB 2BK8A 1INQA 3NIFF 4PREA 3DRTB 2WBWB 3GSWB 4BSJA 4D0CB 2IH3A 3D18B 4LHQB 5KSAA 2EC9U 1QG3A 1ZEAL 3OZ9L 3D5OF 2Y9RT 3K7UA 3ARDA 5FO8A 5C0CE 1INDH 3IU4L 5SX5K 3T0XA 4XP5L 5IHZB 4X7TA 3D9AL 3MZGB 4GBXA 3E6FA 4WUUB 1G9ML 1KGCE 1DVFC 1A4KA 4JZOB 2FX8H 2OJEB 1TTUA 1T21A 3VFGH 4C83B 5E9DE 5FM5O 5F93C 5D1XD 4X8XA 5MEQA 4LSRL 1RUQL 1A47A 3WS3B 1KC5H 1YEEH 3QEUA 5K9QI 4XH2A 1TDQA 3G6JF 1MFDL 3QEGL 2PYED 1FV1B 3A67L 5IK3B 4OM0L 3BH8A 2FEDD 1OP3H 1OGTB 4KZEH 3VXUA 3OR7A 1OTTC 2GSIA 2VLRD 4JQVA 3HCVA 1KEGH 1IL1A 3O4LA 1T89C 3SE8L 2OJZH 2GTZB 3G04A 4LBEB 4NNYA 5FYKH 3I2CL 3QQNA 1F4XH 4LHUD 4YHNA 5EC1B 4U1SA 4JFYA 1F3DH 1KXTB 4LKXA 1A5FL 5F44A 5SWZE 3V52H 1NAKL 3WN5C 5C0ND 5C8JB 3RX7A 4YHIB 3U9UA 4WEMB 1OTSD 2ED9A 1U36A 3QCVH 4PRDA 5TE4H 4K2UL 1VFBA 4BQBA 4OFKA 2YXFA 5TFSL 4JREB 4XNMB 2VABB 4O4YL 4DFHA 5EO9A 2F5BH 3FB5B 5I1EL 2X4PB 2YUZA 1FVEA 5D7JB 1BOGA 2OP4L 1JPTL 4M61A 3SQBA 5ERWB 1OAQH 3L5HA 5KVDL 4XNZB 2Z93B 4HWNA 4HDIA 4OZIF 2BNQE 2DBJA 2PW2B 4M1GL 4HBCL 4YBLB 4ZD3H 4YHKH 3QAZC 4U1GC 3RNQB 1EVUA 3H9ZA 1RZGA 5D9SB 4A6YB 1P7KA 1S7RA 5BRZA 2E8ZA 1S7WB 4UUJA 2D31B 3V6OA 4S1DD 3MMEA 3PWPE 4G43B 4OI7A 1IKFH 1KENL 4HC1A 3U30C 4NJ9L 3VRIB 3ISWA 4Z7VA 5IHBA 5BV7C 4UINL 1ITBB 4JG1H 4PJFF 5A2KH 4AY0A 3M07A 2B4CL 4HXBL 4NDMB 1I1FA 3REVB 1PEZA 2MKLC 5CCKH 3MBEB 1UCBH 1IQDA 4YEEA 2QBWA 3BWAB 4PLOB 3EJYD 3RZCD 4BH8B 3RVTC 1GC1H 2JTDA 2DQUH 1KIRB 1FYTB 3QNZB 1UYWH 2DQIL 1KCUL 2GY5A 3ZKXC 2ITCB 3S4SA 5JZ7C 2AV7A 4YUEL 3BKYH 3QUXA 2EC9T 1UM5H 1FNEB 1KCSL 1QRNA 2FSEA 4U6TA 5BS0A 5MEOA 5HHNB 5HHQB 3QCTH 1UWGH 5SWSA 3SJVB 5HXMA 2FO1A 1ADQH 3L3IB 1DVFB 5T3ZE 4TUJA 3FHAA 3CJJA 2J2ZA 5I1JL 2DQJL 4XNXH 5C2UB 3TO4A 2L4OA 4XP6H 4ZO9A 3MLXH 5ALBH 5CEXB 3SE9H 1JN6A 2Q1EA 1JWMB 3P9WB 4XNUH 3B9AA 5CJXA 1M7DB 4N5ED 3MRCB 1E4KC 4X9BA 3X3GL 4OAWA 4P3WA 4YC2C 4OCRL 4XCCL 4JFFB 4J12A 5ICXB 5DHYA 5FYKE 4K71C 3VRJB 3BZFB 4EEEA 5GGUB 1G0YR 2H2PD 1U8MB 2C3VB 8FABA 4PJ8A 3UJTL 4N0YL 4X7EC 1HSBA 2DQHL 3MRMA 4RISH 4X4YA 1NCBH 2I5YH 4WHTA 3QBTB 1JWUA 2IQ9H 3W9EA 4YZFF 2IGFL 5GSRB 4H8WC 2EH7H 5AWNH 5IFHH 5D1ZC 1N5AA 3LH2H 5FYLH 1E6OL 1IM9D 1W0VB 3SPVB 1XMWA 4UU9A 1MFEL 3DSFH 3EIFA 2OXHA 3HPLB 1FGNL 4UQ3B 2VISB 3O3DA 2HFGL 3TFKC 5DMGD 2C1OA 2UWEE 5C0AE 3S35X 3LEXA 1Y6KR 1I7UA 4XHQA 4K3JL 3QAZB 1MCWM 4LCWB 4U1GB 5FEBA 1KTDB 2MQCA 1XF2A 1BFVL 2D7QA 2GIYA 2I25N 3FAWA 4WI8A 5E6IA 3OJDA 1I9IH 4I0PA 4GRMB 1I8IB 2KUTA 1HN1A 3PHQB 3QIBC 4KK6C 3GJEA 4JZJC 4DVBA 1FN4B 1NGPL 3U30B 4XNQB 4BFIA 1NLDL 5FOBB 1QBMH 5BV7B 4PGZA 5D7JD 5K59E 3MRNB 5DHVH 5GS1C 1IBGL 3V4VH 3VJ6A 2GFBA 4JANA 4PRPA 1EBAA 1IGYB 5KZCB 3MXVL 4P3CH 3BPLC 2VDOH 1XR9A 2JJUA 3OPZL 2VAAB 3VGEA 5HHOB 3MLTB 1NDMA 1NMBL 3L3JA 4OLYL 3AAZA 3HUJB 4NBXB 4PJHF 3SDDA 4OB5H 3M8OL 1HXYB 1MRDH 4GAJL 4BZ1L 5A40E 2MCPH 3OWEA 4LLQB 5C0DA 1B3JA 4U33A 2HTLC 2P1YA 3JBG7 5JXED 2KZ1B 1CGUA 3BEVA 3I02A 3RVWD 2WNGA 3F5WB 5GRJL 5ACLA 1FNSL 5EZJA 3V6BR 2NW3A 5MI0C 3QIUA 2WIIA 3I75B 2EDXA 4EUPH 5IESH 4FZEL 5D7IF 1DQDH 4FFWD 5CD3A 3GK8H 1DE4B 1P9MC 1S7XA 1URLA 2R56L 3KLAA 3QT2A 3UAJD 3JXAA 2DJUA 3HNVL 1WZLA 4YC2B 2CDFA 4BK4A 3SE4A 1RHHA 4R26H 4OZGE 3ULUF 2C7UB 4JB9H 1FGVL 3W5MA 1H8NA 5T5FL 3GSUA 4I77H 2NY0B 1G9EA 4M3KB 5EBMB 1Q94A 1MCOH 4APQD 4ETQB 3BZ4A 2R4RL 5DD0H 4HEME 5JUEL 3RGVC 3HRZA 1BIIB 3Q48A 3SJVD 2H32H 5JA8B 3BN3B 2QQNL 5C09B 3QRFM 1QFWL 3HS0B 3EDFA 1JTOA 5SWQB 4NQDE 5FYLE 5IF0A 3H9SB 2JK5A 2AEQH 3IDJB 1JZ2A 3QXVA 2P24A 2VLMD 4P2CG 2H2SC 2VQTA 4PJCF 2FZ3A 3RUGA 4Z7OE 4NZJA 3DETC 1PSKH 3GIVA 1UWXH 1MCFA 4HS6A 3OG4B 4U1MB 4IOIA 2YK1H 3C5SB 4ESKA 3EBAA 5B8CB 3MJGX 2R2HA 3UCRA 4ERSL 4JQIL 1BFSA 1LO5A 1XF3A 5I2IA 5I9QC 1XR8A 2FEEL 2O26U 5A3ID 2Q86A 2RCSH 5D7SL 5E56A 3PWUB 3MJ9L 3PF2A 4PJXE 2D3VA 5C9JA 3MJ8B 4ZFGL 3EOTL 3QIBB 2YOCA 2LE9A 4YE4H 4JZJB 3B9KD 5H35A 2GTWA 2YPLB 1LE9A 2DDQH 3JWNC 2WINB 4GRWB 1G1CA 2Y36H 1OPGL 1KB5B 3BGFC 5GS1B 1RIUH 5J06A 4G5ZL 1GOFA 3KNBB 2P5EA 2AQ2A 1DQJA 3N9GL 1NCDL 4L9LC 4P23A 4XBEH 4ONFH 2VN7A 3VXRE 3MYJB 4HGMA 5L9DL 5J3HD 4J2XA 2IH1B 3BVNB 3UTSA 4LCWD 4ODHL 1CFSA 3SDXB 4QTHB 2EKSB 2YRLA 3QRGH 3IJSA 1BQHA 3MACH 4U1HB 3IF1B 4JFDB 5HPMB 1ZLWK 4JPWL 3M17B 2VAJA 2GJ6B 2CIKA 4JO4H 4X5XA 3FOLA 2EE3A 3BPNC 4HGWB 3HZYB 4PJAF 5HYSG 1VADB 1AHWC 4MAYD 2G60H 3GJFA 1JNHA 3L3KB 4CVWA 3N06B 5MI0B 4P2RA 3O6FA 1OSPH 3ZT6A 3HB3D 1H5BB 3GMPB 1NC2B 4NHCL 3DRQB 4JY4A 3D3VA 3NCCB 3TJEH 1VEPA 1UB5A 5E4EC 3P4LA 3NFSH 5EUKA 5I8OH 3U6RA 4WHDA 3HZVA 2X2YA 1AKJA 3BP5B 5HYSB 3ESVF 5IGXH 2F53B 1MRCL 5JZ7D 4LPCA 3OAZK 5GRYA 4OF8A 5HHOD 3AUVA 1VKXB 1E6JH 3QUML 2NLJB 1B4JL 2FD6H 1MAJA 4PG9A 1F90H 1QQDA 3S96A 3MV8B 3RGVB 2BY3A 3BH9A 1EHLH 2I9LB 3DHJA 1VCAA 4Y4HA 5A2IH 1RJLB 4UNUA 1RVFL 3P3YA 3KLHC 4X6BB 4I3SL 1DZBA 1YNLL 1Y0LB 4KI5E 4BQCA 1FPTH 2GYSA 3KJ6L 2OQJA 2Z9TA 2XWTA 3IFNL 4LVEA 3ARED 4NO5A 1PBYA 2A9MH 3VXMA 3INUL 3CSYA 4O51B 1HHJA 3G6JB 1TTFA 1D9KA 3HE6A 4LPTA 3MA7B 3RTQA 4J3UA 1OLZA 3V5KB 4ZSOE 2NNAB 2NY0D 3DO7A 4JO1H 3LRGA 1FSKC 3SQOH 1W72B 2OL3B 2R69L 4WVRA 5I9QB 4DJMA 3KWWB 4UOJA 1KPRA 3P4OB 1FL5B 3FFDA 3PWVA 2Z8VC 4PV9B 1HINL 2XZCL 4QF1A 1KJMB 1DEEA 3VFMA 3N0PB 1P7QB 2FHFA 3ZL4L 4JFPA 4M6NL 3WNLA 1DCLA 5BW7C 3O3EA 3PGDB 5DRZA 4Y8AA 4RGOL 1I3RA 3CFIC 4JKWA 5DUBB 1TETL 1YN7B 3TFKD 4XCYB 4FP8L 2DLGA 4EBQH 3WKML 3VA6A 1OAZL 2A83B 4ORGB 2X4OA 2XKNB 5EB9A 3S8WA 4TPRL 1JPGB 5DTFA 3QPXL 5C1MB 4KJPC 4OZIB 5IQ7L 1KNOA 1YEKH 4ZUWB 5J4MA 1NH6A 4KROC 1H8OA 1WIPA 4ZUUA 2X05A 4ZPVA 4OCXH 4LLMA 5I66A 1F4WL 5D5ME 4NCDA 4Z5RB 1IEBA 1L6XA 1MQ8A 4HFUH 1Z9OA 4JFXB 4V1DE 1AHWB 1KPVA 2D0FA 1UZ6F 4ZUVA 1OAYH 5I17A 4ZFOA 3P0VH 4RMVA 3ALPA 3O2WH 1C1EL 3DXAA 4XMPH 3DUSB 3V5DB 1MIEL 2EE6A 4XMKL 4HIHB 4F37K 4C56B 3VG0H 1EO8H 1EFXA 5E4EB 4KKLC 5FYJL 1C5DA 2YA1A 3DI3B 4UDTA 3ILPA 4OGYL 3UZVB 3KPNA 4WV1B 5EUOE 4TOYL 2R1WA 4J8RB 5IROC 4DOHE 4ZS6C 4KJWC 3HNSH 1RUML 3P11H 1JHLL 2VLKE 5D2NA 3BO8A 1D6VH 4PJ9C 3I6GA 4LPVA 1T1ZA 4OZHE 3OB0K 3EDDA 3FFCA 5IMLA 2FWOB 3BAEH 5F1IB 2B39A 4FTVA 5IBLD 3TIEB 4PJ5B 4CADB 4IRZL 2VDPL 3DJ9A 4DUWA 3GSNH 3LIZH 4QHNA 1FFNB 5HTSA 3ZO0A 1NC2D 2WUCL 3EZ8A 2HFEB 2HG5B 3D0LB 1EZVX 1OW0C 3P4MA 4NYLB 4PYHA 3C5ZD 5EU7C 3WIFB 1XIWD 4FFVC 3BMWA 1CBVL 1C08A 3UO1L 4ISVA 4H26B 5DJCA 4H88H 3ULUC 1K4CB 4QRUB 4DGVL 1FSKB 5K9OA 3BD5A 3MV8D 3P30H 5C0CA 3SCMA 1X4YA 3EAKA 3W2DH 4N0RA 2J8UF 2BXZA 2FJHA 5CMAB 2Y4SA 5JNYA 4J3SA 5ICZB 3CNKA 4NO0D 5E5UB 4MB4A 5E9DA 1GHFL 2CQVA 1JI2A 5F7WC 4XX1E 1JGDA 3MFGB 3VWJC 4CVZB 3RGHA 3X12A 1MPAL 1CFQA 5IM7B 1JZ7A 4LK4A 4ODUA 5J57B 5J89A 3L7FA 4NQEB 4TSAL 3DV4B 1DLHA 3D25B 3QISA 5EA0H 1XGYL 2XQYK 4K23L 4KROB 5M7QA 4MA8L 3D2UD 4YHZL 1LEIB 4WIQA 1MJUH 3QWOB 3DHMA 2RQ8A 2PTVA 5EC2B 1TJGL 3PJSA 3FN0H 2PF6A 3G5VA 1S5IL 2BVPA 4OD1H 3WXVL 5B39A 1AXSB 2J8HA 5CWSB 5SWZA 3SDAD 2APBA 1L0YA 2WBJC 5A43C 4P9MH 1WK0A 3VRLE 5JPMB 2BSSA 1T7YA 3PL6C 4LPXA 4NO3B 1I8LC 3M1BA 3U1SH 3SBWC 3VFVB 3T2OA 1OHQA 1YMME 2P46B 2VXTL 1SYVA 2PN5A 2Q6WA 2X4NB 3MR9A 2HAZA 1S9XA 4JFHD 4JHAL 3OBAA 1N6VA 4K9EC 3OKOA 1Q0YL 1V3JA 3BP6A 2MHAB 3NGBC 1BX2B 2ZG2A 4LFHD 1JNLL 1ZHNB 3ARVA 1J11A 1J1OH 2NY6C 3T2NL 3TESA 2BNQA 4WEUD 4JDZB 4N90E 2DS4A 1F6LL 2MOVA 4M48H 3TNMA 1NFDE 2R8SH 4PJ7F 4PJ9B 5D6DC 1OF2A 4J1UB 4S1SL 1CR9L 4URTB 1SEQH 5FUCE 4PJHB 4UQ2A 2YBRA 1R5WB 4AMKH 2PW1A 4GXUN 4W4NA 3JVGC 3SKJH 1OWWA 3DX6A 2A77L 2AXJA 4XXDA 2FYYA 3P0YH 2GAZA 1XCQB 5I1GL 1JPFB 2YWYA 4GKZB 4C56D 3CFEB 4AT6B 4HIXL 1I9RL 4BELD 4XCFH 2IC2A 5T1LB 5D7IB 4CVXA 3S37H 5J12C 5GGRY 5L8LB 4YFEA 1MCCA 1B6DA 3DWTA 3FN9A 3OL2A 2HFTA 5CEYB 2VH5L 4YDVA 2A74B 4YDIH 4FQXB 3RWDB 3PNWB 4NKDA 3ULSA 3WMSA 4K3GA 2P8LA 3EYVA 1BFOA 4P46D 3QWRA 1FQ9C 4EI5C 5JR1L 5DZLA 3RWGA 1Q72H 2AABL 1S7TA 1F11A 4FQ1L 4MJIE 4RQQB 4TSBH 3WLBA 3LAFA 1MH5B 3SO5A 3PQYE 1CG9A 3C8KB 5E8PB 3ROOA 4KDVA 1R5VA 4QRRA 1MAMH 1RK0A 4WW2A 2D4FA 3B2VL 3TN0C 5DMKA 2VDML 1RU9H 4D94A 5TE7H 3VGBA 3VWJB 3KXFE 5L7XH 4D8PB 1WT5C 3C09C 3UJIL 5KSAD 1A8JH 3WFEL 3CDYA 5D7LB 3TVMA 3U7WL 4L3EB 3F7PC 4HWBH 3VXTB 4BYHA 4WU7B 3S97C 4K94H 3ROLB 4R7DB 3CK0H 1IKNA 1U58A 4MXWL 2BP3A 2DIBA 1O5DT 3TZVA 2YA0A 1F6AA 2BOCA 3W39B 1AGCB 1A7RH 1FZOA 1N6QL 4H1LH 3OKDA 2R29H 4BZ2H 2WBJB 3OGCB 1ZV5A 3IRZA 3K80A 4RA3A 5AUMB 3T0EB 3PL6B 4X7SH 2EDFA 2DLFH 3UYRH 3V7MA 4RDQF 2HRPL 4OLWL 3VXUD 3WFBL 2VE6B 3VFRB 1KXVC 1BD2B 4XPAL 4NQED 3NGBB 3LSOB 3MRBA 5C0AA 3RWIA 3ME0A 1T5WB 4U3XA 2FX7H 3HAEA 1A1OA 4XPHH 2NY6B 5J6HA 3MLRH 3LKPA 4KJPD 3OAUL 2HH0L 3MOAL 2PETA 3T1FA 2HN7A 4R3SB 3W11C 1FVCB 3HFMH 2J4WL 4TULH 3FQWB 4WEBL 1NCAH 4PGDA 1JHTA 4QXGL 1NGQH 4LSVH 2A6KB 1H9VA 3HNTH 1HNGA 2R23B 1RZ8A 4PJDE 1MI5B 2J6EH 3OX8B 2D7MA 2G2RB 3V7AG 4R4FL 5C0IA 4PJAB 4RFOL 2OXGA 3QUZD 5IJVA 5FUOH 2AP2A 5F3HA 4P5TC 1TVBB 2FGWL 1S9WB 4OV5A 2Y1VA 4HZLB 5DSCA 3S88L 4JN2B 4WHCA 3BPCA 4JM2D 5J12B 4EN3C 1E0OB 3F58H 2H6PA 3ARTA 2YD2A 3RJDA 43C9A 1TLKA 1WWAX 1RFDL 3KPQB 2Y6SD 4LSQL 5HVFB 5I1AB 4ZS6D 1ODAA 4KZDL 1QYGL 4I18A 4JRXE 1KIPA 1FIGL 4U1NB 5I1HL 1CDUA 4OGAD 3DMMD 2E7HA 1ADQA 2EKJA 1T83C 1Z6JT 3NACH 3IDXL 4EI5B 2D7PA 2WLYA 1U3HD 3CXDH 5DUMH 1CFTB 2ZWLT 3T65A 1RJZB 5IVXF 4NRXA 3LB6C 4HS8H 4G6KL 1CLZH 5BO1H 2UVFA 2WUBL 3TN0B 3HZMA 4HG4K 1SBSH 3T0AA 1NBYA 5GPRA 2NZ9C 3L7EA 43CAA 3O41A 4U1LA 5EORL 1H3WM 1I4FA 4YAQA 3E6HA 3DX8B 3MQIA 4LIQH 5EU4A 2Z31B 5ADPH 1FBIL 1T3FA 4OZGA 5GRVK 2WZPD 5FYJE 1KJ2A 1T1XA 4FQXD 4GFTB 4LNRB 1KJ3H 2ED8A 4PGEA 2OTWA 3CPLB 5CBEA 5EZLB 5F96H 4ODWA 3OXSB 3GBNL 4GG6F 1ZT1A 5FDYA 1Q0XL 2V7NB 2XZQL 3WD5L 5HGBA 3UTTD 3MCG1 5KSUA 1NQBA 3EFFB 5KW9H 3ZDXF 1RZ7L 5ANMB 4DQOL 4N8VA 4NQDA 2MQ0A 12E8L 2F9BT 4MNQE 3D69B 1NL0H 4OM1L 1E28B 1YC7A 2QR0A 2DAVA 4K7PH 4KRPB 2QQKH 4UB0L 4Z7NE 5CBAA 3KPLA 4HCRA 1ZXQA 3HTLX 3GSRA 4XCEA 4M5YL 2VDQH 1JGLL 3EGSA 1AQKH 3CFBA 5FKPB 3KPSE 2JJTA 4P5KB 1WQVT 4S1QL 4EDWL 4PJ8D 4PS4L 5LJYH 4L3ED 5AZEH 3RKPA 1ORQA 3TIDA 2FBJH 1UM4L 2G9HA 2R1YA 2V5YA 1NCTA 3QQ9D 3WFHA 5D2LE 3QSKB 1HHGA 4M8QA 3F7YA 1A7QL 1DL7H 4P4KA 5LQBL 3BP4B 4PRAB 4CN1A 5GZOC 1TNMA 3G5YA 1KLGB 2BY1A 2H1PH 2VXSL 1CFVL 5GISH 3OXRB 4PJXA 3B43A 2HVJA 3GKWL 4OTXH 3T0ED 4G9FB 3ULVD 3RWHB 4XAKD 2VZTA 3C8DA 4KKBC 5IVZA 2DTML 4FXLA 4P5TB 4ODTH 3W81A 2H45A 4OLZL 4WFEE 5ALCH 4F2MB 4CW1A 4OIAA 1BD2D 2CLZB 3UTQA 4AL8L 3EOBA 1G6RB 1XGTA 2XFXB 5H37G 5TDNB 3OKNA 1OSZB 3DVGB 3VE0A 1G7IB 3VXRA 1OCWH 3PWJA 2QHRH 4JFQB 3WYRA 3SO3C 2CKBH 3QUKB 3DOSA 3ARFC 4FQHB 4LMQI 5C0RH 5I18H 5DJAA 3MROA 2OM5A 5ENWB 3U7YH 1ND0A 1NEZA 3HI1B 4HXAL 4GQ9H 4JLRA 1IGTB 3QFDA 4Z95H 3C5JB 4P9HC 2DD8H 4IDJL 3LQAH 3FZUC 1JP5A 3QJHA 2VQUA 3HE7A 1R3HB 1ZT4A 4N8PA 1AP2B 2DQTH 5F7LB 2NPLX 2Z4QB 5IT2L 1OTUD 4RBPH 4HJJL 4K8RD 3V4UH 5E24E 2FATH 2P5WB 4OCSH 3ES6B 3K8LA 3VXQA 4WCYL 1TZIA 4OGXL 4TUOB 3HHRB 3A6OA 5M94B 4LIQE 4DKEH 1UJ3A 5T5NF 1VFAA 3LVEA 2AJXL 1UA6L 4XP1L 4M7JH 3FB6B 1DFBH 2CIIA 1MJJB 4PP1C 3LKSB 5I1CH 2P47B 1LD9A 3NIDF 1XGQA 3NPZB 3DO3A 3R8QA 1NMCC 3TA3A 3QHTC 2H32A 1TJHH 2Q3AA 4IHOA 4N9GB 3MA9L 1MIML 4UT6H 1TVHB 2R4SL 4ZPTA 2DM2A 1UXWA 3IDMB 3NN8A 5L2JB 4ZFZB 1HH9B 2YD5A 5B38G 4PBVC 2J8UB 5TQ0H 1UB6A 2IBZX 1BJ8A 1DDHA 1YNKL 2XWJB 1FJ1A 3ZKND 2C5DC 1V3KA 4HIEA 1CICA 2BHYA 3VD3A 5DMYA 3SY0B 3LHPL 2JJVA 1MFAH 1N8ZA 1WC7B 1AIFA 4QRTA 4M43L 1GXEA 3KYOB 1E27B 2Z31D 3TV3L 1CLCA 4PJBE 5B38B 1S7SB 4ZSOA 2ICWB 3TWCH 4TRPL 3MBXH 1OT1A 3MRHA 4I9WE 3H0TA 1MCPL 1QACA 3S3PA 4MNGE 2B1AH 1G7JA 5I1KL 5E70A 5IUSA 2F74B 5A2FA 2LV4A 3PDDA 3IAQA 4ZMAT 4FQJH 1UGNA 1JF5A 4PY8J 1EGJL 5LKNA 3LQMA 1MNUL 3WE6B 1XF5B 1I1AC 3LCYA 4KY1H 3O45B 4KRPD 4QWWC 1L7IL 3HMXL 1J86A 3CDFA 4POZC 4DAGL 3Q6GH 4PGJA 3KDMA 2EYSB 3TPUA 3LN5B 1R5IA 5DDHA 1P7HL 1CLYL 4PUBL 1JYXA 1DUYA 3WL9A 2PO6A 2O5XL 4GRLC 2PXYD 4A6YL 1DR9A 3ARRA 1LP9E 2CDGA 1U95A 4IRJD 5KVGH 3HZKA 3X13B 2ADFL 5JDSA 1X5FA 2N4IA 3SO3B 5T3XL 3OKYA 3KYAA 3DV6A 4HK0B 1QTYT 3ARFB 4JEGB 3H3KA 1BJ1J 4JPIA 1BGXH 2JB5H 5D5MA 1LQSR 4ACPA 1UWEH 1IEAA 3CZFB 3O9WA 4HKJA 5DRNA 5ID1B 4G9FD 5TF0A 2HLAB 4XP4L 4JFEB 4V1DA 2IQAA 4R7NA 4Z77B 5IB3B 5CFHA 5DVKA 1QLRB 1J88A 3MGAA 4Q9RH 5TE6L 2EDTA 9CGTA 1M6OA 1AJ7L 2P5ED 1N2RB 1EK3A 2Q7YA 4MXQD 1KELL 2G5RA 2WP3T 5IQ9A 3MGOB 4Y2DA 3JV5A 1BZ7A 1IC1A 4WY7L 4E5XB 3PHOA 4NQCE 5EUOA 1IQWH 5DK0B 3QO0B 4YFLI 4EQ3A 3MV7B 4X6EB 5FA3B 1VGEL 1NMCB 4HGKC 2VLKA 3EYOB 2SEBA 2R9HC 2EIZA 4LRNL 5DJYB 4OZHA 4ZXBC 3UTPD 5EULV 2XWBA 1MREL 5F6HJ 3O6FD 4JHWH 1KYOK 1J8HE 1XZ0A 1NGXA 3VWKA 4ONHA 3GMLB 4MX7A 2OLDA 3MFFB 3NABL 4X99B 5E2WH 4NQTA 3V0VB 1MHCB 1W0YT 4KK9D 4NN7C 1F3RB 1K3ZA 3IETA 3UJJH 1EAPB 3IVKA 3NFPA 4OQ1A 1V7ML 1U92B 4GLRI 4XC1L 4MQ7A 5E5MB 1ORSB 2NYYC 3VI3E 1RZJC 3SGJA 1ZWIA 4J4PA 4MS8D 1SM3H 1MCDA 3MRKA 1X5KA 5F88B 5GS0C 1QP1A 2ORBH 5FK9B 3FMGH 2FLBT 1X5AA 5D71H 3X11A 4JE4B 2FB4H 2E7LC 3ET9F 2AEPL 3GMRA 4JM4H 4RDQG 1GVIA 4YHML 4AH2B 1CN4A 3ZT5A 5F9AC 1K9TA 5F1NB 1KCRL 4EVNB 4LCCA 5JHLL 1JF1A 2BY0A 2XNAB 3ALXA 5DJ8B 4UTAH 1I1AB 35C8L 3VXMD 2XTJC 1S7UA 3PABB 4WWKC 4NZRL 4UTBL 5DO2D 4HIJB 4JZNA 1Y6MR 3HPJB 4F3FA 4R4ND 2PYEE 2DWEA 1RK1B 3TBVB 5C08D 1DBMH 1NCWH 3LKNB 4E42B 5DFWH 1PKOA 2VLRE 1E4XL 3K2UL 3U0WL 2HJLA 3WDJA 4TVPL 1NAMB 4MVBC 3G6DL 3V5HA 1LEGA 3PV6A 2R15A 5C0EA 5C6TH 3MCKB 1SYSA 3RWCB 3VW3H 4W6XB 4O5LL 1XCTB 1YPZF 4N0UE 1AQDA 1AGEA 2VL5B 5BV7L 3K46A 2V2TB 3BDYL 3U9PL 4AM0A 1EFQA 1U8HA 5INDA 1RURL 2XQYG 3ZE1E 3RVXC 1X3DA 2EDWA 2YC1B 2VQ1B 2DQEH 4G7VL 4S11A 3GB7B 2LFGA 5GJTL 5BCAA 1FL6A 1G9NC 5FHBH 3UC0L 2P8MB 1YMMA 3BSZH 3QDAA 5DJ0A 4FN0A 1ED3B 4IIQA 2W65A 2OTUA 4YIQB 3O6LH 1MUJB 2Z8RA 3FB8A 3LKRA 2C4FT 2CUMA 4OIBA 5JIPA 4UOW0 2C4XA 4L4JA 2I27N 3EDJA 1V7NL 4QTIH 2UV3A 4GSDH 4M5ZL 3QNYB 2XPGB 2MCG1 4CDGC 5DQDH 3GSXB 3LV3B 1NMAL 5J6GB 5HHXH 4MD0B 2H9GA 2BNUB 1NFDA 3T4YB 5CJOH 3HLAA 3FZUD 4ZXBB 4QGTA 1R3IL 4X4MA 2BSTB 4JFED 5HHVH 3O8XC 3GSNA 1J5OH 5IFJB 3QUYD 2E9BA 1QSEB 2Q8BH 5DD6A 2CXKA 3GO1L 3MJ9A 1DQLH 3WSQL 4PP2B 5D96C 5IVXB 1X5YA 3MGTB 4NKOB 5DJ6B 3VH8A 5BQ7B 4QRSB 2K7PA 4KUCF 5K9JH 1XFPA 4BUHA 4GKNB 3FO0L 2E7CA 1H3PL 3SDYL 3QQ4B 3MRFB 1CE1L 2O5YH 1XF4B 4KH2A 1NBVH 2GJJA 4L4TD 4KMTL 1AGDA 3MV7D 3JWDH 2UZYB 3MCLL 3LEVH 5BMFH 4H8WL 4LSSH 4Z6AT 4YR6A 2VC2H 1BF2A 3WDIA 5E8OB 3QXUA 1VA9A 2ZKHH 1Q1JL 4EI6B 4XPTH 1HZHH 4GG6B 5EZIH 4PV8B 4MJIA 4LMQE 4Q9QH 2P8PA 3LD8C 3ZKSD 2GCYB 3PQYA 2XTJB 3BW9B 4WWKB 1G7HB 3ARBA 5I15L 3ZE0E 2BVOB 3UZQA 5JTWA 2ZZUT 2JJSC 3KXFA 5T1KB 3MNVA 3UBXG 1MLCA 3LRSB 5CS7A 4NKIL 2IAMB 4X8JA 3QDMB 3ILQC 3EYQD 1AGBA 4KRNA 2AJUL 4GAGL 1S3KL 4NIKB 2JCCB 4JHZA 4QCIA 1Q9OB 2CJUL 1Z9SA 1ZMYA 4F58H 1JHKH 4IS6B 4WI5A 3UBXB 1ACYH 1U91B 2L7UA 3ZDYF 5ADOH 1KB5L 5K9KA 1CZ8H 1WEJH 4WHYH 4XTRC 3OGOE 2H41A 4PLNC 5GXBB 3FQTA 1N4XL 4POZD 5CZVL 1N59B 5IW6B 3WUWA 4P2OD 1UENA 3VFPA 4HLJA 2KDGA 4MXVE 3S3SA 1TITA 5E94B 2EEDA 4FQCL 1F02I 3UPCA 3OR6A 4WO4D 5E00B 8CGTA 1QR1A 4XHJD 5INCB 2H3NA 1QZ1A 1SBBA 4HPOL 2IFFL 4HKXB 3ZTNL 1IM3B 1ZVSA 4GLRH 5H2BB 3CUPB 1ZLVH 5CUSH 3O8XB 2EDOA 4FQ2L 4IMLB 4PJDA 3QDGB 2BDNL 2VUYA 3BQUB 2ZCLH 3MOBL 4HULB 3IKCB 3CU7A 3GNML 5D96B 5EDXA 1HI6B 4L8DA 3DGGB 4LLDA 4TSCL 2X1XR 1YMHB 2NY5C 2BNQD 4LLVA 2DWDA 3OKEA 1I7TB 1QEWB 3TNNB 1MSPA 3ARGA 4PIRF 2A9NH 3VFWA 4H25A 2BNRD 4Z7WF 3VFUA 3IDGB 4KVCL 3G5ZB 3QNXA 3NCJH 1CGVA 4JRXA 4XGZB 2R9HD 3OTTA 2V5TA 3DBXA 4LLYB 4ZXBD 2V2XB 3TEUA 1W0WA 4G8EB 4U1JB 1FCCA 5GRWA 3ARDC 3LD8B 2DM3A 3N1PC 1HHKB 4XPFH 4AMKL 4PJIB 5CKGA 4AENA 4CVUA 1I8KA 4GBXC 5IB2B 1JV5B 4R8WL 1ZGLM 5KAQF 1JYNA 3EYFB 4G7YL 4J6RL 4KRMB 2ENSA 1W72L 2OL3L 2NYYD 4HWBA 3P73A 4ZG1A 1FAIL 3QEQD 4Y1AB 4Z7UE 5DC9B 1U6AH 1BLNA 2WW8A 3DYOA 1UKTA 4MA1C 2B1HL 4YXHL 4E0RB 5EO1A 1MFBH 3ZKMD 1C7SA 1IAIL 1BAFH 2FHCA 4ALAL 3SJVE 2C1PB 4OLUL 4HUMB 4B7LA 3GMOA 4JQVC 1JVKA 1D3CA 5DLMH 3GUTB 3WFZA 4QRRD 3EO0B 4LEXH 4YNYA 1D5IL 1X5XA 4XPGH 2VLME 1WGOA 4MNQA 4KK8C 4XC3L 4XVTH 1KCLA 1HQ4B 4P2YA 3QPQC 3L3HB 3C60D 4M7ZC 5DRXB 5CINH 2R0ZH 1LO4L 2DI9A 3SKMB 2AK4B 2DM7A 1UZ8B 1IC4L 1OGAD 1VEMA 1HH6B 2GITB 2YUWA 3KPSA 5GQBA 5EO0B 3RX5A 2IAMD 3QFJB 4MVBD 3WJJA 2EDJA 4LVHC 3BT2H 2BVQA 5D2LA 2BCKB 3QI9D 4HFWA 1PZ5B 2V17L 4GKOA 4JDTH 5FDWA 1HNFA 4LKCB 4HJGB 5KN5A 1A9BA 4G6AD 3QJFB 5ITFA 5J56B 2RHEA 2BRQA 2J6EA 4JY6A 4OKVA 3RVXD 1ZA6B 1T4KB 4QOKD 5IVOA 4Y16A 2WWKT 5HI3D 3BGMA 4ODXA 1J0JA 5C0AD 3EKCA 1RUAH 3FQXB 3LZFH 1RZIB 3WFCL 3DUUB 4OF7A 1WJ3A 3V6OC 1PAMA 1TMCB 1OAKH 1CFBA 5IV2A 5JQ6H 2D7TL 1QVOB 4WTXA 2YXMA 3NIGF 5MP6H 3TCLB 2FX9H 4X83A 3HC3H 4LCWE 5CGYD 5I1LA 4NQVA 3IDIA 2VLLA 5C3TA 4HIIB 5SV4A 3GHEH 4Y7MA 3P9LA 4LSTH 5FOJA 4NQXB 4UT9L 3MRLA 4PREB 1AE6H 4RX4A 2IH3B 1WWBX 1C16A 3MNWA 5EIVA 3QDGD 4KUZL 3QUXC 2CGRH 4AK1A 3E1F1 3BQUD 3ARDB 1KXQE 4NM4L 3RX8A 3RU8L 2EH8H 3O3UN 1U8LA